WorldWideScience

Sample records for vanmarle justine aw

  1. Justine user`s manual

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S.R.

    1995-10-01

    Justine is the graphical user interface to the Los Alamos Radiation Modeling Interactive Environment (LARAMIE). It provides LARAMIE customers with a powerful, robust, easy-to-use, WYSIWYG interface that facilitates geometry construction and problem specification. It is assumed that the reader is familiar with LARAMIE, and the transport codes available, i.e., MCNPTM and DANTSYSTM. No attempt is made in this manual to describe these codes in detail. Information about LARAMIE, DANTSYS, and MCNP are available elsewhere. It i also assumed that the reader is familiar with the Unix operating system and with Motif widgets and their look and feel. However, a brief description of Motif and how one interacts with it can be found in Appendix A.

  2. Kroonika esitleb : Justin Timberlake ja Rod Stewart / Justin Timberlake ; interv. Katrin Lust-Buchanan

    Index Scriptorium Estoniae

    Timberlake, Justin

    2006-01-01

    Meesteajakirja GQ auhindade jagamise tseremoonial Londonis sai ajakirja Kroonika reporter jutule aasta rahvusvahelisima mehe tiitli pälvinud Justin Timberlake'i ja elutööpreemia saanud Rod Stewartiga

  3. Justin Bieber - en toneangivende formidler til tweens

    OpenAIRE

    Lundeby, Maria Celine Kolberg

    2014-01-01

    Ønsket mitt med oppgaven har vært å skape en bevissthet om at populærkulturen er en formidler av noe, og at dette noe bærer i seg potensialet til å ha direkte betydning for vanlige menneskers liv. Gjennom dette utblikket har målet vært å synliggjøre noen eksempler på hvordan det som formidles kan bli gode innfallsvinkler til samtaler om og forkynnelse av kristen tro til tweens. Selv om denne oppgaven har tatt utgangspunkt i et veldig konkret eksempel, Justin Bieber, er de grunnleg...

  4. Justin Ukpongs Jesus. Emmanuel for our times

    Directory of Open Access Journals (Sweden)

    Tshehla, Maarman S

    2015-12-01

    Full Text Available Africa has a long association with the BibleAt the time of Jesus, the Bible was being read in AfricaSince then, the Bible has continued to be read in Africa (Mbiti 1994:27. Jesus Christ is the key character with which many who come to the Bible are concerned, academics as well as countless ordinary readers. Beyond the methodological considerations wherein this leading African chronicler of African Biblical Hermeneutics has made an immense contribution, what specific insights might we glean from Justin Ukpongs work about the Jesus of the canonical evangelists vis-vis our work as organic intellectuals? What does Ukpongs Jesus offer present-day South Africa, if one with a missiological interest may extrapolate?

  5. AWS development essentials

    CERN Document Server

    Kuppusamy, Prabhakaran

    2014-01-01

    This book is intended for expert programmers and architects who want to learn how to migrate the existing infrastructure to AWS Cloud and start using AWS services in all application tiers. Basic knowledge of Java and competence in cloud computing will be needed to follow the examples in this book.

  6. Anaphoric Reference in Justin Bieber's Album “Believe Acoustic”

    OpenAIRE

    Situmorang, Hisarmauli Desi Natalina; Natsir, Muhammad

    2014-01-01

    This research focused on anaphoric reference used in Justin Bieber's Album “Believe Acoustic”. The research conducted by using descriptive qualitative method. The data was collected from the Justin Bieber's album “Believe Acoustic”. The finding of the thesis show that there are 64 lines (sentence, phrase) that consist of 3 anaphoric reference which are anaphora (10), cataphora (6), and zero anaphora (48). The most dominant types is zero anaphora, which means the writer want to create an impli...

  7. Python and AWS Cookbook

    CERN Document Server

    Garnaat, Mitch

    2011-01-01

    If you intend to use Amazon Web Services (AWS) for remote computing and storage, Python is an ideal programming language for developing applications and controlling your cloud-based infrastructure. This cookbook gets you started with more than two dozen recipes for using Python with AWS, based on the author's boto library. You'll find detailed recipes for working with the S3 storage service as well as EC2, the service that lets you design and build cloud applications. Each recipe includes a code solution you can use immediately, along with a discussion of why and how the recipe works. You al

  8. Sugar Free with Justin T.: Diabetes Education through Community Partnerships

    Science.gov (United States)

    Thomas, Justin B.; Donaldson, Joseph L.

    2014-01-01

    This article describes the design, development, and delivery of an Extension community cable television program, "Sugar Free with Justin T.," in Roane County, Tennessee. The program targets diabetics, pre-diabetics, and those who care for them, with practical information and demonstrations to improve dietary quality. In addition to…

  9. Visualization of geometry and tally data using MCNP and Justine

    International Nuclear Information System (INIS)

    Cox, L.J.; Favorite, J.A.

    1999-01-01

    The Monte Carlo N-Particle (MCNP) transport code is a general-purpose code that can be used for neutron, photon, electron, or coupled neutron/photon/electron transport, including the capability to calculate eigenvalues for neutron-multiplying systems. The code treats an arbitrary three-dimensional configuration of materials in geometric cells bounded by first- and second-degree surfaces and fourth-degree elliptical tori. Justine is the graphical user interface and problem setup tool for the Los Alamos Radiation Modeling Interactive Environment (LARAMIE). Its purpose is to serve as a convenient and very general interface for setting up physics calculations and linking together the disparate radiation transport codes under a single front-end. Currently, the LARAMIE system includes MCNP and the deterministic transport code suit DANTSYS (ONEDANT, TWODANT, and THREEDANT, for one-, two-, and three-dimensional geometries, respectively). Justine is currently available through the Radiation Safety Information Computational Center to members of the criticality safety community for evaluation and use. The authors will demonstrate the capabilities of both codes for visualization of geometries and results from a variety of criticality problems

  10. Learning AWS OpsWorks

    CERN Document Server

    Rosner, Todd

    2013-01-01

    A fast-paced, example-based guide to mastering AWS OpsWorks.This book is geared towards application developers, system administrators, DevOps, and anyone else interested in delivering applications while managing highly-scalable and automated infrastructures using push-button procedures. Some knowledge of what cloud computing is as well as some familiarity with Amazon Web Services is all you need as a precursor to reading this book.

  11. Abject Magic: Reasoning Madness in Justine Larbalestier's "Magic or Madness" Trilogy

    Science.gov (United States)

    Potter, Troy

    2013-01-01

    This paper explores the representation of magic and madness in Justine Larbalestier's "Magic or Madness" trilogy (2005-2007). Throughout the series, magic is constructed as an abject and disabling force that threatens to disable magic-wielders, either through madness or death. Despite being represented as a ubiquitous force, the…

  12. Justin Bieber, do doc ao Instagram: a estetização da vida

    Directory of Open Access Journals (Sweden)

    Denise Tavares

    2013-12-01

    Full Text Available Alguns documentários biográficos de celebridades reafirmam um modelo de produção audiovisual que encerra a história de vida no show e na fama, articulando o tensionamento entre biografia, tecnologia, experiência estética e afeto. Tais imbricamentos são ainda mais visíveis quando considerada a fruição desta celebridade, “consumida” em outras possibilidades biográficas que remixa webvideos postados no Youtube e/ou fotos no Instagram. Para discutir estas questões, o artigo destaca Justin Bieber, tendo como ponto de partida o documentário Justin Bieber – Never Say Never (2011, de Jon M. Chu e o Instagram, em um recorte que privilegia a experiência dos desejos dos fãs.

  13. AW-101 entrained solids - Solubility versus temperature

    International Nuclear Information System (INIS)

    GJ Lumetta; RC Lettau; GF Piepel

    2000-01-01

    This report describes the results of a test conducted by Battelle to assess the solubility of the solids entrained in the diluted AW-101 low-activity waste (LAW) sample. BNFL requested Battelle to dilute the AW-1-1 sample using de-ionized water to mimic expected plant operating conditions. BNFL further requested Battelle to assess the solubility of the solids present in the diluted AW-101 sample versus temperature conditions of 30, 40, and 50 C. BNFL requested these tests to assess the composition of the LAW supernatant and solids versus expected plant-operating conditions. The work was conducted according to test plan BNFL-TP-29953-7, Rev. 0, Determination of the Solubility of LAW Entrained Solids. The test went according to plan, with no deviations from the test plan

  14. Justin Bieber, do doc ao Instagram: a estetização da vida

    OpenAIRE

    Tavares, Denise; Pinto, Raphael

    2013-01-01

    Alguns documentários biográficos de celebridades reafirmam um modelo de produção audiovisual que encerra a história de vida no show e na fama, articulando o tensionamento entre biografia, tecnologia, experiência estética e afeto. Tais imbricamentos são ainda mais visíveis quando considerada a fruição desta celebridade, “consumida” em outras possibilidades biográficas que remixa webvideos postados no Youtube e/ou fotos no Instagram. Para discutir estas questões, o artigo destaca Justin Bieber,...

  15. On the Social Nature of Objectivity: Helen Longino and Justin Biddle

    Directory of Open Access Journals (Sweden)

    Jaana Eigi

    2015-11-01

    Full Text Available According to Helen Longino, objectivity is necessarily social as it depends on critical interactions in community. Justin Biddle argues that Longino’s account presupposes individuals that are completely open to any criticism; as such individuals are in principle able to criticise their beliefs on their own, Longino's account is not really social. In the first part of my paper I argue that even for completely open individuals, criticism for maintaining objectivity is only possible in community. In the second part I challenge Biddle’s interpretation of Longino’s conception of the individual. I conclude that Longino’s account is necessarily social.

  16. AWS certified solutions architect official study guide associate exam

    CERN Document Server

    Baron, Joe; Bixler, Tim; Gaut, Biff; Kelly, Kevin E; Senior, Sean; Stamper, John

    2017-01-01

    This is your opportunity to take the next step in your career by expanding and validating your skills on the AWS cloud. AWS has been the frontrunner in cloud computing products and services, and the AWS Certified Solutions Architect Official Study Guide for the Associate exam will get you fully prepared through expert content, and real-world knowledge, key exam essentials, chapter review questions, access to Sybex's interactive online learning environment, and much more. This official study guide, written by AWS experts, covers exam concepts, and provides key review on exam topics, including: * Mapping Multi-Tier Architectures to AWS Services, such as web/app servers, firewalls, caches and load balancers * Understanding managed RDBMS through AWS RDS (MySQL, Oracle, SQL Server, Postgres, Aurora) * Understanding Loose Coupling and Stateless Systems * Comparing Different Consistency Models in AWS Services * Understanding how AWS CloudFront can make your application more cost efficient, faster and secure * Implem...

  17. Tank 241-AW-101 tank characterization plan

    International Nuclear Information System (INIS)

    Sathyanarayana, P.

    1994-01-01

    The first section gives a summary of the available information for Tank AW-101. Included in the discussion are the process history and recent sampling events for the tank, as well as general information about the tank such as its age and the risers to be used for sampling. Tank 241-AW-101 is one of the 25 tanks on the Flammable Gas Watch List. To resolve the Flammable Gas safety issue, characterization of the tanks, including intrusive tank sampling, must be performed. Prior to sampling, however, the potential for the following scenarios must be evaluated: the potential for ignition of flammable gases such as hydrogen-air and/or hydrogen-nitrous oxide; and the potential for secondary ignition of organic-nitrate/nitrate mixtures in crust layer initiated by the burning of flammable gases or by a mechanical in-tank energy source. The characterization effort applicable to this Tank Characterization Plan is focused on the resolution of the crust burn flammable gas safety issue of Tank AW-101. To evaluate the potential for a crust burn of the waste material, calorimetry tests will be performed on the waste. Differential Scanning Calorimetry (DSC) will be used to determine whether an exothermic reaction exists

  18. The battle for Yellowstone: Morality and the  sacred roots of environmental conflict, by Justin Farrell

    Science.gov (United States)

    John Schelhas

    2017-01-01

    A growing number of intractable environmental conflicts involving interest groups with deeply held beliefs are resisting resolution in spite of extensive scientific analysis and legal and bureaucratic attention. Justin Farrell addresses three such conflicts in the Greater Yellowstone Ecosystem (GYE) as moral and spiritual conflicts, each uniquely animated by history,...

  19. The Victorian Philanthropic Quixote: Donna Quixote, by Justin McCarthy

    Directory of Open Access Journals (Sweden)

    Pedro Javier Pardo

    2012-12-01

    Full Text Available The paper undertakes the analysis of a little known Victorian quixotic novel, Donna Quixote, by Justin McCarthy. In so doing, it places the latter, in the first place, within the conception of quixotism characteristic of the Victorian age and, in the second place, within the previous tradition of female quixotes, particularly as a response to George Eliot’s Middlemarch. Then, the text studies the novel’s originality within the English quixotic tradition, which lies in the way it relates quixotism to both philanthropy and feminism, not just by means of the heroine but also of some quixotic secondary figures, and argues the author’s conservative position in the debate on women’s rights known as the woman question. Finally, the paper illustrates such a position and its ideological context by presenting another “Donna Quixote,” in this case a satiric cartoon on the so-called new woman.

  20. Justine Effect: Punishment of the Unduly Self-Sacrificing Cooperative Individuals

    Science.gov (United States)

    Kuběna, Aleš Antonín; Houdek, Petr; Lindová, Jitka; Příplatová, Lenka; Flegr, Jaroslav

    2014-01-01

    Background Allowing players to punish their opponents in Public Goods Game sustains cooperation within a group and thus brings advantage to the cooperative individuals. However, the possibility of punishment of the co-players can result in antisocial punishment, the punishment of those players who contribute the most in the group. To better understand why antisocial punishment exists, it must be determined who are the anti-social punishers and who are their primary targets. Methods For resolving these questions we increased the number of players in a group from usual four to twelve. Each group played six rounds of the standard Public Goods Game and six rounds of the Public Goods Game with punishment. Each player in each round received 20 CZK ($ 1.25). Players (N = 118) were rematched after each round so that they would not take into consideration opponents' past behavior. Results The amount of the punishment received correlated negatively with the contribution (ρ = −0.665, ppunishment obtained was U-shaped (R2 = 0.678, ppunishment was present in all groups, and in eight out of ten groups the Justine Effect (the positive correlation between the contribution to the public pool and the risk of suffering punishment in the subpopulation of altruistic players) emerged. In our sample, 22.5% subjects, all of them Free riders and low contributors, punished the altruistic players. Conclusions The results of our experimental game-study revealed the existence of the Justine effect – the positive correlation between the contribution to the public pool by a subpopulation of the most altruistic players, and the amount of punishment these players obtained from free-riders. PMID:24670974

  1. Justine effect: punishment of the unduly self-sacrificing cooperative individuals.

    Science.gov (United States)

    Kuběna, Aleš Antonín; Houdek, Petr; Lindová, Jitka; Příplatová, Lenka; Flegr, Jaroslav

    2014-01-01

    Allowing players to punish their opponents in Public Goods Game sustains cooperation within a group and thus brings advantage to the cooperative individuals. However, the possibility of punishment of the co-players can result in antisocial punishment, the punishment of those players who contribute the most in the group. To better understand why antisocial punishment exists, it must be determined who are the anti-social punishers and who are their primary targets. For resolving these questions we increased the number of players in a group from usual four to twelve. Each group played six rounds of the standard Public Goods Game and six rounds of the Public Goods Game with punishment. Each player in each round received 20 CZK ($ 1.25). Players (N = 118) were rematched after each round so that they would not take into consideration opponents' past behavior. The amount of the punishment received correlated negatively with the contribution (ρ = -0.665, pboarder of the upper quartile. The antisocial punishment was present in all groups, and in eight out of ten groups the Justine Effect (the positive correlation between the contribution to the public pool and the risk of suffering punishment in the subpopulation of altruistic players) emerged. In our sample, 22.5% subjects, all of them Free riders and low contributors, punished the altruistic players. The results of our experimental game-study revealed the existence of the Justine effect--the positive correlation between the contribution to the public pool by a subpopulation of the most altruistic players, and the amount of punishment these players obtained from free-riders.

  2. Justine effect: punishment of the unduly self-sacrificing cooperative individuals.

    Directory of Open Access Journals (Sweden)

    Aleš Antonín Kuběna

    Full Text Available Allowing players to punish their opponents in Public Goods Game sustains cooperation within a group and thus brings advantage to the cooperative individuals. However, the possibility of punishment of the co-players can result in antisocial punishment, the punishment of those players who contribute the most in the group. To better understand why antisocial punishment exists, it must be determined who are the anti-social punishers and who are their primary targets.For resolving these questions we increased the number of players in a group from usual four to twelve. Each group played six rounds of the standard Public Goods Game and six rounds of the Public Goods Game with punishment. Each player in each round received 20 CZK ($ 1.25. Players (N = 118 were rematched after each round so that they would not take into consideration opponents' past behavior.The amount of the punishment received correlated negatively with the contribution (ρ = -0.665, p<0.001. However, this correlation was positive for players in the highest contributors-quartile (ρ = 0.254, p<0.001. Therefore, the graph of relation between the contribution given and punishment obtained was U-shaped (R2 = 0.678, p<0.001 with the inflection point near the left boarder of the upper quartile. The antisocial punishment was present in all groups, and in eight out of ten groups the Justine Effect (the positive correlation between the contribution to the public pool and the risk of suffering punishment in the subpopulation of altruistic players emerged. In our sample, 22.5% subjects, all of them Free riders and low contributors, punished the altruistic players.The results of our experimental game-study revealed the existence of the Justine effect--the positive correlation between the contribution to the public pool by a subpopulation of the most altruistic players, and the amount of punishment these players obtained from free-riders.

  3. Investigation of Tank 241-AW-104 Composite Floating Layer

    Energy Technology Data Exchange (ETDEWEB)

    Meznarich, H. K. [Washington River Protection Solutions LLC (WRPS), Richland, WA (United States); Bolling, S. D. [Washington River Protection Solutions LLC (WRPS), Richland, WA (United States); Lachut, J. S. [Washington River Protection Solutions LLC (WRPS), Richland, WA (United States); Cooke, G. A. [Washington River Protection Solutions LLC (WRPS), Richland, WA (United States)

    2018-02-27

    Seven grab samples and one field blank were taken from Tank 241-AW-104 (AW-104) on June 2, 2017, and received at 222-S Laboratory on June 5, 2017. A visible layer with brown solids was observed floating on the top of two surface tank waste samples (4AW-17-02 and 4AW 17 02DUP). The floating layer from both samples was collected, composited, and submitted for chemical analyses and solid phase characterization in order to understand the composition of the floating layer. Tributyl phosphate and tridecane were higher in the floating layer than in the aqueous phase. Density in the floating layer was slightly lower than the mean density of all grab samples. Sodium nitrate and sodium carbonate were major components with a trace of gibbsite and very small size agglomerates were present in the solids of the floating layer. The supernate consisted of organics, soluble salt, and particulates.

  4. Test plan for Tank 241-AW-101 solubility screening tests

    International Nuclear Information System (INIS)

    Person, J.C.

    1998-01-01

    Tank 241-AW-101 (101-AW) has been identified as one of the early tanks to be for retrieved for low level waste pretreatment and immobilization and retrieval of the tank waste may require dilution. This test is to determine the effects of dilution on the mass of solids and their composition. This test plan gives test instructions, example data sheets, a waste compatibility review, and a waste stream fact sheet. This test Plan is similar to tests on tanks 241-AN-102 (Person 1998a) and 241-AN-107 (Person 1998 b). The 101-AW tests will be done with composites of liquid and solids from grab samples that were taken in 1998 (Benar 1998). Future revisions of the Tank Sampling and Analysis Plan (Benar 1998) may change the details of the work performed under this test plan

  5. Ruminating on Justin S. Ukpong’s inculturation hermeneutics and its implications for the study of African Biblical Hermeneutics today

    Directory of Open Access Journals (Sweden)

    Madipoane Masenya (ngwan’a Mphahlele

    2016-11-01

    Full Text Available In African biblical scholarship, the concept of inculturation hermeneutics has come to be almost, if not always, linked to the late Professor Justin S. Ukpong, the Nigerian New Testament scholar. In inculturation hermeneutics, argued Ukpong, the past of the biblical text is not supposed to be studied as an end in itself, but as a means to an end. Ukpong (2002 could thus argue: ‘Thus in inculturation hermeneutics, the past collapses into the present, and exegesis fuses with hermeneutics’ (p. 18. What does Ukpong’s concept of inculturation hermeneutics actually entail? Which implications does his notion of the fusion of exegesis and hermeneutics have for the theory and praxis of African Biblical Hermeneutics particularly on the African continent today? The preceding questions will be engaged with in this article.

  6. Acceptance/operational test procedure 101-AW tank camera purge system and 101-AW video camera system

    International Nuclear Information System (INIS)

    Castleberry, J.L.

    1994-01-01

    This procedure will document the satisfactory operation of the 101-AW Tank Camera Purge System (CPS) and the 101-AW Video Camera System. The safety interlock which shuts down all the electronics inside the 101-AW vapor space, during loss of purge pressure, will be in place and tested to ensure reliable performance. This procedure is separated into four sections. Section 6.1 is performed in the 306 building prior to delivery to the 200 East Tank Farms and involves leak checking all fittings on the 101-AW Purge Panel for leakage using a Snoop solution and resolving the leakage. Section 7.1 verifies that PR-1, the regulator which maintains a positive pressure within the volume (cameras and pneumatic lines), is properly set. In addition the green light (PRESSURIZED) (located on the Purge Control Panel) is verified to turn on above 10 in. w.g. and after the time delay (TDR) has timed out. Section 7.2 verifies that the purge cycle functions properly, the red light (PURGE ON) comes on, and that the correct flowrate is obtained to meet the requirements of the National Fire Protection Association. Section 7.3 verifies that the pan and tilt, camera, associated controls and components operate correctly. This section also verifies that the safety interlock system operates correctly during loss of purge pressure. During the loss of purge operation the illumination of the amber light (PURGE FAILED) will be verified

  7. 241-AW Double Shell Tanks (DST) Integrity Assessment Report

    International Nuclear Information System (INIS)

    JENSEN, C.E.

    1999-01-01

    This report presents the results of the integrity assessment of the 241-AW double-shell tank farm facility located in the 200 East Area of the Hanford Site. The assessment included the design evaluation and integrity examinations of the tanks and concluded that the facility is adequately designed, is compatible with the waste, and is fit for use. Recommendations including subsequent examinations, are made to ensure the continued safe operation of the tanks

  8. Evaluation of tank waste transfers at 241-AW tank farm

    International Nuclear Information System (INIS)

    Willis, W.L.

    1998-01-01

    A number of waste transfers are needed to process and feed waste to the private contractors in support of Phase 1 Privatization. Other waste transfers are needed to support the 242-A Evaporator, saltwell pumping, and other ongoing Tank Waste Remediation System (TWRS) operations. The purpose of this evaluation is to determine if existing or planned equipment and systems are capable of supporting the Privatization Mission of the Tank Farms and continuing operations through the end of Phase 1B Privatization Mission. Projects W-211 and W-314 have been established and will support the privatization effort. Equipment and system upgrades provided by these projects (W-211 and W-314) will also support other ongoing operations in the tank farms. It is recognized that these projects do not support the entire transfer schedule represented in the Tank Waste Remediation system Operation and Utilization Plan. Additionally, transfers surrounding the 241-AW farm must be considered. This evaluation is provided as information, which will help to define transfer paths required to complete the Waste Feed Delivery (WFD) mission. This document is not focused on changing a particular project, but it is realized that new project work in the 241-AW Tank Farm is required

  9. 241-AW Tank Farm Construction Extent of Condition Review for Tank Integrity

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, Travis J.; Gunter, Jason R.; Reeploeg, Gretchen E.

    2013-11-19

    This report provides the results of an extent of condition construction history review for the 241-AW tank farm. The construction history of the 241-AW tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AW tank farm, the fourth double-shell tank farm constructed, similar issues as those with tank 241-AY-102 construction occured. The overall extent of similary and affect on 241-AW tank farm integrity is described herein.

  10. Influence of Friction Stir Welding (FSW on Mechanical and Corrosion Properties of AW-7020M and Aw-7020 Alloys

    Directory of Open Access Journals (Sweden)

    Dudzik Krzysztof

    2016-09-01

    Full Text Available Friction welding associated with mixing the weld material (FSW - Friction Stir Welding is an alternative to MIG and TIG welding techniques for Al-alloys. This paper presents experimental results obtained from static tension tests on specimens made of AW-7020M and AW-7020 alloys and their joints welded by using FSW method carried out on flat specimens, according to Polish standards : PN-EN ISO 4136:2011 and PN-EN ISO 6892-1:2010. Results of corrosion resistance tests are also presented. The tests were performed by using the electrochemical impedance spectroscopy (EIS. EIS measurement was conducted with the use of three-electrode system in a substitute sea water environment (3,5% NaCl - water solution. The impedance tests were carried out under corrosion potential. Voltage signal amplitude was equal to 10mV, and its frequency range - 100 kHz ÷ 0,1 Hz. Atlas 0531 EU&IA potentiostat was used for the tests. For the tested object an equivalent model was selected in the form of a substitute electric circuit. Results of the impedance spectroscopy tests are presented in the form of parameters which characterize corrosion process, as well as on Nyquist’s graphs together with the best-fit theoretical curve.

  11. Strain change and creep behavior of STACIR/AW power line with heat exposure

    Energy Technology Data Exchange (ETDEWEB)

    Kim, B.G.; Park, S.D.; Kim, S.S.; Lee, H.W. [Overhead Conductor Research Lab., Korea Electrotechnology Research Inst., Changwon (Korea)

    2005-07-01

    As a way to expand electric capacity in power line with hovering of electric power demand, STACIR/AW (super thermal-resistant Al alloy conductors Al-clad Invar-reinforced) overhead conductor which cans double ampacity has been developed. The STACIR/AW power line is mechanically composite stranded wire composed of INVAR/AW stranded wire as core for sag control and heat-resistant aluminum alloy for delivering doubled electric current. Recently, in order to ensure stable line operation and to predict its span of life, the changes of thermal properties for STACIR/AW have been investigated. In the present work, the changes of strain with temperature and the creep behavior as important factors in sag control will be presented. The transition temperature of STACIR/AW 410 sqmm was estimated approximately 130 C and the creep rates were decreased with temperatures. (orig.)

  12. What makes corruption in the public procurement process awful?

    Directory of Open Access Journals (Sweden)

    Kofi Osei-Afoakwa

    2012-12-01

    Full Text Available Corruption as a societal bane has afflicted homes, families, societies, businesses, governments and nations for ages. Some have traced it to the days of Adam. Under every culture, the phenomenon has been considered detestable although its exact definition has defied definite expression. Its pervasiveness has also been recognised by sociologists for ages. It has appeared in households, offices, churches, marriages and all facets of social endeavours and interactions. When corruption rears its ugly head in the process through which governments acquire goods, works and services for the purpose of running their business, it is highly unacceptable and particularly dangerous to such nations. But why is there the cause to worry about corruption? Why is corruption unacceptable? A theoretical basis is provided to elucidate societal abhorrence to corruption as it affects public procurement in particular using the deontologist-consequentialist dichotomised ethical and moral explanations. It has been concluded that corruption in procurement is awful not only because of its negative consequences but because it is inherently wrong, unethical, immoral and above all an illegality.

  13. Ultrafiltration and Characterization of AW-101 Supernatant and Entrained Solids

    International Nuclear Information System (INIS)

    Brooks, K.P.; Bredt, P.R.; Golcar, G.R.; Hartley, S.A.; Urie, M.W.; Tingey, J.M.; Rappe, K.G.; Jagoda, L.K.

    1999-01-01

    The River Protection Project Waste Treatment Plant (RPP-WTP) (1996) flow sheet uses cross-flow filtration as the solid/liquid separation technique. Unlike traditional dead-end filtration, which has a declining rate caused by the growth of a filter cake on the surface of the filter medium, in cross-flow filtration, the filter cake is swept away by the fluid flowing across it. This filtration method is especially beneficial when there are very fine particles and when system simplicity is required. The objective of this work was to test cross-flow filtration using actual Envelope A Hanford tank waste. Similar to the Phase 1A study, they evaluated the permeability of an Envelope A feed through a single element filter as a function of transmembrane pressure, axial velocity, solids concentration, and time. In addition, the efficiency of back pulse and chemical cleaning on the filter performance was evaluated. The chemical and radiochemical composition of the filtrate and solids was measured to determine efficiency of the filtration process. This report describes the test apparatus, the experimental approach, the results of the tests, and the chemical and radiochemical analysis for supernatants taken from Hanford Tank AW-101. This report also provides a means of transmitting to British Nuclear Fuels, Limited (BNFL) the completed test instruction and raw filtration and analytical data

  14. Precipitation kinetics in warm forming of AW-7020 alloy

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, M., E-mail: Manoj.kumar@ait.ac.at [Leichtmetall-Kompetenzzentrum Ranshofen GmbH, Austrian Institute of Technology, Postfach 26, A-5282 Ranshofen (Austria); Institute of Material Science and Technology, TU Vienna (Austria); Poletti, C. [Present address: Institute of Material Science and Welding, TU Graz (Austria); Institute of Material Science and Technology, TU Vienna (Austria); Degischer, H.P. [Institute of Material Science and Technology, TU Vienna (Austria)

    2013-01-20

    The warm formability of the precipitation hardening AW-7020 (AlZn 4.5Mg1) alloy is investigated by testing extruded tubes. The precipitation kinetics of different conditions before and after warm deformation is studied by differential scanning calorimetry and transmission electron microcopy. The precipitation conditions are correlated with the results of hardness tests at room temperature and of tensile tests at temperatures between 200 and 350 Degree-Sign C at different strain rates. The yield strength decreases with increasing test temperature approaching that of samples in the annealed condition, while the strain at fracture increases. The overall influence of the strain rate on ductility is dominated by the corresponding time required for deformation. The formability of the starting condition T1 as well as the corresponding strain hardening exponent is particularly promising for high strain rates at 250 Degree-Sign C, where the metastable precipitates of the T1 condition are dissolved. The short exposure of about 30 s at 250 Degree-Sign C re-establishes the potential for precipitation strengthening by natural ageing after the warm deformation and a following paint baking heat treatment maintains the hardness level.

  15. Processing ARM VAP data on an AWS cluster

    Science.gov (United States)

    Martin, T.; Macduff, M.; Shippert, T.

    2017-12-01

    The Atmospheric Radiation Measurement (ARM) Data Management Facility (DMF) manages over 18,000 processes and 1.3 TB of data each day. This includes many Value Added Products (VAPs) that make use of multiple instruments to produce the derived products that are scientifically relevant. A thermodynamic and cloud profile VAP is being developed to provide input to the ARM Large-eddy simulation (LES) ARM Symbiotic Simulation and Observation (LASSO) project (https://www.arm.gov/capabilities/vaps/lasso-122) . This algorithm is CPU intensive and the processing requirements exceeded the available DMF computing capacity. Amazon Web Service (AWS) along with CfnCluster was investigated to see how it would perform. This cluster environment is cost effective and scales dynamically based on demand. We were able to take advantage of autoscaling which allowed the cluster to grow and shrink based on the size of the processing queue. We also were able to take advantage of the Amazon Web Services spot market to further reduce the cost. Our test was very successful and found that cloud resources can be used to efficiently and effectively process time series data. This poster will present the resources and methodology used to successfully run the algorithm.

  16. Acceptance test report for 241-AW process air system

    International Nuclear Information System (INIS)

    Kostelnik, A.J.

    1994-01-01

    The acceptance test procedure (ATP) for the compressed air system at building 241-AW-273 was completed on March 11, 1993. The system was upgraded to provide a reliable source of compressed air to the tank farm. The upgrade included the demolition of the existing air compressor and associated piping, as well as the installation of a new air compressor with a closed loop cooling system. A compressed air cross-tie was added to allow the process air compressor to function as a back-up to the existing instrument air compressor. The purpose of the ATP was to achieve three primary objectives: verify system upgrade in accordance with the design media; provide functional test of system components and controls; and prepare the system for the Operational Test. The ATP was successfully completed with thirteen exceptions, which were resolved prior to completing the acceptance test. The repaired exceptions had no impact to safety or the environment and are briefly summarized. Testing ensured that the system was installed per design, that its components function as required and that it is ready for operational testing and subsequent turnover to operations

  17. Stanisław Barańczak i awangarda

    Directory of Open Access Journals (Sweden)

    Alina Świeściak

    2016-12-01

    Full Text Available The poetry of Stanisław Barańczak, who himself was against historical avant-garde as a movement that abandoned ethical commitments, has quite a lot in common with avant-garde. Like other New Wave artists, his poetry can be read in the context of the neo-avant-garde and counterculture, e.g. in the context of Guy Debord’s The Society of the Spectacle and Herbert Marcuse’s Onedimensional Man, with the propositions that overlap in many places with those of Baranczak’s “dialectic Romanticism”. When analysing the links of this poetry with the participant art of the 1960s and 1970s, it can be concluded that new-wave commitment has little in common with the typical attempts of the neo-avant-garde at regaining privacy, since the political character of Barańczak’s poetry is based on giving a position of privilege to the martyrdom code of Polish romanticism, which he frames in elitist modernist language.

  18. Rheological Studies on Pretreated Feed and Melter Feed from AW-101 and AN-107

    International Nuclear Information System (INIS)

    Bredt, Paul R; Swoboda, Robert G

    2001-01-01

    Rheological and physical properties testing were conducted on actual AN-107 and AW-101 pretreated feed samples prior to the addition of glass formers. Analyses were repeated following the addition of glass formers. The AN-107 and AW-101 pretreated feeds were tested at the target sodium values of nominally 6, 8, and 10 M. The AW-101 melter feeds were tested at these same concentrations, while the AN-107 melter feeds were tested at 5, 6, and 8 M with respect to sodium. These data on actual waste are required to validate and qualify results obtained with simulants

  19. Mechanical clinching process stress and strain in the clinching of EN-AW5754 (AlMg3, and EN AW-5019 (AlMg5 metal plates

    Directory of Open Access Journals (Sweden)

    J. Cumin

    2018-01-01

    Full Text Available This paper presents the results of Finite Element Method numerical simulation performed onEN-AW5754(AlMg3, EN AW-5019 (AlMg5 plates subjected to mechanical clinching. The goal was to observe differences between aluminum plates in the same tool; and to determine the possibility of using the constructed tool for the clinching of Al-Al material combinations. This tool construction is to be produced and tested in laboratory conditions, to elaborate prospective results, and reach additional conclusions.

  20. Randomized controlled trial of the Pentax AWS, Glidescope, and Macintosh laryngoscopes in predicted difficult intubation.

    LENUS (Irish Health Repository)

    Malik, M A

    2009-11-01

    The purpose of this study was to determine the potential for the Pentax AWS and the Glidescope to reduce the difficulty of tracheal intubation in patients at increased risk for difficult tracheal intubation, in a randomized, controlled clinical trial.

  1. Investigations on the Hot Stamping of AW-7921-T4 Alloy Sheet

    Directory of Open Access Journals (Sweden)

    M. Kumar

    2017-01-01

    Full Text Available AW-7xxx alloys have been nowadays considered for greater light weighting potential in automotive industry due to its higher strength compared to AW-5xxx and AW-6xxx alloys. However, due to their lower formability the forming processes are still in development. This paper investigates one such forming process called hot stamping. The investigation started by carrying out hot tensile testing of an AW-7xxx alloy, that is, AW-7921 at temperatures between 350°C and 475°C, to measure the strength and formability. Formability was found to improve with increasing temperature and was sensitive to the strain rate. Dynamic recovery is considered as usual reason for the formability improvement. However, examining the precipitation states of the as-received condition and after hot stamping using differential scanning calorimetry (DSC, the dissolution of precipitates was also believed to contribute to this increase in formability. Following solution heat treatment there was no precipitation during cooling across the cooling rates investigated (5–10°C/s. Samples taken from parts hot stamped at 10 and 20 mm s−1 had similar yield strengths. A 3-step paint baking heat treatment yielded a higher postpaint baking strength than a single step treatment.

  2. Thermal modeling of tanks 241-AW-101 and 241-AN-104 with the TEMPEST code

    International Nuclear Information System (INIS)

    Antoniak, Z.I.; Recknagle, K.P.

    1995-07-01

    The TEMPEST code was exercised in a preliminary study of double-shell Tanks 241 -AW-101 and 241-AN-104 thermal behavior. The two-dimensional model used is derived from our earlier studies on heat transfer from Tank 241-SY-101. Several changes were made to the model to simulate the waste and conditions in 241-AW-101 and 241-AN-104. The nonconvective waste layer was assumed to be 254 cm (100 in.) thick for Tank 241-AW-101, and 381 cm (150 in.) in Tank 241-AN-104. The remaining waste was assumed, for each tank, to consist of a convective layer with a 7.6-cm (3-inch) crust on top. The waste heat loads for 241-AW-101 and 241-AN-104 were taken to be 10 kW (3.4E4 Btu/hr) and 12 kW (4.0E4 Btu/hr), respectively. Present model predictions of maximum and convecting waste temperatures are within 1.7 degrees C (3 degrees F) of those measured in Tanks 241-AW-101 and 241-AN-104. The difference between the predicted and measured temperature is comparable to the uncertainty of the measurement equipment. These models, therefore, are suitable for estimating the temperatures within the tanks in the event of changing air flows, waste levels, and/or waste configurations

  3. [Use of the Pentax-AWS videolaryngoscope for bougie-assisted exchange of tracheal tubes].

    Science.gov (United States)

    Kishii, Miki; Asai, Takashi; Nagata, Atsushi; Shingu, Koh

    2009-06-01

    A gum elastic bougie can be useful for tube exchange. One major problem with this technique is that it may not possible to pass a new tube over the bougie into the trachea, because the tip of the tube can collide with tissues around the glottis. We report a case in which tube exchange using the bougie was difficult, but the Pentax-AWS videolaryngoscope enabled tracheal intubation. In a 62-year-old trauma patient with head and neck stabilized using a Halo vest, was scheduled for emergency fixation of the neck. Exchange of a polyvinylchloride tube to a reinforced tube was planned. A bougie was passed through the old tube, removing the tube, and a new tube was advanced over the bougie, but it was impossible to advance the tube into the trachea. Insertion of a Macintosh laryngoscope did not enable intubation. The new tube was removed from the bougie, attached to the Pentax-AWS videolaryngoscope, and the tube (with the Pentax-AWS) was passed over the bougie. Although it was not possible to see the glottis with the Pentax-AWS, the tube was easily advanced over the bougie into the trachea. Operation went on uneventfully. We believe that, when it is difficult to advance a tracheal tube over a tube exchanger, the use of the Pentax-AWS may facilitate intubation.

  4. Pengaruh Bauran Pemasaran (Marketing Mix) Dan Kualitas Pelayanan Terhadap Kepuasan Pelanggan di A&W Restaurants di Sun Plaza Medan

    OpenAIRE

    Purba, Aurora Tianisari

    2012-01-01

    A&W Restaurants Sun Plaza Medan is one of the company engaged in the fast food (fast food), which the company must implement appropriate marketing strategies to achieve corporate objectives and service are also very necessary to provide and create customer satisfaction at the A&W Restaurants well across Indonesia especially in Medan, North Sumatra. Competition experienced by the fast food company A&W Restaurants in Indonesia is quite tight, given the many fast food company such as Kentucky Fr...

  5. Acoustic wave (AW) based moisture sensor for use with corrosive gases

    Science.gov (United States)

    Pfeifer, K.B.; Frye, G.C.; Schneider, T.W.

    1996-11-05

    Moisture corrosive gas stream is measured as a function of the difference in resonant frequencies between two acoustic wave (AW) devices, each with a film which accepts at least one of the components of the gas stream. One AW is located in the gas stream while the other is located outside the gas stream but in the same thermal environment. In one embodiment, the film is a hydrophilic material such as SiO{sub 2}. In another embodiment, the SiO{sub 2} is covered with another film which is impermeable to the corrosive gas, such that the AW device in the gas stream measures only the water vapor. In yet another embodiment, the film comprises polyethylene oxide which is hydrophobic and measures only the partial pressure of the corrosive gas. Other embodiments allow for compensation of drift in the system. 8 figs.

  6. A Case Study for the Welding of Dissimilar EN AW 6082 and EN AW 5083 Aluminum Alloys by Friction Stir Welding

    Directory of Open Access Journals (Sweden)

    Sefika Kasman

    2016-12-01

    Full Text Available The aim of this study is to investigate the effect of keeping constant the tool rotational speed to the welding speed ratio (υ ratio on the mechanical properties of the dissimilar friction stir welding of EN AW6082-T6 and EN AW5083-H111. Two different pins shaped as triangular and pentagonal were associated with the constant υ ratio. From the tensile test results, it was found that the υ ratio does not create an evident change in the weld joint strength. The small cavity- and tunnel-type defects were observed at the nugget zone and located on the advancing side of the pin. These defects caused a decrease in the strength and elongation of the weld joint. The most important inference obtained from the experimental results is that if the υ ratio is kept constant, the weld joint strength for each weld does not correspond to a constant value.

  7. Nomenclatural Studies Toward a World List of Diptera Genus-Group Names. Part V: Pierre-Justin-Marie Macquart.

    Science.gov (United States)

    Evenhuis, Neal L; Pape, Thomas; Pont, Adrian C

    2016-09-30

    The Diptera genus-group names of Pierre-Justin-Marie Macquart are reviewed and annotated. A total of 399 available genus-group names in 69 families of Diptera are listed alphabetically, for each name giving author, year and page of original publication, originally included species, type species and method of fixation, current status of the name, family placement, and a list of any emendations of it that have been found in the literature. Remarks are given to clarify nomenclatural or taxonomic information. In addition, an index to all the species-group names of Diptera proposed by Macquart (3,611, of which 3,543 are available) is given with bibliographic reference (year and page) to each original citation.        The following type species are designated herein: Agculocera nigra Macquart, 1855 for Onuxicera Macquart, 1855, present designation [Tachinidae]; Trixa imhoffi Macquart, 1834, for Semiomyia Macquart, 1848, present designation [Tachinidae].        The following type species are designated herein with fixation under ICZN Code Art. 70.3.2: Azelia nebulosa Robineau-Desvoidy, 1830 for Atomogaster Macquart, 1835, present designation [Muscidae]; Tachydromia vocatoria Fallén, 1816 for Chelipoda Macquart, 1835, present designation [Empididae]; Eriocera macquarti Enderlein, 1912 for Eriocera Macquart, 1838, present designation [Limoniidae]; Limosina acutangula Zetterstedt, 1847 for Heteroptera Macquart, 1835, present designation [Sphaeroceridae]; Phryxe pavoniae Robineau-Desvoidy, 1830 for Masicera Macquart, 1834, present designation [Tachinidae]; Pachymyia macquartii Townsend, 1916 for Pachymyia Macquart, 1844, present designation [Tachinidae].        Earlier valid subsequent type-species designations have been found in this study for the following: Anisophysa Macquart, 1835 [Sepsidae]; Diphysa Macquart, 1838 [Stratiomyidae]; Pachyrhina Macquart, 1834 [Tipulidae]; Silbomyia Macquart, 1844 [Calliphoridae].        One name is raised from

  8. Remembrance of professor Tadeusz Marciniak - Lviv tradition in Wrocław.

    Science.gov (United States)

    Kacała, Ryszard R; Woźniak, Sławomir; Porwolik, Michał; Dąbrowski, Paweł; Domagała, Zygmunt; Kacała, Arkadiusz; Gworys, Bohdan

    2015-01-01

    After the seizure of Lviv by the Soviets, in the years 1944-1946, Tadeusz Marciniak worked in the Descriptive Anatomy Department in the State-Medical Institute of Lviv and also performed the function of the dean of the Medical Faculty. On receiving a proposal to assume the Chair of the Anatomy Department in Wrocław, he made the decision to leave Lviv. By July 2nd, 1946, prof. Tadeusz Marciniak had taken over the duties of full professor of the Descriptive Anatomy Department of the Medical Faculty of the University and the Technical College of Wrocław. On taking his job in Wrocław, prof. Marciniak undertook attempts to restore the worn out parts of the Anatomy Department building. Due to the lack of Polish manuals, he also took to the preparation of scripts for medical students. Professor Marciniak was a member of the Wrocław Section of the Polish Anthropological Association and a regular member of the Wroclaw Association of Science. His main scientific interests referred to the morphogenesis of the central nervous system and urinary system. He concentrated on circulatory system and muscular system tetralogies. Professor Marciniak also actively participated in administrative work at the university. In the years 1947-1948, he held the office of associate dean of the Medical Faculty, and till 1950 was a member of the Senate of the University and Technical College of Wrocław. In the years 1959-1962, he was a vice rector of the Medical University of Wrocław.

  9. Analisis Kebutuhan Bandwidth Pada Pemanfaatan Web Streaming Justin.tv Sebagai Media E-Learning Dengan Menggunakan Wirecast Dan Desktop Presenter

    Directory of Open Access Journals (Sweden)

    Muhammad Ubaidilah

    2014-05-01

    Full Text Available Perkembangan teknologi informasi begitu cepat seperti sekarang telah banyak mengubah sudut pandang banyak orang, antara lain sudut pandang orang untuk mengubah dunia pendidikan menjadi lebih baik. Salah satu contohnya pembelajaran berbasis Information and Communication Technologies (ICT yaitu pembelajaran menggunakan video streaming. Dengan instalasi software open source Wirecast dan Desktop presenter digunakan untuk membuat video pembelajaran Streaming, disiarkan secara real time melalui media broadcast justin.tv (internet TV Channel, diharapkan dapat lebih mendukung konsep pembelajaran kapan dan dimana saja. Masalah terbesar dari teknologi ini adalah keterbatasan bandwidth. Bandwidth adalah parameter penting untuk melakukan streaming dalam jaringan. Sedangkan proses komunikasi menggunakan video digital ini menghabiskan resource yang cukup besar. Sehingga penggunaan wireshark di sini sangat diperlukan untuk menganalisis bandwidth pada paket yang diterima oleh client. Dari hasil pengukuran video dengan standar H.264 resolusi (720 x 540, dengan rata-rata 20 menit dalam pengambilan sampel, sebanyak 30 pengujian sampel streaming video menggunakan wireshark, diperoleh rata-rata throughput keseluruhan 0,343 Mbps, rata-rata throughput terendah 0,309 Mbps dan throughput tertinggi 0,372 Mbps. Dapat disimpulkan bahwa jika dihasilkan throughput yang lebih besar maka kualitas video streaming akan lebih baik, tetapi jika throughput dihasilkan semakin kecil maka kualitas video streaming akan menurun

  10. A polysaccharide isolated from Agaricus blazei Murill (ABP-AW1) as a potential Th1 immunity-stimulating adjuvant.

    Science.gov (United States)

    Cui, Liran; Sun, Yongxu; Xu, Hao; Xu, Huiyu; Cong, Huan; Liu, Jicheng

    2013-10-01

    In the present study, a low molecular weight polysaccharide, ABP-AW1, isolated from Agaricus blazei Murill was assessed for its potential adjuvant activity. ABP-AW1 is considered to create a 'depot' of antigen at a subcutaneous injection site. ICR mice were immunized with 100 μg ovalbumin (OVA) alone or with 100 μg OVA formulated in 0.9% saline containing 200 μg aluminum (alum) or ABP-AW1 (50, 100 and 200 μg) on days 1 and 15. Two weeks after the secondary immunization, splenocyte proliferation, the expression of surface markers, cytokine production and the OVA-specific antibody levels in the serum were determined. The OVA/ABP-AW1 vaccine, in comparison with OVA alone, markedly increased the proliferation of splenic lymphocytes and elicited greater antigen-specific CD4 + T cell activation, as determined by splenic CD4 + CD69 + T cells and Th1 cytokine interferon (IFN)-γ release. The combination of ABP-AW1 and OVA also enhanced IgG2b antibody responses to OVA. In conclusion, these data indicated that ABP-AW1 significantly enhanced the humoral and cellular immune responses against OVA in the mice, suggesting that ABP-AW1 stimulated Th1-type immunity. We suggest that ABP-AW1 may serve as a new adjuvant.

  11. 75 FR 70739 - Domtar A.W. LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for...

    Science.gov (United States)

    2010-11-18

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER11-2021-000] Domtar A.W. LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for Blanket Section... of Domtar A.W. LLC's application for market-based rate authority, with an accompanying rate tariff...

  12. 75 FR 70738 - Domtar A.W. LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for...

    Science.gov (United States)

    2010-11-18

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER11-2021-000] Domtar A.W. LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for Blanket Section... of Domtar A.W. LLC's application for market-based rate authority, with an accompanying rate tariff...

  13. Tank characterization report for double-shell tank 241-AW-102

    Energy Technology Data Exchange (ETDEWEB)

    Bell, K.E.

    1997-05-29

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AW-102. This report supports the requirements of the Tri-Party Agreement Milestone M-44-05.

  14. Supporting document for the historical tank content estimate for AW-tank farm

    Energy Technology Data Exchange (ETDEWEB)

    Brevick, C.H., Stroup, J.L.; Funk, J.W., Fluor Daniel Hanford

    1997-03-06

    This Supporting Document provides historical in-depth characterization information on AW-Tank Farm, such as historical waste transfer and level data, tank physical information, temperature plots, liquid observation well plots, chemical analyte and radionuclide inventories for the Historical Tank Content Estimate Report for the Southeast Quadrant of the Hanford 200 Areas.

  15. Tank characterization report for double-shell tank 241-AW-102

    International Nuclear Information System (INIS)

    Bell, K.E.

    1997-01-01

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AW-102. This report supports the requirements of the Tri-Party Agreement Milestone M-44-05

  16. Women's Stereotypic Roles: A Replication and Standardization of the AWS and PAQ for Selected Ethnic Groups.

    Science.gov (United States)

    Wheeler, Edwin E.; And Others

    A replication of two previous studies, this study examined the effect of both sex and ethnicity on attitudes toward women, self-reported masculinity-femininity, and masculine-feminine stereotypic attitudes. The Attitudes Toward Women Scale (AWS) and the Personal Attributes Questionnaire (PAQ) were administered to 367 college students (112 Anglos,…

  17. Reliability of the Attitudes Toward Women Scale (AWS) and the Personal Attributes Questionnaire (PAQ).

    Science.gov (United States)

    Yoder, Jan D.; And Others

    In recent years, there has been a dramatic increase in the volume of empirical research directed toward the issue of sex-roles, including the development of evaluative instruments such as the Attitudes Toward Women Scale (AWS) and the Personal Attributes Questionnaire (PAQ). The United States Military Academy's Project Athena, designed to examine…

  18. Supporting document for the historical tank content estimate for AW-tank farm

    International Nuclear Information System (INIS)

    Brevick, C.H.; Stroup, J.L.; Funk, J.W.

    1997-01-01

    This Supporting Document provides historical in-depth characterization information on AW-Tank Farm, such as historical waste transfer and level data, tank physical information, temperature plots, liquid observation well plots, chemical analyte and radionuclide inventories for the Historical Tank Content Estimate Report for the Southeast Quadrant of the Hanford 200 Areas

  19. Cytotoxicity properties of PM2.5 collected in Wrocław agglomeration

    Directory of Open Access Journals (Sweden)

    Bełcik Maciej Krzysztof

    2017-01-01

    Full Text Available WHO report published in May 2016 presents the cities with the highest concentrations of particulate matter fraction 10 μm and 2.5 μm on the earth. Report presents that many of Polish cities are on the top of polluted regions in European Union. One of the cities mentioned in the report is Wrocław. Wrocław is the urban and industrial agglomeration, where air pollutions comes from three main sources: low-emissions, industrial emissions and urban traffic. In recent years, reduction in annual average concentrations of particulate matter has been observed. However Wrocław is still one of the cities in Poland, which have problems with smog situations during winter season. This article presents results of researches conducted on the particulate matter fraction 2.5 μm collected in Wrocław agglomeration. Pollutions have been tested using PAN-I assay kit, which contains 4 single toxicity tests allows to check different parameters defining toxic effects on human cells. Cytotoxicity tests which are conducted are: LDH test to evaluate the integrity of cell membrane, XTT test to assess mitochondrial activity, NR test for the evaluation of the lysosomal activity and SRB test to evaluate the total protein content. Tests were performed on adenocarcinomic human alveolar basal epithelial cell line (A549, which allows to simulate conditions as close as real.

  20. Recent technical developments at the IMAU: A new generation of AWS and wireless subglacial measurements

    NARCIS (Netherlands)

    Smeets, C.J.P.P.; Boot, W.; van den Broeke, M.R.; van de Wal, R.S.W.

    2011-01-01

    Two technical developments are presented: a new generation of AWS and a wireless subglacial measurement system. Both systems build on the experience of the IMAU in developing GPS systems (Den Ouden et al., 2010). Combining methods to minimize energy consumption and wireless communication form the

  1. Tank characterization report for double-shell Tank 241-AW-105

    International Nuclear Information System (INIS)

    DiCenso, A.T.; Amato, L.C.; Franklin, J.D.; Lambie, R.W.; Stephens, R.H.; Simpson, B.C.

    1994-01-01

    In May 1990, double-shell Tank 241-AW-105 was sampled to determine proper handling of the waste, to address corrosivity and compatibility issues, and to comply with requirements of the Washington Administrative Code. This Tank Characterization Report presents an overview of that tank sampling and analysis effort, and contains observations regarding waste characteristics. It also addresses expected concentration and bulk inventory data for the waste contents based on this latest sampling data and background tank information. This report summarizes the available information regarding the waste in Tank 241-AW-105, and using the historical information to place the analytical data in context, arranges this information in a useful format for making management and technical decisions concerning this waste tank. In addition, conclusions and recommendations are given based on safety issues and further characterization needs

  2. Concurrent Haloalkanoate Degradation and Chlorate Reduction by Pseudomonas chloritidismutans AW-1T.

    Science.gov (United States)

    Peng, Peng; Zheng, Ying; Koehorst, Jasper J; Schaap, Peter J; Stams, Alfons J M; Smidt, Hauke; Atashgahi, Siavash

    2017-06-15

    Haloalkanoates are environmental pollutants that can be degraded aerobically by microorganisms producing hydrolytic dehalogenases. However, there is a lack of information about the anaerobic degradation of haloalkanoates. Genome analysis of Pseudomonas chloritidismutans AW-1 T , a facultative anaerobic chlorate-reducing bacterium, showed the presence of two putative haloacid dehalogenase genes, the l-DEX gene and dehI , encoding an l-2-haloacid dehalogenase (l-DEX) and a halocarboxylic acid dehydrogenase (DehI), respectively. Hence, we studied the concurrent degradation of haloalkanoates and chlorate as a yet-unexplored trait of strain AW-1 T The deduced amino acid sequences of l-DEX and DehI revealed 33 to 37% and 26 to 86% identities with biochemically/structurally characterized l-DEX and the d- and dl-2-haloacid dehalogenase enzymes, respectively. Physiological experiments confirmed that strain AW-1 T can grow on chloroacetate, bromoacetate, and both l- and d-α-halogenated propionates with chlorate as an electron acceptor. Interestingly, growth and haloalkanoate degradation were generally faster with chlorate as an electron acceptor than with oxygen as an electron acceptor. In line with this, analyses of l-DEX and DehI dehalogenase activities using cell-free extract (CFE) of strain AW-1 T grown on dl-2-chloropropionate under chlorate-reducing conditions showed up to 3.5-fold higher dehalogenase activity than the CFE obtained from AW-1 T cells grown on dl-2-chloropropionate under aerobic conditions. Reverse transcription-quantitative PCR showed that the l-DEX gene was expressed constitutively independently of the electron donor (haloalkanoates or acetate) or acceptor (chlorate or oxygen), whereas the expression of dehI was induced by haloalkanoates. Concurrent degradation of organic and inorganic halogenated compounds by strain AW-1 T represents a unique metabolic capacity in a single bacterium, providing a new piece of the puzzle of the microbial halogen cycle

  3. Structural analysis of color video camera installation on tank 241AW101 (2 Volumes)

    Energy Technology Data Exchange (ETDEWEB)

    Strehlow, J.P.

    1994-08-24

    A video camera is planned to be installed on the radioactive storage tank 241AW101 at the DOE` s Hanford Site in Richland, Washington. The camera will occupy the 20 inch port of the Multiport Flange riser which is to be installed on riser 5B of the 241AW101 (3,5,10). The objective of the project reported herein was to perform a seismic analysis and evaluation of the structural components of the camera for a postulated Design Basis Earthquake (DBE) per the reference Structural Design Specification (SDS) document (6). The detail of supporting engineering calculations is documented in URS/Blume Calculation No. 66481-01-CA-03 (1).

  4. Acceptance for Beneficial Use (ABU) Update for 241-AW-104 Waste Transfer Project

    International Nuclear Information System (INIS)

    MEWES, B.S.

    2001-01-01

    In October of 2000 an Engineering Task Plan (ETP), RPP-6869, was drafted to define objectives, document requirements, and define organizational responsibilities for the purpose of design installation and turnover of the 241-AW-104 Pump Replacement Project The ETP included an Acceptance for Beneficial Use (ABU) checklist, which delineated all tasks necessary to turn the 241-AW-104 Replaced Transfer Pump over to Operations, Maintenance, and Plant Engineering Signature approval of the respective Engineering Data Transmittal (EDT 630501) signified agreement that the ABU checklist was all-inclusive. In January 2001 an additional EDT (EDT 624153) was drafted to define completed ABU items, provide corresponding supporting documentation, and status open items in need of completion. This supporting document is to serve two purposes: (1) update ABU checklist items completed since January 2001, and (2) define remaining ABU checklist items in need of completion

  5. Rough Sets and Intelligent Systems - Professor Zdzisław Pawlak in Memoriam Volume 2

    CERN Document Server

    Suraj, Zbigniew

    2013-01-01

    This book is dedicated to the memory of Professor Zdzis{\\l}aw Pawlak who passed away almost six year ago. He is the founder of the Polish school of Artificial Intelligence and one of the pioneers in Computer Engineering and Computer Science with worldwide influence. He was a truly great scientist, researcher, teacher and a human being. This book prepared in two volumes contains more than 50 chapters. This demonstrates that the scientific approaches  discovered by of Professor Zdzis{\\l}aw Pawlak, especially the rough set approach as a tool for dealing with imperfect knowledge, are vivid and intensively explored by many researchers in many places throughout the world. The submitted papers prove that interest in rough set research is growing and is possible to see many new excellent results both on theoretical foundations and applications of rough sets alone or in combination with other approaches. We are proud to offer the readers this book.

  6. Rough Sets and Intelligent Systems - Professor Zdzisław Pawlak in Memoriam Volume 1

    CERN Document Server

    Suraj, Zbigniew

    2013-01-01

    This book is dedicated to the memory of Professor Zdzis{\\l}aw Pawlak who passed away almost six year ago. He is the founder of the Polish school of Artificial Intelligence and one of the pioneers in Computer Engineering and Computer Science with worldwide influence. He was a truly great scientist, researcher, teacher and a human being. This book prepared in two volumes contains more than 50 chapters. This demonstrates that the scientific approaches  discovered by of Professor Zdzis{\\l}aw Pawlak, especially the rough set approach as a tool for dealing with imperfect knowledge, are vivid and intensively explored by many researchers in many places throughout the world. The submitted papers prove that interest in rough set research is growing and is possible to see many new excellent results both on theoretical foundations and applications of rough sets alone or in combination with other approaches. We are proud to offer the readers this book.

  7. THE LONG-LIVED UV ''PLATEAU'' OF SN 2012aw

    Energy Technology Data Exchange (ETDEWEB)

    Bayless, Amanda J.; Roming, Peter W. A. [Southwest Research Institute, Department of Space Science, 6220 Culebra Road, San Antonio, TX 78238 (United States); Pritchard, Tyler A. [Department of Astronomy and Astrophysics, Penn State University, 525 Davey Lab, University Park, PA 16802 (United States); Kuin, Paul [Mullard Space Science Laboratory, Holmbury St. Mary, Dorking, Surrey RH5 6NT (United Kingdom); Brown, Peter J. [Texas A and M University, Department of Physics and Astronomy, College Station, TX 77843-4242 (United States); Botticella, Maria Teresa; Dall' Ora, Massimo [INAF-Osservatorio Astronomico di Capodimonte, via Moiariello 16, I-80131 Napoli (Italy); Frey, Lucille H.; Even, Wesley; Fryer, Chris L. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Maund, Justyn R.; Fraser, Morgan [Astrophysics Research Center, School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom)

    2013-02-10

    Observations with the Swift UV Optical Telescope have unambiguously uncovered for the first time a long-lived, UV ''plateau'' in a Type II-P supernova (SN). Although this flattening in slope is hinted at in a few other SNe, due to its proximity and minimal line-of-sight extinction, SN 2012aw has afforded the first opportunity to clearly observe this UV plateau. The observations of SN 2012aw revealed all Swift UV and u-band light curves initially declined rapidly, but 27 days after the explosion the light curves flattened. Some possible sources of the UV plateau are the same thermal process that causes the optical plateau, heating from radioactive decay, or a combination of both processes.

  8. Structural analysis of color video camera installation on tank 241AW101 (2 Volumes)

    International Nuclear Information System (INIS)

    Strehlow, J.P.

    1994-01-01

    A video camera is planned to be installed on the radioactive storage tank 241AW101 at the DOE' s Hanford Site in Richland, Washington. The camera will occupy the 20 inch port of the Multiport Flange riser which is to be installed on riser 5B of the 241AW101 (3,5,10). The objective of the project reported herein was to perform a seismic analysis and evaluation of the structural components of the camera for a postulated Design Basis Earthquake (DBE) per the reference Structural Design Specification (SDS) document (6). The detail of supporting engineering calculations is documented in URS/Blume Calculation No. 66481-01-CA-03 (1)

  9. Bibliography of publications by Bogusław Sałata

    Directory of Open Access Journals (Sweden)

    Maria A. Chmiel

    2014-08-01

    Full Text Available Professor Bogusław Sałata, a known and respected Polish mycologist, has died in 1999. His life and achievements were described in the papers Chmiel and Mułenko (1999 and Mułenko and Chmiel (1999. The bibliography is a complete list of works published in 1964-2004. It contains 97 items. This number includes original papers, monographs, books, reviews, translations and articles for the general pulc. The papers are arranged chronologically.

  10. Criticality safety evaluation of disposing of K Basin sludge in double-shell tank AW-105

    International Nuclear Information System (INIS)

    ROGERS, C.A.

    1999-01-01

    A criticality safety evaluation is made of the disposal of K Basin sludge in double-shell tank (DST) AW-105 located in the 200 east area of Hanford Site. The technical basis is provided for limits and controls to be used in the development of a criticality prevention specification (CPS). A model of K Basin sludge is developed to account for fuel burnup. The iron/uranium mass ration required to ensure an acceptable magrin of subcriticality is determined

  11. Cloud Computing for Pharmacometrics: Using AWS, NONMEM, PsN, Grid Engine, and Sonic.

    Science.gov (United States)

    Sanduja, S; Jewell, P; Aron, E; Pharai, N

    2015-09-01

    Cloud computing allows pharmacometricians to access advanced hardware, network, and security resources available to expedite analysis and reporting. Cloud-based computing environments are available at a fraction of the time and effort when compared to traditional local datacenter-based solutions. This tutorial explains how to get started with building your own personal cloud computer cluster using Amazon Web Services (AWS), NONMEM, PsN, Grid Engine, and Sonic.

  12. Many particle approximation of the Aw-Rascle-Zhang second order model for vehicular traffic.

    Science.gov (United States)

    Francesco, Marco Di; Fagioli, Simone; Rosini, Massimiliano D

    2017-02-01

    We consider the follow-the-leader approximation of the Aw-Rascle-Zhang (ARZ) model for traffic flow in a multi population formulation. We prove rigorous convergence to weak solutions of the ARZ system in the many particle limit in presence of vacuum. The result is based on uniform BV estimates on the discrete particle velocity. We complement our result with numerical simulations of the particle method compared with some exact solutions to the Riemann problem of the ARZ system.

  13. Impact of automatization in temperature series in Spain and comparison with the POST-AWS dataset

    Science.gov (United States)

    Aguilar, Enric; López-Díaz, José Antonio; Prohom Duran, Marc; Gilabert, Alba; Luna Rico, Yolanda; Venema, Victor; Auchmann, Renate; Stepanek, Petr; Brandsma, Theo

    2016-04-01

    Climate data records are most of the times affected by inhomogeneities. Especially inhomogeneities introducing network-wide biases are sometimes related to changes happening almost simultaneously in an entire network. Relative homogenization is difficult in these cases, especially at the daily scale. A good example of this is the substitution of manual observations (MAN) by automatic weather stations (AWS). Parallel measurements (i.e. records taken at the same time with the old (MAN) and new (AWS) sensors can provide an idea of the bias introduced and help to evaluate the suitability of different correction approaches. We present here a quality controlled dataset compiled under the DAAMEC Project, comprising 46 stations across Spain and over 85,000 parallel measurements (AWS-MAN) of daily maximum and minimum temperature. We study the differences between both sensors and compare it with the available metadata to account for internal inhomogeneities. The differences between both systems vary much across stations, with patterns more related to their particular settings than to climatic/geographical reasons. The typical median biases (AWS-MAN) by station (comprised between the interquartile range) oscillate between -0.2°C and 0.4 in daily maximum temperature and between -0.4°C and 0.2°C in daily minimum temperature. These and other results are compared with a larger network, the Parallel Observations Scientific Team, a working group of the International Surface Temperatures Initiative (ISTI-POST) dataset, which comprises our stations, as well as others from different countries in America, Asia and Europe.

  14. Cultural Heritage Protection Issues In Leśnica, The Settlement Of Wrocław

    Science.gov (United States)

    Kononowicz, Alena

    2015-09-01

    Leśnica, today the settlement on the western edge of Wrocław, formerly was an independent town, located on a previously wooded area, with a linear street system. It developed in the Middle Ages around the castle and church playing a service role for the Silesian Piast court on their way to Legnica and during hunting. In the thirteenth century it received city rights, and lost them in the eighteenth century. After the Piast dynasty had died out, it was sold by John of Luxembourg, and repeatedly changed its owners. In the nineteenth century it developed thanks to the industry, tourism and a convenient railway connection to Wrocław as well as hotel and restaurant facilities. In 1928, Leśnica was incorporated into Wrocław. After the Second World War, it lost its cultural continuity. In the 1970's, middle-heigh and high prefabricated buildings were built in the vicinity of a residential district. At the end of the twentieth and early twenty-first century, local industries were liquidated, and intensive land development started, causing the systematic blurring of its small-town character and its urban space started to acquire a character of a big city. In 2004, the old part of Leśnica was entered in the Register of Monuments. Also a ring road was planned, moving the cumbersome and dangerous transit traffic away from historic Średzka Street beyond the southern border of the settlement.

  15. Cultural Heritage Protection Issues In Leśnica, The Settlement Of Wrocław

    Directory of Open Access Journals (Sweden)

    Kononowicz Alena

    2015-09-01

    Full Text Available Leśnica, today the settlement on the western edge of Wrocław, formerly was an independent town, located on a previously wooded area, with a linear street system. It developed in the Middle Ages around the castle and church playing a service role for the Silesian Piast court on their way to Legnica and during hunting. In the thirteenth century it received city rights, and lost them in the eighteenth century. After the Piast dynasty had died out, it was sold by John of Luxembourg, and repeatedly changed its owners. In the nineteenth century it developed thanks to the industry, tourism and a convenient railway connection to Wrocław as well as hotel and restaurant facilities. In 1928, Leśnica was incorporated into Wrocław. After the Second World War, it lost its cultural continuity. In the 1970's, middle-heigh and high prefabricated buildings were built in the vicinity of a residential district. At the end of the twentieth and early twenty-first century, local industries were liquidated, and intensive land development started, causing the systematic blurring of its small-town character and its urban space started to acquire a character of a big city. In 2004, the old part of Leśnica was entered in the Register of Monuments. Also a ring road was planned, moving the cumbersome and dangerous transit traffic away from historic Średzka Street beyond the southern border of the settlement.

  16. [Caries of permanent dentition in medieval inhabitants of Wrocław].

    Science.gov (United States)

    Staniowski, Tomasz; Dabrowski, Paweł; Gawlikowska-Sroka, Aleksandra

    2011-01-01

    The study of dentition plays an important role in the reconstruction of the diet and in assessment of the overall health and living conditions of paleopopulations. The aim of this study was to determine the condition of permanent dentition of medieval inhabitants of Wrocław basing on the prevalence and intensity of caries in permanent dentition. The material consisted of 1156 permanent teeth from 118 skulls recovered from two medieval cemeteries in Wrocław: the parish cemetery at the St. Elisabeth Church (13th-14th century) and the cemetery in Ołbin (12th-13th century). Two age classes were formed taking into account anthropologic assessment and group size. The younger class consisted of material up to the age of 35 years; the remaining skulls were assigned to the older class. The prevalence and incidence of caries was determined. The prevalence and intensity of caries was 56.91% and 15.7%, respectively. Carious lesions predominated in males and in the older age class. The prevalence and intensity of caries in permanent dentition did not differ from other medieval populations and increased with age. High prevalence of caries reflects a high proportion of carbohydrates in the diet of medieval inhabitants of Wrocław, their high socioeconomic status, and poor oral hygiene.

  17. Costs of Urbanisation in Poland, Based on the Example of Wrocław

    Science.gov (United States)

    Hełdak, Maria; Płuciennik, Monika

    2017-10-01

    The paper deals with the issue of charging communes with the costs of realisation of the provisions contained in local spatial development plans. When such local spatial development plan enters into force, it leads to economic consequences. In Poland, these consequences are specified in the forecast of the financial impact, which contains a prognosis of own revenues as well as of costs incurred by the budget of the commune. The research consisted in the analysis of the costs of urbanisation of land located in Wrocław, in the southern part of the Krzyki district (Poland). This area is undeveloped to a major extent, consisting mainly of agricultural land, and its development requires the construction of technological and social infrastructure facilities. The expected costs of the realisation of local spatial development plans that are binding for the southern part of Wrocław demonstrate significant costs of the construction of sewage network and municipal roads. The planned development of residential districts is not supported by the existing infrastructure. Additionally, the development of new areas will require the city of Wrocław to take over the real properties on which public goals are planned to be realised. The estimated costs of land acquisition for the realisation of public goals amount to EUR 3 728 500.

  18. 2-Local derivations on matrix algebras over semi-prime Banach algebras and on AW*-algebras

    International Nuclear Information System (INIS)

    Ayupov, Shavkat; Kudaybergenov, Karimbergen

    2016-01-01

    The paper is devoted to 2-local derivations on matrix algebras over unital semi-prime Banach algebras. For a unital semi-prime Banach algebra A with the inner derivation property we prove that any 2-local derivation on the algebra M 2 n (A), n ≥ 2, is a derivation. We apply this result to AW*-algebras and show that any 2-local derivation on an arbitrary AW*-algebra is a derivation. (paper)

  19. A comparison of the Glidescope, Pentax AWS, and Macintosh laryngoscopes when used by novice personnel: a manikin study.

    LENUS (Irish Health Repository)

    Malik, Muhammad A

    2009-11-01

    Direct laryngoscopic tracheal intubation is a potentially lifesaving procedure, but a difficult skill to acquire and maintain. The consequences of poorly performed intubation attempts are potentially severe. The Pentax AWS and the Glidescope are indirect laryngoscopes that may require less skill to use. We therefore hypothesized that AWS and Glidescope would prove superior to the Macintosh laryngoscope when used by novices in the normal and simulated difficult airway.

  20. Tank characterization report for double-shell tank 241-AW-105

    International Nuclear Information System (INIS)

    Sasaki, L.M.

    1997-01-01

    One of the major functions of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for double-shell tank 241-AW-105. The objectives of this report are to use characterization data in response to technical issues associated with tank 241-AW-105 waste; and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order milestone Characterization. information presented in this report originated from sample analyses and known historical sources. While only the results of a recent sampling event will be used to fulfill the requirements of the data quality objectives (DQOs), other information can be used to support or question conclusions derived from these results. Historical information for tank 241-AW-105 is provided in Appendix A, including surveillance information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a process knowledge model. The recent sampling event listed, as well as pertinent sample data obtained before 1996, are summarized in Appendix B along with the sampling results. The results of the 1996 grab sampling event satisfied the data requirements specified in the sampling and analysis plan (SAP) for this tank. In addition, the tank headspace flammability was measured, which addresses

  1. Stanisław Przybyszewski — mizogin czy poszukiwacz miłości idealnej?

    OpenAIRE

    Murzicz, Ewelina

    2011-01-01

    This article presents and analyses the motif of women in Stanisław Przybyszewski’s novels. The author focused on the woman’s nature and presented the way it influenced the man’s character and life. Przybyszewski’s work is an attempt at answering questions about the point of love and desire; it also includes problems connected with metaphysical side of love and impossibility to achieve any unity between the man and the woman. Publikacja dofinansowana przez Wydział Filologiczny U...

  2. The Awá-Guajá Indians of the Brazilian Amazon. Demographic data, serum protein markers and blood groups.

    Science.gov (United States)

    de Oliveira, S F; Lopes, D E; Santos, S E; Guerreiro, J F

    1998-01-01

    The South-American Indian group Awá-Guajá, currently living in the State of Maranhão (Northeastern Brazil), is one of the most recently contacted Indian groups of the Brazilian Amazon. This group is made up by three partially isolated villages named Awá, Guajá and Juriti, and is characterized by having a young population, in which 47.6% of the individuals range from 0 to 14 years old. The sex ratios (male/female) for people of reproductive age are 1.13 for Awá village, 2.00 for Guajá, 3.33 for Juriti and 1.61 for the tribe as a whole. Fst and heterogeneity analysis show that, despite the small differences observed among villages for the eight genetic systems analyzed, the Awá-Guajá tribe is constituted of only one population. Furthermore, comparisons between Awá-Guajá and Urubú-Kaapor tribes indicate that they are still isolated genetically, in spite of the fact that they share territories.

  3. Historical Allotment Gardens in Wrocław - The Need to Protection

    Directory of Open Access Journals (Sweden)

    Kononowicz Wanda

    2016-06-01

    Full Text Available Since about the mid-nineteenth century, together with the changing socio-economic situation, different types of allotments appeared in Wrocław. Initially, they were rented gardens, gardens for the poor or for factory workers. At the beginning of the twentieth century, school gardens and the so called Schreber gardens with a large common square were set up as part of Dr. Schreber’s educational health program. In 1914-1918, “war” vegetable gardens were commonly cultivated. In the 1920s allotment gardens began to be systematically introduced to the city plan as permanent, purposefully designed elements of urban greenery. They were often designed together with urban parks, or so called “Folk Parks” of a recreational and sport character. In the 1930s, during the economic crisis, allotments with garden houses were adapted for the unemployed and the homeless to live in. Wrocław allotment gardens have undeniable historical, social, recreational, economic and compositional value. These gardens are a cultural heritage that should be protected. In Western Europe we are witnessing a renaissance of the idea of allotments, while in Poland - a tendency to eliminate them from urban landscapes.

  4. Population expansion of some bird species in the city of Wrocław

    Directory of Open Access Journals (Sweden)

    Kopij Grzegorz

    2016-12-01

    Full Text Available During the years 2002-2010, distribution and numbers of eight bird species were studied in the whole city of Wrocław, SW Poland (293 km2. The estimation for these species are as follow: Streptopelia turtur: 3 breeding pairs, Upupa epops: 1, Cuculus canorus: 49, Emberiza hortulana: 7, Luscinia megarhynchos: 214-286, Phoenicurus phoenicurus: 87-118, Turdus pilaris: 105-150, Hippolais icterina: 136-181. In comparison with 1980‘s and 1990’s, a rapid increase in the numbers P. phoenicurus, and T. pilaris, and a slight increase of L. megarhynchos and Cuculus canorus were documented. T. pilaris began to breed in the city in the end of 1990‘s. The increase may indicate that the habitats in Wrocław improved both in regard to food availability, nesting sites and other environmental requisitions. The increase in the numbers recorded for C. canorus, P. phoe-nicurus, and L. megarhynchos may also be a result of good conditions prevailing in their wintering grounds in sub-Saharan Africa.

  5. Ultrasonic Examination of Double-Shell Tank 214-AW-102 Knuckle Region. Examination completed February 2003

    International Nuclear Information System (INIS)

    Pardini, Allan F.; Posakony, Gerald J.

    2003-01-01

    COGEMA Engineering Corporation (COGEMA), under a contract from CH2M Hill Hanford Group (CH2M Hill), has performed an ultrasonic examination of the knuckle region of Double-Shell Tank 241-AW-102 utilizing the Remotely Operated Nondestructive Examination (RONDE) system. The purpose of this examination was to provide information that could be used to evaluate the integrity of the knuckle region of the primary tank. The requirements for the ultrasonic examination of Tank 241-AW-102 were to detect, characterize (identify, size, and locate), and record measurements made of any circumferentially oriented cracks that might be present in the knuckle area of the primary tank. Any measurements that exceed the requirements set forth in the Engineering Task Plan (ETP), RPP-7869, are reported to CH2M Hill and the Pacific Northwest National Laboratory (PNNL) for further evaluation. Under the contract with CH2M Hill, all data is to be recorded on disk and paper copies of all measurements are provided t o PNNL for third-party evaluation. PNNL is responsible for preparing a report(s) that describes the results of the COGEMA ultrasonic examinations

  6. Historical Allotment Gardens in Wrocław - The Need to Protection

    Science.gov (United States)

    Kononowicz, Wanda; Gryniewicz-Balińska, Katarzyna

    2016-06-01

    Since about the mid-nineteenth century, together with the changing socio-economic situation, different types of allotments appeared in Wrocław. Initially, they were rented gardens, gardens for the poor or for factory workers. At the beginning of the twentieth century, school gardens and the so called Schreber gardens with a large common square were set up as part of Dr. Schreber's educational health program. In 1914-1918, "war" vegetable gardens were commonly cultivated. In the 1920s allotment gardens began to be systematically introduced to the city plan as permanent, purposefully designed elements of urban greenery. They were often designed together with urban parks, or so called "Folk Parks" of a recreational and sport character. In the 1930s, during the economic crisis, allotments with garden houses were adapted for the unemployed and the homeless to live in. Wrocław allotment gardens have undeniable historical, social, recreational, economic and compositional value. These gardens are a cultural heritage that should be protected. In Western Europe we are witnessing a renaissance of the idea of allotments, while in Poland - a tendency to eliminate them from urban landscapes.

  7. The effect of alternative work schedules (AWS) on performance during acquisition based testing at the U.S. Army Aberdeen Test Center

    OpenAIRE

    Thomas, Alicia J.

    2014-01-01

    Approved for public release; distribution is unlimited This project analyzed the effects of an alternate work schedule (AWS) on the performance of acquisition based testing conducted at the U.S. Army Aberdeen Test Center (ATC), a subordinate test center to the U.S. Army Test and Evaluation Command. The literature review uncovered how an AWS improved employee work and life balance and performance at three separate external companies. Other potential AWS success factors such as employee abse...

  8. Effect of the welding parameters on all-weld-metal deposited from AWS E10018-M, E11018-M

    International Nuclear Information System (INIS)

    Surian, E.

    1996-01-01

    Using each one of the electrodes types AWS A5.5-81-M, from standard batches, three-all-weld metal test pieces were prepared (cold, warm and hot) according to the AWS A5.5-81 standard. In order to have three different values for the heat input, the welding parameters were varied, but always having in mind the mentioned standard requirements. The test pieces were used to determine the mechanical properties and to carry out metallographic studies. the results obtained showed that the alloy deposited by the E10018-M electrode is less sensible to heat input variations than that from both E11018-M and E12018-M electrodes. Therefore, to work with these last mentioned electrodes it is necessary to have a strict control and very exact instructions, even more exacting than those established in the AWS a5.5.-81 standard. 9 refs

  9. Cultura da celebridade, fãs e a nova mídia: um estudo sobre a promoção da imagem e trabalho de Justin Bieber

    OpenAIRE

    Camyla da Silva Oliveira; Renata Prado Alves Silva

    2016-01-01

    Este artigo se propõe a analisar as dinâmicas de comunicação entre Justin Bieber e seus seguidores na web, buscando compreender as formas de promoção da imagem e trabalhos do artista nas novas mídias. Nos métodos de pesquisa se destacam a netnografia das redes de fãs e análise de conteúdo para as mensagens dos canais de comunicação oficiais, além das trocas de informação entre membros do fandom. Os resultados apontam para as novas mídias como plataforma dinâmica para divulgação de informações...

  10. Guided Multiple Launch Rocket System/Guided Multiple Launch Rocket System Alternative Warhead (GMLRS/GMLRS AW)

    Science.gov (United States)

    2015-12-01

    Physical Configuration Audit for the GMLRS AW was completed at the system level in March 2015. ​Director of Operational Test and Evaluation Assessment...Confidence Level Confidence Level of cost estimate for current APB: 50% The confidence level used in establishing the cost estimate for GMLRS/GMLRS AW...PAUC Development Estimate Changes PAUC Production Estimate Econ Qty Sch Eng Est Oth Spt Total 0.039 -0.003 0.001 0.001 0.009 0.037 0.000 0.000 0.045

  11. On Self, essayismus, Charles Lamb and Stanisław Brzozowski

    Directory of Open Access Journals (Sweden)

    Roma Sendyka

    2009-01-01

    Full Text Available By introducing the theory of the self to modern disputes on identity and subjectivity in the literary text, the article retells contemporary discussions on theory of the self from the Chicago school of symbolic interactionism (G.H. Mead through its development in social psychology (E. Goffman to postmodern compelling ideas of A. Giddens, M. Foucault, J. Glass, K. Gergen, J. Baudrillard and Z. Bauman. This retelling is generated by the question whether the social sciences’ analysis of a subject can be useful in literary studies, traditionally relying on philosophical debates about the identity of a person. The main area of observation becomes modern Polish essay, with the specific example of Stanisław Brzozowski’s last completed essay, the one on Charles Lamb. The text proposes an idea of recursive subjectivity based on the structures of the self – social, interactive, and reflexive.

  12. An interpretation of the observations performed on rasplav AW200-1 corium

    International Nuclear Information System (INIS)

    Froment, K.; Seiler, J.M.; CEA Centre d'Etudes de Grenoble, 38

    1997-01-01

    The RASPLAV test AW-200-1, performed in the Kurchatov Institute in 1996, showed unexpected results: elevated measured temperatures and stratification of the C-22 corium. Thermalhydraulic and thermodynamic calculations allowed us to give some explanation of the phenomenon which took place in the device: due to the large range between the solidus and the liquidus temperature of the initial mixture, and due to the density difference between the liquid and the solid phase in this temperature domain separation of these two phases had happened during the melting of the mixture (we have no explanation why this separation occurred). GEMINI2 calculations of the solidification paths are consistent with metallographic analyses which were carried out in these two separated layers after solidification. (author)

  13. How does a Poem Think? Czesław Miłosz Nad strumieniem

    Directory of Open Access Journals (Sweden)

    Joanna Zach

    2014-01-01

    Full Text Available The subject of the analysis is the poem by Czesław Miłosz from the volume To, entitled “Nad strumieniem”. The task the author embarked upon boils down to the answer to the question: how does a specific idea(its hidden mental message develop in this poem and what results from it for the idea as well as for the poem. The proposed reading takes place at three levels. Preliminary reconnaissance is made by naive reading consisting in the reconstruction of the situation portrayed in the poem, in the recreation of that which can be fund, so to say, on the “surface” of the poem. Next, the author launches these contexts which in Miłosz’s representation of the attitude of man towards nature allow one to notice balance and harmony, coming to terms with life and wisdom, which is based on distance and silence. At the third reading level, the author refers to the image crowning opus magnum by Charles Darwin, in which a similar situation—contemplation in the open nature—leads to the formulation of the answer to the question about the sense of “fight in nature, famine and death”. This answer is juxtaposed with the ending of Czesław Miłosz’s poem: „Wydaje mi się, że słyszę głos demiurga:/ Albo nieme skały jak w pierwszym dniu stworzenia,/ albo życie, którego warunkiem jest śmierć,/ i to upajające ciebie piękno”. („It seems to me that I hear the voice of demiurge:/ Either silent rocks as on the first day of creation, / or life, whose condition is death,/ and this beauty engulfing you”.

  14. Comparison of Pentax-AWS Airwayscope and Glidescope for Infant Tracheal Intubation by Anesthesiologists during Cardiopulmonary Arrest Simulation: A Randomized Crossover Trial

    Directory of Open Access Journals (Sweden)

    Shunsuke Fujiwara

    2015-01-01

    Full Text Available Background. Recent guidelines for infant cardiopulmonary resuscitation emphasize that all rescuers should minimize interruption of chest compressions, even for endotracheal intubation. We compared the utility of the Pentax-AWS Airwayscope (AWS with the Glidescope (GS during chest compressions on an infant manikin. Methods. Twenty-four anesthesiologists with more than two years of experience performed tracheal intubation on an infant manikin using the AWS and GS, with or without chest compressions. Results. In GS trials, none of the participants failed without compressions, while three failed with compressions. In AWS trials, all participants succeeded regardless of chest compressions. Intubation time was significantly longer with chest compressions with the GS (P<0.05, but not with the AWS. Difficulty of operation on a visual analog scale (VAS for laryngoscopy did not increase significantly with chest compressions with either the GS or the AWS, while the VAS for tube passage through the glottis increased with compressions with the GS, but not with the AWS. Conclusion. We conclude that in infant simulations managed by anesthesiologists, the AWS performed better than the GS for endotracheal intubation with chest compressions.

  15. Genomic and secondary metabolite analyses of Streptomyces sp. 2AW provide insight into the evolution of the cycloheximide pathway

    Directory of Open Access Journals (Sweden)

    Elizabeth eStulberg

    2016-05-01

    Full Text Available The dearth of new antibiotics in the face of widespread antimicrobial resistance makes developing innovative strategies for discovering new antibiotics critical for the future management of infectious disease. Understanding the genetics and evolution of antibiotic producers will help guide the discovery and bioengineering of novel antibiotics. We discovered an isolate in Alaskan boreal forest soil that had broad antimicrobial activity. We elucidated the corresponding antimicrobial natural products and sequenced the genome of this isolate, designated Streptomyces sp. 2AW. This strain illustrates the chemical virtuosity typical of the Streptomyces genus, producing cycloheximide as well as two other biosynthetically unrelated antibiotics, neutramycin and hygromycin A. Combining bioinformatic and chemical analyses, we identified the gene clusters responsible for antibiotic production. Interestingly, 2AW appears dissimilar from other cycloheximide producers in that the gene encoding the polyketide synthase resides on a separate part of the chromosome from the genes responsible for tailoring cycloheximide-specific modifications. This gene arrangement and our phylogenetic analyses of the gene products suggest that 2AW holds an evolutionarily ancestral lineage of the cycloheximide pathway. Our analyses support the hypothesis that the 2AW glutaramide gene cluster is basal to the lineage wherein cycloheximide production diverged from other glutarimide antibiotics. This study illustrates the power of combining modern biochemical and genomic analyses to gain insight into the evolution of antibiotic-producing microorganisms.

  16. The Relationship between Zhedanov's Algebra AW(3) and the Double Affine Hecke Algebra in the Rank One Case

    NARCIS (Netherlands)

    Koornwinder, T.H.

    2007-01-01

    Vadim Kuznetsov Memorial Issue on Integrable Systems and Related Topics Abstract Zhedanov's algebra AW(3) is considered with explicit structure constants such that, in the basic representation, the first generator becomes the second order q-difference operator for the Askey-Wilson polynomials. It is

  17. Final Report for the Erosion-Corrosion Anaysis of Tank 241-AW-02E Feed Pump Pit Jumpers B-2 and 1-4 Removed from Service in 2013

    Energy Technology Data Exchange (ETDEWEB)

    Page, Jason S.

    2014-04-07

    This document is the final report summarizing the results in the examination of two pipe sections (jumpers) from the tank 241-AW-02E feed pump pit in the 241-AW tank farm. These pipe section samples consisted of jumper AW02E-WT-J-[B – 2] and jumper AW02E-WT-J-[1 – 4]. For the remainder of this report, these jumpers will be referred to as B – 2 and 1 – 4.

  18. Wrocław – Cultural Semantics of the Contemporary Urban Embedding

    Directory of Open Access Journals (Sweden)

    Marcin R. Odelski

    2009-11-01

    Full Text Available The transformation of Europe – and, particularly, one of its narrow scopes – a socio-urban transformation has undergone an enormous shift, the illustration of which can be found in separate and collective alternating narratives. Those alternating narratives understood as experience based opinions embedded in individual observations contribute to a better understanding of a given urban setting. Wrocław, one may state, is a very individual city or, rather one should say, a city that is perfect for individuals. This work aims at exploring the concept of Wroclaw from various possible (but still selected angles within the meaning of Europe. Not only linguistics and semantics will be the axes of reference in this particular case but also bordering sciences such as: anthropology or sociology. Moreover, people in contemporary Wroclaw learn to identify not only themselves but also the space. The light is shed on selected meanings being constructed by people from the inside, as well as, from the outside; therefore one should also adhere to its citizens and visitors because empty space loses its meaning to a large extent. Recent twenty years (1989-2009, most probably, will be described as a period of constant rapid changes. This particular period in wroclawians’ mentality was (and still is full of actions taking the "re” prefix to denote and stress far-reaching initiatives, initiatives that go far beyond the imagination of fossilized mind so common in the bygone political epoch.

  19. Effect of Shielding Gas on the Properties of AW 5083 Aluminum Alloy Laser Weld Joints

    Science.gov (United States)

    Vyskoč, Maroš; Sahul, Miroslav; Sahul, Martin

    2018-04-01

    The paper deals with the evaluation of the shielding gas influence on the properties of AW 5083 aluminum alloy weld joints produced with disk laser. Butt weld joints were produced under different shielding gas types, namely Ar, He, Ar + 5 vol.% He, Ar + 30 vol.% He and without shielding weld pool. Light and electron microscopy, computed tomography, microhardness measurements and tensile testing were used for evaluation of weld joint properties. He-shielded weld joints were the narrowest ones. On the other hand, Ar-shielded weld joints exhibited largest weld width. The choice of shielding gas had significant influence on the porosity level of welds. The lowest porosity was observed in weld joint produced in Ar with the addition of 5 vol.% He shielding atmosphere (only 0.03%), while the highest level of porosity was detected in weld joint produced in pure He (0.24%). Except unshielded aluminum alloy weld joint, the lowest tensile strength was recorded in He-shielded weld joints. On the contrary, the highest average microhardness was measured in He-shielded weld joints.

  20. Czesław Miłosz’s Migrant Perspective in Rodzinna Europa [Native Realm

    Directory of Open Access Journals (Sweden)

    Kołodziejczyk Ewa

    2017-11-01

    Full Text Available The article traces the impact of Czesław Miłosz’s first American stay on his image of Central Europe in Rodzinna Europa [Native Realm]. In the United States, the post-war immigrant from Vilnius learned to perceive, understand and evaluate American culture; he also gained a new perspective on his region of Europe and Slavic immigrants. This experience enabled him to adopt an American point of view in his autobiographical essay. Following William Faulkner, Miłosz carries on an analysis of Eastern and Central Europe’s history and identities. The uses Western historical and sociological glossary to describe processes that formed his “native realm.” Analogically, the poet from pre-war Vilnius reflects on American multi-ethnicity and religious diversity from a Central European perspective. In Rodzinna Europa, Miłosz takes the position of a migrant translator and a two-way mediator between East and West.

  1. From eugenics to lysenkoism: the evolution of Stanisław Skowron.

    Science.gov (United States)

    Dejong-Lambert, William

    2009-01-01

    This article describes the relationship between Polish geneticist Stanisław Skowron's views on eugenics during the interwar period, his experiences in Nazi concentration camps during World War II, and his response to Trofim D. Lysenko's ban on genetic research in Soviet-allied states after 1948. Skowron was educated at the Jagiellonian University in Krakow and received funding from the Rockefeller Foundation to study in the United States, Italy, Denmark, and Great Britain from 1924 to 1926. His exposure to research being conducted outside of Poland made him an important figure in Polish genetics. During this time Skowron also began to believe that an understanding of biological principles of heredity could play an important role in improving Polish society and became a supporter of eugenics. In 1939 he was arrested along with other faculty members at the Jagiellonian and sent to Sachsenhausen and Dachau. In 1947 he published the first book updating Polish biologists on recent developments in genetics; however, after learning of the outcome of the 1948 session of the Lenin All-Union Academy of Agricultural Sciences in Moscow, Skowron emerged as on of the most vocal advocates for Michurinism. I argue that Skowron's conversion to Lysenkoism was motivated by more than fear or opportunism, and is better understood as the product of his need to rationalize his own support for a theory he could not possibly have believed was correct.

  2. Tank 214-AW-105, grab samples, analytical results for the final report

    International Nuclear Information System (INIS)

    Esch, R.A.

    1997-01-01

    This document is the final report for tank 241-AW-105 grab samples. Twenty grabs samples were collected from risers 10A and 15A on August 20 and 21, 1996, of which eight were designated for the K Basin sludge compatibility and mixing studies. This document presents the analytical results for the remaining twelve samples. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DO). The results for the previous sampling of this tank were reported in WHC-SD-WM-DP-149, Rev. 0, 60-Day Waste Compatibility Safety Issue and Final Results for Tank 241-A W-105, Grab Samples 5A W-95-1, 5A W-95-2 and 5A W-95-3. Three supernate samples exceeded the TOC notification limit (30,000 microg C/g dry weight). Appropriate notifications were made. No immediate notifications were required for any other analyte. The TSAP requested analyses for polychlorinated biphenyls (PCB) for all liquids and centrifuged solid subsamples. The PCB analysis of the liquid samples has been delayed and will be presented in a revision to this document

  3. The Balkans and the Polish cause. Radosław Kobierski’s “Mitrovica”

    Directory of Open Access Journals (Sweden)

    Dariusz Pawelec

    2012-01-01

    Full Text Available The aim of the interpretation of the poem Mitrovica written by Radosław Kobierski is a quest for the ”peculiarity” and “singularity” of the literature” as it is viewed by Derek Attridge. The way the eponymous word sounds leads to a formulation of the question on what “semantic relations” are established between the title word and the remaining text. The journalistic character of the poem relates to the geography of the Balkan War of the 1990s. But the singularity and uniqueness of the poem Mitrovica stems rather from the tension that arises from its journalistic-style narration, reporting citation and a specific place name and what is metaphorical and symbolic. The Kobierski’s poem, creating its own, unique “singularity” comes also to grips with the media discourse related to the post-Yugoslav crisis. The interpretation shows how important is the application of the rule of myth-making poetical reversal in stripping the poetical discourse of stereotypes and cliches, but not of the relevance to reality.

  4. [Is Władysław Ołtuszewski a creator of modern phoniatrics in Poland?].

    Science.gov (United States)

    Kierzek, A

    1995-01-01

    In 1880 Władysław Ołtuszewski founded the faulty articulation infirmary, which was functioning until 1892. He was also working (1884-1892) at the department of Dr Heryng, one of the pioneers of Polish laryngology. He was involved in a welfare work in Warsaw Charity Society. He supported his interest in physiopathology of speech with studies in foreign centres in Germany and France. In 1892 he founded the "Warsaw Therapeutic Institution for persons stricken with speech deviations". It was the first phoniatric infirmary. He was delivering lectures, talks and he published tens papers in field of speech physiopathology. He was indicating the connection of dysphasia with psychiatric disorders. The author has presented in his article the main assumptions of the most valuable book by Ołtuszewski: Study of the science on speech and its deviations, and speech hygiene, published in 1905, pointing out that compared with the books by foreign authors the contents of this one was much ampler and more modern. He has also presented the comprehensive picture of Ołtuszewski's scientific output and wide non-scientific interests.

  5. Czesław Miłosz In The Search for Another Historicity

    Directory of Open Access Journals (Sweden)

    Jens Herlth

    2012-01-01

    Full Text Available The article presents an analysis of the concept of “historicity”, which seems to be crucial for the understanding of the philosophical foundations of Miłosz’s work. The poet’s intention is to find a solution for the double dilemma of modern historical imagination: on the one hand, you should not become prey to the “murderous historicité”, but on the other, human life, when totally deprived of the historical dimension, seems to be empty and worthless. Miłosz found a solution of the dilemma in Stanisław Brzozowski’s philosophy, especially in his idea of of indispensability of historical consciousness, that is of “amplification” of historicity. The paradoxical, at first sight, attempt to overcome the disastrous consequences of historical thought through amplification of historicity itself, is seen in a wider contest of 20th-century philsophical investigations (Michaił Bachtin, Martin Heidegger, Barbara Skarga. It turns out that poetic discourse is the right place for its realization.

  6. Tenderness, pH and Water Activity (Aw of Spices Dried Meat on Various Concentrate of Ginger Extract (Zingiber Officinale Roscoe and Different Soaking Time

    Directory of Open Access Journals (Sweden)

    Akhadiyah Afrila

    2012-09-01

    Full Text Available The objectives of current research were to find out the concentrate of Ginger extract (Zingiber officinale Roscoe and different soaking time of to tenderness, pH, and water activity (Aw, microbial count and sensory evaluation of spices dried meat. The result showed that higher the ginger extract (Zingiber officinale Roscoe concentrate and longer the soaking time, it would give more tenderness, pH, and water activity (Aw to spices dried meat with 15% ginger extract (Zingiber officinale Roscoe extract and 20 minutes length of soaking time. Key Words : Dendeng, ginger, soaking time, tenderness, pH and Aw

  7. Sampling and Analysis for Tank 241-AW-104 Waste in Support of Evaporator Campaign 2001-1

    International Nuclear Information System (INIS)

    MCKINNEY, S.G.

    2000-01-01

    This Tank Sampling and Analysis Plan (TSAP) identifies sample collection, laboratory analysis, quality assurance/quality control (QA/QC), and reporting objectives for the characterization of tank 241-AW-104 waste. Technical bases for these objectives are specified in the 242-A Evaporator Data Quality Objectives (Bowman 2000a and Von Bargen 1998), 242-A Evaporator Quality Assurance Project Plan (Bowman 1998 and Bowman 2000b), Tank 241-AW-104 Sampling Requirements in Support of Evaporator Campaign 2000-1 (Le 2000). Characterization results will be used to support the evaporator campaign currently planned for early fiscal year 2001. No other needs (or issues) requiring data for this tank waste apply to this sampling event

  8. Cultura da celebridade, fãs e a nova mídia: um estudo sobre a promoção da imagem e trabalho de Justin Bieber

    Directory of Open Access Journals (Sweden)

    Camyla da Silva Oliveira

    2016-09-01

    Full Text Available Este artigo se propõe a analisar as dinâmicas de comunicação entre Justin Bieber e seus seguidores na web, buscando compreender as formas de promoção da imagem e trabalhos do artista nas novas mídias. Nos métodos de pesquisa se destacam a netnografia das redes de fãs e análise de conteúdo para as mensagens dos canais de comunicação oficiais, além das trocas de informação entre membros do fandom. Os resultados apontam para as novas mídias como plataforma dinâmica para divulgação de informações não apenas através de canais oficiais da celebridade, mas especialmente por meio do compartilhamento e apropriação de conteúdos de fãs para fãs, que utilizam a web para criação, publicação e disseminação de mensagens, alimentando a expectativa de se comunicarem diretamente com seu ídolo.

  9. Shot peening as a pre-treatment to anodic oxidation coating process of AW 6082 aluminum for fatigue life improvement

    Czech Academy of Sciences Publication Activity Database

    Hadzima, B.; Nový, F.; Trško, L.; Pastorek, F.; Jambor, M.; Fintová, Stanislava

    2017-01-01

    Roč. 93, 9-12 (2017), s. 3315-3323 ISSN 0268-3768 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 Keywords : Fatigue life * AW 6082 aluminum alloy * Anodizing * Shot peening * Ultrasonic fatigue testing Subject RIV: JL - Materials Fatigue, Friction Mechanics OBOR OECD: Audio engineering, reliability analysis Impact factor: 2.209, year: 2016 https://link.springer.com/content/pdf/10.1007%2Fs00170-017-0776-1.pdf

  10. Studies of the AA2519 Alloy Hot Rolling Process and Cladding with EN AW-1050A Alloy

    Directory of Open Access Journals (Sweden)

    Płonka B.

    2016-03-01

    Full Text Available The objective of the study was to determine the feasibility of plastic forming by hot rolling of the AA2519 aluminium alloy sheets and cladding these sheets with a layer of the EN AW-1050A alloy. Numerous hot-rolling tests were carried out on the slab ingots to define the parameters of the AA2519 alloy rolling process. It has been established that rolling of the AA2519 alloy should be carried out in the temperature range of 400-440°C. Depending on the required final thickness of the sheet metal, appropriate thickness of the EN AW-1050A alloy sheet, used as a cladding layer, was selected. As a next step, structure and mechanical properties of the resulting AA2519 alloy sheets clad with EN AW-1050A alloy was examined. The thickness of the coating layer was established at 0,3÷0,5mm. Studies covered alloy grain size and the core alloy-cladding material bond strength.

  11. The type IIP supernova 2012aw in M95: Hydrodynamical modeling of the photospheric phase from accurate spectrophotometric monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Dall' Ora, M.; Botticella, M. T.; Della Valle, M. [INAF, Osservatorio Astronomico di Capodimonte, Napoli (Italy); Pumo, M. L.; Zampieri, L.; Tomasella, L.; Cappellaro, E.; Benetti, S. [INAF, Osservatorio Astronomico di Padova, I-35122 Padova (Italy); Pignata, G.; Bufano, F. [Departamento de Ciencias Fisicas, Universidad Andres Bello, Avda. Republica 252, Santiago (Chile); Bayless, A. J. [Southwest Research Institute, Department of Space Science, 6220 Culebra Road, San Antonio, TX 78238 (United States); Pritchard, T. A. [Department of Astronomy and Astrophysics, Penn State University, 525 Davey Lab, University Park, PA 16802 (United States); Taubenberger, S.; Benitez, S. [Max-Planck-Institut für Astrophysik, Karl-Schwarzschild-Str. 1, D-85741 Garching (Germany); Kotak, R.; Inserra, C.; Fraser, M. [Astrophysics Research Centre, School of Mathematics and Physics, Queen' s University Belfast, Belfast, BT7 1NN (United Kingdom); Elias-Rosa, N. [Institut de Ciències de l' Espai (CSIC-IEEC) Campus UAB, Torre C5, Za plata, E-08193 Bellaterra, Barcelona (Spain); Haislip, J. B. [Department of Physics and Astronomy, University of North Carolina at Chapel Hill, 120 E. Cameron Ave., Chapel Hill, NC 27599 (United States); Harutyunyan, A. [Fundación Galileo Galilei - Telescopio Nazionale Galileo, Rambla José Ana Fernández Pérez 7, E-38712 Breña Baja, TF - Spain (Spain); and others

    2014-06-01

    We present an extensive optical and near-infrared photometric and spectroscopic campaign of the Type IIP supernova SN 2012aw. The data set densely covers the evolution of SN 2012aw shortly after the explosion through the end of the photospheric phase, with two additional photometric observations collected during the nebular phase, to fit the radioactive tail and estimate the {sup 56}Ni mass. Also included in our analysis is the previously published Swift UV data, therefore providing a complete view of the ultraviolet-optical-infrared evolution of the photospheric phase. On the basis of our data set, we estimate all the relevant physical parameters of SN 2012aw with our radiation-hydrodynamics code: envelope mass M {sub env} ∼ 20 M {sub ☉}, progenitor radius R ∼ 3 × 10{sup 13} cm (∼430 R {sub ☉}), explosion energy E ∼ 1.5 foe, and initial {sup 56}Ni mass ∼0.06 M {sub ☉}. These mass and radius values are reasonably well supported by independent evolutionary models of the progenitor, and may suggest a progenitor mass higher than the observational limit of 16.5 ± 1.5 M {sub ☉} of the Type IIP events.

  12. Influence of Process Parameters on the Quality of Aluminium Alloy EN AW 7075 Using Selective Laser Melting (SLM)

    Science.gov (United States)

    Kaufmann, N.; Imran, M.; Wischeropp, T. M.; Emmelmann, C.; Siddique, S.; Walther, F.

    Selective laser melting (SLM) is an additive manufacturing process, forming the desired geometry by selective layer fusion of powder material. Unlike conventional manufacturing processes, highly complex parts can be manufactured with high accuracy and little post processing. Currently, different steel, aluminium, titanium and nickel-based alloys have been successfully processed; however, high strength aluminium alloy EN AW 7075 has not been processed with satisfying quality. The main focus of the investigation is to develop the SLM process for the wide used aluminium alloy EN AW 7075. Before process development, the gas-atomized powder material was characterized in terms of statistical distribution: size and shape. A wide range of process parameters were selected to optimize the process in terms of optimum volume density. The investigations resulted in a relative density of over 99%. However, all laser-melted parts exhibit hot cracks which typically appear in aluminium alloy EN AW 7075 during the welding process. Furthermore the influence of processing parameters on the chemical composition of the selected alloy was determined.

  13. Automatic Weather Station (AWS Program operated by the University of Wisconsin-Madison during the 2012-2013 field season: Challenges and Successes

    Directory of Open Access Journals (Sweden)

    Matthew A. Lazzara

    2015-03-01

    Full Text Available This report reviews 2012-2013 field season activities of the University of Wisconsin-Madison's Antarctic Automatic Weather Station (AWS program, summarizes the science that these sites are supporting, and outlines the factors that impact the number of AWS sites serviced in any given field season. The 2012-2013 austral summer season was unusual in the AWS network history. Challenges encountered include, but are not limited to, warmer than normal conditions in the Ross Island area impacting airfield operations, changes to logistical procedures, and competition for shared resources. A flexible work plan provides the best means for taking on these challenges while maximizing AWS servicing efforts under restricted conditions and meeting the need for routine servicing that maintaining an autonomous observing network demands.

  14. RED AND DEAD: THE PROGENITOR OF SN 2012aw IN M95

    International Nuclear Information System (INIS)

    Fraser, M.; Maund, J. R.; Smartt, S. J.; Inserra, C.; Kotak, R.; Reilly, E.; Botticella, M.-T.; Dall'Ora, M.; Tomasella, L.; Benetti, S.; Ciroi, S.; Ochner, P.; Pastorello, A.; Valenti, S.; Eldridge, J. J.; Ergon, M.; Sollerman, J.; Taddia, F.; Mattila, S.; Stephens, A.

    2012-01-01

    Core-collapse supernovae (SNe) are the spectacular finale to massive stellar evolution. In this Letter, we identify a progenitor for the nearby core-collapse SN 2012aw in both ground-based near-infrared and space-based optical pre-explosion imaging. The SN itself appears to be a normal Type II Plateau event, reaching a bolometric luminosity of 10 42 erg s –1 and photospheric velocities of ∼11,000 km s –1 from the position of the Hβ P-Cygni minimum in the early SN spectra. We use an adaptive optics image to show that the SN is coincident to within 27 mas with a faint, red source in pre-explosion HST+WFPC2, VLT+ISAAC, and NTT+SOFI images. The source has magnitudes F555W = 26.70 ± 0.06, F814W = 23.39 ± 0.02, J = 21.1 ± 0.2, K = 19.1 ± 0.4, which, when compared to a grid of stellar models, best matches a red supergiant. Interestingly, the spectral energy distribution of the progenitor also implies an extinction of A V > 1.2 mag, whereas the SN itself does not appear to be significantly extinguished. We interpret this as evidence for the destruction of dust in the SN explosion. The progenitor candidate has a luminosity between 5.0 and 5.6 log L/L ☉ , corresponding to a zero-age main-sequence mass between 14 and 26 M ☉ (depending on A V ), which would make this one of the most massive progenitors found for a core-collapse SN to date.

  15. Heritage of Stanisław Ostrowski - the only one medical doctor who became state Polish President - Patriae Semper Fidelis.

    Science.gov (United States)

    Woltanowska, Martyna; Woltanowski, Piotr; Wincewicz, Andrzej; Woltanowska, Magdalena

    2018-01-01

    Our purpose was to write a biography of Stanisław Ostrowski that would address in the first place the medical aspect of his professional life, with a comprehensive approach of others fields of his activity. We essentially grounded the paper on primary resources that were papers authored by Ostrowski including his scientific publications, memories, speeches as well as contemporaneous official documents that referred to Ostrowski. Second resources were also used to double check some data from primary resources and to place the biography of Stanisław Ostrowski in a proper background with special care to social, professional and political context. In this study, second resources comprised papers, that were prepared after the death of Stanisław Ostrowski. Stanisław Ostrowski, MD was a meticulous military medical doctor with an academic engagement at the King John Casimir University of Lvov. In addition, he was an excellent organizer, who soon got involved in politics to serve the local community with essential projects in public health particularly anti-tuberculosis campaigns in Lvov district. His quiet and proficient nature made him an ideal statesman with incredible skills to reconcile social, national and political enemies. Ostrowski was elected a member of parliament three times. He also held the position of President of the city of Lvov until World War Two. During the war, he was imprisoned and deported to Siberia, Soviet Union, in years 1939-1941. Subsequently he fought against Nazi Germans in the Polish II Corps. Ostrowski survived the war providing medical service in the various military units. Afterwards, he ran his medical practice in the UK. Stanisław Ostrowski was the only dermatologist who became a state president. He held an office of state president of the Polish Republic on exile in London. His life is not a simple story, but a great lesson that provides clear guidelines how to find a stable ground for lifetime being a medical doctor in the

  16. Ability of paramedics to perform endotracheal intubation during continuous chest compressions: a randomized cadaver study comparing Pentax AWS and Macintosh laryngoscopes.

    Science.gov (United States)

    Truszewski, Zenon; Czyzewski, Lukasz; Smereka, Jacek; Krajewski, Paweł; Fudalej, Marcin; Madziala, Marcin; Szarpak, Lukasz

    2016-09-01

    The aim of the trial was to compare the time parameters for intubation with the use of the Macintosh (MAC) laryngoscope and Pentax AWS-S100 videolaryngoscope (AWS; Pentax Corporation, Tokyo, Japan) with and without chest compression (CC) by paramedics during simulated cardiopulmonary resuscitation in a cadaver model. This was a randomized crossover cadaver trial. Thirty-five paramedics with no experience in videolaryngoscopy participated in the study. They performed intubation in two emergency scenarios: scenario A, normal airway without CC; scenario B, normal airway with continuous CC. The median time to first ventilation with the use of the AWS and the MAC was similar in scenario A: 25 (IQR, 22-27) seconds vs. 24 (IQR, 22.5-26) seconds (P=.072). A statistically significant difference in TTFV between AWS and MAC was noticed in scenario B (P=.011). In scenario A, the first endotracheal intubation (ETI) attempt success rate was achieved in 97.1% with AWS compared with 94.3% with MAC (P=.43). In scenario B, the success rate after the first ETI attempt with the use of the different intubation methods varied and amounted to 88.6% vs. 77.1% for AWS and MAC, respectively (P=.002). The Pentax AWS offered a superior glottic view as compared with the MAC laryngoscope, which was associated with a higher intubation rate and a shorter intubation time during an uninterrupted CC scenario. However, in the scenario without CC, the results for AWS and MAC were comparable. Copyright © 2016 Elsevier Inc. All rights reserved.

  17. Correlates of Abusing and Misusing Over-the-Counter Pain Relievers Among Adult Population of Wrocław (Poland).

    Science.gov (United States)

    Wójta-Kempa, Monika; Krzyżanowski, Dominik M

    2016-01-01

    Almost 90% of households in Poland buy medicines on their own initiative. The most popular OTC medicines bought by Polish consumers are painkillers and non-steroid-anti-inflammatory drugs. The aim of this article was to recognize and describe the most important predictive factors of the abuse and misuse of over-the-counter pain relievers among adults in Wrocław (Poland). The groups of users were selected and described. Some examples of misuse were analyzed. Three hundred eighty six adult inhabitants of Wrocław took part in the survey. The quota sample was representative referring to the most important socio-demographic factors (sex and median age). Almost 91% of participants declare taking OTC pain relievers, and 1.3% of them are their daily users. Only 6.2% of adult inhabitants of Wrocław never take OTC pain relievers. The category of "heavy users" embraces 11% of participants. The most important risk factors of overusing OTC pain relievers are sex (female), age over 55 years and the low health status. Only half of participants read the box label regularly and 25% of users admit they have modified recommended doses. Over 60% shortened recommended intervals between doses and 16% took two or more different pain medications (containing different substances). The non-medical purposes of using OTC pain relievers were: tiredness (7%), stressful situations (5.4%), and discomfort (18.4%). Some users take pain medications to cure hangovers (26%), or instead of the appropriate medicine (7%). About 20% take pain medications without a doctor's advice for longer than the recommended 3 days, and 10% never consult taking such medications with doctors. Pain should be treated aggressively and successfully, especially among chronically ill patients. We should monitor the consumption of OTC pain relievers and limit their current excessively supply and high availability.

  18. La cogobernanza en el borde del Estado: las apuestas del proceso organizativo awá en el Ecuador

    Directory of Open Access Journals (Sweden)

    Juan Pineda

    2013-09-01

    Full Text Available El presente trabajo es una síntesis de la investigación sobre el sistema de gobernanza en el territorio awá del Ecuador. Las principales conclusiones giran en torno a las características de la dinámica participativa, los conflictos, los enfoques de la cooperación en la zona, la ausencia del Estado y el impacto que estos factores tienen en la legitimidad de la FCAE2, en el uso, regulación y conservación del territorio y en la consolidación de un sistema de gobernanza ambiental

  19. Crippled song. Ręka by Bolesław Leśmian within the context of expressionistic poetry

    Directory of Open Access Journals (Sweden)

    Katarzyna Szewczyk-Haake

    2009-01-01

    Full Text Available The analysis of Leśmian’s poem Ręka (from the collection of poems entitled Łąka, 1920 leads to distinguishing certain features of the poem that make a connection of the poem with literary expressionism feasible. The above similarities can be testified not only by distinct macabre motifs but also a very peculiar way the narrator constructs his narrative that can be concluded as an attempt at establishing a particular bond between the protagonist and the reader. Works written by the Poznań based expressionists Stanisław Kubicki and Józef Wittlin provide the appropriate context for the poem.

  20. Analysis of the Foundation Slab Settlement of the “Africa Pavilion” Facility in Wrocław

    Directory of Open Access Journals (Sweden)

    Sawicki Eugeniusz

    2015-12-01

    Full Text Available This article presents the results of numerical calculations of soil consolidation underneath the “Africa Pavilion” structure in Wrocław Zoo, Poland. To determine the deformations of the baseplate of the “Africa Pavilion” and deformations of the subsoil, Biot’s consolidation theory for two-phase medium was applied. The calculations were carried out using the professional program FlexPDE v.6, which is based on the Finite Element Method. Numerical calculations performed were used to evaluate the design assumptions allowing for the laying of hydraulic conduits under the slab.

  1. Comparison of the Glidescope and Pentax AWS laryngoscopes to the Macintosh laryngoscope for use by advanced paramedics in easy and simulated difficult intubation.

    LENUS (Irish Health Repository)

    Nasim, Sajid

    2009-01-01

    BACKGROUND: Intubation of the trachea in the pre-hospital setting may be lifesaving in severely ill and injured patients. However, tracheal intubation is frequently difficult to perform in this challenging environment, is associated with a lower success rate, and failed tracheal intubation constitutes an important cause of morbidity. Novel indirect laryngoscopes, such as the Glidescope and the AWS laryngoscopes may reduce this risk. METHODS: We compared the efficacy of these devices to the Macintosh laryngoscope when used by 25 Advanced Paramedics proficient in direct laryngoscopy, in a randomized, controlled, manikin study. Following brief didactic instruction with the Glidescope and the AWS laryngoscopes, each participant took turns performing laryngoscopy and intubation with each device, in an easy intubation scenario and following placement of a hard cervical collar, in a SimMan manikin. RESULTS: Both the Glidescope and the AWS performed better than the Macintosh, and demonstrate considerable promise in this context. The AWS had the least number of dental compressions in all three scenarios, and in the cervical spine immobilization scenario it required fewer maneuvers to optimize the view of the glottis. CONCLUSION: The Glidescope and AWS devices possess advantages over the conventional Macintosh laryngoscope when used by Advanced Paramedics in normal and simulated difficult intubation scenarios in this manikin study. Further studies are required to extend these findings to the clinical setting.

  2. [Professor Wacław Kuśnierczyk (1908-1997)--Pro Memoria in the century of birthday].

    Science.gov (United States)

    Brozek, Krzysztof; Kozakiewicz, Jacek; Kierzek, Andrzej

    2009-01-01

    Wacław Kuśnierczyk was born in 1908 in Sniatyń. He received the degree in medicine at Jan Kazimierz University in Lwów in 1932. He did his PhD degree under Professor Zaleski supervision in 1938 at Jan Kazimierz University. At that time he concentrated his scientific activity on research on tuberculosis. In 1953 he obtained the title of second degree specialist in ear, nose and throat diseases. He became a chief of Otolaryngology at Urban Hospital No 4 in Katowice in 1960. Since then this eminent physician was working on tumours located in upper respiratory tract and the possibility of its endoscopic diagnosis at Silesian Academy of Medicine in Katowice. As one of the first he pointed out the negative influence of smoking cigarettes on cancer of larynx. It was Wacław Kuśnierczyk who implemented new priorities for integrated programs in patient care, research, education and cancer prevention. He has published widely in peer reviewed journals and has edited or contributed to many books. He has given many major lectures and is the recipient of numerous prestigious awards for his scientific accomplishments. The achievement of Professor Kuśnierczyk were the valuable source of information for the physicians. In 1997, on the 31st of January he died in Katowice.

  3. From the Royal Castle to school. King Stanisław August’s legacy and the Volhynian Gymnasium collections

    Directory of Open Access Journals (Sweden)

    Katarzyna Buczek

    2017-01-01

    Full Text Available The library and the cabinet collections of King of Poland Stanisław August Poniatowski reflect the trends of the Enlightement as well as the monarch’s interests. Their acquisition by one of the most important Polish schools, the Volhynian Gymnasium in Kremenets, saved them from dismemberment and gave rise to school collections. The acquisition was possible owing to history (the Partition of Poland, and the emergence of the Vilna Educational District and a unique man – Tadeusz Czacki. The collections at the Volhynian Gymnasium in Kremenets was open to the public on a daily basis. In this way, the Polish King’s Stanisław August wish to have the collection available for masses came true, after his death regrettably. School collections were very valuable. Having originated from the royal collection of the last Polish King, they became a reminiscence of the national potential of a country that disappeared from the map of Europe in 1795. This article is a part of a future book and an attempt of documenting the transition of respective collections from the royal residence in Warsaw to Kremenets. The analysis of Polish, Lithuanian and Ukrainian archives enables to reconstruct the history of the royal collections and to show their quality and didactic utility.

  4. Pit nucleation on as-cast aluminiuim alloy AW-5083 in 0.01M NaCl

    Directory of Open Access Journals (Sweden)

    Dolić N.

    2011-01-01

    Full Text Available The use of aluminium alloys in a wide range of technical applications is related mostly to the two facts: they facilitate weight saving of final products (if compared to the steel and they are prone to spontaneous passivity due to the coherent surface oxide layer which impedes further reaction of aluminium with the environment. Among the commercial Al alloys, EN AW-5083 alloy is a representative non-heat treatable Al-Mg based alloy which possesses many interesting characteristics as a structural material, such as low price, moderately high strength, high formability in conjunction with superplasticity and good corrosion resistance in marine atmospheres. Aiming to enhance the knowledge of possible interactions of studied alloy EN AW-5083 in as-cast condition with chloride media, electrochemical measurements were used to follow the pitting behaviour in 0.01 M NaCl. The results of tests have shown that susceptibility of alloy to pitting corrosion is strongly influenced by the microstructural constituents of the alloy in as-cast condition.

  5. The memorable service and monastic humility – the history of Stanisław Konarski’s heart

    Directory of Open Access Journals (Sweden)

    Ryszard Mączyński

    2016-12-01

    Full Text Available The article concentrates on an interesting 130-year-old artefact located in the Krakow church of Piarists – the decoration of the place where Stanisław Konarski’s (1700–1773 heart was buried. Konarski was a monk of the Pious Schools in the 18th century, as well as publisher of a collection of national laws Volumina legum, a bold commentator calling for strengthening royal power and abolishing liberum veto, reformer of the educational system and founder of the renowned, modern Collegium Nobilium. The circumstances of the discovery and relocation of the relic in 1882 from Warsaw to Krakow and the ceremony of its introduction to the monastic Church of the Transfiguration of Jesus on February 13 are also outlined. Three significant research issues are also discussed. The first one is the problem of the authenticity of the artefact, which was discovered more than a hundred years after Konarski’s death in the possession of a Warsaw optician Jakub Pik. It was then that the question started occupying the minds of researchers, including the rector of the Krakow college Adam Słotwiński. The question is made more relevant by the lack of any direct evidence from 1773 about the removal of Stanisław Konarski’s heart from his body after his death. The information gathered so far allow us to assume, with probability bordering on certainty, that it is authentic and the only surviving part of this famous monk’s body. Another question, totally absent from past reflections on the subject, is the reason why the heart was removed. This particular aspect turns our attention at a strikingly popular early-modern Polish tradition – first in royal families, later also among magnates and nobility – of burying hearts separately, usually by entombing them in a church founded by the deceased. It was found that a considerable number of hearts removed from bodies had been inhumed in Piarist churches (Rzeszów, Warsaw or Łowicz. This tradition, however, did

  6. [Case of awake intubation in semi-sitting position for a patient with myasthenia gravis combined with cervical disc hernia utilizing Pentax-AWS Airwayscope].

    Science.gov (United States)

    Komasawa, Nobuyasu; Ueki, Ryusuke; Tomita, Yukihiko; Kaminoh, Yoshiroh; Tashiro, Chikara

    2011-01-01

    We report a case of awake intubation utilizing Pentax-AWS Airwayscope in semi-sitting position. A 74-year-old man with myasthenia gravis and cervical disc hernia was scheduled for distal gastrectomy under general anesthesia. He could not move his head due to severe cervical disc hernia and also could not sufficiently breathe due to the fatigue of respiratory muscles by myasthenia gravis in supine position. With fentanyl bolus administration and lidocaine spray for laryngotracheal anesthesia, we performed awake intubation in semi-sitting position with AWS from cranial side. The patient did not buck during intubation and no hemodynamic change was observed.

  7. The reception of Czesław Miłosz’s poetry by students of primary, lower secondary and upper secondary schools

    OpenAIRE

    Angelika Matuszek

    2013-01-01

    The works of Czesław Miłosz are usually regarded as “especially difficult” literature. It is therefore important to examine how young people analyse and interpret selected works of the poet. The article presents the results of a study evaluating the quality of reception of Miłosz’s poetry by students at all levels of compulsory education prior to the Czesław Miłosz Year in 2011. The study enabled the assessment of students’ knowledge of the life and work of Miłosz and the reading competencies...

  8. Estonia's Big Boys' Club / Justin Petrone

    Index Scriptorium Estoniae

    Petrone, Justin, 1979-

    2007-01-01

    Eesti üliõpilasseltside ajaloost, liikmetest ning mõjust Eesti ühiskonnale ja poliitikale. Lähemalt Eesti Üliõpilaste Seltsist (EÜS), selle tekkest, taastamisest Gorbatšovi reformide aastail, liikmeskonnast, suhetest teiste korporatsioonidega. EÜSi liikmete hulka kuulub ka president Toomas Hendrik Ilves. Ajakirjanumbri esikaanel T.H. Ilvese foto

  9. 2009-IJBCS-Article- Justin Abadassi

    African Journals Online (AJOL)

    hp

    utilized as human food, animal feed and raw ... systems, their relatively low susceptibility to ... The present work was undertaken to ... Figure 1: Principal components analysis: Biplot showing the representation of variables and .... Table 2: Population means and their standard errors for earliness variables and plant and ear.

  10. Time Sequence Spectroscopy of AW UMa. The 518 nm Mg i Triplet Region Analyzed With Broadening Functions

    Science.gov (United States)

    Rucinski, Slavek M.

    2015-02-01

    High-resolution spectroscopic observations of AW UMa, obtained on three consecutive nights with a median time resolution of 2.1 minutes, have been analyzed using the broadening function method in the spectral window of 22.75 nm around the 518 nm Mg i triplet region. Doppler images of the system reveal the presence of vigorous mass motions within the binary system; their presence puts into question the solid-body rotation assumption of the contact binary model. AW UMa appears to be a very tight, semi-detached binary; the mass transfer takes place from the more massive to the less massive component. The primary, a fast-rotating star with Vsin i=181.4+/- 2.5 km s-1, is covered with inhomogeneities: very slowly drifting spots and a dense network of ripples more closely participating in its rotation. The spectral lines of the primary show an additional broadening component (called the “pedestal”) that originates either in the equatorial regions, which rotate faster than the rest of the star by about 50 km s-1, or in an external disk-like structure. The secondary component appears to be smaller than predicted by the contact model. The radial velocity field around the secondary is dominated by accretion of matter transferred from (and possibly partly returned to) the primary component. The parameters of the binary are Asin i=2.73+/- 0.11 {{R}⊙ } and {{M}1}{{sin }3}i=1.29+/- 0.15 {{M}⊙ }, {{M}2}{{sin }3}i=0.128+/- 0.016 {{M}⊙ }. The mass ratio, {{q}sp}={{M}2}/{{M}1}=0.099+/- 0.003, while still the most uncertain among the spectroscopic elements, is substantially different from the previous numerous and mutually consistent photometric investigations which were based on the contact model. It should be studied why photometry and spectroscopy give such discrepant results and whether AW UMa is an unusual object or if only very high-quality spectroscopy can reveal the true nature of W UMa-type binaries. Based on observations obtained at the Canada

  11. Time sequence spectroscopy of AW UMa. The 518 nm Mg I triplet region analyzed with broadening functions

    International Nuclear Information System (INIS)

    Rucinski, Slavek M.

    2015-01-01

    High-resolution spectroscopic observations of AW UMa, obtained on three consecutive nights with a median time resolution of 2.1 minutes, have been analyzed using the broadening function method in the spectral window of 22.75 nm around the 518 nm Mg i triplet region. Doppler images of the system reveal the presence of vigorous mass motions within the binary system; their presence puts into question the solid-body rotation assumption of the contact binary model. AW UMa appears to be a very tight, semi-detached binary; the mass transfer takes place from the more massive to the less massive component. The primary, a fast-rotating star with Vsini=181.4±2.5 km s −1 , is covered with inhomogeneities: very slowly drifting spots and a dense network of ripples more closely participating in its rotation. The spectral lines of the primary show an additional broadening component (called the “pedestal”) that originates either in the equatorial regions, which rotate faster than the rest of the star by about 50 km s −1 , or in an external disk-like structure. The secondary component appears to be smaller than predicted by the contact model. The radial velocity field around the secondary is dominated by accretion of matter transferred from (and possibly partly returned to) the primary component. The parameters of the binary are Asini=2.73±0.11 R ⊙ and M 1 sin 3 i=1.29±0.15 M ⊙ , M 2 sin 3 i=0.128±0.016 M ⊙ . The mass ratio, q sp =M 2 /M 1 =0.099±0.003, while still the most uncertain among the spectroscopic elements, is substantially different from the previous numerous and mutually consistent photometric investigations which were based on the contact model. It should be studied why photometry and spectroscopy give such discrepant results and whether AW UMa is an unusual object or if only very high-quality spectroscopy can reveal the true nature of W UMa-type binaries.

  12. GT-WGS: an efficient and economic tool for large-scale WGS analyses based on the AWS cloud service.

    Science.gov (United States)

    Wang, Yiqi; Li, Gen; Ma, Mark; He, Fazhong; Song, Zhuo; Zhang, Wei; Wu, Chengkun

    2018-01-19

    Whole-genome sequencing (WGS) plays an increasingly important role in clinical practice and public health. Due to the big data size, WGS data analysis is usually compute-intensive and IO-intensive. Currently it usually takes 30 to 40 h to finish a 50× WGS analysis task, which is far from the ideal speed required by the industry. Furthermore, the high-end infrastructure required by WGS computing is costly in terms of time and money. In this paper, we aim to improve the time efficiency of WGS analysis and minimize the cost by elastic cloud computing. We developed a distributed system, GT-WGS, for large-scale WGS analyses utilizing the Amazon Web Services (AWS). Our system won the first prize on the Wind and Cloud challenge held by Genomics and Cloud Technology Alliance conference (GCTA) committee. The system makes full use of the dynamic pricing mechanism of AWS. We evaluate the performance of GT-WGS with a 55× WGS dataset (400GB fastq) provided by the GCTA 2017 competition. In the best case, it only took 18.4 min to finish the analysis and the AWS cost of the whole process is only 16.5 US dollars. The accuracy of GT-WGS is 99.9% consistent with that of the Genome Analysis Toolkit (GATK) best practice. We also evaluated the performance of GT-WGS performance on a real-world dataset provided by the XiangYa hospital, which consists of 5× whole-genome dataset with 500 samples, and on average GT-WGS managed to finish one 5× WGS analysis task in 2.4 min at a cost of $3.6. WGS is already playing an important role in guiding therapeutic intervention. However, its application is limited by the time cost and computing cost. GT-WGS excelled as an efficient and affordable WGS analyses tool to address this problem. The demo video and supplementary materials of GT-WGS can be accessed at https://github.com/Genetalks/wgs_analysis_demo .

  13. Comparisons of ANS, ASME, AWS, and NFPA standards cited in the NRC standard review plan, NUREG-0800, and related documents

    International Nuclear Information System (INIS)

    Ankrum, A.R.; Bohlander, K.L.; Gilbert, E.R.; Spiesman, J.B.

    1995-11-01

    This report provides the results of comparisons of the cited and latest versions of ANS, ASME, AWS and NFPA standards cited in the NRC Standard Review Plan for the Review of Safety Analysis Reports for Nuclear Power Plants (NUREG 0800) and related documents. The comparisons were performed by Battelle Pacific Northwest Laboratories in support of the NRC's Standard Review Plan Update and Development Program. Significant changes to the standards, from the cited version to the latest version, are described and discussed in a tabular format for each standard. Recommendations for updating each citation in the Standard Review Plan are presented. Technical considerations and suggested changes are included for related regulatory documents (i.e., Regulatory Guides and the Code of Federal Regulations) citing the standard. The results and recommendations presented in this document have not been subjected to NRC staff review

  14. Jean-Léon Gérôme and Stanisław Chlebowski: The Story of a Friendship

    Directory of Open Access Journals (Sweden)

    Wójcik, Agata

    2010-12-01

    Full Text Available The aim of the article is to present the story of the relationship between Jean-Léon Gérôme and Stanisław Chlebowski. The reconstruction of their friendship is partly based on yet unpublished source materials on the life and work of Chlebowski. The artists met in the early 1860s. Their acquaintance became closer in 1875 when Gérôme stayed in Istanbul at Chlebowski's house. When Chlebowski moved to France, Gérôme introduced him to the French artistic circles, offered him advice and suggested themes for his work. Their relationship was interrupted by Chlebowski's disease and his return to Poland. The last note of this friendship was the short story by Léontine de Nittis, published in 1892.

  15. The extraction of total lipids from parsley: Petroselinum crispum (mill. Nym. Ex. A.W. Hill seeds

    Directory of Open Access Journals (Sweden)

    Stanković Mihajlo Z.

    2004-01-01

    Full Text Available The kinetics of extraction of total lipids from ground parsley (Petroselinum crispum (Mill. Nym. ex. A.W. Hill seeds with a mixture of ethanol or methanol with non-polar organic solvents, chloroform, carbon tetrachloride, trichloroethylene and petroleum ether, at various temperatures were studied. The maceration technique with reflux was used. The kinetic parameters were determined in extraction kinetic equations, as well as the optimal operation conditions for total lipids extraction. The maximum total lipids yield under optimal conditions was 33.7 g per 100 g of dry parsley seeds. Nine lipid fractions of the total lipids were separated by thin layer chromatography among which were phospholipids, sterol, mono-, di- and triacylglycerol, free fatty acids and carbohydrates.

  16. Natural Borders? Modernist Geopolitics and Environmental Ecopolitics in Awá Territory: Bios and Thanatos on the Margin

    Directory of Open Access Journals (Sweden)

    Anne-Lise Naizot

    2011-01-01

    Full Text Available The creation of extractive, agro-industrial and ecological spaces in indigenous territories raises a series of questions regarding the future of these territories and, particularly, the indigenous project of territorial and political autonomy in Latin America and elsewhere. These spaces are first of all social spaces, crossed and interwoven by power relations that define mobile frontiers between life and death, domination and autonomy, inclusion and exclusion. This paper deals with the situation of the Awá people and their territory in Ecuador, in a context of growing territorial and environmental pressures from the state, logging, mining, and palm-oil companies, as well as from the growing interest and actions regarding the conservation of its “nature”. 

  17. Mechanisms of gas retention and release: Experimental results for Hanford waste tanks 241-AW-101 and 241-AN-103

    Energy Technology Data Exchange (ETDEWEB)

    Rassat, S.D.; Gauglitz, P.A.; Bredt, P.R.; Mahoney, L.A.; Forbes, S.V.; Tingey, S.M.

    1997-09-01

    The 177 storage tanks at Hanford contain a vast array of radioactive waste forms resulting, primarily, from nuclear materials processing. Through radiolytic, thermal, and other decomposition reactions of waste components, gaseous species including hydrogen, ammonia, and the oxidizer nitrous oxide are generated within the waste tanks. Many of these tanks are known to retain and periodically release quantities of these flammable gas mixtures. The primary focus of the Flammable Gas Project is the safe storage of Hanford tank wastes. To this end, we strive to develop an understanding of the mechanisms of flammable gas retention and release in Hanford tanks through laboratory investigations on actual tank wastes. These results support the closure of the Flammable Gas Unreviewed Safety Question (USQ) on the safe storage of waste tanks known to retain flammable gases and support resolution of the broader Flammable Gas Safety Issue. The overall purpose of this ongoing study is to develop a comprehensive and thorough understanding of the mechanisms of flammable gas retention and release. The first objective of the current study was to classify bubble retention and release mechanisms in two previously untested waste materials from Tanks 241-AN-103 (AN-103) and 241-AW-101 (AW-101). Results were obtained for retention mechanisms, release characteristics, and the maximum gas retention. In addition, unique behavior was also documented and compared with previously studied waste samples. The second objective was to lengthen the duration of the experiments to evaluate the role of slowing bubble growth on the retention and release behavior. Results were obtained for experiments lasting from a few hours to a few days.

  18. Mechanisms of gas retention and release: Experimental results for Hanford waste tanks 241-AW-101 and 241-AN-103

    International Nuclear Information System (INIS)

    Rassat, S.D.; Gauglitz, P.A.; Bredt, P.R.; Mahoney, L.A.; Forbes, S.V.; Tingey, S.M.

    1997-09-01

    The 177 storage tanks at Hanford contain a vast array of radioactive waste forms resulting, primarily, from nuclear materials processing. Through radiolytic, thermal, and other decomposition reactions of waste components, gaseous species including hydrogen, ammonia, and the oxidizer nitrous oxide are generated within the waste tanks. Many of these tanks are known to retain and periodically release quantities of these flammable gas mixtures. The primary focus of the Flammable Gas Project is the safe storage of Hanford tank wastes. To this end, we strive to develop an understanding of the mechanisms of flammable gas retention and release in Hanford tanks through laboratory investigations on actual tank wastes. These results support the closure of the Flammable Gas Unreviewed Safety Question (USQ) on the safe storage of waste tanks known to retain flammable gases and support resolution of the broader Flammable Gas Safety Issue. The overall purpose of this ongoing study is to develop a comprehensive and thorough understanding of the mechanisms of flammable gas retention and release. The first objective of the current study was to classify bubble retention and release mechanisms in two previously untested waste materials from Tanks 241-AN-103 (AN-103) and 241-AW-101 (AW-101). Results were obtained for retention mechanisms, release characteristics, and the maximum gas retention. In addition, unique behavior was also documented and compared with previously studied waste samples. The second objective was to lengthen the duration of the experiments to evaluate the role of slowing bubble growth on the retention and release behavior. Results were obtained for experiments lasting from a few hours to a few days

  19. Poezja wyjaśniająca swój własny rodowód: Czesław Miłosz a John Ashbery

    NARCIS (Netherlands)

    van Nieukerken, A.

    2011-01-01

    A poetry that explains its own genesis: Czesław Miłosz and John Ashbery The first part of this paper considers the origin of the metaphysical import of the constructive principle in the long poems of the ageing Czesław Miłosz (my analysis focuses on "From the Rising of the Sun" and "The separate

  20. In memory of professor Czesław Niżankowski, Head of the Department of Anatomy, Wroclaw Medical University.

    Science.gov (United States)

    Kacała, Ryszard R; Wronecki, Krzysztof; Kacała, Arkadiusz; Domagała, Zygmunt; Porwolik, Michał

    2018-03-20

    Professor Czesław Niżankowski was an academic teacher and researcher at several universities; head of the Department of Anatomy at Wroclaw Medical University (1966-1982); and head of the Department of Biological Sciences at the Wrocław School of Physical Education (since 1972 University School of Physical Education in Wrocław), as well as the chancellor there. He contributed greatly to the development of morphological sciences, supervising many doctoral and post-doctoral works. He dedicated considerable time to the preparation of anatomical specimens of lungs, hearts and organs of the gastrointestinal tract. At the Museum of Anatomy, there are over 100 specimens of lungs prepared using the forced air technique improved by Professor Niżankowski, along with specimens of the bronchial tree and vascular system prepared using a corrosive technique. Professor Niżankowski was an active member of scientific societies in Wrocław and in other cities in Poland. For his accomplishments, he received a number of ministerial and state awards, including the Knight's Cross of the Order of Polonia Restituta, and was granted an honorary doctorate by Wroclaw Medical University.

  1. Decision Document for the Low Activity Waste Retrieval Strategy for Tanks 241-AN-103 and 241-AN-104 and 241-AN-105 and 241-AW-101

    International Nuclear Information System (INIS)

    RASMUSSEN, O.R.

    2000-01-01

    This report documents the preferred approach (retrieval strategy) to prepare and transfer waste from low-activity waste source tanks containing soluble solids (Tanks 241-AN-103, 241-AN-104, 241-AN-105 and 241-AW-101) to the vitrification plant. Several opportunities to further refine the selected retrieval strategy were identified; these were recommended for follow-on studies

  2. Tradycje śląskiej kultury muzycznej. XIV Miȩdzynarodowa 299 Konferencja, Wrocław 2.–4. 3. 2016

    Czech Academy of Sciences Publication Activity Database

    Gabrielová, Jarmila

    2016-01-01

    Roč. 53, 2/3 (2016), s. 300-301 ISSN 0018-7003. [Tradycje śląskiej kultury muzycznej. XIV Miȩdzynarodowa Konferencja. Wrocław, 02.03.2016-04.03.2016] Institutional support: RVO:68378076 Keywords : music ological conference * Silesia * history of music Subject RIV: AL - Art, Architecture, Cultural Heritage

  3. Running climate model on a commercial cloud computing environment: A case study using Community Earth System Model (CESM) on Amazon AWS

    Science.gov (United States)

    Chen, Xiuhong; Huang, Xianglei; Jiao, Chaoyi; Flanner, Mark G.; Raeker, Todd; Palen, Brock

    2017-01-01

    The suites of numerical models used for simulating climate of our planet are usually run on dedicated high-performance computing (HPC) resources. This study investigates an alternative to the usual approach, i.e. carrying out climate model simulations on commercially available cloud computing environment. We test the performance and reliability of running the CESM (Community Earth System Model), a flagship climate model in the United States developed by the National Center for Atmospheric Research (NCAR), on Amazon Web Service (AWS) EC2, the cloud computing environment by Amazon.com, Inc. StarCluster is used to create virtual computing cluster on the AWS EC2 for the CESM simulations. The wall-clock time for one year of CESM simulation on the AWS EC2 virtual cluster is comparable to the time spent for the same simulation on a local dedicated high-performance computing cluster with InfiniBand connections. The CESM simulation can be efficiently scaled with the number of CPU cores on the AWS EC2 virtual cluster environment up to 64 cores. For the standard configuration of the CESM at a spatial resolution of 1.9° latitude by 2.5° longitude, increasing the number of cores from 16 to 64 reduces the wall-clock running time by more than 50% and the scaling is nearly linear. Beyond 64 cores, the communication latency starts to outweigh the benefit of distributed computing and the parallel speedup becomes nearly unchanged.

  4. Influence of clinical experience of the Macintosh laryngoscope on performance with the Pentax-AWS Airway Scope(®), a rigid video-laryngoscope, by paramedics in Japan.

    Science.gov (United States)

    Ota, Kohei; Sadamori, Takuma; Kusunoki, Shinji; Otani, Tadatsugu; Tamura, Tomoko; Une, Kazunobu; Kida, Yoshiko; Itai, Junji; Iwasaki, Yasumasa; Hirohashi, Nobuyuki; Nakao, Masakazu; Tanigawa, Koichi

    2015-10-01

    We sought to establish the clinical utility of the Pentax-AWS Airway Scope(®) (AWS) when used by paramedics to intubate the trachea, and to evaluate whether their performance was influenced by previous clinical experience with the Macintosh laryngoscope (ML). Twenty paramedics attempted tracheal intubation using the AWS in five patients each in the operating room. We recorded the success rate, the number of intubation attempts, and the time for intubation and adverse events, and compared these based on the paramedics' previous clinical experience with the ML. Ten paramedics had no prior clinical experience of the ML (group A) and 10 had used it on more than 30 occasions (group B). The intubation success rate was 99 % (99/100). Notably, 96 % (47/49) of intubations were achieved on the first attempt by the inexperienced paramedics in group A, compared with 64 % (32/50) by the experienced paramedics in group B (p = 0.0001). The time to intubation (mean ± SD) was significantly shorter in group A than in group B (37 ± 24 vs. 48 ± 21 s, p = 0.002). There were marked variations in the times taken to intubate, but no apparent improvement as the intubators gained experience between their first and fifth cases. No complications were encountered in either group. We found that paramedics could achieve a high tracheal intubation success rate using the AWS independent of previous airway management experience. Better intubation performance with the AWS was observed in paramedics without clinical experience with the ML.

  5. Comparisons of the Pentax-AWS, Glidescope, and Macintosh Laryngoscopes for Intubation Performance during Mechanical Chest Compressions in Left Lateral Tilt: A Randomized Simulation Study of Maternal Cardiopulmonary Resuscitation

    Directory of Open Access Journals (Sweden)

    Sanghyun Lee

    2015-01-01

    Full Text Available Purpose. Rapid advanced airway management is important in maternal cardiopulmonary resuscitation (CPR. This study aimed to compare intubation performances among Pentax-AWS (AWS, Glidescope (GVL, and Macintosh laryngoscope (MCL during mechanical chest compression in 15° and 30° left lateral tilt. Methods. In 19 emergency physicians, a prospective randomized crossover study was conducted to examine the three laryngoscopes. Primary outcomes were the intubation time and the success rate for intubation. Results. The median intubation time using AWS was shorter than that of GVL and MCL in both tilt degrees. The time to visualize the glottic view in GVL and AWS was significantly lower than that of MCL (all P<0.05, whereas there was no significant difference between the two video laryngoscopes (in 15° tilt, P=1; in 30° tilt, P=0.71. The progression of tracheal tube using AWS was faster than that of MCL and GVL in both degrees (all P<0.001. Intubations using AWS and GVL showed higher success rate than that of Macintosh laryngoscopes. Conclusions. The AWS could be an appropriate laryngoscope for airway management of pregnant women in tilt CPR considering intubation time and success rate.

  6. Wrocław as a European Capital of Culture 2016. Brand Building on Facebook. Visual Identification

    Directory of Open Access Journals (Sweden)

    Urszula Wich-Szymczak

    2017-03-01

    Full Text Available The article contains research in two fields of image building. The first is describing general thoughts about city marketing communication, brand building and current trends in this area. Author pays attention to the aesthetics issue, that creates the possibility for different organizations to affect their audience through a whole range of sensory stimulators, thereby creating the conditions of mutual satisfaction. Then the author tries to answer the questions: what should be done to make the city brand exist in consumers' minds in the twenty-first century? How to exist in virtual reality without visual identification? Next step is to overview the book of visual identification of Wrocław ECOC. The second area of interest is cumulated around image building on official Facebook profile of Wroclaw ECOC. It is a platform for opinion exchange. Its focuses on a fourfold type of creation: creation of the individual, creation of the organization, creation of the company, and finally creation of the brand.

  7. Design of Laser Welding Parameters for Joining Ti Grade 2 and AW 5754 Aluminium Alloys Using Numerical Simulation

    Directory of Open Access Journals (Sweden)

    Mária Behúlová

    2017-01-01

    Full Text Available Joining of dissimilar Al-Ti alloys is very interesting from the point of view of weight reduction of components and structures in automotive or aerospace industries. In the dependence on cooling rate and chemical composition, rapid solidification of Al-Ti alloys during laser welding can lead to the formation of metastable phases and brittle intermetallic compounds that generally reduce the quality of produced weld joints. The paper deals with design and testing of welding parameters for preparation of weld joints of two sheets with different thicknesses from titanium Grade 2 and AW 5754 aluminium alloy. Temperature fields developed during the formation of Al-Ti butt joints were investigated by numerical simulation in ANSYS software. The influence of laser welding parameters including the laser power and laser beam offset on the temperature distribution and weld joint formation was studied. The results of numerical simulation were verified by experimental temperature measurement during laser beam welding applying the TruDisk 4002 disk laser. The microstructure of produced weld joints was assessed by light microscopy and scanning electron microscopy. EDX analysis was applied to determine the change in chemical composition across weld joints. Mechanical properties of weld joints were evaluated using tensile tests and Vickers microhardness measurements.

  8. Pollution of soils (Pb, Cd, Cr, Zn, Cu, Ni) along the ring road of Wrocław (Poland)

    Science.gov (United States)

    Hołtra, Anna; Zamorska-Wojdyła, Dorota

    2017-11-01

    The concentrations of metallic pollution in soils and plants along the ring road of Wrocław, Poland, have been determined. Environmental samples were collected from the surface layer of the profile within 2-3 m from the edge of the road. The analysis of metals (Pb, Cd, Cr, Zn, Cu and Ni) has been carried out through FAAS and GFAAS methods. The mineralizates of soils and plants were prepared in HNO3, 65% supra pure, using the Microwave Digestion System. The pH and conductivity of the soil solutions were measured to evaluate their active and exchangeable acidity and the salinity of the soils. The index of the enrichment of soils in metals (Wn) and the bioaccumulation coefficient (WB) have been determined. Also, histograms of the frequency of the occurrence of metals in the environmental samples and the Pearson's correlation coefficients were presented. The results of metal concentrations in soils were compared to the geochemical background in uncontaminated soils of Poland. The assessment of the results in the soils was also made relative to the standard, according to the Polish Ministry of Environment Regulation from September 1st, 2016. During the assessment of the bioaccumulation coefficients of metals in plants a reference was made to the content of undesirable substances in feed in agreement with the Polish Ministry of Agriculture and Rural Development Regulation from January 23rd, 2007.

  9. A holographic model of reminiscence in the poetry of Czesław Miłosz

    Directory of Open Access Journals (Sweden)

    Agnieszka Rydz

    2011-01-01

    Full Text Available For a model of nostalgic memory in the poetry of Czesław Miłosz, based on the psychological phenomenon of reminiscence, an allegoric counterpart can be identified in the hologram metaphor (Douwe Draaisma. The question: “Who am I” – reappears in Miłosz’s late lyrical poetry when he ponders over both his biography and the biographies of others. The response is provided, for instance, in the concept of human dialectic biography (of subject and object, formulated by Paul Ricoeur in his philosophical analyses. Human memory remains equally dialectic, placed in the antinomy between memory and oblivion. Still, retrieving a detail which has been remembered evokes all experience along with its rich context. That is the holographic effect, described in literature as the “ghost image”. Also in poetry, the effacing of memory trace does not make a barrier for the restitution of recollection. “The Sun of Memory” beams through the lyric of the author of the collection of poems “This”.

  10. Flowering Plants Preferred by Bumblebees (Bombus Latr. in the Botanical Garden of Medicinal Plants in Wrocław

    Directory of Open Access Journals (Sweden)

    Sikora Aneta

    2016-12-01

    Full Text Available Due to fewer bumblebees in rural areas these days, it is necessary to look for alternative habitats for the active protection of these very important pollinators. The research was carried out in The Botanical Garden of Medicinal Plants, in Wrocław, Poland. In the garden, approximately 2000 plant species were cultivated, of which 185 were visited by bumblebees. Amongst them, 57 plant species were deemed very attractive and were determined to be indicators for 7 bumblebee species. Indicator species for bumblebees ranged between 6 for Bombus pratorum to up to 20 for B. pascuorum. Monarda didyma was an indicator plant to 6 recorded bumblebee species. Other indicator plant species for at least 4 bumblebees species were: Origanum vulgare, Lavandula angustifolia, Rhododendron catawbiense, Phacelia tanacetifolia, and Agastache rugosa. Three bumblebee species were found to forage the most on 11 of the flowering plant species. The biggest group of plants were those which were mostly visited by 1-2 bumblebee species. Amongst all recorded indicator plants, 32% were native species.

  11. Physical Activity as a Determinant of Quality of Life in Working-Age People in Wrocław, Poland

    Directory of Open Access Journals (Sweden)

    Daniel Puciato

    2018-03-01

    Full Text Available Regular physical activity can greatly contribute to the improvement of physical fitness and performance, reduction of the incidence risk of some occupational diseases, and as a consequence, to a general improvement of quality of life in terms of health status. The aim of the article was to assess relationships between the quality of life and physical activity of a working-age population. The study material comprised 4460 residents of the city of Wrocław, Poland (2129 men, 2331 women aged 18–64 years. The study was a questionnaire survey using the International Physical Activity Questionnaire Short Form (IPAQ-SF and The World Health Organization Quality of Life (WHOQOL-BREF questionnaires. The highest levels of overall quality of life and its four particular domains (physical, psychological, social, and environmental, as well as perceived health conditions were found among the most physically active respondents. Furthermore, the odds of high assessment of perceived overall quality of life were shown to increase with the increasing levels of physical activity. Activities aimed at the improvement of the quality of life of working-age people should involve programs enhancing the development of physical activity.

  12. Proximal interphalangeal joint ankylosis in an early medieval horse from Wrocław Cathedral Island, Poland.

    Science.gov (United States)

    Janeczek, Maciej; Chrószcz, Aleksander; Onar, Vedat; Henklewski, Radomir; Skalec, Aleksandra

    2017-06-01

    Animal remains that are unearthed during archaeological excavations often provide useful information about socio-cultural context, including human habits, beliefs, and ancestral relationships. In this report, we present pathologically altered equine first and second phalanges from an 11th century specimen that was excavated at Wrocław Cathedral Island, Poland. The results of gross examination, radiography, and computed tomography, indicate osteoarthritis of the proximal interphalangeal joint, with partial ankylosis. Based on comparison with living modern horses undergoing lameness examination, as well as with recent literature, we conclude that the horse likely was lame for at least several months prior to death. The ability of this horse to work probably was reduced, but the degree of compromise during life cannot be stated precisely. Present day medical knowledge indicates that there was little likelihood of successful treatment for this condition during the middle ages. However, modern horses with similar pathology can function reasonably well with appropriate treatment and management, particularly following joint ankylosis. Thus, we approach the cultural question of why such an individual would have been maintained with limitations, for a probably-significant period of time. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. EN AW-4032 T6 Piston Alloy After High-Temperature Exposure: Residual Strength and Microstructural Features

    Science.gov (United States)

    Balducci, Eleonora; Ceschini, Lorella; Morri, Alessandro; Morri, Andrea

    2017-08-01

    This study aims to evaluate the effects of prolonged thermal exposure on both microstructural evolution and mechanical properties of the EN AW-4032 T6 piston alloy. For the purpose, the experimental activities have been carried out on samples machined from forged and heat-treated automotive pistons. The effects of overaging have been investigated in the temperature range of 140-290 °C, firstly by evaluating the time-temperature-hardness curves and then by carrying out room-temperature tensile tests on overaged samples. The material softening was substantial and extremely rapid when the soaking temperature exceeded 250 °C. During overaging, both the tensile strength and the residual hardness considerably decreased, and a relationship between these parameters has been established. The alloy behavior in the plastic field has been modeled according to the Hollomon's equation, showing that both the strain hardening exponent and the strength coefficient are a function of the residual hardness. The results were finally related to the corresponding microstructural changes: OM and FEG-SEM metallographic and fractographic analyses on overaged samples gave evidence of coarsened precipitates along the grain boundaries.

  14. Postsecular Instruments of Acculturation. Czesław Miłosz’s Works from the Second American Stay

    Directory of Open Access Journals (Sweden)

    Jarzyńska Karina

    2017-08-01

    Full Text Available The article raises the question about the ways in which religious tradition can become an ally in the process of acculturation while serving the modern subject both as a springboard for innovative, creative work and as a tool of self-improvement. Czesław Miłosz’s selected works from his second stay in the United States (1961-1980 are analysed from the postsecular perspective which recognises religion as a full-fledged actor in the process of modern transformations that may broaden the field of artistic choice but remains vulnerable to artistic resemantizations or even profanations (Agamben. Such an analysis allows us to interpret the poem From the Rising of the Sun as a form of reconciliation of Miłosz’s American and Lithuanian experience (as well as of maturity and childhood, centre and periphery, modern and pre-modern cultural formation through textual practices inspired by his private Liturgy of the Hours. In this light, the translations of the Books of the Bible on which Miłosz worked, his novel The Mountains of Parnassus, as well as his essays from Visions from San Francisco Bay emerge as instruments of shaping the communal identity with the use of pre-existing rituals, which are, nonetheless, also negotiated in the act of writing.

  15. [Some remarks on the theory of sets by Richard Dedekind and Stanisław Leśniewski].

    Science.gov (United States)

    Obojska, Lidia

    2014-01-01

    Mereology, is a part-whole theory, also called the theory of collective sets. It was founded in 1916 by Stanisław Leśniewski and this is an alternative theory versus the classical set theory by Georg Cantor. These two theories are usually teamed up together as Leśniewski himself was referring to the concept of the set by Cantor and Cantor is considered the "main" ideologist of the set theory. However, when analyzing the original texts of various authors, it seems that the very concept of a collective set is closer to the idea of Richard Dedekind rather than that of Georg Cantor. It is known that Cantor borrowed some concepts on the notion of set from Dedekind, whose ideas were also known to Leśniewski, however, there is no study on this topic. This work is therefore an attempt to compare some set-theoretical concepts of both of these authors, i.e. S. Leśiewski and R. Dedekind and the presentation of their convergence.

  16. The energy balance of tropical Glaciar Artesonraju, Cordillera Blanca, Perú - AWS-measurements and numerical modeling

    Science.gov (United States)

    Galos, S.; Mölg, T.; MacDonell, S.; Großhauser, M.; Marzeion, B.

    2012-04-01

    Like in most regions of the world, tropical glaciers in the Peruvian Andes have experienced considerable mass loss during the last decades. In order to better understand and correctly interpret the ongoing glacier changes in this region, we need to examine the driving processes behind these changes. Therefore we installed several automatic weather stations (AWS) in the Cordillera Blanca mountain range. Two of these stations are situated in the ablation area of Glaciar Shallap and Glaciar Artesonraju, while four other stations were established in the vicinity of the two glaciers. The resulting eight year record of meteorological data is analyzed and finally used as input for a physically based numerical energy and mass balance model, which in a first step was applied to the ablation zone of Glaciar Artesonraju (8.96° S / 77.63° W). In July 2010, eddy covariance measurements were carried out on the glacier surface. The resulting data was used to calibrate the parametrization scheme for the turbulent fluxes of sensible and latent heat. Finally the model output was validated against ablation data from a sonic ranger and from single stake ablation measurements. The model results were interpreted with special respect to the seasonal fluctuation in atmospheric moisture (tropical wet / dry season).

  17. Aluminium EN AW-2124 alloy matrix composites reinforced with Ti(C,N), BN and Al2O3 particles

    International Nuclear Information System (INIS)

    Dobrzanski, L.A.; Wlodarczyk, A.; Adamiak, M.

    2003-01-01

    Investigation results of the aluminium alloy EN AW-2124 matrix composite materials with particles of the powders Ti(C,N), BN and Al 2 O 3 (15 wt.%) are presented in the paper. In order to obtain uniform distribution of reinforcement particles in aluminium alloy matrix powders of composite components have been milled in the rotary ball-bearing pulverizer. The composites have been pressed in laboratory vertical press at room temperature under the pressure of 500 kN. Obtained die samplings have been heated to the temperature 520-550 o C and extruded. Bars of diameter 8 mm have been received as a final product. Metallographic examination of the composites materials' structure shows non-uniform distribution of reinforced powders in the aluminium alloy matrix banding of reinforcements particles corresponds to the extrusion direction. Particles of reinforcement distribution in aluminium alloy matrix is irregular, some agglomerations of powder of aluminium oxide and porosity of different size have been noticed. Investigations of hardness and ultimate compressive strength show that the particles of reinforcement improve mechanical properties of composite materials. Investigations of compressive strength, carried out at room temperature, enable to compare mechanical properties of matrix and composite. (author)

  18. NIR technology for on-line determination of superficial a(w) and moisture content during the drying process of fermented sausages.

    Science.gov (United States)

    Collell, Carles; Gou, Pere; Arnau, Jacint; Muñoz, Israel; Comaposada, Josep

    2012-12-01

    Three different NIR equipment were evaluated based on their ability to predict superficial water activity (a(w)) and moisture content in two types of fermented sausages (with and without moulds on surface), using partial least squares (PLS) regression models. The instruments differed mainly in wavelength range, resolution and measurement configuration. The most accurate equipment was used in a new experiment to achieve robust models in sausages with different salt contents and submitted to different drying conditions. The models developed showed determination coefficients (R(2)(P)) values of 0.990, 0.910 and 0.984, and RMSEP values of 1.560%, 0.220% and 0.007% for moisture, salt and a(w) respectively. It was demonstrated that NIR spectroscopy could be a suitable non-destructive method for on-line monitoring and control of the drying process in fermented sausages. Copyright © 2012 Elsevier Ltd. All rights reserved.

  19. The reception of Czesław Miłosz’s poetry by students of primary, lower secondary and upper secondary schools

    Directory of Open Access Journals (Sweden)

    Angelika Matuszek

    2013-09-01

    Full Text Available The works of Czesław Miłosz are usually regarded as “especially difficult” literature. It is therefore important to examine how young people analyse and interpret selected works of the poet. The article presents the results of a study evaluating the quality of reception of Miłosz’s poetry by students at all levels of compulsory education prior to the Czesław Miłosz Year in 2011. The study enabled the assessment of students’ knowledge of the life and work of Miłosz and the reading competencies required by a modern student to analyse and interpret his literary work.

  20. Thriving rough sets 10th anniversary : honoring professor Zdzisław Pawlak's life and legacy & 35 years of rough sets

    CERN Document Server

    Skowron, Andrzej; Yao, Yiyu; Ślęzak, Dominik; Polkowski, Lech

    2017-01-01

    This special book is dedicated to the memory of Professor Zdzisław Pawlak, the father of rough set theory, in order to commemorate both the 10th anniversary of his passing and 35 years of rough set theory. The book consists of 20 chapters distributed into four sections, which focus in turn on a historical review of Professor Zdzisław Pawlak and rough set theory; a review of the theory of rough sets; the state of the art of rough set theory; and major developments in rough set based data mining approaches. Apart from Professor Pawlak’s contributions to rough set theory, other areas he was interested in are also included. Moreover, recent theoretical studies and advances in applications are also presented. The book will offer a useful guide for researchers in Knowledge Engineering and Data Mining by suggesting new approaches to solving the problems they encounter.

  1. “A June Dream about Snow, a Trace, a Face”. A Poem by Czesław Miłosz – an Attempt to Read It

    Directory of Open Access Journals (Sweden)

    Mateusz Antoniuk

    2014-01-01

    Full Text Available The article is an attempt at a close reading of the poem 17 czerwca (“17 June” by Czesław Miłosz. The author starts with a versological analysis, supposed to indicate in what way the poet achieved the tonal effects in the text. The interpretation that has been conducted makes visible a semantic unsolvability, which—according to the author—is born in the poem and, once discerned, cannot be easily neutralized.

  2. Pro Memoria. Professor Bolesław Jałowy (1906-1943): Mortui viventes obligant - the livings are obligated to the dead.

    Science.gov (United States)

    Wincewicz, Andrzej

    2016-01-01

    Professor Bolesław Jałowy (1906-1943) was a chairman of Department of Histology and Embryology at Faculty of Medicine of King John Casimir University (Polish: Universytet Jana Kazimierza: UJK) in Lvov. He succeeded Professor Władysław Szymonowicz (1869-1939) who held this position for decades. As the most skillful followers of his tutor, Bolesław Jałowy was a great investigator of physiology of human tissue, embryogenesis, histological consequences of female sex hormones on blood clotting action as well as regeneration of nerves in addition to description of silver staining technique for reticulin fibers of skin. He was a hard working person with gentle attitude to such a subtle matter as microscopic structure of human body. However, he happened to live in brutal conditions of nationalistic struggles. His example shows how much a dedicated scientist could do in a very short time as his life was tragically ended with murdering him during World War Two. His story is a great lesson for generations of academic workers how to meet high moral standards with efficient and creative scientific work in evil and destructive, nationalistic climate that occurs usually in wartime.

  3. Energy management: analysis of reducing energy consumption by sectors of the A.W. Faber-Castell S.A. company; Gerenciamento energetico: analise de reducao do consumo de energia eletrica de setores da empresa A.W. Faber-Castell S.A.

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Jesue Ferraz da [Faculdades Integradas de Sao Carlos (FADISC), SP (Brazil); Branco, Fabio Jose Ceron [Universidade de Sao Paulo (EESC/USP), Sao Carlos, SP (Brazil). Escola de Engenharia

    2009-07-01

    The energy consumption in the sectors that require a lot of input from the company A.W. Faber-Castell S.A. after the implementation of the program to reduce energy consumption by the Internal Committee for Energy Conservation was studied. This program aimed to reduce by 0.5% of electric power in the company.

  4. GEOMETRIC ACCURACY ANALYSIS OF WORLDDEM IN RELATION TO AW3D30, SRTM AND ASTER GDEM2

    Directory of Open Access Journals (Sweden)

    S. Bayburt

    2017-05-01

    Full Text Available In a project area close to Istanbul the quality of WorldDEM, AW3D30, SRTM DSM and ASTER GDEM2 have been analyzed in relation to a reference aerial LiDAR DEM and to each other. The random and the systematic height errors have been separated. The absolute offset for all height models in X, Y and Z is within the expectation. The shifts have been respected in advance for a satisfying estimation of the random error component. All height models are influenced by some tilts, different in size. In addition systematic deformations can be seen not influencing the standard deviation too much. The delivery of WorldDEM includes information about the height error map which is based on the interferometric phase errors, and the number and location of coverage’s from different orbits. A dependency of the height accuracy from the height error map information and the number of coverage’s can be seen, but it is smaller as expected. WorldDEM is more accurate as the other investigated height models and with 10 m point spacing it includes more morphologic details, visible at contour lines. The morphologic details are close to the details based on the LiDAR digital surface model (DSM. As usual a dependency of the accuracy from the terrain slope can be seen. In forest areas the canopy definition of InSAR X- and C-band height models as well as for the height models based on optical satellite images is not the same as the height definition by LiDAR. In addition the interferometric phase uncertainty over forest areas is larger. Both effects lead to lower height accuracy in forest areas, also visible in the height error map.

  5. ATLAS-AWS

    International Nuclear Information System (INIS)

    Gehrcke, Jan-Philip; Stonjek, Stefan; Kluth, Stefan

    2010-01-01

    We show how the ATLAS offline software is ported on the Amazon Elastic Compute Cloud (EC2). We prepare an Amazon Machine Image (AMI) on the basis of the standard ATLAS platform Scientific Linux 4 (SL4). Then an instance of the SLC4 AMI is started on EC2 and we install and validate a recent release of the ATLAS offline software distribution kit. The installed software is archived as an image on the Amazon Simple Storage Service (S3) and can be quickly retrieved and connected to new SL4 AMI instances using the Amazon Elastic Block Store (EBS). ATLAS jobs can then configure against the release kit using the ATLAS configuration management tool (cmt) in the standard way. The output of jobs is exported to S3 before the SL4 AMI is terminated. Job status information is transferred to the Amazon SimpleDB service. The whole process of launching instances of our AMI, starting, monitoring and stopping jobs and retrieving job output from S3 is controlled from a client machine using python scripts implementing the Amazon EC2/S3 API via the boto library working together with small scripts embedded in the SL4 AMI. We report our experience with setting up and operating the system using standard ATLAS job transforms.

  6. Cognition through montage and mechanisms of individual memory in Bogusław Bachorczyk's art on the example of the artist's apartment-studio

    Directory of Open Access Journals (Sweden)

    Antos, Janusz

    2014-12-01

    Full Text Available The present text discusses Bogusław Bachorczyk's apartment-studio in Krakow. The decorations he has been making there since 2003 have transformed into a kind of work-in-progress. These decorations, just like Bachorczyk's art, are related to the issues of memory and identity. In 2013 he started the transformation of his apartment by "lacing up the wall" with polychrome in the library room, later to embrace also other rooms. He installed into existing polychromes new elements according to the rule of montage, which has recently constituted the basic strategy of his work.

  7. Otfrid Foerster, the great neurologist and neurosurgeon from Breslau (Wrocław): his influence on early neurosurgeons and legacy to present-day neurosurgery.

    Science.gov (United States)

    Piotrowska, Natalia; Winkler, Peter A

    2007-08-01

    As a result of the turbulences of World War II, Wrocław, Poland (formerly Breslau, Germany) lost its internationally acknowledged position in the field of neurosurgery, which it once had thanks to Otfrid Foerster. This innovative German doctor and scientist made a considerable contribution to the development of neurological and neurosurgical research worldwide. He also made Breslau a renowned center for scientific study, luring researchers from around the world. His achievements influenced many neurosurgeons during his lifetime, above all those from the US and England, including, for example, such well-known men as Fulton, Bucy, Bailey, and Penfield (who worked with Foerster in Breslau for quite a long time). Together Foerster and Penfield searched for the causes of epilepsy and the surgical methods to treat it. For young American neurosurgeons it was a very significant step in their careers to be able to train in Breslau under the guidance of Otfrid Foerster. In 1937 the British Association of Neurological Surgeons visited Breslau and awarded him with the honor of "Member Emeritus," which could be seen as the culmination of Foerster's career. In this paper the authors give an overview of Foerster's work and evaluate its significance. They also elucidate the difficult historical background during fascism in Germany using the sources of the Polish National Archives. Dr. Foerster's remaining traces in today's Wrocław are meticulously reported.

  8. Biodegradation and kinetics of organic compounds and heavy metals in an artificial wetland system (AWS) by using water hyacinths as a biological filter.

    Science.gov (United States)

    Rodríguez-Espinosa, P F; Mendoza-Pérez, J A; Tabla-Hernandez, J; Martínez-Tavera, E; Monroy-Mendieta, M M

    2018-01-02

    The objective of the present study was to investigate the ability of water hyacinth (Eichhornia crassipes) to absorb organic compounds (potassium hydrogen phthalate, sodium tartrate, malathion, 2,4-dichlorophenoxy acetic acid (2,4-D), and piroxicam). For the aforementioned purpose, an artificial wetland system (AWS) was constructed and filled with water hyacinth collected from the Valsequillo Reservoir, Puebla, Mexico. Potassium hydrogen phthalate and sodium tartrate were measured in terms of chemical oxygen demand (COD) and biological oxygen demand (BOD). The present study indicated that the water hyacinths absorbed nearly 1.8-16.6 g of COD kg -1 dm (dry mass of water hyacinth), while the absorbance efficiency of BOD was observed to be 45.8%. The results also indicated that the maximum absorbance efficiency of malathion, 2,4-D, and piroxicam was observed to be 67.6%, 58.3%, and 99.1%, respectively. The kinetics of organic compounds fitted different orders as malathion followed a zeroth-order reaction, while 2,4-D and piroxicam followed the first-order reactions. Preliminary assessment of absorption of heavy metals by the water hyacinth in the AWS was observed to be (all values in mg g -1 ) 7 (Ni), 13.4 (Cd), 16.3 (Pb), and 17.5 (Zn) of dry biomass, thus proving its feasibility to depurate wastewater.

  9. Estudio microestructural y de resistencia de uniones soldadas de la aleación AW7020 por procedimiento MIG en función de la preparación de bordes

    Directory of Open Access Journals (Sweden)

    Bloem, Carlos Alberto

    2000-02-01

    Full Text Available Medium strength AW7XXX aluminium alloys are widely used as welded structures and in transportation. The applications of these alloys are limited by the behavior of the welded joints. There is not an agreement on the joint geometry that must be used on the 5 mm aluminium welds. The microhardness evolution is one of the most important strength indicator, For this reason, the aim of this work is to study the welded joint geometry influence on microhardness profile and on microstructure of a welded aluminium alloy AW7020 MIG, filled with AW5356.

    Las aleaciones de aluminio de la serie AW7XXX de medias prestaciones se están empleando ampliamente en el sector del transporte, así como en la construcción de estructuras soldadas. La posibilidad de que estas aleaciones se empleen con mayor profusión está condicionada a un mayor conocimiento del comportamiento de la unión soldada. La evolución de la microdureza como un indicador de resistencia es ampliamente utilizado, pero no hay acuerdo sobre el efecto de la preparación de bordes previo a la soldadura y es por ello que el objetivo de este trabajo sea estudiar la influencia de la preparación de bordes sobre el perfil de microdureza y microestructura de la unión soldada de una aleación de aluminio AW7020, soldada mediante el proceso MIG, empleando como metal de aporte AW5356.

  10. “Secure the Bastion of Sensation”: Seamus Heaney’s and Czesław Miłosz’s Poetry of the Everyday

    Directory of Open Access Journals (Sweden)

    Tomasz Bilczewski

    2015-07-01

    Full Text Available This essay attempts to situate Seamus Heaney’s poetics of the everyday in relation to the work of Czesław Miłosz, who for many years served as one of his sources of inspiration. Although Heaney frequently treated Polish poetry as a lesson in the poet’s ethical responsibility, he also found in it, thanks to translations, a testimony to amazement at seemingly trite objects and trivial phenomena. A comparative analysis of selected poems confronts Miłosz’s and Heaney’s poetry of the everyday with the long tradition of literary epiphanies, paying particular attention to the Romantic and Modernist moments, and to both poets’ turn towards the Dutch masters.

  11. The effect of hydrodistillation technique on the yield and composition of essential oil from the seed of petroselinum crispum (mill. Nym. Ex. A.W. Hill

    Directory of Open Access Journals (Sweden)

    Stanković Mihajlo Z.

    2004-01-01

    Full Text Available The essential oil was isolated from the seed of Petroselinum crispum (Mill. Nym. ex. A.W. Hill by using different techniques of Clevenger-type hydrodistillation. The highest yield of oil, after five consecutive hydrodistillation runs (3.9 mL/100 g of plant material, was obtained by the technique in which water from the still flask was separated by filtration and used together with fresh water for immersing the plant material in a subsequent distillation. Regardless of the technique used, the oil contained different amounts of α-pinene, ß-p/nene, limonene, 2,3,4,5-tetramethoxy-1-allylbenzene, apiole and 1,2-benzenedicarbonic acid.

  12. A dialogue in the middle of the road: Czesław Miłosz as reader and translator of Carlos Drummond de Andrade

    Directory of Open Access Journals (Sweden)

    Marcelo Paiva de Souza

    2015-04-01

    Full Text Available In Wypisy z ksiąg użytecznych (Extracts from Useful Books, a very personal commented anthology of world poetry selected, prefaced and mostly translated by Czesław Miłosz himself (the volume also contains other translators’ versions, as well as pieces of Polish poetry, he has included only one text of a single Brazilian author: Carlos Drummond de Andrade’s “In the Middle of the Road”. Rewritten – and reread – in Polish, the poem is likely to show unfamiliar and all the more interesting facets of Drummond’s writing. Furthermore, it offers a revealing perspective of Miłosz’ work as a poet and critic of modern poetry.

  13. Noise level arrangement in determined zones of homogenous development of green areas on the example of the spa park in Inowrocław

    Science.gov (United States)

    Sztubecka, Małgorzata; Skiba, Marta

    2016-11-01

    Noise measurements are usually carried out in developed areas as well as in the surroundings of traffic routes providing basis for actions in order to limit its influence on the neighboring areas. Noise measurements in park areas are rare due to belief that these areas are silent zones. Such attitude cannot be justified. This article aims to the assessment of noise appearing in determined subzones of the spa park in Inowrocław. From the research carried out it can be noticed that traffic noise does not have any important meaning for the acoustic climate of the park. It is the people who stay there who generate more noise. Comparative analysis proves the appearance and penetration of noise from the zones with greater level of noise to the ones with lower amount.

  14. Mugwort (Artemisia L., nettle (Urtica L. and plantain (Plantago L. pollen in the atmosphere of Wrocław in the years 2002-2004

    Directory of Open Access Journals (Sweden)

    Małgorzata Malkiewicz

    2012-12-01

    Full Text Available The paper includes the results of pollen season analysis of the selected plants (mugwort, nettle, plantain regarded as the most allergenic in Wrocław in 2002-2004. The studies were carried out using volumetric method (Burkard trap. The results show strong variation in pollen seasons. The average duration of the pollen season of Artemisia was 82 days. The highest pollen concentration of mugwort was recorded in 2004 (156 grains × m-3. The start of nettle pollen seasons varied in studied period on average by 24 days, on average, but its end was almost the same. The pollen season of Urtica was the earliest in 2004. It started on 5th May and lasted 136 days. The annual pollen total of Plantago was relatively low, on average 0.2-0.4% in annual pollen totals.

  15. Sporulation boundaries and spore formation kinetics of Bacillus spp. as a function of temperature, pH and a(w).

    Science.gov (United States)

    Baril, Eugénie; Coroller, Louis; Couvert, Olivier; El Jabri, Mohammed; Leguerinel, Ivan; Postollec, Florence; Boulais, Christophe; Carlin, Frédéric; Mafart, Pierre

    2012-10-01

    Sporulation niches in the food chain are considered as a source of hazard and are not clearly identified. Determining the sporulation environmental boundaries could contribute to identify potential sporulation niches. Spore formation was determined in a Sporulation Mineral Buffer. The effect of incubation temperature, pH and water activity on time to one spore per mL, maximum sporulation rate and final spore concentration was investigated for a Bacillus weihenstephanensis and a Bacillus licheniformis strain. Sporulation boundaries of B. weihenstephanensis and of B. licheniformis were similar to, or included within, the range of temperatures, pH and water activities supporting growth. For instance, sporulation boundaries of B. weihenstephanensis were evaluated at 5°C, 35°C, pH 5.2 and a(w) 0.960 while growth boundaries were observed at 5°C, 37°C, pH 4.9 and a(w) 0.950. Optimum spore formation was determined at 30°C pH 7.2 for B. weihenstephanensis and at 45°C pH 7.2 for B. licheniformis. Lower temperatures and pH delayed the sporulation process. For instance, the time to one spore per mL was tenfold longer when sporulation occurred at 10°C and 20°C, for each strain respectively, than at optimum sporulation temperature. The relative effect of temperature and pH on sporulation rates and on growth rates is similar. This work suggests that the influence of environmental factors on the quantitative changes in sporulation boundaries and rates was similar to their influence on changes in growth rate. Copyright © 2012 Elsevier Ltd. All rights reserved.

  16. Composition and quantities of retained gas measured in Hanford waste tanks 241-AW-101 A-101, AN-105, AN-104, and AN-103

    International Nuclear Information System (INIS)

    Shekarriz, A.; Rector, D.R.; Mahoney, L.A.

    1997-03-01

    This report provides the results obtained for the first five tanks sampled with the Retained Gas Sampler (RGS): Tanks 241-AW-101, A-101, AN-105, AN-104, and AN-103. The RGS is a modified version of the core sampler used at Hanford. It is designed specifically, in concert with the gas extraction equipment in the hot cell, to capture and extrude a gas-containing waste sample in a hermetically sealed system. The retained gases are then extracted and stored in small gas canisters. The composition of the gases contained in the canisters was measured by mass spectroscopy. The total gas volume was obtained from analysis of the extraction process, as discussed in detail throughout this report. The following are the findings of this research: (1) The RGS is a viable approach for measuring retained gases in double- and single-shell waste tanks at Hanford. (2) Local measurements of void fraction with the RGS agree with the results obtained with the void fraction instrument (VFI) in most cases. (3) In the tanks sampled, more than 16% of the retained gas in the nonconvective layer was nitrogen (N 2 ). The fraction of nitrogen gas was approximately 60% in Tank 241-AW-101. This finding shows that not all the retained gas mixtures are flammable. (4) In the tanks sampled, the ratios of hydrogen to oxidizers were observed to be significantly higher than 1; i.e., these tanks are fuel-rich. Based on these observations, the RGS will be used to sample for retained gases in several single-shell tanks at Hanford. The remaining sections of this summary describe the RGS-findings for the first five tanks tested. The results are described in the order in which the tanks were sampled, to reflect the increasing experience on which RGS methods were based

  17. Current procedures of the integrated urban vector-mosquito control as an example in Cotonou (Benin, West Africa) and Wrocław area (Poland).

    Science.gov (United States)

    Rydzanicz, Katarzyna; Lonc, Elzbieta; Becker, Norbert

    2009-01-01

    Current strategy of Integrated Vector Management (IVM) comprises the general approach of environmentally friendly control measures. With regard to mosquitoes it includes first of all application of microbial insecticides based on Bacillus thuringiensis israelensis (Bti) and B. sphaericus (Bs) delta-endotoxins as well as the reduction of breeding habitats and natural enemy augmentation. It can be achieved thorough implementation of the interdisciplinary program, i. e., understanding of mosquito vector ecology, the appropriate vector-diseases (e. g., malariometric) measurements and training of local personnel responsible for mosquito abatement activities, as well as community involvement. Biocontrol methods as an alternative to chemical insecticides result from the sustainability development concept, growing awareness of environmental pollution and the development of insecticide-resistant strains of vector-mosquito populations in many parts of the world. Although sustainable trends are usually considered in terms of the monetary and training resources within countries, environmental concerns are actually more limiting factors for the duration of an otherwise successful vector control effort. In order to meet these new needs, increasing efforts have been made in search of and application of natural enemies, such as parasites, bacterial pathogens and predators which may control populations of insect vectors. The biological control agent based on the bacterial toxins Bti and Bs has been used in the Wrocław's University and Municipal Mosquito Control Programs since 1998. In West-Africa biocontrol appears to be an effective and safe tool to combat malaria in addition to bed-nets, residual indoor spraying and appropriate diagnosis and treatment of malaria parasites which are the major tools in the WHO Roll Back Malaria Program. IVM studies carried out 2005-2008 in Cotonou (Benin) as well those in Wrocław Irrigated Fields during the last years include the following major

  18. Conjugative plasmid pAW63 brings new insights into the genesis of the Bacillus anthracis virulence plasmid pXO2 and of the Bacillus thuringiensis plasmid pBT9727

    Directory of Open Access Journals (Sweden)

    Mahillon Jacques

    2005-07-01

    Full Text Available Abstract Background Bacillus cereus, Bacillus anthracis and Bacillus thuringiensis belong to the genetically close-knit Bacillus cereus sensu lato group, a family of rod-shaped Gram-positive bacteria. pAW63 is the first conjugative plasmid from the B. cereus group to be completely sequenced. Results The 71,777 bp nucleotide sequence of pAW63 reveals a modular structure, including a 42 kb tra region encoding homologs of the Type IV secretion systems components VirB11, VirB4 and VirD4, as well as homologs of Gram-positive conjugation genes from Enterococcus, Lactococcus, Listeria, Streptococcus and Staphylococcus species. It also firmly establishes the existence of a common backbone between pAW63, pXO2 from Bacillus anthracis and pBT9727 from the pathogenic Bacillus thuringiensis serovar konkukian strain 97-27. The alignment of these three plasmids highlights the presence of well conserved segments, in contrast to distinct regions of high sequence plasticity. The study of their specific differences has provided a three-point reference framework that can be exploited to formulate solid hypotheses concerning the functionalities and the molecular evolution of these three closely related plasmids. This has provided insight into the chronology of their divergence, and led to the discovery of two Type II introns on pAW63, matching copies of the mobile element IS231L in different loci of pXO2 and pBT9727, and the identification on pXO2 of a 37 kb pathogenicity island (PAI containing the anthrax capsule genes. Conclusion The complete sequence determination of pAW63 has led to a functional map of the plasmid yielding insights into its conjugative apparatus, which includes T4SS-like components, as well as its resemblance to other large plasmids of Gram-positive bacteria. Of particular interest is the extensive homology shared between pAW63 and pXO2, the second virulence plasmid of B. anthracis, as well as pBT9727 from the pathogenic strain B. thuringiensis

  19. Influence of the welding temperature and the welding speed on the mechanical properties of friction stir welds in EN AW-2219-T87

    Science.gov (United States)

    Bachmann, A.; Krutzlinger, M.; Zaeh, M. F.

    2018-06-01

    Friction Stir Welding (FSW) is an innovative joining technique, which has proven to produce high quality joints in high strength aluminum alloys. Consequently, it is commonly used to manufacture lightweight aerospace structures with stringent requirements. For these structures, it is necessary to ensure a high ultimate tensile strength (UTS). Various studies have reported that the UTS is significantly influenced by the welding parameters. Samples welded with different parameter sets showed a considerably different UTS, despite being free from detectable welding defects (e.g. tunnel defect, voids, or lack of penetration). Based on the observations in the literature, a hypothesis was posed. The welding temperature along with the welding speed determine the UTS of the weld. This study aims to prove this hypothesis experimentally by using temperature-controlled FSW to join plates of EN AW-2219-T87 in butt joint configuration. The welded samples were examined using visual inspection, metallography, X-ray imaging, and uniaxial tensile tests. Finally, a statistical analysis was conducted. Hereby, the hypothesis was confirmed.

  20. Reading between the lines. Czesław Miłosz’s Native Realm. A Search for Self-Definition and its English/American translation

    Directory of Open Access Journals (Sweden)

    Bartłomiej Biegajło

    2011-01-01

    Full Text Available The aim of this article is to discuss the problem of translating Polish prose, based on an analysis of a selection of samples taken from Czesław Miłosz’s Native Realm. A Search for Self-Definition translated by Catherine S. Leach. The book documents specific relations between the Western and the Eastern Europe determined by historical provenance of the realms in question. The dichotomy of the collective European history has a profound influence on the reception of Polish literature among the Western audience. Native Realm showcases the issue perfectly – it is interesting in terms of its careful account of the historical and social development of the Continent. The perception of reality is conditioned by an inherent dissimilarity of experiences between the West and the East. The intention of Miłosz was to provide an analysis of them and produce an insightful book addressed specifically to the Western readership. My discussion is an attempt to prove that the endeavour is doomed to failure due to the intrinsic differences between the cultures involved, as cultural inheritance determines the interpretation of historical facts and prompts dissimilar connotations. In the case of Native Realm, on the one hand, we encounter Miłosz’s vision/imagination that is irreversibly rooted in the Slavic way of looking at things and, on the other, the distinctively dissimilar Western vantage point. Translating these differences appears to be a major challenge for any translator.

  1. Czesław Miłosz’s ’Dar’(’Gift’ in the light of Jacques Derrida’s philosophy of gift

    Directory of Open Access Journals (Sweden)

    Tomasz Umerle

    2011-01-01

    Full Text Available The aim of this text is to present an attempt at the deconstructionist interpretation of Czesław Miłosz’s verse ‘Dar’ (‘Gift’. On the one hand, this paper emphasizes the moment of ‘dissemination’ of the literary work – the space between the title and ‘the rest’ of the text (which appeals more to the American deconstructionism is seen as both a connection and an irreducible gap. On the other hand, this ‘dissemination’ is understood in terms offered by J. Derrida’s philosophy of gift. Miłosz used a word ‘gift’ in the title, but in the ‘textual corpus’ he made this donation ‘imperceptible’. This observation enables the Author to interpret Miłosz’s poem in the context of Derrida’s discourse of (impossibility of gift. Consequently the title will be understood here as a gift to the text (the gift of meaning to the experience described there, but at the same time this gift/title will be seen as irreducibly separated from the ‘rest’ of the text, because of the relation between the title and the ‘textual corpus’.

  2. Effect of parsley (Petroselinum crispum (Mill.) Nym. ex A.W. Hill, Apiaceae) extracts on some biochemical parameters of oxidative stress in mice treated with CCl(4).

    Science.gov (United States)

    Popović, Mira; Kaurinović, Biljana; Jakovljević, Vida; Mimica-Dukic, Neda; Bursać, Marija

    2007-08-01

    The in vitro and in vivo antioxidant activity of different extracts of leaves and root of parsley (Petroselinum crispum (Mill.) Nym. ex A.W. Hill, Apiaceae) were studied. Free radical scavenging capacity (RSC) was evaluated measuring the scavenging activity on the 2,2-diphenyl-1-picrylhydrazil (DPPH) and OH radicals. Also, the effects on lipid peroxidation (LP) were evaluated. The results obtained showed that all examined extracts act as good scavengers of DPPH and OH radicals and reduce the intensity of LP. The in vivo effects were evaluated on some antioxidant systems (activities of LPx, GSH-Px, Px, CAT and XOD, and GSH content) in the mice liver and blood after treatment with the examined parsley extracts, or in combination with carbon tetrachloride (CCl(4)). On the basis of the results obtained it can be concluded that the examined extracts exhibited a certain protective effect. However, combined treatments with CCl(4) and the examined extracts showed both positive and negative synergism, inducing or suppressing the influence of CCl(4) alone. (c) 2007 John Wiley & Sons, Ltd.

  3. Laser coating of aluminum alloy EN AW 6082-T651 with TiB2 and TiC: Microstructure and mechanical properties

    Science.gov (United States)

    Ravnikar, Dunja; Dahotre, Narendra B.; Grum, Janez

    2013-10-01

    This paper deals with laser coating of ceramics by deposition of a precursor powder mixture of TiB2-TiC-Al on an EN AW 6082-T651 aluminum alloy. The resulting coating was studied by means of a microstructural and mechanical analysis. The coating has with TiC and TiB2 particles of various shapes and sizes embedded in an Al matrix, as well as being adherent and free of cracks with an average porosity lower than 2%. Microhardness in the coating is 40% higher than the uncoated alloy, while the microhardness in the laser melt zone and heat-affected zone dropped significantly. The wear test showed a great improvement in terms of the mass lost after the 30 min test. The three-point bending test was used to determine the flexural properties of the coated aluminum alloy. Higher content of TiB2 in ceramic components increases the flexural strength of the coated specimens, delaying the occurrence of the first crack in the coating or the occurrence of delamination. The measurements of residual stresses confirmed the presence of favorable compressive residual stresses in the surface coating. With depth, these stresses become tensile.

  4. M. TEMU-JUSTIN*', PG RISHA', YG MLAVWASI

    African Journals Online (AJOL)

    with the objective of promoting the efficient management of drug supply especially in the developing countries. Tanzania launched EDP in 1983 [I]. In addition to addressing the selection and procurement in the drug supply chain, a lot of effort has been put on training healthcare providers on the concept of rational drug use.

  5. Dialoogid kohatusest / Justin Ions ; tõlkinud Katrin Kivimaa

    Index Scriptorium Estoniae

    Ions, Justin

    2009-01-01

    Rahvusvaheline näitus "thisPLACEd" ("Kohatute koht") Tallinna Linnagaleriis 1. märtsini. Kuraatorid Silvina Der-Meguerditchian ja Reet Varblane. Suur osa näitusel osalevatest kunstnikest on armeenia päritolu. Koostöösse on kaasatud Eestiga seotud kunstnikud Olga Jürgenson (elab Londonis) ja Eléonore de Montesquiou

  6. Justin Bieber Featuring Slipknot: Consumption as Mode of Production

    OpenAIRE

    Brøvig-Hanssen, Ragnhild

    2016-01-01

    The chapter is taken from the book: The Oxford Handbook of Music and Virtuality edited by Sheila Whiteley and Shara Rambarran, 2016, reproduced by permission of Oxford University Press https://doi.org/10.1093/oxfordhb/9780199321285.001.0001

  7. Just-in time system and climate change

    Energy Technology Data Exchange (ETDEWEB)

    Caceres, J.; Richards, D.

    1999-10-01

    The recent trends in freight transportation and its relationship with production and distribution were analyzed. This was done in an effort to help policy makers develop strategies to reduce greenhouse gas emissions and to develop a freight transportation system and a route system that is environmentally, economically and socially sustainable. One of the ways to find a solution is to restructure the overall industry organization and its link to transportation and the economy. However, this method is met with a lot of resistance by policy makers. Another method would be to find a way to delay or avoid restructuring; for example, by using unlimited greenhouse gas emissions trading. By doing so, emissions reductions would be targeted where they are most economically efficient. 18 refs., 1 fig.

  8. 2599-IJBCS-Article-Arcadius Yves Justin A+

    African Journals Online (AJOL)

    hp

    (Toffo) introduite depuis 1916 (Béhaghel,. 1999) et la provenance dite tanzanienne. Cette dernière a montré de meilleures performances de croissance (Azankpan et al., 2009 ;. Kokutse et al., 2009). La provenance tanzanienne introduite dans le pays par l'Office National du Bois, entreprise publique en charge de la gestion ...

  9. Adventures from Justin's Life: Engaging Your Physics Students

    Science.gov (United States)

    Ridgley, James A.; Herron, Sherry S.

    2018-03-01

    Many teachers have had students ask the proverbial question, "When will I ever use this in my life?" In the sciences, especially physics, teachers seem to battle this torrent of indifference continually. Although many areas of our students' lives can distract them from their academic pursuits, we as teachers must be introspective in order to prevent our teaching style from becoming one of our students' potential distractions. For example, a problem source with teaching physics may be an inability to successfully pique students' interest in our lessons. According to Barrett, student engagement is critical in order for learning to occur. Student engagement is so crucially important that researchers from across the globe attempt to assist teachers in the careful construction of pedagogical "hooks" whereby they can actively engage their students. A student who is not academically engaged may find little use for what is presented and may be bored stiff during the lesson. Regardless of your theoretical perspectives on learning, constructivists to traditionalists alike have no excuse to be boring, and therefore should engage their students before presenting physics concepts.

  10. 2798-IJBCS-Article-Arcadius Yves Justin Akossou

    African Journals Online (AJOL)

    hp

    économie béninoise. La filière est confrontée cependant à un certain nombre de difficultés, notamment la méconnaissance des caractéristiques des différentes variétés par les planteurs. Cette étude est donc une contribution à la caractérisation ...

  11. Effects of Process Conditions on the Mechanical Behavior of Aluminium Wrought Alloy EN AW-2219 (AlCu6Mn Additively Manufactured by Laser Beam Melting in Powder Bed

    Directory of Open Access Journals (Sweden)

    Michael Cornelius Hermann Karg

    2017-01-01

    Full Text Available Additive manufacturing is especially suitable for complex-shaped 3D parts with integrated and optimized functionality realized by filigree geometries. Such designs benefit from low safety factors in mechanical layout. This demands ductile materials that reduce stress peaks by predictable plastic deformation instead of failure. Al–Cu wrought alloys are established materials meeting this requirement. Additionally, they provide high specific strengths. As the designation “Wrought Alloys” implies, they are intended for manufacturing by hot or cold working. When cast or welded, they are prone to solidification cracks. Al–Si fillers can alleviate this, but impair ductility. Being closely related to welding, Laser Beam Melting in Powder Bed (LBM of Al–Cu wrought alloys like EN AW-2219 can be considered challenging. In LBM of aluminium alloys, only easily-weldable Al–Si casting alloys have succeeded commercially today. This article discusses the influences of boundary conditions during LBM of EN AW-2219 on sample porosity and tensile test results, supported by metallographic microsections and fractography. Load direction was varied relative to LBM build-up direction. T6 heat treatment was applied to half of the samples. Pronounced anisotropy was observed. Remarkably, elongation at break of T6 specimens loaded along the build-up direction exceeded the values from literature for conventionally manufactured EN AW-2219 by a factor of two.

  12. Comparison of organic and inorganic ion exchangers for removal of cesium and strontium from simulated and actual Hanford 241-AW-101 DSSF tank waste

    International Nuclear Information System (INIS)

    Brown, G.N.; Bray, L.A.; Carlson, C.D.

    1996-04-01

    A number of organic and inorganic exchangers are being developed and evaluated for cesium removal from Hanford tank wastes. The exchangers of interest that are investigated in this work include powdered (IONSIV reg-sign IE-910; referred to as IE-910) and engineered (IONSIV reg-sign IE-911; referred to as IE-911) forms of the crystalline silico-titanate (CST) inorganic sorbent developed by Sandia National Laboratories (SNL)/Texas A and M and prepared by UOP; a phenol-formaldehyde (CS-100) resin developed by Rohm and Haas; a resorcinol-formaldehyde (R-F) polymer developed at the Westinghouse Savannah River Company (WSRC) and produced by Boulder Scientific; an inorganic zeolite exchanger produced by UOP (IONSIV reg-sign TIE-96; referred to as TIE-96); an inorganic sodium titanate produced by Allied Signal/Texas A and M (NaTi); and a macrocyclic organic resin developed and produced by IBC Advanced Technologies (SuperLig reg-sign 644; referred to as SL-644). Several of these materials are still under development and may not be in the optimal form. The work described in this report involves the direct comparison of the ion exchange materials for the pretreatment of actual and simulated Hanford tank waste. Data on the performance of all of the exchangers with simulated and actual double shell slurry feed (DSSF) is included. The DSSF waste is a mixture of the supernate from tanks 101-AW (70%), 106-AP (20%) and 102-AP (10%). The comparative parameters include radionuclide removal efficiency under a variety of conditions and material properties (e.g., bed density and percent removable water). Cesium and strontium distribution (K d ), lambda (λ = K d x ρ b ), and decontamination factors (DF) are compared as a function of exchanger contact duration, solution composition (Na and Cs concentration), exchanger/waste phase ratio, and multiple sequential contacts

  13. Portrait of a viral infection: The infection cycle of Vibrio vulnificus phage VvAW1 visualized through plaque assay, electron microscopy, and proteomics

    Science.gov (United States)

    Clah, K. E. Y.; Nigro, O. D.; Miranda, J.; Schvarcz, C.; Culley, A.; Saito, M. A.; Steward, G.

    2016-02-01

    The bacterium Vibrio vulnificus is an opportunistic human pathogen that thrives in warm brackish waters. Viral infection is one of several mechanisms influencing the population dynamics of this bacterium in the natural environment. V. vulnificus-specific viruses have been isolated; however, the details of their infection cycle have not been reported. As a result, our current understanding of the interaction between the bacterium and its viruses in the environment is limited. To better understand the infection process, a strain of V. vulnificus (V93D1V) and its bacteriophage, Vibrio phage VvAW1, were isolated from the estuarine waters of the Ala Wai Canal, HI. A time-series infection experiment was conducted with the virus-host pair in which samples were collected every ten minutes for eighty minutes post-infection for analysis by plaque assay, electron microscopy, and proteomics. Using electron microscopy, visibly infected bacteria were observed forty minutes after the introduction of the virus, signaling the end of the eclipse period. The peak of infection occurred at seventy minutes with an average viral load of 78 viruses per bacterium. The percentage of visibly infected bacteria reached a maximum just prior to a rise in free viruses in the culture, indicating the end of the latent period. The percentage of infected cells that lysed was low and there was little effect on the bacterial population growth rate. Analysis of the proteome revealed that protein expression patterns, in particular capsid and other structural proteins, closely follow the timing of the observed infection cycle. Together, these analyses provided the first detailed view of a viral infection in a highly lethal aquatic bacterium. The apparent temperate nature of this virus suggests that it can be a source of mortality to V. vulnificus, but has evolved to avoid total destruction of its host by complete lysis, a characteristic that helps ensure its replication in subsequent generations.

  14. The Colourful Space of Pure Form. The Problem of Colour in Theory and Practice in the Work of Stanisław Ignacy Witkiewicz

    Directory of Open Access Journals (Sweden)

    Anna Żakiewicz

    2010-01-01

    Full Text Available Colour was a very important problem in the whole work of Stanisław Ignacy Witkiewicz. Not only a whole chapter of his basic theoretical work Nowe formy w malarstwie (New Forms in Painting, published 1919 was devoted to that but the artist also examined his theory in practice executing many paintings presenting his ideas (e.g. Self-portrait, 1913, Portrait of Feliks Lewiński, 1917, Portrait of Maria Witkiewiczowa, 1918 and many others. A base for that was a harmony of complementary colours: green and red, blue and orange, violet and yellow. Many theorists before Witkacy were interested in that: Wolfgang Goethe, Philip Otto Runge, Wassili Kandinsky. The artist didn’t mention them in his deliberations but a psychologist, Hermann Ebinghaus (Grundzüge der Psychologie, 1897 and other artists only: Paul Gauguin and Pablo Picasso. Witkacy even copied one of Gauguin’s paintings, Te Arii Vahine and described it in his writings as the best example of Pure Form. Witkacy enthusiastically described Picasso’s paintings in his first novel 622 upadki Bunga (622 Downfalls of Bungo, written ca. 1910, first published 1972 and mentioned many times in his theoretical works. The artist appreciated also Georges Seurat’s paintings and his thoughts on colours. Witkacy himself created a detailed systempresenting the best colour schemes and described many compositions corresponding to that. In 1938 the artist wrote an article O istocie malarstwa (On the Essence of Painting, which was an opposition to his earlier thoughts. In the end of his life the artist decided that the most important was imagination instead of theoretical rules.

  15. Revitalisation As a Force Promoting Spatial Changes in Wrocław/ Idea Rewitalizacji Motorem Przemian Przestrzennych Wrocławia

    Science.gov (United States)

    Kożan, Aldona

    2015-06-01

    The idea of revitalization, which grew out of the need to repair degraded urban spaces, has taken on a new meaning in the context of contemporary development challenges. The work includes references to the basic programme documents and strategies. It shows regeneration activities carried out in Wrocław in connection with the organization of international events, cultural and sport events, and with the improvement of spatial order. These actions contributed to the revitalization of the image of the city. The paper contains the results of these changes, the complementarity of decisions and their impact on social behaviour. Idea rewitalizacji, wyrosła z konieczności naprawy zdegradowanych przestrzeni miejskich i zniesienia konfliktów społecznych, nabrała nowego znaczenia w kontekście współczesnych wyzwań rozwojowych. Władze Wrocławia opracowały strategię i szereg dokumentów programowych, których efektem są zrealizowane przedsięwzięcia rewitalizacyjne: obiekty stanowiące infrastrukturę techniczną dla realizacji imprez sportowo - kulturalnych (Stadion Miejski Euro 2012, obiekty Hali Stulecia, rozwoju nauki: kampusy uczelni wyższych i obiekty kultury). Rewitalizacji przestrzennej zostały poddane przestrzenie publiczne miasta: ulice i place, modernizacji i rozbudowie podlegały układy i obiekty transportowe: nowy terminal lotniczy, przebudowa Dworca Głównego we Wrocławiu. Działania rewitalizacyjne wpłynęły na nowy wizerunek miasta, podniosły jakość życia i wyzwoliły nowe zachowania społeczne. Praca zawiera wyniki tych przemian, komplementarności podjętych decyzji i ich wpływu na zachowania społeczne.

  16. Personalism in the Lublin School of Philosophy (Card. Karol Wojtyła, Fr. Mieczysław A. Krąpiec

    Directory of Open Access Journals (Sweden)

    Tomasz Duma

    2016-06-01

    Full Text Available The article presents the conception of personalism and the understanding of human person developed by two Polish philosophers: Karol Wojtyła and Mieczysław A. Krąpiec, the framers and the main representatives of the Lublin School of Philosophy. The author comes to the following conclusions: (1 Wojtyła’s and Krąpiec’s conception of personalism comes from experience and seeks verification in experience; it does not accept any a priori explanations or theses, though it does not shy away from drawing upon different branches of knowledge in its attempts to broaden experience, being aware that not everything is given to immediate experiential perception; (2 Wojtyła’s and Krąpiec’s personalism wants to draw on the whole philosophical tradition, taking into account, at the same time, the findings of different sciences of man or humanities which broaden the experience of man or contribute something to the interpretation of experience; (3 bringing together genetic empiricism and methodical rationalism, Wojtyła and Krąpiec are able to avoid radicalism in the explanation of man, making a successful attempt to join in a complementary way these aspects of personal human being which carry some opposition; (4 Wojtyła’s and Krąpiec’s conception of person does not bear any traces of antagonism since it is not directed against anyone; in the light of this conception every human person has a character of the honest good which is the unconditional good, that is the highest and the ultimate good not competing with the value of anything else; (5 Wojtyła and Krąpiec prove that the conception of human person lies at the basis of understanding society, culture, ethics, law, politics, economy, art, and even religion.

  17. What's So Terrible? So Awful?

    Science.gov (United States)

    Blessington, John P.

    1976-01-01

    Suggests that the business of schooling requires teachers who face their responsibilities with a rational perspective about themselves. Provides guidelines for examining what triggers off an undesirable emotion. (RK)

  18. PROFESSOR ZDZISŁAW ŻYGULSKI JR.: AN OUTSTANDING PERSON, A GREAT PERSONALITY, A MUSEUM PROFESSIONAL, A RESEARCHER ON ANTIQUE WEAPONS, ORIENTAL ART AND EUROPEAN PAINTING (1921–2015)

    OpenAIRE

    Teresa Grzybkowska

    2017-01-01

    Professor Zdzisław Żygulski Jr. (1921–2015) was one of the most prominent Polish art historians of the second half of the 20th century. He treated the history of art as a broadly understood science of mankind and his artistic achievements. His name was recognised in global research on antique weapons, and among experts on Rembrandt and Leonardo da Vinci. He studied museums and Oriental art. He wrote 35 books, about 200 articles, and numerous essays on art; he wrote for the daily press about h...

  19. Kėdainiai region in the creative work of Adam Mickiewicz, Oscar Miłosz, and Czesław Miłosz : mythologema of coming back

    OpenAIRE

    Sakalavičiūtė, Kristina

    2011-01-01

    The history of Lithuanian regional literature classifies Adam Mickiewicz, Oscar Miłosz, and Czesław Miłosz as the authors of Kėdainiai district. The fact that all of them have mentioned Kėdainiai in their creative work lays at the basis of such a classification. Mickiewicz, O. Miłosz, and Cz. Miłosz were writing about Kėdainiai region while living abroad. Personal and cultural memory, as well as imagination were essential for them because all three authors had “to be back” to Lithuania in ord...

  20. The churches dedicated to Saint Bishop and Martyr Stanisław in Kraków, built in 20th century

    Directory of Open Access Journals (Sweden)

    Józef Szymon Wroński

    2003-12-01

    Full Text Available 1. Die Pfarrkirche Zum Hl Bischof und Märtyrer Stanislaus in Dąbie Dąbie liegt 3 Kilometer östlich vom Stadtzentrum entfernt. In die Stadt wurde es 1911 eingemeindet. In den Jahren 1965-75 entstand hier eine Wohnsiedlung. In den nächsten Jahren -infolge der zunehmenden Einwohnerzahl - erfolgte eine Verdichtung der Wohnsiedlungsbebauung. Das Grundstück, auf dem die Kirche steht, liegt im Winkel zwischen der Weichsel und der Białucha, im Bereich der ehemaligen österreichischen Schanze FS-16. Es war stark mit Bäumen bepflanzt. Das bereitete aber viele Schwierigkeiten, d.h. es gab Probleme sowohl mit der Ausdünnung der Bäume, als auch mit der Erhaltung des restlichen Baumbestandes. Am 11. März 1982 erhielt Dąbie endlich eine Baugenehmigung für den Bau einer Kirche in der Wohnsiedlung. Die Kirche, die nach einem Projekt des Architekten Henryk Kamiński in den Jahren 1984-2000 errichtet wurde, ist der Gemeinde zur Verfügung gestellt, aber im Innern noch nicht ausgestattet. Der Bau der Kirche zerfällt in zwei Phasen: die erste Phase dauerte bis zum Jahre 1989, in dem es zu einem Probstwechsel kam. Der neue Probst und zugleich der Investor Wiesław Macuda übernahm den Bau in dem Moment, als die Mauern der Kirche bis zu den Sohlbänken ausgeführt waren. Mit voller Energie ging er ans Werk, um den Bau weiterzuführen. Die Kirche hat zwei Geschosse: - die sog. Unterkirche im Erdgeschoss und die Oberkirche. Die Kirche hat einen fast quadratischen Grundriss, der diagonal gestellt und stark modifiziert ist. Die eigentliche Kirche - die Oberkirche ist dreischiffig. Die Seitenschiffe sind von dem Mittelschiff durch (je einen Pfeiler getrennt. Das Mittelschiff hat einen Obergaden (Region der Fenster im Mittelschiff iner Basilika in der Form einer Lichtnische, durch die das Licht in den Raum hineinfällt und die ganze Kirche mit Licht überflutet ist. Von hier aus streben die „Scheiben-wände” der Obergadenlichtnische nach oben. Ziel ist die

  1. Using Amazon Web Services (AWS) to enable real-time, remote sensing of biophysical and anthropogenic conditions in green infrastructure systems in Philadelphia, an ultra-urban application of the Internet of Things (IoT)

    Science.gov (United States)

    Montalto, F. A.; Yu, Z.; Soldner, K.; Israel, A.; Fritch, M.; Kim, Y.; White, S.

    2017-12-01

    Urban stormwater utilities are increasingly using decentralized "green" infrastructure (GI) systems to capture stormwater and achieve compliance with regulations. Because environmental conditions, and design varies by GSI facility, monitoring of GSI systems under a range of conditions is essential. Conventional monitoring efforts can be costly because in-field data logging requires intense data transmission rates. The Internet of Things (IoT) can be used to more cost-effectively collect, store, and publish GSI monitoring data. Using 3G mobile networks, a cloud-based database was built on an Amazon Web Services (AWS) EC2 virtual machine to store and publish data collected with environmental sensors deployed in the field. This database can store multi-dimensional time series data, as well as photos and other observations logged by citizen scientists through a public engagement mobile app through a new Application Programming Interface (API). Also on the AWS EC2 virtual machine, a real-time QAQC flagging algorithm was developed to validate the sensor data streams.

  2. ANALISIS POSITIONING RESTORAN CEPAT SAJI WARALABA FRIED CHICKEN DI BANJARMASIN BERDASARKAN PERSEPSI KONSUMEN (Studi Pada KFC Duta Mall, Texas Fried Chicken Duta Mall,AW Duta Mall Dan California Fried Chicken Rs Ulin Banjarmasin

    Directory of Open Access Journals (Sweden)

    Prihatini Ade Mayvita

    2016-04-01

    Full Text Available During  the  last  14  years,  the  growth  rate  of  fried  chicken  franchise  with  the concept of fast food restaurants in Banjarmasin is 12% per year. It is characterized by large number of outlets/stores of fried chicken franchise in Banjarmasin city as many as 10 outlets. Most of the existing outlets are in Duta Mall Banjarmasin.  This study aims to identify and analyze the competitive position of fried-chicken fast-food franchise restaurants based on the consumers’ perceptions (Study on KFC,  Texas  Fried  Chicken, AW  Duta  Mall  and  CFC  RS  Ulin  Banjarmasin. Perceptions formulated are based on the assessment of marketing mix, which consists of services, physical condition, Product, promotion, personal traits, Price, means of support, distribution and location. 100 respondents are taken as samples in this study, i.e. respondents who have eaten in the fourth Fried Chicken fast food franchise using the technique of non proportional stratified random sampling. Meanwhile, the technique of data analysis uses Multi Dimensional Scaling (MDS. The findings from the analysis using Multi Dimensional Scaling (MDS show inequality  positions  of  Fried  Chicken  franchise  restaurants,  Kentucky  Fried Chicken,  Texas  Chicken,  AW  and  California  Fried  Chicken,  based  on  their consumers’  perceptions:  1.  KFC  is  a  fried  chicken  franchise  restaurant  that has superiority over the ease in getting information for organizing parties, the rooms’ capacities, the frequency of advertisements, employee skills, appropriate Products with Prices. In addition, KFC also has special superiority over different/ unique fried chicken taste and more outlets than other fried chicken franchise restaurants; 2. Texas Fried chicken has superiority over the speed of Customer service,  cleanliness  of  the  room,  the  Product  pakaging  which  is  favorable  to consumers,  direct  gifts,

  3. Influência do pré-tratamento na ação anticorrosiva de revestimentos híbridos de sol-gel aplicados na liga EN AW-6063

    OpenAIRE

    Moreira, Edna Fernandes, 1985-

    2012-01-01

    Tese de mestrado em Química Tecnológica, apresentada à Universidade de Lisboa, através da Faculdade de Ciências, 2012 O presente trabalho teve como objetivo o estudo da influência de pré-tratamentos superficiais no desempenho à corrosão de revestimentos híbridos de sol-gel para a proteção de uma liga de alumínio frequentemente utilizada na construção civil. Para atingir esse objetivo foram aplicados diversos pré-tratamentos à liga de alumínio EN AW-6063. Os pré-tratamentos adotados consist...

  4. Evidence of tuberculosis among children in medieval (13th–15th century Wrocław: A case study of hip joint tuberculosis in a juvenile skeleton excavated from the crypt of the St. Elizabeth church

    Directory of Open Access Journals (Sweden)

    Cieślik Agata Izabela

    2017-06-01

    Full Text Available Paleopathological examinations of the skeletal remains of people who died centuries ago are material source of knowledge about health and diseases in the past. In this article, a case of skeletal tuberculosis from historical (13th-15th c. Wrocław, Poland has been presented. The juvenile skeleton excavated from grave No 93, from the crypt located under the church of St. Elizabeth, displayed pathological lesions within the right hip joint resulting from a chronic inflammation, which might have been assigned to signs typical for skeletal tuberculosis. The results of macroscopic and radiological analyses appeared to be consistent, and allowed to determine a reliable diagnosis of this paleopathological case.

  5. LiDAR and 2D Electrical Resistivity Tomography as a Supplement of Geomorphological Investigations in Urban Areas: a Case Study from the City of Wrocław (SW Poland)

    Science.gov (United States)

    Kasprzak, Marek; Traczyk, Andrzej

    2014-06-01

    In urbanized areas, particularly in lowland terrains and floors of large river valleys, the natural land configuration is often hard to recognize due to a long history of human activity. Accordingly, archaeological works in cities, which supply knowledge on settlement conditions, are usually accompanied by geological and geomophological research. Lately, data from light detection and ranging (LiDAR) have become a valuable source of information on urban land configuration. Geophysical methods are also becoming increasingly popular in background studies. The paper presents a method of using and linking these sources of spatial information about landforms in such areas. The main aim is to identify to what extent these complementary sources of data and the proposed method can be used in such a specific environment to reconstruct natural, buried terrain morphology. The city of Wrocław in Central Europe serves as an example. To this end geomorphometric studies were conducted with the use of digital elevation models (DEMs) based on LiDAR scanning and derivated land-surface parameters—SAGA Wetness Index, Channel Network Base Level and Altitude above Channel Network. The study also involved determining morphological edges and measurements of the meanders of the Odra, as well as expanding information on the spatial distribution of alluvia and the structure of slope breaks. To this end, geophysical measurements were conducted using the Two-Dimensional Electrical Resistivity Tomography method. Additionally, five typical sequences of man-made ground present within the perimeter of the city were distinguished. As a result, a map of the main landforms of Wrocław is presented. Finally, we argue that although high resolution DEM and derivate land-surface parameters are very useful in terrain analysis, places with thick man-made ground or strongly levelled areas must be recognized by geoarchaeological excavations or geological bore holes. The geophysical survey is useful to

  6. A discussion of a book: Historiografia prasy polskiej (do 1918 roku. Naukometryczna analiza dyscypliny 1945–2009 by Władysław Marek Kolasa. Kraków: Wydawnictwo Naukowe Uniwersytetu Pedagogicznego, 2013; “Prace Monograficzne” 678, ISBN 0239-6025, 978-83-7271-843-1, 525 pp. + BIbliography (CD (in Polish

    Directory of Open Access Journals (Sweden)

    Michał Kokowski

    2016-11-01

    Full Text Available This article presents a peer review of the book by Władysław Marek Kolasa on the historiography of the Polish press. It regards the methodology of historiography, the science of science and its sub-disciplines: scientometrics and bibliometrics.

  7. Paweł Bąk, Die Metapher in der Übersetzung. Studien zum Transfer der Aphorismen von Stanisław Jerzy Lec und der Gedichte von Wisława Szymborska, Peter Lang Europäischer Verlag der Wissenschaft en, Frankfurt am Main u. a. 2007 =...

    OpenAIRE

    Zieliński, Lech

    2008-01-01

    Paweł Bąk, Die Metapher in der Ubersetzung. Studien zum Transfer der Aphorismen von Stanisław Jerzy Lec und der Gedichte von Wisława Szymborska, Peter Lang Europaischer Verlag der Wissenschaft en, Frankfurt am Main u. a. 2007 = Danziger Beitrage zur Germanistik, Bd. 20 wyd. Andrzej Kątny, 332 strony

  8. Notes of Karol Górski in archival collections of the Archive of the General Congregation of Saint Michael the Archangel in Marki regarding Blessed Bronisław Markiewicz and his pupils

    Directory of Open Access Journals (Sweden)

    Roman Majka CSMA

    2012-12-01

    Full Text Available Professor Karol Górski (1903-1988 was an expert on spirituality in Poland, and an author of many publications, such as An outline of the history of spirituality in Poland published in Krakow in 1986. Professor was inspired by the Michaelite spirituality, while exploring the life and work of the founder of Michaelite Fathers - Blessed Father Bronislaw Markiewicz (1842-1912. Presently, Father Markiewicz's selected academic works and research material are preserved in Archive of the General Congregation of St. Michael the Archangel in Marki near Warsaw. Among many Górski's publications is an article The inner life of fr. Bronisław Markiewicz published in the journal "Our Past", Vol. 23, 1966, p. 239-278. Remaining in the collection are notes handwritten by Górski kept as "Calendarium", which attest to his thoroughness and diligence in research. Collected materials carefully prepared with the aim to enable most accurate reconstruction of the events of the Education Service of Miejsce Piastowe describe the life and work of the Blessed Markiewicz and his first pupils. Sustained contact of Górski with Michaelite Fathers is confirmed in preserved correspondence, especially the letters of fr. Valerian Moroz CSMA (1919-2005. Professor, drawing from the history of spirituality in Poland, read the current issues of the Church and was highly respectful of family values and providing care of poor people in need of help.

  9. Breeding avifauna of the Special Protection Area Natura 2000 ‘Grądy Odrzańskie’ in Czernica and Siechnice counties, Wrocław district (Poland

    Directory of Open Access Journals (Sweden)

    Kopij Grzegorz

    2015-03-01

    Full Text Available In 2009, in the Special Protection Area Natura 2000 ‘Grądy Odrzańskie’ in Czernica and Siechnice counties, Wrocław district, 95 breeding bird species were recorded. For 33 of them, maps of distribution of their breeding pairs are presented and for the remaining a relative abundance was estimated based on line transect method. In 2009, the following species were recorded in the study area for the first time: Cygnus olor, Crex crex, Upupa epops, and Picus canus. On the other hand, 11 species recorded in 1978-87 as breeding in the study area (Ciconia nigra, Pernis apivorus, Milvus migrans, Milvus milvus, Falco tinnunculus, Gallinago gallinago, Limosa limosa, Tringa totanus, Riparia riparia, Anthus campestris, Phoenicurus phoenicurus were not recorded again in 2009. It has been shown that Saxicola torquata, Ficedula albicollis, Corvus corax and Remiz pendulinus have increased in numbers. The following species recorded in 2009 as breeding in the the study area: Cygnus olr, Ciconia ciconia, Circus aeruginosus, Crex crex, Alcedo atthis, Dryocopus martius, Picus canus, Dendrocopos medius, Lulula arborea, Sylvia nisoria, Ficedula albicollis, Lanius collurio and Emberiza hortulana are included in Annex 1 of the Bird Directive.

  10. The Use of a Decision Support System for Sustainable Urbanization and Thermal Comfort in Adaptation to Climate Change Actions—The Case of the Wrocław Larger Urban Zone (Poland

    Directory of Open Access Journals (Sweden)

    Jan K. Kazak

    2018-04-01

    Full Text Available The increasing level of antropopression has a negative impact on environmental resources and has reached the level of our planetary boundaries. One limitation is land use change caused by urbanization. Global policies prove the need to undertake action in order to develop more sustainable human settlements, which would be adapted better to potential future climate change effects. Among such changes are the increase of average temperatures and extreme events like heat waves. Those changes are more severe in urban areas due to land use development, and result in the urban heat island effect (UHI, which has a negative impact on the thermal comfort of citizens. The paper presents a decision support system that can be used for the assessment of areas to the potential exposure to the UHI effect. The system integrates scenario analysis, land use modelling in cellular automata (Metronamica, and an indicator-based assessment in a geographic information system (ArcGIS. The applicability of the model is illustrated through developing scenarios for the future land use allocation of the Wrocław Larger Urban Zone (Poland. The results of the calculations show which scenario is the least vulnerable to UHI effects. Moreover, for each scenario, cores of urban areas were identified, in which certain urban design patterns accounting for adaptation to climate change could be implemented. The study provides a guideline for local authorities on where to focus actions in order to create more sustainable urban structures and to better adapt to climate change and environmental extremes.

  11. “kkw y kkw-zmAw. Un estudio del concepto de oscuridad en la Duat de los Libros del Más Allá del Reino Nuevo Egipcio”

    Directory of Open Access Journals (Sweden)

    Mariano Bonanno

    2017-06-01

    Full Text Available Los Libros del Más Allá del Reino Nuevo hablan incesantemente del estado pre y post paso de Ra por la Duat. El contexto de oscuridad revierte en luz, calor y movimiento con su presencia, para los difuntos que en la tierra actuaron conforme a mAat; los condenados, por el contrario, sufrían las puniciones consecuencia de su iniquidad. Los egipcios disponían de varios vocablos para aludir a la idea de oscuridad, pero sin lugar a dudas kkw y kkw-zmAw son los que más controversia nos generan dada la falta de límites y las eventuales superposiciones que entre ambas acepciones se producen. El presente artículo propone, además de profundizar los pioneros estudios de Hornung (1956a y 1956b, revisar ambos conceptos, contextualizarlos a los libros funerarios del Reino Nuevo -Libro del Amduat, Libro de las Puertas, Libro de las Cavernas y Libro de la Tierra-, y poner en consideración las definiciones que taxativamente proponen espacios y áreas de influencia precisas

  12. Correction of inaccuracies to article of Stanisław Brożek, „Does Polish soil classification, V edition, refer to all soils in our country“ published in the Soil Science Annual, vol. 63 no. 3/2012: 49–56

    Directory of Open Access Journals (Sweden)

    Marcinek Jerzy

    2014-03-01

    Full Text Available The paper presents correction of inaccuracies to the article entitled .Does Polish soil classification, V edition, refer to all soils in our country. by Stanisław Brożek published in Soil Science Annual, vol. 63, No. 3/2012: 49.56. The article of Stanisław Brożek is not a discussion paper but only a collection of numerous remarks, mostly non-professional, on .Polish soil classification. ed. 5, 2011 (SgP5. Since the article of Stanisław Brożek contains a lot of mistakes and inaccuracies arising from misunderstanding merits of a soil classification, as well as SgP5‘s text assessed, therefore in our paper wider merits discussion has not been taken. Correction of the erroneous statements of Author which relate to SgP5 were shown instead. Moreover, this paper is necessary as the Author is not a specialist in the field of soil classification, and his article was published in a pedological scientific journal.

  13. PROFESSOR ZDZISŁAW ŻYGULSKI JR.: AN OUTSTANDING PERSON, A GREAT PERSONALITY, A MUSEUM PROFESSIONAL, A RESEARCHER ON ANTIQUE WEAPONS, ORIENTAL ART AND EUROPEAN PAINTING (1921–2015

    Directory of Open Access Journals (Sweden)

    Teresa Grzybkowska

    2017-02-01

    Full Text Available Professor Zdzisław Żygulski Jr. (1921–2015 was one of the most prominent Polish art historians of the second half of the 20th century. He treated the history of art as a broadly understood science of mankind and his artistic achievements. His name was recognised in global research on antique weapons, and among experts on Rembrandt and Leonardo da Vinci. He studied museums and Oriental art. He wrote 35 books, about 200 articles, and numerous essays on art; he wrote for the daily press about his artistic journeys through Europe, Japan and the United States. He illustrated his publications with his own photographs, and had a large set of slides. Żygulski created many exhibitions both at home and abroad presenting Polish art in which armour and oriental elements played an important role. He spent his youth in Lvov, and was expatriated to Cracow in 1945 together with his wife, the pottery artist and painter Eva Voelpel. He studied English philology and history of art at the Jagiellonian University (UJ, and was a student under Adam Bochnak and Vojeslav Molè. He was linked to the Czartoryski Museum in Cracow for his whole life; he worked there from 1949 until 2010, for the great majority of time as curator of the Arms and Armour Section. He devoted his whole life to the world of this museum, and wrote about its history and collections. Together with Prof. Zbigniew Bocheński, he set up the Association of Lovers of Old Armour and Flags, over which he presided from 1972 to 1998. He set up the Polish school of the study of militaria. He was a renowned and charismatic member of the circle of international researchers and lovers of militaria. He wrote the key texts in this field: Broń w dawnej Polsce na tle uzbrojenia Europy i Bliskiego Wschodu [Weapons in old Poland compared to armaments in Europe and the Near East], Stara broń w polskich zbiorach [Old weapons in Polish armouries], Polski mundur wojskowy [Polish military uniforms] (together with H

  14. FURTHER EVIDENCE OF AN ASSOCIATION BETWEEN LOW SECOND-TO-FOURTH DIGIT RATIO (2D:4D) AND SELECTION FOR THE UNIFORMED SERVICES: A STUDY AMONG POLICE PERSONNEL IN WROCŁAW, POLAND.

    Science.gov (United States)

    Kozieł, Sławomir; Kociuba, Marek; Chakraborty, Raja; Sitek, Aneta; Ignasiak, Zofia

    2017-08-22

    Males and females differ in their preference for occupations and sporting activities, and differ also in risk-taking attitudes. In addition to other explanations, prenatal hormone exposure has been implicated in these gender-associated differences. The ratio of the relative lengths of the second-to-fourth digits (2D:4D) is a proxy indicator of prenatal exposure to testosterone relative to oestrogen. The 2D:4D ratio has been found to be associated with choice of occupation, particularly among females. This study investigated whether 2D:4D differed between police officers and a control group of civilians in Wrocław, Poland. Participants were 147 male and 55 female police officers and 91 male and 75 female civilian controls. The police officers had to undergo rigorous physical ability tests during recruitment and their job bore relatively higher risk, whereas the controls had a normal civilian lifestyle. Height, weight, hand grip strength and lengths of the second and fourth digits were measured. Analyses of variance and covariance were employed to assess the significance of difference in digit ratio between groups (police officers and civilians) allowing for interaction with sex. The policewomen, compared with the female controls, were taller and had stronger hand grip strength, but had lower 2D:4D in the right hand and average 2D:4D of both hands. However, male and female police officers slightly differed only in the right hand digit ratio but not in the left hand ratio or the average for the two hands. However, the control group showed significant sex differences in all digit ratios with higher (feminine) mean values in females. The study provides further evidence that prenatal testosterone exposure, as reflected in the 2D:4D ratio, might have an association with choice of occupation, particularly among females.

  15. 75 FR 63088 - RIN 1018-AW77

    Science.gov (United States)

    2010-10-14

    ..., contact Steve Kessler, Regional Subsistence Program Leader, USDA, Forest Service, Alaska Region; (907) 743... or more on the economy or adversely affect an economic sector, productivity, jobs, the environment... Service; and Steve Kessler, Alaska Regional Office, U.S. Forest Service. List of Subjects 36 CFR Part 242...

  16. AW OCRACY LOPMENT LAW DEMOCRACY & DEVELOPMENT

    African Journals Online (AJOL)

    LAW

    served as a central authority, while regional/provincial and local nobilities exercised ... and the accommodation of diversity in Ethiopia: A comparative study (2007) at 16; .... expansionist move.25 This was the case, for instance, in Kafa, the Oromo ..... and urban local government: woredas (districts) in rural areas and city ...

  17. It must be awful for them

    Directory of Open Access Journals (Sweden)

    Heather P. Lacey

    2006-11-01

    Full Text Available When survey respondents rate the quality of life (QoL associated with a health condition, they must not only evaluate the health condition itself, but must also interpret the meaning of the rating scale in order to assign a specific value. The way that respondents approach this task depends on subjective interpretations, resulting in inconsistent results across populations and tasks. In particular, patients and non-patients often give very different ratings to health conditions, a discrepancy that raises questions about the objectivity of either groups' evaluations. In this study, we found that the perspective of the raters (i.e., their own current health relative to the health conditions they rated influences the way they distinguish between different health states that vary in severity. Consistent with prospect theory, a mild and a severe lung disease scenario were rated quite differently by lung disease patients whose own health falls between the two scenarios, whereas healthy non-patients, whose own health was better than both scenarios, rated the two scenarios as much more similar. In addition, we found that the context of the rating task influences the way participants distinguish between mild and severe scenarios. Both patients and non-patients gave less distinct ratings to the two scenarios when each were presented in isolation than when they were presented alongside other scenarios that provided contextual information about the possible range of severity for lung disease. These results raise continuing concerns about the reliability and validity of subjective QoL ratings, as these ratings are highly sensitive to differences between respondent groups and the particulars of the rating task.

  18. AW OCRACY LOPMENT LAW DEMOCRACY & DEVELOPMENT

    African Journals Online (AJOL)

    User

    scrutinise and oversee government actions,8 thus providing it with the ... 2 Feldman D “The roles of parliaments in protecting human rights: A view ... Lecture delivered at the Law School, University of Melbourne (2006) available at ..... issues of national concern and in the subsequent ratification of treaties as the basis for.

  19. Across the Baltic : a Mission to Raise Awareness of Communist Crimes / Justin Petrone

    Index Scriptorium Estoniae

    Petrone, Justin, 1979-

    2008-01-01

    Paar aastat tagasi loodi Rootsis mittetulundusühing Organization for Information on Communism (UOK), et Rootsi noortele selgitada kommunismi olemust, selle mõju regiooni ja naaberriikide ajaloole, arengule ning tänapäevale. Organisatsiooni auliikmeteks on ka Carl Bildt ja Mart Laar

  20. Adventures from Justin's Life: Engaging Your Physics Students

    Science.gov (United States)

    Ridgley, James A., Jr.; Herron, Sherry S.

    2018-01-01

    Many teachers have had students ask the proverbial question, "When will I ever use this in my life?" In the sciences, especially physics, teachers seem to battle this torrent of indifference continually. Although many areas of our students' lives can distract them from their academic pursuits, we as teachers must be introspective in…

  1. PacIOOS Water Quality Buoy AW (WQB-AW): Ala Wai, Oahu, Hawaii

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The water quality buoys are part of the Pacific Islands Ocean Observing System (PacIOOS) and are designed to measure a variety of ocean parameters at fixed points....

  2. Riflessioni sulla ricezione italiana di Czesław Miłosz. Con annessa una bibliografia italiana delle opere e della critica [The reception of the works of Czeslaw Milosz in Italy. With the complete bibliography of Milosz’s texts and texts on Milosz in Italian

    Directory of Open Access Journals (Sweden)

    Anna Małyszkiewicz

    2015-12-01

    Full Text Available The author presents the reception of the works of Czesław Miłosz in Italy starting from the first articles mentioning his name in the late 1940s. After his emigration from Poland in the 1950s, thanks to his efforts in favor of freedom of expression and of criticism of socialist realism, he found many Italian intellectuals who shared the same views. In 1980, when he was awarded the Nobel Prize in Literature, Miłosz had his greatest moment of fame, which allowed him to publish his most important works in Italy. The second part of the article consists of the complete bibliography of Miłosz’s texts in Italian, including those published in newspapers and magazines.

  3. Aktywność fizyczna i odżywianie w zdrowym stylu życia uczniów w wieku 10-13 lat ze Szkoły Podstawowej nr 9 w Inoworocławiu = Nutrition physical activity and healthy lifestyle in pupils aged 10-13 years of Primary School no 9 in Inoworocław

    Directory of Open Access Journals (Sweden)

    Tomasz Niewiadomski

    2015-06-01

    The aim of the present study was to leisure time, physical activity and nutrition of children between the ages of 10 to 13 years in the Primary School No. 9 in Inowrocław. Work consisted of two parts, the theoretical and research. In pursuing erected on the following research questions: 1. How children spend their free time? 2. Does physical activity plays an important role in the lives of children? 3. Do the children understand the need for healthy eating? 4. What is the self-esteem of physical fitness and health of children? On the basis of detailed questions hypothesized principal, who spoke about this that an active lifestyle and a healthy, balanced diet positively affects the normal development of children and youth. In carrying the paper the multiple test methods. Among them, the most important role played by survey that gave a realistic picture of leisure and physical activity by children. The survey was anonymous, and research involved a group of 60 people. Developed following conclusions: 1. Children have substantial free time, which can not properly effects. 2. Most frequently undertaken a form of leisure is to play on the computer or watching TV. 3. Children are aware of how important physical activity, however, opt for passive lifestyle. 4. Children most like to ride a bike, and the boys play football. 5. Children understand the need for healthy nutrition and sport to live a healthy lifestyle.

  4. Daimoniono įvaizdis ir subjekto raiškos formos Czesławo Miłoszo poezijoje | The concept of Daemonion and forms of subject expression in the poetry of Czesław Miłosz

    Directory of Open Access Journals (Sweden)

    Erika Malažinskaitė

    2012-01-01

    Full Text Available The paper analyses the poetry of Czesław Miłosz as a field of intersubjective relationships, referring to the aesthetics of Mikhail Bakhtin. In the collection “Oca­lenie” (1945, the subject is viewed as a mediator, and this is more fully elaborated in the later poetical works of Miłosz. Various ways of expressing the subject “I” as the mediator actualize its problematic status and intersubjective relationships, its dialogue with the ot­her characters of other poetical texts. Poetical charac­ters differ in either being dead (and thus existing only in memory related with biographical texts or acting in another world (God and Daemonion. The subject gives voice to characters of the other world and in this way becomes a mediator. A specific emphasis is given to the concept of Daemonion. The paper ana­lyses different texts in which this image appears, and morphs. A question arises whether Daemonion is a character, or whether it is related to the complicated issue of form and content. To conclude, Daemonion appearing in poetry is the form itself. Also presented are various forms of the expressed subject (subject-witness, subject-chronicler, subject-shaman, which are related to the changing poetry, and the visual development of the characters.

  5. Stanisław Bułak-Bałachowicz. Postać, która mogła połączyć narody byłego Wielkiego Księstwa Litewskiego, a jednak ich nie połączyła

    Directory of Open Access Journals (Sweden)

    Joanna Gierowska-Kałłaur

    2017-12-01

    Full Text Available Stanisław Bułak-Bałachowicz. He who could have united the nations of the former Grand Duchy of Lithuania, yet did not Revered, fluent in all Borderland languages, an excellent soldier; Stanisław Bułak-Bałachowicz, back when he was a subordinate of Nikolai Yudenich, tried to rename the unit under his command to the "People's Army", or in other words, the Territorial or National Army. The territorial understanding of "Belarusness", in conjunction with the nearly atavistic antibolshevism of Bałachowicz, were a great asset in Józef Piłsudski's new political combination. Piłsudski decided to benefit from Savinkov's idealistic approach for his own purpose. The Russian Political Committee, Bałachowicz's troops and the statements of Vyacheslav Adamovich (father were to support the establishment of Belarus for Belarusians. Not under Kaunas and Berlin, nor a Soviet one. A “Third Belarus”. A Belarus friendly towards Poland. Following discussions with Savinkov, the builder of the "Third Russia", Piłsudski engaged himself after 6 March 1920 (Millerand Note in supporting (inter alia financially the Russian Political Committee. Based on the agreement of the Polish Supreme Command with B.V. Savinkov, all Russian formations on the Polish territory were subordinated politically to B. Savinkov. On 27 August 1920, on the orders of the Supreme Command, Bałachowicz entered a secret agreement with Savinkov. They both were also to seek convening the Constituent Assembly, providing land for the people and democracy, and to create a Union of Nations (i.e., a federation. In the event of Bałachowicz's unit succeeding "deeper into Russian territory", the local government and the administrative board were to be founded on his authority. This is how Bułak-Bałachowicz was to become the executor of the first phase of Piłsudski's new "concept for Belarus".   Stanisław Bułak-Bałachowicz. Postać, która mogła połączyć narody byłego Wielkiego Ksi

  6. Erozijos tema Czesławo Miłoszo kūryboje: svarstymai lietuvių literatūros akivaizdoje. The Topic of Erosion in the Works of Czesław Miłosz from the perspective of Lithuanian Literature

    Directory of Open Access Journals (Sweden)

    Audinga Peluritytė

    2009-01-01

    Full Text Available The creation of Polish literature classic Czesław Miłosz (1911–2004 is being discussed in this article. It is proposed that the Christian time and history are more important that space and its experiences in the creation of Miłosz. History is a time of God, Creator, that is given to human being, but that time of history is finite, and knowable in that way only. The time of history is given to human so that he could realize his will by creating culture, civilization, by being in action in the world. The gift of knowledge is given to human in the presence of God, Creator, and so the responsibility for the surrounding matter of the planet. Human inevitably consumes the nature of the planet he lives on by his activity, and embroils into a difficult creative process. The erosion of nature is a consequence of human activity in history. Miłosz ponders upon the categories of human history and nature by invoking plenty of cultural contexts. The Christian eschatology – one of the most important of them. But Lithuanian literature, entering Polish literature mainly through biographic and creative experience of Miłosz, almost does not know such eschatological, Christian time. The Lithuanian lite­rature reasons in a perspective of natural, entropic time, and consequently the questions of Christianity, civilization, history exist in Lithuanian literature un­der a different – alternative – programme of natural religion and worldview.

  7. Tabish Khair, Martin Leer, Justin Edwards & Hanna Ziadeh, eds. Other Routes - 1500 Years of African and Asian Travel Writing

    Directory of Open Access Journals (Sweden)

    Florence D’SOUZA

    2006-10-01

    Full Text Available This anthology of extracts from non-European travel texts, by Asians and Africans, in English translation, spans from the 5th century AD to the 19th century AD. It is edited by four contemporary scholars, one of Indian origin, two Danish, and one of Egyptian origin, all attached to Danish academic institutions. Six other contemporary scholars from a variety of countries have also contributed extracts and introductory presentations among the book's thirty-three sections, that include the writi...

  8. Gathering Leaves & Lifting Words. Histories of Buddhist Monastic Education in Laos and Thailand, Justin Thomas McDaniel

    Directory of Open Access Journals (Sweden)

    Guillaume Rozenberg

    2012-09-01

    Full Text Available Depuis maintenant trois ou quatre décennies, on a vu la constitution aux États-Unis, du moins pour ce qui concerne les recherches sur les sociétés theravādin d’Asie du Sud et du Sud-Est, d’une sorte d’école qu’on qualifierait volontiers de « bouddhographique », mélange détonnant de bouddhologie et d’ethnographie. Ses représentants se distinguent par la conjonction d’une solide culture classique (maîtrise du pâli et souvent du sanskrit, une formation pluridisciplinaire à la croisée de la phil...

  9. JBJ van Ryssen* & AW Lishman JP Kitching & Moss

    African Journals Online (AJOL)

    genese, uitgedruk as persentasie spermbuise in die testes met sperms, as die Mo-groep gehad. Dit kan moontlik .... 27 em, provided a high spermatozoa count was ob- served. ... the rams in both groups reached this stage on average.

  10. AWS and ASME welding problems in the nuclear industry

    International Nuclear Information System (INIS)

    Reedy, R.F.; Borter, W.H.

    1984-01-01

    The cost of nuclear power plant construction in the United States far exceeds the expectations of ten years ago, even considering high interest rates and inflation. The largest portion of the increased direct construction costs is related to delays and unnecessary repairs and rework. Most of these repairs and rework are related to welding. There is a way to start controlling these costs now, but it involves revising specifications and educating engineers regarding materials and welding

  11. Light Curve Solution of the Contact Binary AW UMa

    Directory of Open Access Journals (Sweden)

    J. H. Jeong

    1997-12-01

    Full Text Available A total of 1088 observations (272 in B,272 in V, 272 in R, and 272 in I were made from January to February in 1995 at Chungbuk National University observatory(CbNUO. We constructed BVRI light curves with our data. The photometric solution of these light curves was obtained by means of the Wilson-Devinney method. Our result was compared with those by previous investigators.

  12. Name Stanislaus (Stanisław in Slavic Onomastic Tradition

    Directory of Open Access Journals (Sweden)

    Franciszek Sowa

    2003-12-01

    Full Text Available St. Stanislaus, bishop and martyr, is one of the few saints of the Church bearing a traditional Slavic name. It belongs to an Indo-European Anthroponomastic system as a compound name whose components represent a pattern inherited from the period of the Indo-European community. This is a fortune-telling name (a nomen-omen given to a child on a wish of the parents, who wanted him to be famous (Polish ‘slawa’ means ‘fame’- Today, in our Christian culture, in choosing a name for the child we consider the following: 1 the child ‘brought’ his/her name (i.e. is given the name of the day’s patron; this is the gist of our ‘nameday’, 2 a family tradition, 3 respect for the grandfather or father (grandmother, mother, 4 fashion. Today’s anthroponomastic system in Slavic languages (except Bulgarian has grown cold leaving us unable to acquire precise understanding of the meaning of the name. Besides, nowadays names only denote, they do not mean anything. Compound Slavic names refer in their structure to names from other groups of the Indo-European community and are closely linked with a nation’s spiritual culture and appropriate ultimate and instrumental values. In Indo-European languages a different number of lexical components is used in names as their first or second part: in Old Indian - 865; in Old Persian and Median - 43; in Greek - 1015; in the Celtic group - 336; the German one - 1800 and in the Slavic group - 220. The most numerous in Old Polish anthroponomastics were names with the component slaw. As the first component - slaw appears in 4 names, and as the second, in 100. This component has appeared from times immemorial in Indian, Avestan, Greek and Illyrian names. Name Stanislaus is known in all Slavic countries, while its feminine form only in Polish, Bulgarian, Serb and Croatian. In Poland it has been in use since very old times up to now. Numerous surnames and names of places derive from it. The popularity of the name waned slightly in the 19th century, but it has never come into disuse as was the case with many Slavic names, which were ‘dug out’ in the 19th century, and not infrequently, erroneously read. A great number of Indo-European names with the component - ‘slaw’ testifies to the fact that people who bore that name always wanted to be the bearers offame, good fame that is, such as St. Stanislaus, bishop and martyr, has enjoyed.

  13. Generalized geology of the 241-AW Tank Farm

    International Nuclear Information System (INIS)

    Last, G.V.; Marratt, M.C.

    1978-08-01

    A series of maps has been compiled to document the structure and stratigraphy of the sediments underlying the high-level radioactive waste storage tank farms located within the Hanford Reservation. Purpose is to provide basic geologic information to be utilized in support of the Long Term Management of Low Level Waste Program Data Base

  14. What makes corruption in the public procurement process awful?

    OpenAIRE

    Kofi Osei-Afoakwa

    2012-01-01

    Corruption as a societal bane has afflicted homes, families, societies, businesses, governments and nations for ages. Some have traced it to the days of Adam. Under every culture, the phenomenon has been considered detestable although its exact definition has defied definite expression. Its pervasiveness has also been recognised by sociologists for ages. It has appeared in households, offices, churches, marriages and all facets of social endeavours and interactions. When corruption rears its ...

  15. What binds Bronisław Malinowski with social networks?

    Directory of Open Access Journals (Sweden)

    Zbigniew Meger

    2012-12-01

    Full Text Available Bronislaw Malinowski, a Polish anthropologist, ethnologist and sociologist, is the father of phatic communication. He has defined and described for the first time a phatic function of language and its importance in societies with low levels of development. As it turns, the phatic communication, which does not transfer any content, is also present today, and even - due social networks portals - comes into new stage of development. Although an impression that the phatic communication has low importance, it plays an important role in society. Also in educational activities this communication has an impact on interpersonal relationships. Through it, people better cooperate with each other and create groups of collaborating individuals. In this way are also built relationships between students and the educational institutions. They are also generated positive emotions which help in all processes of learning. Generally, the phatic communication can have a positive influence on educational processes.

  16. Computational Platform About Amazon Web Services (Aws Distributed Rendering

    Directory of Open Access Journals (Sweden)

    Gabriel Rojas-Albarracín

    2017-09-01

    Full Text Available Today has created a dynamic in which people require higher image quality in different media formats (games, movies, animations. Further definition usually requires image processing larger; this brings the need for increased computing power. This paper presents a case study in which the implementation of a low-cost platform on the Amazon cloud for parallel processing of images and animation.

  17. Jakub Sobieski’s Description of the Moscow Campaign (based on the Diariusz ekspedycyjej moskiewskiej dwuletniej królewica Władysława Anno Domini 1617 [The Diary of the Two-Year Moscow Campaign by Royal Prince Władysław in 1617

    Directory of Open Access Journals (Sweden)

    Piotr Borek

    2013-01-01

    Full Text Available The essay discusses Jakub Sobieski’s diaries and memories, which belong to the finest specimens of such writing in Polish Baroque. The diary and memoirs of the Moscow campaign of 1617-1618 have survived in only a few copies, with the most important ones in Biblioteka Czartoryskich in Cracow. Reconstruction of Prince Władysław’s struggle for the Russian crown is mostly based on a handwritten testimony called Diariusz ekspedycyjej moskiewskiej dwuletniej królewica Władysława A. D. 1617 [The Diary of the Two-Year Moscow Campaign by Royal Prince Władysław in 1617]. The events described in the diary span from April 5th, 1617 to December 28th, 1618. The author has arranged the material chronologically, focusing on the text as historical evidence. The conclusion of the text, where Sobieski quotes a fragment of Tacitus’s Annals, points out to the argumentative function of the work, which was supposed to explain to Poles (the king, the sejm and senate, the nobility that commissaries were right in signing the Truce of Deulino, regarding the safety of the homeland threatened by Turks and Tatars, and the budgetary difficulties of the Crown and Lithuania. The second work by Sobieski is more of a Baroque memoir, composed as a temporal sequence (some fragments have the structure of diary. The author reconstructs the events of the Moscow campaign, beginning with the death of tsar Ivan the Terrible (1584, and leads the narrative to the end of 1618, when the Truce of Deulino. The work is characterized by greater coherence in presentation of facts, their selection, and a more general point of view, pointing out to the failure of Polish dynastic policy. Sobieski seems to be critical of the Polish intervention and the Polish raison d’état in this respect. He is also critical of the young prince’s campaign of 1617-1618; he was a commissioner for treaties with Moscow during the campaign.

  18. The Effects of Cassady and Justin's Functional Model for Emotional Information Processing on Improving Social Competence of First Grade Children with ADHD

    Science.gov (United States)

    Eissa, Mourad Ali

    2017-01-01

    This study explores whether or not Emotional Information Processing (EIP) model Intervention has positive effects on the Social Competency in first grade children with ADHD. 10 first graders primary who had been identified as having ADHD using Attention-Deficit Hyperactivity Disorder Test (ADHDT) (Jeong, 2005) and were experiencing social problems…

  19. ‘Justin Bieber Sounds Girlie’: Young People’s Celebrity Talk and Contemporary Masculinities

    OpenAIRE

    Kim Allen; Laura Harvey; Heather Mendick

    2015-01-01

    In this article, we explore the ways that contemporary young masculinities are performed and regulated through young people’s relationship with celebrity. We address the relative paucity of work on young men’s engagements with popular culture. Drawing on qualitative data from group interviews with 148 young people (aged 14-17) in England, we identify ‘celebrity talk’ as a site in which gender identities are governed, negotiated and resisted. Specifically we argue that celebrity as a s...

  20. EFFECTS OF COOPERATIVE LEARNING MODEL TYPE STAD JUST-IN TIME BASED ON THE RESULTS OF LEARNING TEACHING PHYSICS COURSE IN PHYSICS SCHOOL IN PHYSICS PROGRAM FACULTY UNIMED

    Directory of Open Access Journals (Sweden)

    Teguh Febri Sudarma

    2013-06-01

    Full Text Available Research was aimed to determine: (1 Students’ learning outcomes that was taught with just in time teaching based STAD cooperative learning method and STAD cooperative learning method (2 Students’ outcomes on Physics subject that had high learning activity compared with low learning activity. The research sample was random by raffling four classes to get two classes. The first class taught with just in time teaching based STAD cooperative learning method, while the second class was taught with STAD cooperative learning method. The instrument used was conceptual understanding that had been validated with 7 essay questions. The average gain values of students learning results with just in time teaching based STAD cooperative learning method 0,47 higher than average gain values of students learning results with STAD cooperative learning method. The high learning activity and low learning activity gave different learning results. In this case the average gain values of students learning results with just in time teaching based STAD cooperative learning method 0,48 higher than average gain values of students learning results with STAD cooperative learning method. There was interaction between learning model and learning activity to the physics learning result test in students

  1. The origin of weld seam defects related to metal flow in the hot extrusion of aluminium alloys en AW-6060 and en AW-6082

    NARCIS (Netherlands)

    Bakker, A.J. den; Werkhoven, R.J.; Sillekens, W.H.; Katgerman, L.

    2014-01-01

    Longitudinal weld seams are an intrinsic feature in hollow extrusions produced with porthole dies. As these joins occur along the entire extruded length, it is desirable that these weld seams have a minimal impact on the structural integrity of the extrudate. In particular, defects associated with

  2. Vitrification and Product Testing of AW-101 and AN-107 Pretreated Waste

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Gary L.; Greenwood, Lawrence R.; Piepel, Gregory F.; Schweiger, Michael J.; Smith, Harry D.; Urie, Michael W.; Wagner, Jerome J.

    2000-10-31

    The primary objective for vitrifying the LAW samples is to generate glass products for subsequent product testing. The work presented in this report is divided into 6 work elements: 1) Glass Fabrication, 2) Chemical Composition, 3) Radiochemical Composition, 4) Crystalline and Non-crystalline Phase Determination, and 5) Release Rate (Modified PCT). These work elements will help demonstrate the RPP-WTP projects ability to satisfy the product requirements concerning, chemical and radionuclide reporting, waste loading, identification and quantification of crystalline and non-crystalline phases, and waste form leachability. VOA, SVOA, dioxins, furans, PCBs, and total cyanide analyses will be reported in as separate document (WTP-RPT-005).

  3. Cost comparison of running web applications in the cloud using monolithic, microservice, and AWS Lambda architectures

    NARCIS (Netherlands)

    Villamizar, Mario; Garcés, Oscar; Ochoa, Lina; Castro, Harold; Salamanca, Lorena; Verano, Mauricio; Casallas, Rubby; Gil, Santiago; Valencia, Carlos; Zambrano, Angee; Lang, Mery

    2017-01-01

    Large Internet companies like Amazon, Netflix, and LinkedIn are using the microservice architecture pattern to deploy large applications in the cloud as a set of small services that can be independently developed, tested, deployed, scaled, operated, and upgraded. However, aside from gaining agility,

  4. Literary Criticism Fiction: the Wacław Borowy–Manfred Kridl polemic

    Directory of Open Access Journals (Sweden)

    Maciej Gorczyński

    2016-03-01

    Full Text Available The paper The Fictions of Literary Criticism refers to a polemic between Manfred Kridl and Waclaw Borowy which was conducted in several articles published in the years 1936–1957. The polemic played a significant role in the development of modern Polish literary criticism. The matter of dispute was a new method of literary criticism announced by Kridl in his renowned Introduction to the Research of Literary Work (1936. The main topics of the discussion were the problems of the literary process, the evaluation of a literary work and the uses of scientific methods in humanities. The paper’s author pays attention especially to the rhetorical and literary means of argumentation which were used in the creation of this unusual form of non-fiction.

  5. Ring rolling of AW5083 large rings for the external cylinder of CMS

    CERN Multimedia

    S. Sgobba / EST

    2001-01-01

    Picture 1: The forged cylinder is engaged in the ring rolling plant. Picture 2: Vertical rolls allow for the reduction in the axial direction. Rolling is carried out at approx. 400 degrees C. Horizontal rolls (not shown) allow for the reduction in the radial direction. Picture 3: Handling of the ring, rolled at the internal diameter of approx. 7m, and transfer to the quenching both. All pictures have been taken during the visit of Mr. Sgobba at Dembiermont, Mobeuge (Bruxelles).

  6. Revaluation Of Wrocław Public Use Buildings In Years 2005 - 2013

    Science.gov (United States)

    Kirschke, Paweł

    2015-09-01

    In the years 2005-2013 in Wroclaw, there was commissioned to use hundreds of public buildings, including fifty revalued monuments These were: offices, museums, theatres, science and education facilities, as well as commercial buildings: banks, department stores, office buildings and hotels. The success of these projects was the merit of Wroclaw scientists who nurtured these outstanding works of architecture and convince the public to the fact that they stand for works which cannot be missed. The merit of architects and conservators was professionally prepared projects and effective supervision of investment, making the implementation of technical and program objectives not colliding with protection of historic material of the objects.

  7. Touchstones from Ostrów Tumski in Wrocław

    Czech Academy of Sciences Publication Activity Database

    Ježek, Martin; Pankiewicz, A.; Zavřel, J.

    2015-01-01

    Roč. 48, č. 2010 (2015), s. 59-78 ISSN 0066-5924 Institutional support: RVO:67985912 Keywords : Early Middle Ages * touchstones * central sites * exchange * archaeometallurgy Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Influence of Scanning Strategies on Processing of Aluminum Alloy EN AW 2618 Using Selective Laser Melting

    Science.gov (United States)

    Palousek, David; Pantelejev, Libor; Hoeller, Christian; Pichler, Rudolf; Tesicky, Lukas; Kaiser, Jozef

    2018-01-01

    This paper deals with various selective laser melting (SLM) processing strategies for aluminum 2618 powder in order to get material densities and properties close to conventionally-produced, high-strength 2618 alloy. To evaluate the influence of laser scanning strategies on the resulting porosity and mechanical properties a row of experiments was done. Three types of samples were used: single-track welds, bulk samples and samples for tensile testing. Single-track welds were used to find the appropriate processing parameters for achieving continuous and well-shaped welds. The bulk samples were built with different scanning strategies with the aim of reaching a low relative porosity of the material. The combination of the chessboard strategy with a 2 × 2 mm field size fabricated with an out-in spiral order was found to eliminate a major lack of fusion defects. However, small cracks in the material structure were found over the complete range of tested parameters. The decisive criteria was the elimination of small cracks that drastically reduced mechanical properties. Reduction of the thermal gradient using support structures or fabrication under elevated temperatures shows a promising approach to eliminating the cracks. Mechanical properties of samples produced by SLM were compared with the properties of extruded material. The results showed that the SLM-processed 2618 alloy could only reach one half of the yield strength and tensile strength of extruded material. This is mainly due to the occurrence of small cracks in the structure of the built material. PMID:29443912

  9. [Deutschland, Russland und das Baltikum] / Bogus̮aw Dyba{250}

    Index Scriptorium Estoniae

    Dyba{250}, Bogus̮aw

    2006-01-01

    Rets. rmt.: Deutschland, Russland und das Baltikum. Beiträge zu einer Geschichte wechselvoller Beziehungen. Festschrift zum 85. Geburtstag von Peter Krupnikow, hrsg. v. Florian Anton und Leonid Luks (=Schriften des Zentralinstituts für Mittel- und Osteuropastudien. Bd.7), Böhlau Verlag, Köln-Weimar-Wien, 2005

  10. Index of Air Weather Service Technical Publications. Headquarters AWS and Subordinate Units.

    Science.gov (United States)

    1982-07-01

    llp (ATI-98239). 105-77 "Hurricanes of 1950: Narrative History of Each Storm and Comments on Hurricane Reconnaissance," July 1951, 90p (ATI-110565...Solar Flare Videometer," by Paul E. Tallant, pp. 92-109. "The Use of Ground Level Neutron Monitors in a Real Time Solar Proton Monitoring Network," by M...8-12p ’Window’ Radiation over Indonesia and Malaysia ," by Earl S. Merritt, pp. 245-253. "Short Range, Subsynoptic Surface Weather Prediction," by

  11. Czesław Miłosz and Walt Whitman: translation as an authentic presence

    Directory of Open Access Journals (Sweden)

    Arent Van Nieukerken

    2012-01-01

    Full Text Available Miłosz’s later poetry attempts to overcome the (postmodernist gap between the author as a textual effect and the subject of autobiography. An important stage on this road was his poetry book (in fact, a long poem in its own right Nieobjęta ziemia [Unattainable Earth]. Its form is clearly dialogical. The collection mixes authorial poems with vari­ous examples of “heteroglossia”. Particularly striking is the prominent presence of Walt Whitman’s poetry. Whitmanian poetics assume that fully experiencing reality presupposes the existence of a community. The task of poetry consists in conceiving artistic structures that, when they are “concretized”, allow the reader to participate in such a community. Nieobjęta ziemia tries to come to terms with the Whitmanian challenge. The poetical subject in this somewhat modified example of the modern “sylva rerum” experiences its link with the “other” by an individual reception of artifacts that point to the communal essence of humanity. Nieobjęta ziemia , realizing community in the field of poetics “performatively”, incorporates these artifacts into the text. Particularly important seems to be the role played by poems translated by Miłosz himself (they are explicitly labeled as translations, and that represent the human condition called by Whitman “en masse”.

  12. Performance and Cost Analysis of the Supernova Factory on the Amazon AWS Cloud

    Directory of Open Access Journals (Sweden)

    Keith R. Jackson

    2011-01-01

    Full Text Available Today, our picture of the Universe radically differs from that of just over a decade ago. We now know that the Universe is not only expanding as Hubble discovered in 1929, but that the rate of expansion is accelerating, propelled by mysterious new physics dubbed “Dark Energy”. This revolutionary discovery was made by comparing the brightness of nearby Type Ia supernovae (which exploded in the past billion years to that of much more distant ones (from up to seven billion years ago. The reliability of this comparison hinges upon a very detailed understanding of the physics of the nearby events. To further this understanding, the Nearby Supernova Factory (SNfactory relies upon a complex pipeline of serial processes that execute various image processing algorithms in parallel on ~10 TBs of data. This pipeline traditionally runs on a local cluster. Cloud computing [Above the clouds: a Berkeley view of cloud computing, Technical Report UCB/EECS-2009-28, University of California, 2009] offers many features that make it an attractive alternative. The ability to completely control the software environment in a cloud is appealing when dealing with a community developed science pipeline with many unique library and platform requirements. In this context we study the feasibility of porting the SNfactory pipeline to the Amazon Web Services environment. Specifically we: describe the tool set we developed to manage a virtual cluster on Amazon EC2, explore the various design options available for application data placement, and offer detailed performance results and lessons learned from each of the above design options.

  13. Small fatigue crack growth in aluminium alloy EN-AW 6082/T6

    Czech Academy of Sciences Publication Activity Database

    Jíša, D.; Liškutín, P.; Kruml, Tomáš; Polák, Jaroslav

    2010-01-01

    Roč. 32, č. 12 (2010), s. 1913-1920 ISSN 0142-1123 R&D Projects: GA ČR GA101/07/1500 Institutional research plan: CEZ:AV0Z20410507 Keywords : Aluminium alloys * small cracks * grack growth rate Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 1.799, year: 2010

  14. A new alpha(0)-thalassemia deletion found in a Dutch family (--(AW)).

    NARCIS (Netherlands)

    Phylipsen, M.; Vogelaar, I.P.; Schaap, R.A.; Arkesteijn, S.G.; Boxma, G.L.; Helden, W.C. van; Wildschut, I.C.; Bruin-Roest, A.C. de; Giordano, P.C.; Harteveld, C.L.

    2010-01-01

    Alpha-thalassemia is an inherited hemoglobin disorder characterized by a microcytic hypochromic anemia caused by a quantitative reduction of the alpha-globin chain. The majority of the alpha-thalassemias is caused by deletions in the alpha-globin gene cluster. A deletion in the alpha-globin gene

  15. J. Grobbelaar, AW Lishman*, WA Botha, DJ MilIar** and SF Lesch

    African Journals Online (AJOL)

    111mof topical antiseptic (Surgispray, Novo Industries). A 50 mm x 50 mm square of adhesive plaster (Elasto- plast) was moistened with anaesthetic ether and pressed down finnly over the wound. A 50 mm wide strip of masking tape was then wound around the neck of the sheep to shield completely the point of entry into ...

  16. IMPLEMENTASI KOMPUTASI AWAN MENGGUNAKAN TEKNOLOGI GOOGLE APP ENGINE (GAE DAN AMAZON WEB SERVICES (AWS

    Directory of Open Access Journals (Sweden)

    Adi Nugroho

    2013-04-01

    Full Text Available Interoperabilitas, dalam arti cara bagaimana suatu sistem yang memiliki platform perangkat keras dan perangkat lunak tertentu dapat berkomunikasi dengan sistem-sistem yang memiliki platform yang berbeda, mungkin merupakan bagian dari ‘masa lalu’. Di masa-masa yang akan datang, interoperabilitas yang selama ini ditangani secara manual oleh organisasi-organisasi/perusahaan-perusahaan akan ditangani langsung oleh vendor-vendor penyedia komputasi awan (cloud computing yang memang memiliki sumberdaya-sumberdaya manusia (analis sistem, pemrogram, pakar jaringan, perangkat keras (komputer-komputer server yang berjumlah sangat banyak dan berkemampuan raksasa, serta perangkat lunak (sistem operasi, server aplikasi, server Web yang memang memenuhi syarat untuk itu. Di masa yang akan datang, untuk mendapatkan layanan-layanan  (service dan tempat penyimpanan tertentu, organisasi-organisasi/ perusahaan-perusahaan tidak perlu berinvestasi terlalu tinggi untuk menyediakannya sendiri; mereka bisa saja menyewanya dari vendor-vendor komputasi awan yang saat ini mulai bermunculan. Google dan Amazon adalah para pendahulu dari teknologi komputasi awan (cloud computing ini. Melalui tulisan ini, kita tidak akan membahas struktur internal keduanya secara rinci, melainkan kita akan mencoba membahas kelebihan serta kekurangan kedua vendor komputasi awan ini dari sudutpandang para manajer di bidang Teknologi Informasi yang akan melakukan investasi yang bermanfaat bagi organisasi/perusahaannya.

  17. IMPLEMENTASI KOMPUTASI AWAN MENGGUNAKAN TEKNOLOGI GOOGLE APP ENGINE (GAE DAN AMAZON WEB SERVICES (AWS

    Directory of Open Access Journals (Sweden)

    Adi Nugroho

    2012-01-01

    Full Text Available Interoperabilitas, dalam arti cara bagaimana suatu sistem yang memiliki platform perangkat keras dan perangkat lunak tertentu dapat berkomunikasi dengan sistem-sistem yang memiliki platform yang berbeda, mungkin merupakan bagian dari masa lalu. Di masa-masa yang akan datang, interoperabilitas yang selama ini ditangani secara manual oleh organisasi-organisasi/perusahaan-perusahaan akan ditangani langsung oleh vendor-vendor penyedia komputasi awan (cloud computing yang memang memiliki sumberdaya-sumberdaya manusia (analis sistem, pemrogram, pakar jaringan, perangkat keras (komputer-komputer server yang berjumlah sangat banyak dan berkemampuan raksasa, serta perangkat lunak (sistem operasi, server aplikasi, server Web yang memang memenuhi syarat untuk itu. Di masa yang akan datang, untuk mendapatkan layanan-layanan (service dan tempat penyimpanan tertentu, organisasi-organisasi/ perusahaan-perusahaan tidak perlu berinvestasi terlalu tinggi untuk menyediakannya sendiri; mereka bisa saja menyewanya dari vendor-vendor komputasi awan yang saat ini mulai bermunculan. Google dan Amazon adalah para pendahulu dari teknologi komputasi awan (cloud computing ini. Melalui tulisan ini, kita tidak akan membahas struktur internal keduanya secara rinci, melainkan kita akan mencoba membahas kelebihan serta kekurangan kedua vendor komputasi awan ini dari sudutpandang para manajer di bidang Teknologi Informasi yang akan melakukan investasi yang bermanfaat bagi organisasi/perusahaannya.

  18. Becoming Known through Email: A Case of Woman, Leadership, and an Awfully Familiar Strange Land

    Science.gov (United States)

    Drake, Pat

    2015-01-01

    This project explores women and educational leadership from the perspective of an individual who moved from the UK to Australia in order to take up the position of Dean of an education grouping in a university. Emails sent by the Dean to the group are analysed after nine months in post and categorised according to the requirements of the position…

  19. Automated 99Tc analysis in AW-101 and AN-107 ''diluted feed'' matrixes

    International Nuclear Information System (INIS)

    Egorov, O.B.; DE Kurath, D.E.

    2000-01-01

    A process monitor is needed by British Nuclear Fuels Limited, Inc. (BNFL Inc.) to measure total 99 Tc levels in column effluents during technetium removal from the aqueous fraction of the Hanford high-level tank wastes. The monitor must achieve detection limits of 1 x 10 -8 Ci/mL (0.6 microg/mL). Measurements must be done in near real time, with an analysis frequency of approximately15 min. The monitoring technology must be sufficiently simple and robust for unattended continuous operation in the plant settings

  20. Lt AW Beauchamp-Proctor – die klein mannet jie met die leeuemoed

    African Journals Online (AJOL)

    Many millions of words have been written abour heroes and many more will be written in the future, but this article about the late Captain Andrew Weatherby Beauchamp-Proctor, VC., 050., MC.(Bar), OFC., is special because he was the only South African among nineteen pilots to win the Victoria Cross during the First World ...

  1. KrygsheldelWar Heroes LT A.W. BEAUCHAMP-PROCTOR - DIE ...

    African Journals Online (AJOL)

    Many millions of words have been written abour heroes and many more will be written in the future, but this article about the late Captain Andrew Weatherby Beauchamp-Proctor, VC., 050.,. MC.(Bar), OFC., is special because he was the only South African among nineteen pilots to win the Victoria Cross during the First ...

  2. J.S. Crichton* A.W. Lishman S.F. Lesch

    African Journals Online (AJOL)

    Under conditions of natural mating the bull must ensure that every cow capable of ... more bulls per 100females than is necessary to ensure good herd fertility. ... Prior to the start of mating cows were evaluated for body condition (van Niekerk ...

  3. Influence of Scanning Strategies on Processing of Aluminum Alloy EN AW 2618 Using Selective Laser Melting.

    Science.gov (United States)

    Koutny, Daniel; Palousek, David; Pantelejev, Libor; Hoeller, Christian; Pichler, Rudolf; Tesicky, Lukas; Kaiser, Jozef

    2018-02-14

    This paper deals with various selective laser melting (SLM) processing strategies for aluminum 2618 powder in order to get material densities and properties close to conventionally-produced, high-strength 2618 alloy. To evaluate the influence of laser scanning strategies on the resulting porosity and mechanical properties a row of experiments was done. Three types of samples were used: single-track welds, bulk samples and samples for tensile testing. Single-track welds were used to find the appropriate processing parameters for achieving continuous and well-shaped welds. The bulk samples were built with different scanning strategies with the aim of reaching a low relative porosity of the material. The combination of the chessboard strategy with a 2 × 2 mm field size fabricated with an out-in spiral order was found to eliminate a major lack of fusion defects. However, small cracks in the material structure were found over the complete range of tested parameters. The decisive criteria was the elimination of small cracks that drastically reduced mechanical properties. Reduction of the thermal gradient using support structures or fabrication under elevated temperatures shows a promising approach to eliminating the cracks. Mechanical properties of samples produced by SLM were compared with the properties of extruded material. The results showed that the SLM-processed 2618 alloy could only reach one half of the yield strength and tensile strength of extruded material. This is mainly due to the occurrence of small cracks in the structure of the built material.

  4. PHYTOCOENOSES OF URBAN RIPARIAN FORESTS ON THE EXAMPLE OF THE LAS OSOBOWICKI FOREST (WROCŁAW

    Directory of Open Access Journals (Sweden)

    Ewa Stefańska-Krzaczek

    2014-10-01

    Full Text Available The Las Osobowicki forest is remnant riparian woodland of the Odra valley. Floristic data were collected from circular 100m2 plots (with a radius of 5.64m which were systematically chosen in forest communities. Four plant communities were determined within data set. They were represented Fagetalia order and Querco-Fagetea class. Flood prevention caused disappearance of riparian forest species, expansion of common hornbeam and Norway maple expansion and a decrease of species richness. However, spatial distribution of phytocoenoses proves the river influence on the vegetation.

  5. mediCAl UniVersity oF WArsAW

    Directory of Open Access Journals (Sweden)

    Piotr Kwast

    2016-12-01

    Full Text Available Introduction. infantile hemangiomas in the region of head and neck are relatively common. When localized in the vicinity ofvital organs, airways or the eye, they may cause a serious threat to the child’s health and development, or even life. the recentlydiscovered effectiveness of propranolol in treating infantile hemangiomas enabled the development of a fast and safe treatmentmethods of these lesions in laryngological patients.Aim. the purpose of this study was to analyze the patients with infantile hemangioma and their treatment with a view to thelatest findings and therapeutic standards.Material and methods. Children hospitalized in the years 2013-2015 in the department of pediatric otolaryngology at themedical University of Warsaw with the diagnosis of infantile hemangioma of the head and neck were included in the study.data concerning patients’ age and sex, location of the lesion, any additional lesions and duration of the propranolol therapy, aswell as the response to treatment, were collected for the study.Results. We included 17 patients (12 girls and 5 boys in the study. hemangioma was located in the larynx in 8 cases, there were3 cases of hemangioma of the tongue, 3 cases of hemangioma of the nasal cavity and 3 cases of a hemangioma in a different location: cheek, parotid gland and palate. in 3 cases, there was an additional hemangioma localized outside of the head and neckregion. 11 patients were under one year old at the beginning of treatment. treatment duration varied from 3 to 12 months. inall cases in which propranolol was introduced in infancy, we observed complete remission of the changes.Conclusions. propranolol treatment for infantile hemangioma is a very effective and safe way for reducing the mass of the lesion. it allows to reach complete remission when administered early enough.

  6. Awfully afraid? Dissociating decision- from motor- and sensory-related brain activation during perceptual choices.

    NARCIS (Netherlands)

    Tobler, P.N.; Kalenscher, T.

    2007-01-01

    We constantly make decisions about how to interpret our current situation and what to do next. Such decisions usually reflect available sensory input and the potential costs and benefits of choosing a particular interpretation or course of action over another. Facial expressions are a particularly

  7. High temperature corrosion investigations at AW2-bio. Final report; Biomass boiler

    Energy Technology Data Exchange (ETDEWEB)

    Borg, U.

    2011-01-15

    The measured corrosion rates in the test superheaters and ordinary superheaters of Avedoere 2 biomass boiler reveal that the corrosion rate increases with metal temperature and is significantly accelerated above steam temperatures of 540 deg. C. For the boiler with a live steam temperature of 540 deg. C, the measured corrosion rates in superheater 2 and 3 were up to 1mm pr. 10000 hours. It was observed that the flue gas temperature and heat flux had a significant effect on the corrosion rates through the surface metal temperature. Thus, the highest corrosion rates in the ordinary superheaters were not found at the position of the highest steam temperature in the outlet of superheater 3, but at the outlet of superheater 2. A steam temperature of approximately 580 deg. C at the outlet of one of the test superheater loops caused a tube fracture after a few months. A HVOF coating was applied to a section of superheater 2 and at a higher temperature in the test superheater loop. Analyses of the tube section after exposure showed that parts of the coating were not present and corrosion of the underlying TP347H FG was apparent. This indicates that the coating had spalled during operation. Furthermore, chlorine diffusion through the coating was observed causing attack at the coating-alloy interface. The project work has shown that it is not possible to increase the live steam temperature of the biomass fired boiler to more than 540 deg. C without a significant increase in superheater corrosion rates for the applied tube materials and coatings. (Author)

  8. 76 FR 68297 - Airworthiness Directives; Agusta S.p.A. (Agusta) Model AB139 and AW139 Helicopters

    Science.gov (United States)

    2011-11-04

    ... related PS module, CSIO module, CIO module, MAU cabinet, and all related connectors. (d) Reinstall the AFT... and related connectors for corrosion. If there is corrosion on the connectors, this AD requires cleaning the connectors before further flight. If there is corrosion on a module, before further flight...

  9. Population Densities of Birds Breeding in Urbanized Habitats in the Grabiszyn District in the City of Wrocław

    Directory of Open Access Journals (Sweden)

    Kopij Grzegorz

    2014-11-01

    Full Text Available Studies were carried out in 2010 by mean of simplified version of the mapping method. The study area (395 ha was located close to the city centre. It comprised a mosaic of urbanized habitats, with a clear dominance of green areas, such as parks (41.1 ha, gardens, cemeteries and tree clumps. A total of 48 breeding bird species were recorded in the whole study area. The most common (<25 pairs/100 ha were Passer domesticus, Passer montanus, Sturnus vulgaris, Parus caeruleus, Parus major, Apus apus and Columba livia. Numerous (7-15 pairs/100 ha were also the following species: Columba palumbus, Turdus pilaris, Sylvia atricapilla, Serinus serinus, Turdus merula and Pica pica. Insectivorous birds were the most common birds constituting 63.3%, and granivorous -32.6% of all pairs recorded. Most birds nested in tree holes (39.3%, in/on buildings (30.2% and in trees/shrubs (25.6%. Distribution of breeding pairs of 23 bird species was presented on maps. Population trends for 17 species were documented. Rapid increase in numbers of Turdus pilaris, Corvus cornix and Phoenicurus phoenicurus and decrease of Pica pica were recorded.

  10. Psychobiography of Jesus Christ in view of Władysław Witwicki’s theory of cratism

    Directory of Open Access Journals (Sweden)

    Citlak Amadeusz

    2015-12-01

    Full Text Available The article is an attempt at a critical evaluation of applying one of the most original theories of Polish psychology, i.e. W. Witwicki’s theory of cratism, to the interpretation of the activities and personality of Jesus Christ. The theory of cratism, though it provides substantial explanation possibilities, has been largely forgotten. W. Witwicki used it to try to interpret many aspects of human activity such as art, social relations, as well as the life of ancient figures, among others, Socrates and Jesus Christ. Thanks to this, he created the first ever in Polish psychology (and also one of the first in world psychology psychobiography. The proposal to decipher the activity of Jesus of Nazareth through Witwicki, however, raises large concerns, which discouraged many psychologists, and especially religious environments. I would like to indicate the most controversial moments of his work, while drawing attention to the great value of the theory itself also today, at the beginning of the 21st century, particularly in the area of historical psychology.

  11. Pühakoda kui tempel ja korrastatud struktuur : A.W. Hupel arhitektuurihindajana / Krista Kodres ; tõlk. Tiina Randviir

    Index Scriptorium Estoniae

    Kodres, Krista, 1957-

    2008-01-01

    August Wilhelm Hupeli arhitektuuriideaalidest, "arhitektuuriteoloogiast", korrast (order) kirikuruumide ülesehituses ja Vaivara kirikust kui ajastu teoloogilisest sümbolist, esimesest omalaadsest luteri kirikust ja ideaalsest kirikuarhitektuurist - ehitati aastatel 1775-1777, hävis 1944

  12. Motivi biblici nell’opera teatrale di Stanisław Wyspiański e Jerzy Grotowski

    Directory of Open Access Journals (Sweden)

    Luca Bernardini

    2011-06-01

    The second play partly centered on a biblical theme is Akropolis (1904, a monumental drama set in Cracow’s Pantheon, the Wawel cathedral. In the second act of the play, the characters of the tapestries hanging on the walls of the cathedral come to life. One of the tapestries portraits the story of Jacob (Genesis: 25-33. Wyspiański was very likely inspired by  Raffaello’s fresco paintings in Eliodor’s room at the Vatican, and by Gerhard Hauptmann’s fragment Das Hirtenlied. The playwright closely follows the text of the Bible but for a few „apocryphical” insertions, the more relevant of which refer to Jacob’s struggle with the Angel. The Angel defies Jacob, founder of tribes”, claiming that he’ll thread „on the weak ones, in this graveyard of tribes”. Much has been debated on where the action of the drama should take place. Wyspiański himself thought about staging Akropolis in the cathedral on the Wawel hill, but the best known production of the play, performed by Jerzy Grotowski (1962, dispensed from the original setting. For Wyspiański, the cathedral on the Wawel hill, with her tombs, was the most significant achievement in Polish national history  and culture, but for Grotowski the most meaningful event in the history of the whole humankind had taken place in Auschwitz extermination camp. Grotowski sees the setting of the play – using Wyspianski’s words - „in a graveyard of tribes”. This graveyard is not longer the peaceful and magnificent cathedral where the playwright used to stroll in search of inspiration, but a dramatically real one, the graveyard in which millions of human beings belonging to all nations have been buried after having completed the crematorium in which they and their companions will be burned. Grotowski has not altered Wyspiański’s lines, just changed the order of the scenes, so that Jacob’s struggle with the Angel could be at the centre of  a play which could be reintepreted by the light shed on Auschwitz  extermination machine by Tadeusz Borowski’s concentrationary  short stories. The last line of the play comes from a caption imagined by Wyspiański for its monumental drama, but the old words have for the modern audience a tragic and complete new meaning: „they’re gone, spirals of smoke float in the air”.

  13. “A Jaguar is an Awful Cat”. Animals and Animal Metaphors in James M. Cain’s Novels

    Directory of Open Access Journals (Sweden)

    Giulio Segato

    2018-02-01

    Full Text Available James M. Cain is often linked with hard-boiled writers such as Dashiell Hammett and Raymond Chandler. Actually, he wrote a different kind of novels, where there are no ‘private eye’ detectives and very few murders. Robert Polito describes them as Noir Novels, using a term normally associated with the famous Hollywood genre, because of their particular emphasis on psyche and drama issues – distinctive elements of the Film Noir Era.

  14. The Effect of Dilution on Microsegregation in AWS ER NiCrMo-14 Alloy Welding Claddings

    Science.gov (United States)

    Miná, Émerson Mendonça; da Silva, Yuri Cruz; Dille, Jean; Silva, Cleiton Carvalho

    2016-12-01

    Dilution and microsegregation are phenomena inherent to claddings, which, in turn, directly affect their main properties. This study evaluated microsegregation in the fusion zone with different dilution levels. The overlays were welded by the TIG cold wire feed process. Dilution was calculated from the geometric characteristics of the claddings and from the conservation of mass equation using chemical composition measurements. Microsegregation was calculated using energy dispersive X-ray spectroscopy measurements of the dendrites and the chemical composition of the fusion zone. The dilution of the claddings was increased by reducing the wire feed rate. Fe showed potential to be incorporated into the solid phase ( k > 1), and this increased with the increase of dilution. Mo, in turn, was segregated into the liquid phase ( k < 1) and also increased with the increase of dilution. However, Cr and W showed a slight decrease in their partition coefficients ( k) with the increase of dilution.

  15. SBI AWS02-I CTD Data collected from the Polar Star in the Beaufort and Chukchi Seas (NODC Accession 0001290)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The field phase of the Shelf-Basin Interactions Experiment (SBI) began in 2002 with a series of three cruises to the Chukchi and Beaufort Seas. SBI is a...

  16. Czesław Miłosz “On Oneself as Another”: Miłosz - Ricoeur

    Directory of Open Access Journals (Sweden)

    Agnieszka Rydz

    2012-01-01

    Full Text Available The article is thematically related to the fundamental essay by the French hermeneutic philosopher, On Oneself as Another, which discussed with reference to Miłosz’s later writings (poetry and essays. The autobiographical quality of Miłosz’s expression is discussed through the concept of “otherness” as presented by Ricoeur. The discussion is con­ducted in the framework of triple relation of a subjective “I”: to one’s body, to the Other, and to one’s conscience. Miłosz, in his later works, responds to the ailings of the body with understanding, or even a sort of tenderness. Similar emotions are evoked by his contact with the Other, embodied by his ancestors and contemporaries. The responsibility for another person, however, and the communion with fellow people, are related, in his work, with the category of conscience. An attempt to narrate “oneself as another” allowed the Polish poet to reduce the seemingly irremovable rift between an artist and “the human family”; that rift was for Miłosz a troublesome legacy of modernism.

  17. 75 FR 50863 - Airworthiness Directives; Agusta S.p.A. Model A119 and AW119 MKII Helicopters

    Science.gov (United States)

    2010-08-18

    ... missing, or improperly fitted, engine rotary variable differential transformer (RVDT) control gear locking... box) and inspecting each rotary variable differential transformer (RVDT) control gear locking pin... manual engine throttle control, and subsequent loss of control of the helicopter. DATES: Effective...

  18. The fear of awful smell: risk perceptions among farmers in Vietnam using wastewater and human excreta in agriculture

    DEFF Research Database (Denmark)

    Knudsen, Line G; Phuc, Pham D; Hiep, Nguyen T

    2008-01-01

    Vietnamese farmers' health-risk awareness, knowledge, and practices related to their use of wastewater and human excreta was investigated in an anthropological study by a multidisciplinary team in peri-urban Hanoi and Nghe An Province. Farmers identified health risks associated with their use...... of excreta and wastewater, but they viewed these as unavoidable risks related to production. They perceived the health risks as different for the use of wastewater and human feces. They perceived health risks from wastewater as non-serious because it remained on the skin and only caused skin problems......, but they considered health risks from non-composted smelly feces serious because it entered the body through 'polluted' air. Most farmers were more aware of threats to health from 'dirt' entering the domestic environment than of the health risks during their work. The concept of 'dirt' should be separated from...

  19. Biodegradation of Medium Chain Hydrocarbons by Acinetobacter venetianus 2AW Immobilized to Hair-Based Adsorbent Mats (Postprint)

    Science.gov (United States)

    2010-09-01

    open- water oil spills or treatment of large contaminated volumes such as ballast water or holding ponds. The practi- cal application of the mat is...SS, Al-Hasan RH, Salamah S, Al-Dabbous A. Biore- mediation of oily sea water by bacteria immobilized in biofilms coating macroalgae . Int Biodeter...adsorbent, for in situ degradation of hydrocarbons, has practical application in the bioremediation of oil in water emulsions. acinetobacter

  20. Homologación de soldadores y procesos bajo el código AWS D17.1

    OpenAIRE

    Gaona Latorre, Mireia

    2015-01-01

    Los fabricantes de motores aeronáuticos exigen a las organizaciones de mantenimiento que dispongan de soldadores homologados para realizar reparaciones en los componentes. Los certificados de homologación son la mejor garantía de que los soldadores poseen la destreza y conocimientos necesarios para realizar trabajos de soldadura. Estas homologaciones se realizan tanto a los soldadores que emplean métodos manuales como a operadores de máquinas de soldeo. Este proyecto está dividido en dos p...

  1. Test procedure for use of the shear vane in tanks 103-SY, 103-AN, and 103-AW

    International Nuclear Information System (INIS)

    LeClair, M.D.; Waters, E.

    1995-01-01

    This is a record copy of a test procedure for application of the full-scale shear vane to underground waste tanks at Hanford. The introduction of the report provides background information on the development and proof-testing of the shear vane, as well as information about its current location. The document was originally prepared in 1988, and the work as shelved temporarily for lack of funds. Activities to utilize the shear vane will be expedited by use of this information

  2. Language, Epistemology, and Cultural Identity: "Hopiqatsit Aw Unangvakiwyungwa" ("They Have Their Heart in the Hopi Way of Life")

    Science.gov (United States)

    Nicholas, Sheilah E.

    2010-01-01

    Daniel Nettle and Suzanne Romaine in "Vanishing Voices: The Extinction of the World's Languages" state that indigenous peoples represent about 4 percent of the world's population but speak at least 60 percent of the world's languages. They point out the reality of an ominous linguistic crisis of global proportions--languages die and continue to…

  3. Development of System Architecture to Investigate the Impact of Integrated Air and Missile Defense in a Distributed Lethality Environment

    Science.gov (United States)

    2017-12-01

    SYSTEM ARCHITECTURE TO INVESTIGATE THE IMPACT OF INTEGRATED AIR AND MISSILE DEFENSE IN A DISTRIBUTED LETHALITY ENVIRONMENT by Justin K. Davis...TO INVESTIGATE THE IMPACT OF INTEGRATED AIR AND MISSILE DEFENSE IN A DISTRIBUTED LETHALITY ENVIRONMENT 5. FUNDING NUMBERS 6. AUTHOR(S) Justin K...ARCHITECTURE TO INVESTIGATE THE IMPACT OF INTEGRATED AIR AND MISSILE DEFENSE IN A DISTRIBUTED LETHALITY ENVIRONMENT Justin K. Davis Lieutenant

  4. Stanisław Rey’s “Manor House” and “Palace” in Sieciechowice, Investigations into The Cultural Heritage of Poland

    Science.gov (United States)

    Gil-Mastalerczyk, Joanna; Gil, Regina; Frycz Modrzewski, Andrzej

    2017-10-01

    The historic manor house - park complex is located in the centre of a village called Sieciechowice. It lies not far from Cracow, at a distance of approximately 30 km from the Wawel Castle hill. It is one of the most interesting architectural and urban objects found in the krakowski country district and in Małopolska region. The spatial development of the built-up features was closely related to the urban layout of villages. The special arrangement was characterised by a great diversity of historic residences, backup facilities and greenery. The original estate, containing several buildings and engineering structures, constituted a vital part of Sieciechowice. The buildings provided vivid illustrations of manor house and palace architecture. The estate was in the hands of the Rey family. The war events, makeshift repairs, lack of ideas on the management of the estate and permanent lack of funds, however, resulted in the decline of this once splendid estate.

  5. Selective separation of actinides and long-lived fission products from 1 AW MTR liquid waste: pilot plant tests part II

    International Nuclear Information System (INIS)

    Grossi, G.; Marrocchelli, A.; Pietrelli, L.; Calle, C.; Gili, M.; Luce, A.; Troiani, F.

    1992-01-01

    In Italy there are some 120 m 3 of liquid High-level radioactive Wastes coming from MTR, Candu and EPK River fuel elements reprocessing. These High-level radioactive wastes contain a large amount of chemicals and inert salts together with cesium, strontium and transuranium elements. Transuranium elements and strontium are separated from the inert salts by means of a selective precipitation while Cesium is adsorbed on synthetic zeolithes (AZE Process) or precipitated with sodium Tetraphenyl borate (NaTPB) (ATE process). The benchscale experiments have confirmed the feasibility of selective separation processes and have showed that decontamination efficiency for strontium, plutonium and cesium were, respectively, 100, 5000 and 1000. This second part of the CEC final report describes Searse pilot plant tests with cold experiments. 37 Refs.; 17 Figs.; 16 Tabs

  6. Analytical Hierarchy Process (Ahp) Approach on Consumer Preference in Franchise Fast Food Restaurant Selection in Manado City (Study at: Mcdonald's, Kfc, and A&w)

    OpenAIRE

    Wibowo, Svetlania Wulan; Tielung, Maria

    2016-01-01

    Franchise fast food restaurant has become one of the preferred restaurants in Manado City. There have been many outlets franchise fast food restaurant which opened its business in Manado City. The purpose of this research is to analyze the most preferred franchise fast food restaurant by consumer and to analyze the criteria that influence consumer in selecting franchise fast food restaurant. Researcher used Analytical Hierarchy Process (AHP) to compare each franchise fast food restaurant as t...

  7. "You're Awfully Old to Have This Disease": Experiences of Stigma and Ageism in Adults 50 Years and Older Living with HIV/AIDS

    Science.gov (United States)

    Emlet, Charles A.

    2006-01-01

    Purpose: Older adults living with HIV infection may be doubly stigmatized, as they are branded by both age as well as HIV status. Through semistructured interviews, this study sought to examine whether older adults with HIV/AIDS experience both ageism and HIV stigma and how those experiences manifest in their lives. Design and Methods: This was a…

  8. Decision making for destination therapy left ventricular assist devices: "there was no choice" versus "I thought about it an awful lot".

    Science.gov (United States)

    McIlvennan, Colleen K; Allen, Larry A; Nowels, Carolyn; Brieke, Andreas; Cleveland, Joseph C; Matlock, Daniel D

    2014-05-01

    Destination therapy left ventricular assist devices (DT LVADs) are one of the most invasive medical interventions for end-stage illness. How patients decide whether or not to proceed with device implantation is unknown. We aimed to understand the decision-making processes of patients who either accept or decline DT LVADs. Between October 2012 and September 2013, we conducted semistructured, in-depth interviews to understand patients' decision-making experiences. Data were analyzed using a mixed inductive and deductive approach. Twenty-two eligible patients were interviewed, 15 with DT LVADs and 7 who declined. We found a strong dichotomy between decision processes with some patients (11 accepters) being automatic and others (3 accepters, 7 decliners) being reflective in their approach to decision making. The automatic group was characterized by a fear of dying and an over-riding desire to live as long as possible: "[LVAD] was the only option I had…that or push up daisies…so I automatically took this." By contrast, the reflective group went through a reasoned process of weighing risks, benefits, and burdens: "There are worse things than death." Irrespective of approach, most patients experienced the DT LVAD decision as a highly emotional process and many sought support from their families or spiritually. Some patients offered a DT LVAD face the decision by reflecting on a process and reasoning through risks and benefits. For others, the desire to live supersedes such reflective processing. Acknowledging this difference is important when considering how to support patients who are faced with this complex decision. © 2014 American Heart Association, Inc.

  9. Decision Making for Destination Therapy Left Ventricular Assist Devices: “There was no choice” versus “I thought about it an awful lot”

    Science.gov (United States)

    McIlvennan, Colleen K.; Allen, Larry A.; Nowels, Carolyn; Brieke, Andreas; Cleveland, Joseph C.; Matlock, Daniel D.

    2014-01-01

    Background Destination therapy left ventricular assist devices (DT LVAD) are one of the most invasive medical interventions for end-stage illness. How patients decide whether or not to proceed with device implantation is unknown. We aimed to understand the decision-making processes of patients who either accept or decline DT LVADs. Methods and Results Between October 2012–September 2013, we conducted semi-structured, in-depth interviews to understand patients’ decision-making experiences. Data were analyzed using a mixed inductive and deductive approach. Twenty-two eligible patients were interviewed, 15 with DT LVADs and 7 who declined. We found a strong dichotomy between decision processes with some patients (11 accepters) being “automatic” and others (3 accepters, 7 decliners) being “reflective” in their approach to decision making. The automatic group was characterized by a fear of dying and an overriding desire to live as long as possible: “[LVAD] was the only option I had…that or push up daisies…so I automatically took this”. In contrast, the reflective group went through a reasoned process of weighing risks, benefits, and burdens: “There are worse things than death.” Irrespective of approach, most patients experienced the DT LVAD decision as a highly emotional process and many sought support from their families or spiritually. Conclusion Some patients offered a DT LVAD face the decision by reflecting on a process and reasoning through risks and benefits. For others, the desire to live supersedes such reflective processing. Acknowledging this difference is important when considering how to support patients who are faced with this complex decision. PMID:24823949

  10. WA-AW. Arquitectura moderna para la salud pública: un análisis a partir de proyectos de Wladimiro Acosta y Amancio Williams

    Directory of Open Access Journals (Sweden)

    Luis Müller

    2013-06-01

    El propósito de este trabajo es el de, analizando propuestas de Wladimiro Acosta y Amancio Williams para hospitales públicos, dar cuenta de transformaciones ocurridas al interior de los procesos y las lógicas del proyecto en apenas algo más de una década.

  11. Czeslaw Wycech as the Creator of Educational Policy [Czesław Wycech jako kreator polityki oświatowo-wychowawczej

    Directory of Open Access Journals (Sweden)

    Witold CHMIELEWSKI

    2017-11-01

    Full Text Available Czeslaw Wycech as education minister in the Interim Government of National Unity had taken a number of initiatives aimed at improving the functioning of the oganization of education in post-war Poland. He devoted much attention to shaping the territorial division of the school administration. He set himself a target of fully implementing compulsory education. He improved the structure of elementary education, abolished the three-level organization of these schools and established one-year classes. He introduced into elementary schools transitory curricula with partially revised content. He joined the efforts to increase the number of secondary and vocational schools and to popularize pre-school education. He attempted to organise educational management at the level of districts and counties. He came up with some important legislative initiatives, aimed at a comprehensive reform of the Polish system of education. He aspired to open under favourable conditions, the eighth grade of elementary school. He kept improving the teachers` training system in Poland. He wanted to educate the young generation of Poles according to contemporary needs.

  12. Professor Leon Kozłowski as a man, scientist, politician and his inϐluence into Wrocław archaeology

    Directory of Open Access Journals (Sweden)

    ALEKSANDRA BURDUKIEWICZ

    2017-10-01

    Full Text Available Th e most outstanding archaeologist and professor at John Casimir University in Lviv as well as and a acknowledged politician (among others the Prime Minister (1934– 1935 of the Second Republic of Poland was Professor Leon Kozłowski (1892–1944, a student of E. Majewski from Warsaw, R.R. Schmidt from the University of Tübingen and W. Demetrykiewicz from the Jagiellonian University in Krakow. As a professor of John Casimir University he cooperated with V. Gordon Childe from the UK and H. Breuil from France, the most outstanding archaeologists in Europe at that time. His publications stand out with a clear and well-argued reasoning, great dash and thorough knowledge of the materials and concepts of the time. He was also an excellent teacher of many Polish and Ukrainian archaeologists. Aft er 1939, he was imprisoned and tortured in the Soviet Union and Germany, where he died in unknown circumstances in 1944. Among his pupils was Helena Cehak-Hołubowiczowa (1902–1979, who, with her husband Włodzimierz Hołubowicz (1908–1962, worked in the years 1931–1939 at the Stefan Batory University in Vilnius and between 1943 and 1945 they were the forced labourers in Austria. Th ey both, since 1950, were employed at the University of Wroclaw and developed archaeology according to the ideas of Leon Kozłowski. Włodzimierz Hołubowicz developed the methodics and methodology of archaeology and Helena Cehak-Hołubowiczowa dealt with the religious beliefs of prehistoric and early medieval societies. Th ey educated many students who are now employees of the Institute of Archaeology at the University of Wroclaw, and other institutions.

  13. Comparison of organic and inorganic ion exchangers for removal of cesium and strontium from simulated and actual Hanford 241-AW-101 DSSF tank waste

    International Nuclear Information System (INIS)

    Brown, G.N.; Bray, L.A.; Carlson, C.D.

    1996-01-01

    Pacific Northwest National Laboratory (Northwest National Laboratory) conducted this study as a joint effort between the ''Develop and Test Sorbents'' task for the Efficient Separations and Processing Cross-Cutting Program (ESP) and the ''Batch Testing of Crystalline Silico-Titanates (CSTs)'' subtask, which is part of the Northwest National Laboratory Tank Waste Remediation System (TWRS) Pretreatment Technology Development Project. The objective of the study is to investigate radionuclide uptake of the newly produced CST materials under a variety of solution conditions and to compare the results obtained for this material with those obtained for other commercial and experimental exchangers

  14. [Epidemiology of secretory otitis media in children examined at the Otolaryngologic Clinic in Wrocław in 1996-1999].

    Science.gov (United States)

    Pośpiech, Lucyna; Rak, Jerzy; Jaworska, Marzena; Klempous, Joanna

    2002-01-01

    The aim of the work was an evaluation of epidemiological factors in otitis media with effusion (OME) in children. Material consisted of 191 children treated surgically in Wroclaw ENT Clinic. The control group consisted of 95 healthy children. The evaluation was based on detailed history of the patients and physical ORL examination. The factors taken into considerations were: age, sex, birth factors, breast feeding, attending to kindergarten, passive smoking, social and environmental factors, incidents of upper respiratory airways and middle ear infections before OME being diagnosed. Frequent upper respiratory infections, acute and recurrent middle ear infections, staying with other children (kindergarten) and passive smoking increase the risk of OME incidence.

  15. The Effect of Alternative Work Schedules (AWS) on Performance During Acquisition Based Testing at the U.S. Army Aberdeen Test Center

    Science.gov (United States)

    2014-09-01

    and business continuity (Giglio n.d.-a). 2. Case Two A company profile (see Table 5) and case study summary on Eastman Kodak are presented in the...because of the flexibility they offer. Each case study demonstrated how large 15 companies (i.e., Texas Instruments, Kodak , and KPMG) responded with...11 A. CASE STUDIES ................................................................................. 11 1. Case One

  16. Is sports choice and participation related to 2D:4D? A study among adult male students in Wrocław, Poland.

    Science.gov (United States)

    Koziel, Slawomir; Kociuba, Marek; Ignasiak, Zofia; Chakraborty, Raja

    2016-06-01

    Psychology and personality of individuals may have implications for choice of, and performance in sports disciplines. Individual- and group sports differ in psychological requirements, such as, competitiveness, sensation seeking and risk taking attitude, often required in sports. There is sex difference in human in these qualities, which also show association with prenatal testosterone exposures. Second-to-fourth digit lengths ratio (2D:4D) is an indicator of prenatal testosterone exposure. Lower 2D:4D indicates higher prenatal testosteron exposure and vice versa. Males generally have lower 2D:4D than females. This study cross-sectional study investigated the relationship of 2D:4D with team based- or individual sports. The participants were 421 Polish male students with a mean (+SD) age of 19.78 (+0.79) years. Among them, 139 were engaged in sports and 282 were not. Mean 2D:4D in each hand of individual sporting group was significantly lower than the team sports- and no sports groups. Participants not involved in any sports had the highest mean 2D:4D value. However, the team sportsmen’s 2D:4D did not differ from the non sporting group. Prenatal testosterone exposure might have implication in sports choice and participation.

  17. The phenomenon of femininity in the poetical imagination of Bolesław Leśmian against the background of European anthropological reflection

    Directory of Open Access Journals (Sweden)

    Marzena Karwowska

    2009-01-01

    Full Text Available In the early decades of the twentieth century the misogynist philosophical conceptions proposed by Schopenhauer, Nietzsche and Weininger exerted a particular influence upon the image of woman. In the literary output of Leśmian this phenomenon takes on the form decidedly divergent from the patterns prevalent at the time manifesting in the typical features of archetypal and mythical figures. In the construction of his literary lovers, Leśmian makes references to ritual symbolism. His almost hieratic female figures, notionally available to woman, guide the way in a possible passage between the beyond (spiritual world and the world of mortals. The poet accentuates the analogies between the sacredness of woman and the sacrum of Tellus Mater and adopts the at- titude of a neophyte who endows women with the power of initiation into the mystery of regeneration. The notional female figures created by Leśmian, with the typical for the poet positive and exhilarating valorization of woman’s body, have the power of euphemising thanatical fears and anxiety. Leśmian treats the corporeal nature of woman as hierophany: a female, revealing the sacral character of the universe, forms and contributes to its spiritual order. Schopenhauer, Nietzsche and Weininger demythologize the phenomenon of femininity, Leśmian remythologizes it back again.

  18. 77 FR 44110 - Special Conditions: Agusta S.p.A. Model AW139 and AB139 Helicopter, Installation of a Search and...

    Science.gov (United States)

    2012-07-27

    ... flight testing. For failures demonstrated in flight, the following normal pilot recovery times are... INFORMATION CONTACT: FAA, Aircraft Certification Service, Rotorcraft Directorate, Regulations and Policy Group... monitors for flight guidance deviations and failures, and contains an alerting function that provides the...

  19. Effects of gamma irradiation, pH-Reduction and AW-reduction on the shelf-life of chilled 'tenderloin rolls'

    International Nuclear Information System (INIS)

    Farkas, J.; Andrassy, E.

    1993-01-01

    Experimental batches of refrigerated, vacuum-package, ready-to-fry, minced meat product, 'tenderloin rolls' were preserved by combinations of reduction of pH from 6.1 to 5.6 by ascrobic acid, reduction of the water activity from a w =0.975 to 0.962 by sodium lactate, and/or a radiation dose of 2 kGy. Storage of the untreated and irradiated samples at +2 C for 4 weeks was followed by one-week incubation at +10 C. Total plate counts, counts of presumptive lactobacilli, the Enterobacteriaceae and sulphite-reducing clostridia were estimated at weekly intervals. pH-changes during storage were also followed. Comparative estimations of sensory qualities, thiamine contents, and TBA-values were also performed. The results demonstrated the possibility of significantly extending the shelf-life of the chilled product - without hampering the microbiological safety - by the sensorically acceptable radiation dose in combination with slight reduction of the pH and the water activity. (orig.)

  20. A Comparison of the AFGL Flash, Draper Dart and AWS Haze Models with the Rand Wetta Model for Calculating Atmospheric Contrast Reduction.

    Science.gov (United States)

    1982-03-01

    52 ILLUSTRATIONS Figure I Horizontal Visibility Profiles for Stair-Step and Exponential Extinction Coefficient...background reflectances. These values were then numerically intergrated (via a combination of Simpson’s and Newton’s 3/8th rules) and compared with the

  1. Czesław Miłosz i Walt Whitman : przekład jako prawdziwa obecność

    NARCIS (Netherlands)

    van Nieukerken, A.

    2012-01-01

    Miłosz’s later poetry attempts to overcome the [post]modernist gap between the author as a textual effect and the subject of autobiography. An important stage on this road was his poetry book (in fact, a long poem in its own right) Unattainable Earth. Its form is clearly dialogical. The collection

  2. Biochemical and haematological assessment of toxic effects of the leaf ethanol extract of Petroselinum crispum (Mill) Nyman ex A.W. Hill (Parsley) in rats.

    Science.gov (United States)

    Awe, Emmanuel Olorunju; Banjoko, S Olatunbosun

    2013-04-04

    Petroselinum crispum, a bright green biennial shrub is widely used traditionally as a food additive and herbal remedies for many ailments. This study therefore aimed to assess the toxic effects of its leaf extract using some biochemical, haematological parameters. The toxic effects were assessed by quantifying liver enzymes such as serum aspartate amino transferase (AST), alanine amino transferase (ALT), alkaline phosphatase (ALP), total serum protein and liver weight. Effects on haematological parameters were assessed by analysis of parked cell volume (PCV), red blood cell count (RBC), white blood cells (WBC) and haemoglobin (Hb) concentrations. Histopathological studies were done on the liver and kidneys. The extract caused significant increase in serum activity of alanine amino transferase and blood urea nitrogen (BUN) levels at the dose of 1000 mg/kg. Other biochemical and haematological parameters were not affected at lower doses. Conversely, the liver weight was not affected after eight weeks of treatment at the dose levels studied. The organs obtained for pathological study, were structurally unchanged under histopathological evaluation at lower doses but inflammatory and necrotic features were observed at doses ≥ 1000 mg/kg. The results indicate that the leaf ethanol extract of Petroselinum crispum was hepatotoxic and nephrotoxic at continued oral doses equal to or more than 1000 mg/kg, but no obvious toxicity when used at lower doses. Therefore, there should be caution in its administration to avoid overdosing and known interaction with some medications. In addition, the plant should be kept away from pets and domestic animals and should not be cultivated on soil irrigated with waste water due to their ability to bio-accumulate toxic metals.

  3. SBI AWS02-I Bottle and Nutrient Data collected from the Polar Star in the Beaufort and Chukchi Seas (NODC Accession 0001288)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The field phase of the Shelf-Basin Interactions Experiment (SBI) began in 2002 with a series of three cruises to the Chukchi and Beaufort Seas. SBI is a...

  4. Thermal and Radiolytic Gas Generation Tests on Material from Tanks 241-U-103, 241-AW-101, 241-S-106, and 241-S-102: Status Report

    International Nuclear Information System (INIS)

    King, C.M.; Bryan, S.A.

    1999-01-01

    This report summarizes progress in evaluating thermal and radiolytic flammable gas generation in actual Hanford single-shell tank wastes. The work described was conducted at Pacific Northwest National Laboratory (PNNL) for the Flammable Gas Safety Project, whose purpose is to develop information to support DE and S Hanford (DESH) and Project Management Hanford Contract (PHMC) subcontractors in their efforts to ensure the safe interim storage of wastes at the Hanford Site. This work is related to gas generation studies performed by Numatec Hanford Corporation (formerly Westinghouse Hanford Company). This report describes the results of laboratory tests of gas generation from actual convective layer wastes from Tank 241-U-103 under thermal and radiolytic conditions. Accurate measurements of gas generation rates from highly radioactive tank wastes are needed to assess the potential for producing and storing flammable gases within the tanks. The gas generation capacity of the waste in Tank 241-U-103 is a high priority for the Flammable Gas Safety Program due to its potential for accumulating gases above the flammability limit (Johnson et al, 1997). The objective of this work was to establish the composition of gaseous degradation products formed in actual tank wastes by thermal and radiolytic processes as a function of temperature. The gas generation tests on Tank 241-U-103 samples focused first on the effect of temperature on the composition and rate of gas generation Generation rates of nitrogen, nitrous oxide, methane, and hydrogen increased with temperature, and the composition of the product gas mixture varied with temperature

  5. [Crusading and chronicle writing on the medieval Baltic frontier: A companion to the chronicle of Henry of Livonia] / Radosław Biskup

    Index Scriptorium Estoniae

    Biskup, Radosław

    2014-01-01

    Arvustus: Crusading and chronicle writing on the medieval Baltic frontier : a companion to the chronicle of Henry of Livonia, eds. Marek Tamm, Linda Kaljundi, Carsten Selch Jensen. Farnham ; Burlington (Vt.) : Ashgate, c2011

  6. A shot from a distance. On Pierwsza piątka (The First Five by Stanisław Barańczak

    Directory of Open Access Journals (Sweden)

    Marek Hendrykowski

    2016-12-01

    Full Text Available Marek Hendrykowski’s article provides an analysis and interpretation of Barańczak’s well-known poem “Pierwsza piątka” [The First Five], whose main characters are the basketball legends of Boston Celtics, NBA champions on many occasions.

  7. ”Overhear the musical motif”. About a music-poetic cycle on the example of Music in the evening by Jarosław Iwaszkiewicz

    Directory of Open Access Journals (Sweden)

    Aleksandra Reimann

    2011-01-01

    Full Text Available The article compares the cyclic form in music with the poetic cycle. The analytico-interpretational identifying of two sub-cycles: “Music for quartet” and “Music for orchestra”, which make up the volume, helped to formulate the interdisciplinary proposition of terminology: the music-poetic cycle, which in literature also implies musical order. A reading dictated by musical expectations towards the verses touches upon many issues, such as song forms (AB, but also Lied, dynamics, intonation, phonemic assembly, the occurrence of motifs. Texts, which usually have musical titles allow comparative interpretations. The volume on poetry by Iwaszkiewicz is an example of music-literary complementarity, which must be respected, if the cycle is to be understood fully.

  8. [Professor Wiesław Magdzik (MD), the representative of the Polish School of Epidemiology in 80th anniversary of birthday].

    Science.gov (United States)

    Naruszewicz-Lesiuk, Danuta

    2012-01-01

    Wieslaw Magdzik in 1955 completed his medical studies in the Sanitary--Hygienic Department of Faculty of Medicine, Medical University of Warsaw. At the recommendation of Dr. Jan Kostrzewski, was hired in the Department of Epidemiology (2.11.1955). When working in the Department he completed the second degree of specialization in epidemiology and the first drgree of infectious diseases and also obtained doctoral degree in medical science. Head of his specialization and supervisor of dissertation was prof. Dr. Jan Kostrzewski. In 1970 the Scientific Council of the PZH awarded him a Ph.D. degree. In 1982 he received the title of associate professor and in 1988 the full professorship of medical science. At PZH he worked until 2002, to his retirement, occupying the positions: Head of the Department of Epidemiology (1979-2002), Director of PZH (1981-1990). Periodically, during the years 1972-1978, he worked in the Ministry of Health and Human Services as director of the Department of Sanitary Inspection. He participated the fight against smallpox in India, he served as a temporary adviser for the control of communicable diseases in the WHO regional office in Copenhagen, then in New Delhi. He published over 240 scientific papers. He has supervised eight doctoral theses, has been honored with many decorations and medals, among which are: the Commander's Cross of the Polonia Restituta (1998), the Order of the Bifurcated Needle (WHO, 1976), the badge ,,For Merits to the Kielce region" (1985).

  9. ¿fronteras naturales? geopolítica modernista y ecopolítica ambientalista en territorio awá: bios y thanatos en el margen

    OpenAIRE

    Naizot, Anne-Lise

    2011-01-01

    La creación de espacios extractivos, agroindustriales y ecológicos en los territorios indígenas plantea una serie de interrogantes sobre el futuro de esos territorios y, especialmente, sobre el proyecto de autonomía territorial y política de los pueblos indígenas en América Latina y el mundo. Esos espacios son ante todo espacios sociales y están atravesados por relaciones de poder que definen fronteras móviles entre la vida y la muerte, la dominación y la autonomía, la inclusión y la exclusió...

  10. Naturaleza(s), poder, sujeto(s) en territorio Awá : Bios y Thanatos en el margen socio-ambiental

    OpenAIRE

    Naizot, Anne-Lise

    2011-01-01

    La creación de espacios extractivos, tóxicos, y ecológicos en los territorios indígenas plantean una serie de interrogaciones para el futuro de esos territorios y el proyecto de autonomía territorial y política de los pueblos indígenas en América Latina y en el mundo. Esos espacios son, antes que todo, espacios sociales; son atravesados por relaciones de poder que definen fronteras móviles entre la vida y la muerte, la dominación y la autonomía, la inclusión y la exclusión. Este trabajo indag...

  11. Awful face of the war-impacted smoke bomb capsule in the face and systemic toxicity: reports from the conflict in Syria.

    Science.gov (United States)

    Yilmaz, Bahar; Yeşiloğlu, Nebil; Firincioğullari, Remzi; Gökkaya, Ali; Özbey, Rafet; Özgür, Mustafa

    2015-01-01

    In this study, a rare kind of injury due to smoke bomb capsule impaction to midface and under the cranial base is presented, and maneuvers to reduce mortality are discussed. Three male patients were presented with impacted smoke bomb capsules into the midface and under the cranial base structures. Midface structures, anterior cranial base, and, in 2 patients, unilateral eye were severely damaged. Two patients died after the initial emergency operations because their lung disease progressed to acute respiratory distress syndrome. One of the patients lived, and soft tissue reconstruction was achieved by using temporal transposition and cheek advancement skin flaps with split-thickness skin graft from donor site. However, craniofacial destruction is important in these patients; a multidisciplinary approach is needed for the treatment of direct smoke bomb injuries because the patients experienced chemical burn and acute trauma. The timing of maxillofacial reconstruction is also a question in these specific patients.

  12. Otimização dos parâmetros de tecimento para confecção de amanteigamento em chapas de aço ao carbono pelo processo TIG com arame AWS ER309L Weaving parameter optimization for buttering on carbon steel plates by TIG process with an AWS ER309L wire

    Directory of Open Access Journals (Sweden)

    Rômulo Queiroz Fratari

    2010-09-01

    Full Text Available O objetivo do presente trabalho foi avaliar os efeitos dos parâmetros de tecimento e da velocidade de alimentação sobre a formação da primeira camada de amanteigamento com aço inoxidável austenítico, visando a otimização da operação no sentido de maximizar a relação entre espessura da camada e diluição. Os experimentos foram realizados pelo processo TIG com alimentação de arame, variando-se sistematicamente, e garantindo-se a ortogonalidade do planejamento experimental, a amplitude, o tempo de parada lateral e a velocidade de alimentação, permitindo se encontrar equações estocásticas de predições da geometria resultante do depósito. Através de um programa de otimização, procurou-se os parâmetros de regulagem que levassem a maior relação da área depositada pela área fundida. Escolheu-se como restritor a relação reforço por largura, evitando-se revestimentos com alta convexidade e possibilidade de formação de sobreposição lateral de cordão. Soldagens de validação mostraram a robustez e confirmaram a adequabilidade do método de otimização. Com a metodologia empregada foi possível demonstrar a necessidade, para a otimização do cordão de amanteigamento, de se usar a máxima velocidade de alimentação e o mínimo de tempo na parada lateral. A amplitude ideal é um balanço entre os efeitos sobre a área fundida e convexidade, mostrando uma tendência de adquirir um valor maior do que a faixa central.The objective of the present work was to evaluate the effects of the weaving parameters and of the wire feed speed on the formation of a stainless steel buttering layer, aiming the process optimization by the layer height and dilution maximization. The experiments were carried out by the TIG process with wire feeding. Weaving amplitude, lateral dwell time and wire feed speed were systematically varied, through an orthogonal experimental planning, allowing finding stochastic predictive equations of the geometry resulting from the deposits. Through an optimization program, it was sought the tuning parameters to take the largest relationship between deposited and melted areas. It was chosen as restrictor the relationship bead reinforcement by bead width, avoiding deposits with high convexity and possibility of overlay formation. Welding of validation showed the robustness and confirmed the adequacy of the optimization approach. With the employed methodology, it was possible to demonstrate the need of using the fastest wire feed speed and the minimum dwell time for buttering bead optimization. The ideal amplitude is a balance between the effects of it on melted area and bead convexity, presenting a tendency for taking a value greater than the one in the middle of the central range.

  13. Loovlinn - kultuuriga vääristatud turismitoode / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2005-01-01

    Panu Lehtovuori ja Justin O'Connoriga kultuuritööstusest ja loovate linnade loomisest. Selgitatakse kultuuritööstuse, loovlinnade ja loovtööstuse mõisteid. Manchesteri ülikooli professor Justin O'Connor esines linnaruumi teemalisel seminaril Eesti Kunstiakadeemias. Seminari korraldas kunstiakadeemia urbanistika õppetooli juhtima asuv Panu Lehtovuori

  14. Alternative Work Schedules Increase Employee Satisfaction.

    Science.gov (United States)

    Turney, John R.; Cohen, Stanley L.

    1983-01-01

    Facets of alternative work schedules (AWS) are discussed: importance of employee control, possible negative consequences, AWS handbook, time monitoring systems, and treatment of exceptions. AWS' effect on productivity and motivation is examined. (SK)

  15. [Proceedings of the symposium 'Molluscan Palaeontology' : 11th International Malacological Congress, Siena (Italy) 30th August - 5th September 1992 / A.W. Janssen and R. Janssen (editors)]: The Mesozoic Marine Revolution and epifaunal bivalves

    NARCIS (Netherlands)

    Harper, E.M.; Skelton, P.W.

    1992-01-01

    The well documented dramatic increase in predation pressure which started during the early Mesozoic, termed the Mesozoic Marine Revolution (MMR), had an important impact on the evolution of prey organisms (Vermeij, 1983). Epifaunal bivalves in particular are at considerable risk to predation. In

  16. Procedimientos de control e inspección aplicados en la fabricación de la estructura de un puente soldado de acuerdo al código aws d1.5

    OpenAIRE

    Acosta Herrera, Hector Xavier; Serrano V, Omar

    2009-01-01

    El objetivo primordial de la presente tesis es la de presentar un método de control de calidad inspección aplicados a la fabricación de un puente y de esta manera crear una cultura de calidad en todo el proceso de fabricación, dándole mayor énfasis al control e inspección de la soldadura. Para obtener mejores resultados en el control de calidad durante la fabricación, se ha adaptado un programa de Inspección el cual incluirá los diferentes controles e inspecciones que deben realizars...

  17. Nägemise orvud (ehk Kuidas modernism on olnud kohutav lapsevanem) = Orphans of Vision (or how modernism has been an awful parent) / Jeremy Canwell ; tõlk. Heie Treier

    Index Scriptorium Estoniae

    Canwell, Jeremy

    2008-01-01

    Jüri Okase, vene maalikunstniku Grisha Bruskini ja saksa kunstniku Blinky Palermo (sünd. Peter Schwarz) looming ameerika minimalismi seisukohtadelt vaadatuna. Ameerika kunstikriitiku Clement Greenbergi seisukohad

  18. Comparative testing of radiographic testing, ultrasonic testing and phased array advanced ultrasonic testing non destructive testing techniques in accordance with the AWS D1.5 bridge welding code.

    Science.gov (United States)

    2014-02-01

    A comprehensive body of non-destructive testing data was collected from steel bridge welds under real-world conditions in a fabricators shop. Three different non-destructive testing (NDT) techniques were used on each weld inspection, these being R...

  19. Comparative testing of radiographic testing, ultrasonic testing and phased array advanced ultrasonic testing non destructive testing techniques in accordance with the AWS D1.5 bridge welding code : [summary].

    Science.gov (United States)

    2014-02-01

    To ensure that Florida bridges remain safe and structurally secure for their 50-year-plus service life, they are inspected regularly. For steel bridges, welds critical to the bridges integrity do not even leave the workshop unless they meet rigoro...

  20. The influence of various doses of phosphorus and of the addition of calcium or potassium fertilization upon the yield of tomatoes in Wrocław hydroponic culture using two intensities of light

    Directory of Open Access Journals (Sweden)

    Z. Gumicka

    2013-12-01

    Full Text Available Two experiments were carried out with phosphate fertilization of tomatoes in hydroponic culture. It has been proved that an additional dose of phosphorus given during the second cluster bloom, caused an yield increase. The optimal dose is 12 g of superphosphate (16% P2O5 per plant. The "green back" symptoms did not appear in these conditions. The parallel additional applying of calcium or potassium gave a decrease of the yield. When the light intensity was lowered to about 50%, the yield has decreased by half. In these conditions an additional applying of calcium (0,4 g CaCO3 and phosphorus (1g superphosphate annulated the negative influence of the low light intensity.

  1. Al-Isyârât al-Kauniyyah fi al-Hurûf al-Muqatha’ah Awâili al-Suwar ‘Inda Thanthawi Jauhari

    Directory of Open Access Journals (Sweden)

    Ilham Habibullah

    2017-07-01

    Full Text Available Muslim scholars have different views about the meaning and interpretation of the letters of Muqatha'ah in the Qur'an. This issue also received special attention from the orientalists, as they saw that the letters of Muqatha'ah belonged to the deficiency of the Qur'an. According to Thanthawi Jauhari the different views among Muslim scholars includes three points: first, the letters need not be interpreted because the real meaning of Muqotha’ah is only Allah knows (Mutasyâbihât; second, the letters have related meaning to Asma Allah SWT or related to the names of surah in al- Qur'an; third, the letters are codes containing messages to read the Greatness of Allah SWT in this universe. That is the reason why according to Thanthawi "alif lâm mîm" has a close correlation with "alam taro", that alif lâm and mîm lead to verses that read "alam" which are both derived from the lâm and mîm alif letters. This paper discusses about the third point, which is exploring the meanings of the letters of Muqhata'ah that related to this universe according to Thanthawi Jauhari. Namely all the verses that discuss about alam (nature, such as geography and astrology referring to "alif lâm mîm". Thanthawi tries to bring his interpretation to the current reality, that the letters of muqhata'ah are symbols of all modern science, such as psychology, military, organization and political science. But of course Thanthawi is very observant and careful in relating the verse that according to the Muslim scholars are included in the mutasyâbihât discussion, so Thantawi always tries to provide clear evidence. But Thanthawi insists that the verses in the Qur'an have a very dominant scientific message or Isyârât.

  2. Changes in weed infestations on plantations of sugar beet (Beta vulgaris L. subsp. vulgaris cultivated on black soil near Wrocław in 1989–1995 and 2006–2012

    Directory of Open Access Journals (Sweden)

    Krzysztof Domaradzki

    2016-03-01

    Full Text Available Field studies were carried out in 1989–1995 and 2006–2012 on plantations of sugar beet (Beta vulgaris L. subsp. vulgaris. During this period, 542 phytosociological relevés were made using the Braun-Blanquet method. In total, 46 weed species were found. In 1989–1995, the occurrence of 36 segetal species was reported. The highest cover indices were determined for Chenopodium album and Amaranthus retroflexus. Galium aparine, Echinochloa crus-galli, and Elymus repens were the dominant species, as well. Analysis of the frequency of occurrence revealed one constant species (Chenopodium album, two frequent species (Amaranthus retroflexus and Galium aparine, and two medium-frequent species (Echinochloa crus-galli and Matricaria maritima ssp. inodora. In 2006–2012, the occurrence of 40 weed species on the sugar beet plantations was recorded. The plantations were clearly dominated by Chenopodium album, accompanied by Polygonum persicaria and Polygonum lapathifolium ssp. lapathifolium. Other dominant species comprised Setaria viridis, Galinsoga parviflora, Brassica napus ssp. napus, and Fallopia convolvulus. The Chenopodium album was a constant component of the sugar beet plantations. In turn, no frequent species were observed and six medium-frequent species were found (Setaria viridis, Galinsoga parviflora, Brassica napus ssp. napus, Echinochloa crus-galli, Amaranthus retroflexus, and Capsella bursa-pastoris. Noteworthy, the presence of previously unreported species, e.g., Abutilon theophrasti, Hyoscyamus niger, or Artemisia vulgaris, was revealed. These species are rare components in sugar beet crops. A reverse phenomenon, i.e., the disappearance of some species such as Euphorbia helioscopia, Malva neglecta, Rumex acetosella, Sinapis arvensis, or Sisymbrium officinale, was also observed.

  3. Calificación de procedimientos de soldadura, operadores y soldadores en procesos smaw y gmaw, de acuerdo al código aws d1.1 para aceros estructurales

    OpenAIRE

    Chan Pozo, Ma. Angelica; Serrano Valarezo, Omar

    2009-01-01

    Inicialmente, se explicará el procedimiento de calificación de soldaduras de ranura y se expondrán los tipos de ensayos de calificación establecidos por el código citado y sus respectivos criterios de aceptación. A continuación, se calificará una soldadura de ranura en V realizada mediante el proceso de Soldadura de Arco con Electrodo Revestido, SMAW. Si dicha soldadura fuera aprobada se elaborará el respectivo Certificado de Calificación del Procedimiento y el Registro de Calificación de...

  4. ANALISIS POSITIONING RESTORAN CEPAT SAJI WARALABA FRIED CHICKEN DI BANJARMASIN BERDASARKAN PERSEPSI KONSUMEN (Studi Pada KFC Duta Mall, Texas Fried Chicken Duta Mall,AW Duta Mall Dan California Fried Chicken Rs Ulin Banjarmasin)

    OpenAIRE

    Prihatini Ade Mayvita; Ikhwan Faisal

    2016-01-01

    During  the  last  14  years,  the  growth  rate  of  fried  chicken  franchise  with  the concept of fast food restaurants in Banjarmasin is 12% per year. It is characterized by large number of outlets/stores of fried chicken franchise in Banjarmasin city as many as 10 outlets. Most of the existing outlets are in Duta Mall Banjarmasin.  This study aims to identify and analyze the competitive position of fried-chicken fast-food franchise restaurants based on the consumers’ perceptions (St...

  5. Efeito da Diluição Sobre a Microestrutura da Liga AWS ER NiCrMo-14 na Soldagem de Revestimentos pelo Processo TIG com Alimentação de Arame Frio

    Directory of Open Access Journals (Sweden)

    Émerson Mendonça Miná

    Full Text Available Resumo: A diluição é um evento de forte influência na microestrutura e, consequentemente, nas propriedades de revestimentos soldados. O presente estudo avaliou o efeito do nível de diluição na microestrutura da zona fundida de revestimentos da liga Inconel 686. Os revestimentos foram depositados por processo TIG com alimentação de arame frio. A diluição foi calculada a partir das características geométricas dos revestimentos e por medidas de composição química de EDS e de espectroscopia de emissão ótica. As microestruturas de todos os revestimentos foram compostas por uma matriz γ-CFC com alguns precipitados secundários. Essas partículas são chamadas de fases topologicamente compactas. Esses precipitados assumiram diversos aspectos morfológicos, nos quais os precipitados com morfologia disforme foram observados com maior frequência em todos os revestimentos avaliados, independentemente do nível de diluição. Uma fase com morfologia lamelar, que estabelece uma relação de orientação com a matriz γ-CFC na direção de solidificação, foi observada nos revestimentos de menor diluição. Além disso, uma fase com morfologia disforme com uma fina precipitação agregada foi observada nos revestimentos mais diluídos.

  6. Case report

    African Journals Online (AJOL)

    raoul

    2011-08-16

    Aug 16, 2011 ... ... due to exuberant immune responses to occult or apparent opportunistic infections or cancers. ... A full blood count revealed a packed cell volume of 28% and total .... Stebbing Justin, Portsmouth Simon, Gazzard Brain.

  7. Plaadid / Priit Juurmann

    Index Scriptorium Estoniae

    Juurmann, Priit

    2006-01-01

    Uutest heliplaatidest Alexkid "Caracol", Bob Dylan "Modern Times", Justin Timberlake "Future Sex", Ilves, Pulk ja Rahman "Murõt ei olõ", Audioslave "Revelations", Bill Frisell "Bill Frisell, Ron Carter, Paul Motian", Julie & Khari "Moon Bossa"

  8. Lean Manufacturing Principles Guide, Version 0.5. A Guide to Lean Shipbuilding

    National Research Council Canada - National Science Library

    Liker, Jeffrey K; Lamb, Thomas

    2000-01-01

    .... Through years of trial and error on the shopfloor Toyota discovered that they could simultaneously achieve high quality, low cost, and just-in time delivery by shortening the production flow by eliminating waste...

  9. Children's Brain Tumor Foundation

    Science.gov (United States)

    ... 2 Family Donate Volunteer Justin's Hope Fund Children’s Brain Tumor Foundation, A non-profit organization, was founded ... and the long term outlook for children with brain and spinal cord tumors through research, support, education, ...

  10. Histopathology of Polymicrogyria

    Directory of Open Access Journals (Sweden)

    Iga Fudyma

    2015-12-01

    Full Text Available Investigators from Sainte Justine Hospital (Montreal, Montreal Neurological Hospital and Institute, King's College Hospital (London, and John Radcliffe Hospital (Oxford retrospectively reviewed medical records, autopsy reports, and genetic studies containing “Polymicrogyria.”

  11. 78 FR 54663 - National Vaccine Injury Compensation Program; List of Petitions Received

    Science.gov (United States)

    2013-09-05

    .... Julie Cochran on behalf of John James Bieber, Deceased, Dayton, Tennessee,, Court of Federal Claims No... of Justin Ryker Swick, Deceased, Iowa Falls, Iowa, Court of Federal Claims No: 13-0526V 32. Megan...

  12. Antioxidant benzophenones and xanthones from the root bark of ...

    African Journals Online (AJOL)

    Antioxidant benzophenones and xanthones from the root bark of Garcinia smeathmannii. Alain Meli Lannang, Justin Komguem, Fernande Ngounou Ngninzeko, Jean Gustave Tangmouo, David Lontsi, Asma Ajaz, Muhammad Iqbal Choudhary, Beiban Luc Sondengam, Atta -ur-Rahman ...

  13. "Lilja 4-everi" õppetund / Kaur Kender

    Index Scriptorium Estoniae

    Kender, Kaur, 1971-

    2003-01-01

    Suures osas Paldiskis filmitud Rootsi mängufilm "Lilja 4-ever" : režissöör Lukas Moodysson. Filmi peategelase Lilja saatuse võrdlus markii de Sade'i romaani "Justine ehk Vooruse õnnetused" nimitegelase omaga

  14. Room-Temperature Single-Photon Source for Secure Quantum Communication

    Data.gov (United States)

    National Aeronautics and Space Administration — We are asking for four years of support for PhD student Justin Winkler's work on a research project entitled "Room temperature single photon source for secure...

  15. Idoldyrkelse

    OpenAIRE

    Pedersen, Lærke; Jessen, Frida Julie; Dyjak, Sofie; Isaqzai, Hossai; Winther, Line Sandra; Henriques, Marie Simone Malmborg; Jagielska, Anna Pipi Olivia

    2014-01-01

    This project examines the subject of celebrity idolisation on the basis of a specific case: fans of contemporary pop-icon Justin Bieber. The examination of this subject is made on the basis of classical theories: mass psychology by Le Bon and psychoanalysis by Freud. The project includes an analysis of these theories and their psychological ideas based on an interview with three girls who worship Justin Bieber. This analysis aims to explore why a person worships a celebrity, and concludes tha...

  16. 76 FR 7216 - National Institutes of Health Statement of Organization, Functions, and Delegations of Authority

    Science.gov (United States)

    2011-02-09

    ... Office of Portfolio Analysis (OPA) and Office of Program Evaluation and Performance (OPEP) within the... headed ``Office of Portfolio Analysis and Strategic Initiatives'' (N AW6, formerly HN AW6), insert the following: Office of Portfolio Analysis (N AW7, formerly N AW7) (1) Prepare and analyze data on NIH...

  17. Long-term kinetics of Salmonella Typhimurium ATCC 14028 survival on peanuts and peanut confectionery products.

    Directory of Open Access Journals (Sweden)

    Maristela S Nascimento

    Full Text Available Due to recent large outbreaks, peanuts have been considered a product of potential risk for Salmonella. Usually, peanut products show a low water activity (aw and high fat content, which contribute to increasing the thermal resistance and survival of Salmonella. This study evaluated the long-term kinetics of Salmonella survival on different peanut products under storage at 28°C for 420 days. Samples of raw in-shell peanuts (aw = 0.29, roasted peanuts (aw = 0.39, unblanched peanut kernel (aw = 0.54, peanut brittle (aw = 0.30, paçoca (aw = 0.40 and pé-de-moça (aw = 0.68 were inoculated with Salmonella Typhimurium ATCC 14028 at two inoculum levels (3 and 6 log cfu/ g. The Salmonella behavior was influenced (p420 days, especially in products with aw around 0.40.

  18. ORF Alignment: NT_033778 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available r) ... Length = 206 ... Query: 114 AWCKLFECLHRYPLVTKPAVNSMHLCEAPGAFIASLNHYLHSKYEKDEIKWRWRSTTLNP 173 ... ... ... AWCKLFECLHRYPLVTKPAVNSMHLCEAPGAFIASLNHYLHSKYEKDEIKWRWRSTTLNP Sbjct: 1 ... AW...CKLFECLHRYPLVTKPAVNSMHLCEAPGAFIASLNHYLHSKYEKDEIKWRWRSTTLNP 60 ... Query: 234 DGSIDCAAQPDCQEEIVVRLFFAEVLSALRILSS

  19. Delayed Antiwindup Control Using a Decoupling Structure

    Directory of Open Access Journals (Sweden)

    Huawei Zhu

    2013-01-01

    Full Text Available This paper investigates the antiwindup (AW control problem for plants with input saturation. The AW compensator is not activated as soon as input saturation occurs as usual. A delayed decoupling structure is first proposed. Then, appropriate linear matrix inequalities (LMIs are developed to determine a plant-order AW compensator. Effectiveness of the presented AW technique is illustrated by a fighter aircraft model.

  20. 29 CFR 1910.67 - Vehicle-mounted elevating and rotating work platforms.

    Science.gov (United States)

    2010-07-01

    ... nationally recognized testing laboratory, to be in conformity with all applicable provisions of ANSI A92.2...) Welding standards. All welding shall conform to the following Automotive Welding Society (AWS) Standards... Procedure, AWS B3.0—41. (ii) Recommended Practices for Automotive Welding Design, AWS D8.4-61. (iii...

  1. 167th Airlift Wing > Home

    Science.gov (United States)

    flight-related information.(Call 911 for emergencies) MID AIR COLLISION AVOIDANCE (MACA) INFO Note: The page on a full 8.5" x 11" sheet. 167 AW MACA Pamphlet - April 2017 167AW MACA Document - April 2017 167AW MACA Poster - Coming Soon featured Links mission Posted 02/09/2017 Freedom of

  2. On harmonic curvatures of a Frenet curve in Lorentzian space

    International Nuclear Information System (INIS)

    Kuelahci, Mihriban; Bektas, Mehmet; Erguet, Mahmut

    2009-01-01

    In this paper, we consider curves of AW(k)-type, 1 ≤ k ≤ 3, in Lorentzian space. We give curvature conditions of these kind of curves. Furthermore, we study harmonic curvatures of curves of AW(k)-type. We investigate that under what conditions AW(k)-type curves are helix. Some related theorems and corollaries are also proved.

  3. Interacting temperature and water activity modulate production of ...

    African Journals Online (AJOL)

    West African Journal of Applied Ecology ... Concentrations of DA were further modulated by interactions of temperature and aw. ... was at 0.98 aw and 35°C while the lowest was at 0.96 aw and 35°C. The abiotic interactions that supported biomass production appeared different from what was required for production of DA.

  4. Relationship between water activity, deformation speed, and crispness characterization

    NARCIS (Netherlands)

    Castro Prada, E.M.; Primo Martin, C.; Meinders, M.B.J.; Hamer, R.J.; Vliet, van T.

    2009-01-01

    Very little is known on the rate dependency of the fracture behavior of crispy products as a function of water activity (Aw). Therefore, the effect of deformation speed on instrumental and sensory crispness was studied as a function of Aw. Deformation speed clearly affects the transition Aw range

  5. Water Activated Doping and Transport in Multilayered Germanane Crystals

    Science.gov (United States)

    2015-09-21

    Justin Young, Basant Chitara , Nicholas Cultrara , Maxx Q Arguilla , Shishi Jiang, Fan Fan , Ezekiel Johnston-Halperin, Joshua E Goldberger 611102 c...Crystals Justin R Young1, Basant Chitara2, Nicholas D Cultrara2, Maxx Q Arguilla2, Shishi Jiang2, Fan Fan2 Ezekiel Johnston-Halperin1, Joshua E...Optoelectronics ACS Nano 7 5660-5 [9] Zhang Y, Tan Y-W, Stormer H L and Kim P 2005 Experimental observation of the quantum Hall effect and Berry’s phase in

  6. [The constribution of Justyne Siegemundin, the midwife of the Brandenburg court, to the development of the obstetrics at XVII century].

    Science.gov (United States)

    Kraśnianin, Elzbieta; Semczuk, Andrzej

    2006-12-01

    From the beginning of the world assisting during childbirth was and is the women's domain. On the evolution this profession composed of many famous midwifes. Into this group unquestionably we can count Justine Siegemundin (1636-1705), midwife-self-taught person. Her activity contributed to rise the obstetrics knowledge in XVII century. Justine Siegemundin, the midwife of the Brandenburg court, published in 1690 a book describing a surgical trick still bears her name today. It is called the "double hold"--"Gedoppelter Handgriff", or "Siegemundin-Handgriff". This book counts as on the most important milestones of obstetrics history.

  7. Knowledge and opinions of veterinary students in Italy toward animal welfare science and law.

    Science.gov (United States)

    Magnani, D; Ferri, N; Dalmau, A; Messori, S

    2017-03-04

    Animal welfare (AW) is a growing concern worldwide and veterinary students are expected to demonstrate a high degree of professional interest in the welfare of animals. However, previous studies have highlighted gaps in the teaching of AW teaching in different countries, possibly impairing veterinary competency in the area. This survey aimed to assess the opinions of Italian veterinary students towards AW, as well as their knowledge on the issue. Questions were divided into different sections, investigating the definition of, and information on, AW, knowledge about AW legislation, and the level of tolerance towards AW in regard to the use of animals for different purposes. Results showed that behaviour was the most frequently used word to define AW. Italian students considered their own level of knowledge on AW as good, relying on their university training, websites and television. They requested more AW legislation, but when questioned on specifics of the current legislation, there was a general lack of knowledge. Although poultry, pigs and rabbits were considered the species experiencing the worst management conditions, the species that raised the most AW concerns were companion animals and cattle. Results from this investigation may allow the development of tailored actions aimed at appropriately implementing educational strategies, at national and international levels, to improve the role of future veterinarians as leaders in AW. British Veterinary Association.

  8. Sensitivity of various bone parameters of laying hens to different daily calcium intakes.

    Science.gov (United States)

    Cheng, T K; Coon, C N

    1990-12-01

    Experiments were designed to examine the sensitivity of various bone parameters of laying hens to different levels of calcium intake (2.0, 2.5, 3.0, 3.5, 4.0, and 4.5 g/day). All birds were individually fed 85 g of feed daily. Dry femur weight (DW) and absolute ash weight (AW) of the whole bone (WB), cortical bone (CB), or medullary bone (MB) were reliable indicators of bone status affected by changes in calcium intake. Expressing AW as a percentage of fat-free dry matter (AW/FFDM) or a percentage of dry weight (AW/DW) showed no effect due to different levels of calcium intake. The correlations between CB-AW/FFDM or CB-AW/DW with calcium intake were .05 and -.07, respectively. Bone ash concentration and bone ash per unit volume (AW/VOL, mg/mL) was very sensitive to different levels of calcium intake; the values increased linearly as calcium intake increased from 2 to 4.5 g/day (WB = 316 to 403; CB = 479 to 571; MB = 133 to 213). Bone-breaking force (BBF), bone-bending moment (BBM), bone stress, and BBF/100 g body weight were equally sensitive in indicating bone mineral reserves due to different levels of calcium intake. Regression equations showed that AW/VOL alone (true for WB, CB, and MB) was capable of predicting BBM well (all with R2 greater than .82). However, AW/FFDM did not have predictive power over BBM (CB-AW/FFDM:R2 less than .001). Using daily calcium intake as the predictor, regression lines for BBM, WB-AW, WB-AW/VOL, CB-AW/VOL, and MB-AW/VOL yielded significant slopes of 1.24 kg.cm, .01 g, 17.11 mg/mL, 16.34 mg/mL, and 16.42 mg/mL, respectively.

  9. Role of Housing Reconstruction Between Years 2000 - 2014 in Merging of Urban Structure of The North East Wrocław / Rola Zabudowy Mieszkaniowej z Lat 2000-2014 w Scalaniu Struktury Urbanistycznej Północno-Wschodniego Wrocławia

    Directory of Open Access Journals (Sweden)

    Masztalski Robert

    2016-03-01

    Full Text Available The article presents the urban structure of the North-East of Wroclaw, where in the vicinity of the historic buildings and residential buildings from the 70s of the last century, and between, in the last 20 years there were built new buildings, as binding material of the urban structure. The new multifamily housing development of years 2000-2014 of Psie Pole as a housing development in Wroclaw, closes the gap between the historic district residential buildings in the old Psie Pole and the buildings of large slabs of the 70s of the twentieth century. The contemporary residential development uses the existing social infrastructure centre of the old Psie Pole district, and also the social infrastructure of the housing development of 70s of the twentieth century. The authors analyze, in the first part, the spatial development of these areas on the basis of historical materials. In the following, based on an analysis of urban structure created in the last 15 years of development, analyze existing conditions, context and value (in terms of urban planning - the wealth of social infrastructure, the contemporary housing development of Psie Pole.

  10. Opracowanie optymnlnych dawek i form makro- i mikro elementów pożywki hydroponicznej w metodzie wrocławskiej przy równoczesnym działaniu humianoów [Elaboration of optimal doses and forms of macro- and microelements and hiLrnatcs in the nutrient used in hydroponic culture "Wrocław"

    Directory of Open Access Journals (Sweden)

    Z. Gumiński

    2015-06-01

    Full Text Available The effectiveness of macro- and microelements of modified solution of Hampe was investigated. In general, the original doses and forms of ions were optimal. Nevertheless, a pronounced dependence on external factors was found. In aulumn, changes of magnesium doses were of no importance. A double calcium dose was optimal at that time. During summer copper, boron and molybdenum gave better effects if applied in tenfold doses. Applying of humate in non-optimal conditions was distinctly adventageous.

  11. [Proceedings of the symposium 'Molluscan Palaeontology' : 11th International Malacological Congress, Siena (Italy) 30th August - 5th September 1992 / A.W. Janssen and R. Janssen (editors)]: Trace fossils on molluscs from the Molluscan Clay (Late Oligocene, Egerian) — a comparison between two localities (Wind Brickyard, Eger, and Nyárjas Hill, Novaj, NE Hungary)

    NARCIS (Netherlands)

    Årpád, Dàvid

    1992-01-01

    Trace fossils, found on shells of gastropods, bivalves and scaphopods from Molluscan Clay exposures (Oligocene, Egerian) at Eger (Wind brickyard) and Novaj (Nyárjas Hill) (NE Hungary), were studied. The relative abundance of different types of borings, traces of bioerosion and palaeopathological

  12. [Proceedings of the symposium 'Molluscan Palaeontology' : 11th International Malacological Congress, Siena (Italy) 30th August - 5th September 1992 / A.W. Janssen and R. Janssen (editors)]: Early rissoid gastropods from the Jurassic of Italy: the meaning of first appearances

    OpenAIRE

    Conti, M.A.; Monari, S.; Oliviero, M.

    1992-01-01

    Studies of Jurassic outcrops from Veneto, Central Italy and Sicily improved our knowledge on the gastropods of these areas, characterised by the presence, aside of archaic forms, of some modern ones. Noteworthy is the record from those outcrops of several species, which can be referred to the family Rissoidae (Rissooidea). Formerly, earliest rissoid records were only known from European outcrops of younger age. In the Italian records several species have been recognised belonging to at least ...

  13. Brasagem dos aços inoxidáveis duplex 'baixa liga' UNS S32101, UNS S32304 e superduplex UNS S32750 com metal de adição AWS A5.3 tipo BNi-7 (Ni-Cr-P

    Directory of Open Access Journals (Sweden)

    Dany Michell Andrade Centeno

    2013-12-01

    Full Text Available Os aços inoxidáveis duplex, devido à sua resistência à corrosão, têm uma grande aplicação em diversos segmentos industriais, onde a resistência à corrosão é uma propriedade requerida. Por terem resistência mecânica superior aos aços inoxidáveis ferríticos e austeníticos convencionais, podem produzir equipamentos mais leves. Quando ciclados termicamente, estes aços podem ter suas propriedades alteradas, principalmente quando se emprega processos de junção, como a brasagem, e quando ocorre o desbalanceamento da fração volumétrica ferrita/austenita. O objetivo deste trabalho é caracterizar a brasagem de aços inoxidáveis duplex 'baixa liga' e superduplex, verificando o efeito da folga e do tempo de brasagem na formação de intermetálicos contínuos no interior da junta brasada. Neste trabalho foram brasados, em forno continuo com atmosfera de hidrogênio, corpos-de-prova de aço inoxidável duplex UNS S32101, UNS S32304 e UNS S32750 com a adição para brasagem BNi-7 (Ni-Cr-P, na temperatura de 1100ºC, por tempos de 12 min e 32 min, utilizando-se folgas das juntas de 0,0 e 0,3 mm, seguidos de resfriamento em forno. Os corpos de prova foram caracterizados utilizando-se microscópio óptico, microscópio eletrônico de varredura com EDS e difração de raios X. Os resultados mostraram que a melhor condição para a brasagem em forno empregado foi a brasagem com a folga de 0,0 mm. Ambas as folgas apresentaram microestruturas variadas, porém a folga de 0,0 mm mostrou a presença de uma fase contínua CFC (cúbica de face centrada, rica em níquel, que é denominada, frequentemente, de γ-Ni. Para folgas de 0,3 mm, forma-se uma região eutética contínua no centro da junta, que pode prejudicar as propriedades mecânicas da mesma. Esta região é composta de fases intermetálicas ricas em fósforo. Foram observadas precipitações de fase sigma no metal de base no AID UNS S35750, nas condições de brasagem estudadas.

  14. 75 FR 74002 - Fresh Garlic From the People's Republic of China: Extension of Time Limit for Preliminary Results...

    Science.gov (United States)

    2010-11-30

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-570-831] Fresh Garlic From the People... Trading, Inc.), Milton Koch (Jining Yifa Garlic Produce Co., Ltd.), Justin Neuman (Shenzhen Bainong Co... Department published the initiation of the new shipper reviews of the antidumping duty order on fresh garlic...

  15. Embedding JIT into MRP

    NARCIS (Netherlands)

    Flapper, S.D.P.; Miltenburg, G.J.; Wijngaard, J.

    1991-01-01

    Today many companies who are using MRP production control systems are investigating how they can produce some or all of their products using just-in time (JIT) principles. They wonder to what extent MRP can provide support for JIT production. This paper describes how JIT can be embedded into MRP. A

  16. Becoming a Youth Activist in the Internet Age: A Case Study on Social Media Activism and Identity Development

    Science.gov (United States)

    Fullam, Jordan

    2017-01-01

    This paper draws on a case study of one youth activist, and explores connections between social media activism, identity development, and critical education. Justin Rodriguez, a 17-year-old high school student in Newark, New Jersey, leveraged social media and texting as organizing tools and garnered support for a school walkout to protest…

  17. Extended Independent Comparison of Popular Deep Packet Inspection (DPI) Tools for Traffic Classification

    DEFF Research Database (Denmark)

    Bujlow, Tomasz; Carela-Español, Valentín; Barlet-Ros, Pere

    ), Sopcast, Spotify, Steam, TOR, and World of Warcraft. The included web services are: 4Shared, Amazon, Apple, Ask, Bing, Blogspot, CNN, Craigslist, Cyworld, Doubleclick, eBay, Facebook, Go.com, Google, Instagram, Justin.tv, LinkedIn, Mediafire, MSN, Myspace, Pinterest, Putlocker, QQ.com, Taobao...

  18. Developing Senior Leaders’ Family and Social Strength in the Operational Army

    Science.gov (United States)

    2013-04-01

    April 2007): 87. 19 Joe Doty & Jeff Fenlason, “ Narcissism and Toxic Leaders,” Military Review Online, (January-February 2013): 55-60. 20...Generations at Work (New York, NY: Amacom, 2010). 40Justin Menkes, “ Narcissism : The Difference Between High Achievers and Leaders,” Harvard Business

  19. Coalition Warfare Program Tactile Situation Awareness System for Aviation Applications: Simulator Flight Test

    Science.gov (United States)

    2015-12-01

    David Myers1 Timothy Gowen2 Angus Rupert3 Ben Lawson3 Justin Dailey3,4 1Chesapeake Technology International 2Naval Aviation Center for... Angus Rupert of the USAARL. The algorithm is described in “Configuration Parameters for the Tactile Situation Awareness System (TSAS)” dated July 2010

  20. Operational art in the Defense: The German Abwehrschlachten in 1918

    Science.gov (United States)

    2012-05-17

    Siegismund, 1937), 74. 21 Jacob Jung, Max von Gallwitz (1852-1937) (Osnabrück: Biblio -Verlag, 1995), 93 & 97. 22 Erich Ludendorff, Meine...Goerre-Verlag, 2003. 44 Jung, Jakob. Max von Gallwitz (1852-1937). Osnabrück: Biblio -Verlag, 1995. Kelly, Justin, and Michael J. Brennan. "The

  1. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 19; Issue 2. Why Some Pool Shots are More Difficult Than Others. Justin Jankunas Richard N Zare. General Article Volume 19 Issue 2 February 2014 pp 116-122. Fulltext. Click here to view fulltext PDF. Permanent link:

  2. Advanced Concept Architecture Design and Integrated Analysis (ACADIA)

    Science.gov (United States)

    2017-11-03

    1 Advanced Concept Architecture Design and Integrated Analysis (ACADIA) Submitted to the National Institute of Aerospace (NIA) on...Research Report 20161001 - 20161030 Advanced Concept Architecture Design and Integrated Analysis (ACADIA) W911NF-16-2-0229 8504Cedric Justin, Youngjun

  3. Support for Implications of Compressive Sensing Concepts to Imaging Systems

    Science.gov (United States)

    2015-08-02

    Justin Romberg Georgia Tech jrom@ece.gatech.edu Emil Sidky University of Chicago sidky@uchicago.edu Michael Stenner MITRE mstenner@mitre.org Lei Tian...assessment of image quality. Michael Stenner Michael has broad interests in optical imaging, sensing, and communications, and is published in such

  4. Evaluation of heavy metal uptake and translocation by Acacia ...

    African Journals Online (AJOL)

    Jane

    2011-08-08

    Aug 8, 2011 ... Acacia mangium as a phytoremediator of copper contaminated soil. Nik M. Majid, M. M. Islam*, Veronica Justin, Arifin Abdu and Parisa Ahmadpour. Department of ... The different levels of Cu were: T0 (control, soil), T1 (50 ppm Cu), T2 (100 ppm ..... aspects such as photosynthesis and respiration rate need.

  5. Dual Optical Comb LWIR Source and Sensor

    Science.gov (United States)

    2017-10-12

    Justin M. Brown, Mark G. Allen Physical Sciences Inc. (PSI) Pierre Jouy, Jérôme Faist Swiss Federal Institute of Technology (ETH) Markus Geiser...Research, Development & Engineering Center Name of Contractor: Physical Sciences Inc. Principal Investigator: Dr. Joel M. Hensley Business...including the time for reviewing instructions, searching existing data sources, gathering and maintaining the data needed, and completing and

  6. Kernel-Based Approximate Dynamic Programming Using Bellman Residual Elimination

    Science.gov (United States)

    2010-02-01

    Redding, Mike Robbins, Frant Sobolic, Justin Teo, Tuna Toksoz, Glenn Tournier, Aditya Undurti, Mario Valenti, Andy Whitten, Albert Wu, and Rodrigo...vector algorithms. Neural Computation, 12(5):1207–1245, 2000. [143] P. Schweitzer and A. Seidman. Generalized polynomial approximation in Markovian

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 224 ... Vol 41, No 3 (2014), The Pastoral, the Primal and the Post-Apartheid Sublime in Justin Cartwright's White Lightning, Abstract. D Klopper. Vol 41, No 2 (2014), The Poetics and Politics of Transnational Petro-Environmentalism in Nnimmo Bassey's We Thought It Was Oil but It Was Blood, Abstract.

  8. Art and Sonic Mining in the Archives: Methods for Investigating the Wartime History of Birmingham School of Art

    Science.gov (United States)

    Vaughan, Sian

    2018-01-01

    "Absconditi Viscus" (or "Hidden Entries") is a series of sound compositions based on the history of Birmingham School of Art during the First World War. Sound artist Justin Wiggan explored the concept of historical sonic information that although lost could still potentially permeate the archival record and the fabric of the…

  9. Gestion des forêts domaniales en période de conflits : cas de la forêt ...

    African Journals Online (AJOL)

    Gestion des forêts domaniales en période de conflits : cas de la forêt classée du Haut-Sassandra, Centre-Ouest de la Côte d'Ivoire. Akoua Tamia Madeleine Kouakou, Yao Sadaiou Sabas Barima, Souleymane Konate, Issouf Bamba, Justin Yatty Kouadio, Jan Bogaert ...

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 1025 ... Vol 17, No 1 (2003), Speciation of cadmium mixed ligand complexes in salt water lakes, Abstract PDF. John L. Kituyi, Henry M. Thairu, Justin Irina, Knut H. Schroder. Vol 24, No 3 (2010), Spectral characterizations and antibacterial effect of 2-(5-R-1H-benzimidazol-2-YL)-4-methyl/bromo-phenols and ...

  11. 77 FR 17410 - Bottom Mount Combination Refrigerator-Freezers From the Republic of Korea: Final Affirmative...

    Science.gov (United States)

    2012-03-26

    ...: Myrna L. Lobo, Justin M. Neuman, or Milton Koch, AD/CVD Operations, Office 6, Import Administration... Operations, Re: Scope Modification Requests, dated October 26, 2011 (Preliminary Scope Memorandum). [[Page.... KEXIM Export Factoring 2. K-SURE--Export Credit Guarantees 3. Gwangju Metropolitan City Programs A...

  12. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Anshu Aggarwal. Articles written in Journal of Biosciences. Volume 27 Issue 4 July 2002 pp 339-346 Articles. Place prioritization for biodiversity content · Sahotra Sarkar Anshu Aggarwal Justin Garson Chris R Margules Juliane Zeidler · More Details Abstract Fulltext PDF.

  13. Reference: 169 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available e M et al. 2005 Mar. Plant J. 41(5):744-54. The recessive Arabidopsis thalianafumonisin B1-resistant (fbr6) ...opment and sensitivity to fumonisin B1. 5 744-54 15703061 2005 Mar The Plant journal Liang Xinwen|Nekl Emily R|Stiers Justin J|Stone Julie M

  14. Dvě zprávy o raně křesťanské liturgii. Pokus o analýzu narativní struktury

    Czech Academy of Sciences Publication Activity Database

    Fialová, Radka

    -, č. 24 (2014), s. 83-111 ISSN 1805-2762 R&D Projects: GA ČR(CZ) GBP401/12/G168 Institutional support: RVO:67985955 Keywords : Early Christian liturgy * baptism and Eucharist in the 2nd Century * Didache * Justin Martyr's Apology Subject RIV: AA - Philosophy ; Religion https://www.etf.cuni.cz/ sat /2014-1.html

  15. 77 FR 61379 - Performance Review Board Membership

    Science.gov (United States)

    2012-10-09

    ... DEPARTMENT OF COMMERCE Performance Review Board Membership AGENCY: Economics and Statistics... eligible to serve on the Performance Review Board (PRB) in accordance with the Economics and Statistics.... Arnold William G. Bostic, Jr. Joanne Buenzli Crane Justin R. Ehrenwerth Ron S. Jarmin Theodore A. Johnson...

  16. Human Capital Management of Air Force SOF: Leadership Identification, Selection and Cultivation

    Science.gov (United States)

    2017-12-01

    managers, they are now called “People Leaders.” According to Justin Whitman, Senior Human Resources Manager at the Corporate Finance and Audit Staff...Approach to Learning and Development ..........................................50 Figure 7. Corporate Audit Staff Programs...Assignment Interactive Module 2.0 CAS Corporate Audit Staff CEB Corporate Executive Board CEO chief executive officer CFO chief financial officer CLP

  17. High incidence of GJB2 gene mutations among assortatively mating ...

    Indian Academy of Sciences (India)

    High incidence of GJB2 gene mutations among assortatively mating hearing impaired families in Kerala: future implications. Amritkumar Pavithra, Justin Margret Jeffrey, Jayasankaran Chandru, Arabandi Ramesh and C. R. Srikumari Srisailapathy. J. Genet. 93, 207–213. Table 1. Consolidated table of GJB2 mutation status ...

  18. Keeping a (Digital) Eye on Nature's Clock

    Science.gov (United States)

    Magney, Troy; Eitel, Karla; Eitel, Jan; Jansen, Vincent; Schon, Jenny; Rittenburg, Rebecca; Vierling, Lee

    2013-01-01

    Many students probably take pictures daily. Whether snapshots of their friends at a Justin Bieber concert or of their latest skateboard trick, these images document changes in a student's life. Digital cameras can do more, however, than record memories to post on Facebook. They can also help students examine changes in their environment. This…

  19. Filosof Iústinos proroky motivovaný

    Czech Academy of Sciences Publication Activity Database

    Hoblík, Jiří

    2014-01-01

    Roč. 20, č. 1 (2014), s. 53-68 ISSN 1211-1872 R&D Projects: GA ČR(CZ) GBP401/12/G168 Institutional support: RVO:67985955 Keywords : Justin Martyr * prophets * philosophy * Logos * Jesus Christ Subject RIV: AA - Philosophy ; Religion

  20. 78 FR 68151 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2013-11-13

    ... CLAUDIA FRIEDLANDER ROBERT MAX FRIESEN KATHLEEN ELLEN FUKUNAGA MIWA FULLER NICHOLAS ALAN FULLER NICHOLAS... SHIPLEY ROBERT ANTHONY SIM JEONG SUN SIMON ANTHONY NICHOLAS SIMON JULIE ANN SINN JUSTINE TUNG SITTARO... JAMES TAN YANQIANG TANAKA RYO TANG MARX THERN EDINA RITTER THERN JR ROBERT WILLIAM TIEN LAUREN TSAK YEN...

  1. Science of Security Lablet - Scalability and Usability

    Science.gov (United States)

    2014-12-16

    Cybersecurity_Framework.ashx Byres, Eric and Justin Lowe, 2004, The Myths and Facts behind Cyber Security Risks for Industrial Control Systems, Proceedings of the VDE ...Myths and Facts behind Cyber Security Risks for Industria l Control Systems, Proceedings of the VDE Kongress, 2004. Kshetri, Nir, 2005, Pattern of

  2. Fulltext PDF

    Indian Academy of Sciences (India)

    IAS Admin

    116 Why Some Pool Shots are More Difficult Than Others. Justin Jankunas and Richard N Zare. 122 Some Physics Inside Drying Droplets. Dileep Mampallil. 135 From the Triangle Inequality to the Isoperimetric. Inequality. S Kesavan. 149 Seaweeds. Ancestors of Land Plants with Rich Diversity. Felix Bast. 116. 122. 149 ...

  3. Popmuusika / Mart Juur

    Index Scriptorium Estoniae

    Juur, Mart, 1964-

    2006-01-01

    Uutest heliplaatidest New York Dolls "One Day It Will Please Us To Remember Even This", Missy Elliott "Respect M.E.", Justin Timberlake "Futuresex/Lovesounds", Kelis "Kells Was Here", Beyonce "B'Day", Method Man "4.21... The Day After", Korn "Live & Rare"

  4. Nevidimõi

    Index Scriptorium Estoniae

    2008-01-01

    Ulmeline põnevusfilm "Nähtamatu" ("The Invisible") : režissöör David S. Goyer : osades Justin Chatwin, Margarita Levieva : Ameerika Ühendriigid 2008. Film on uusversioon 2002.a. rootsi samanimelisest filmist ("Deb Osynlige"; Joel Bergvall, Simon Sandquist)

  5. Plaadid / Villu Päärt

    Index Scriptorium Estoniae

    Päärt, Villu, 1972-

    2002-01-01

    Uutest plaatidest Nick Carter "Now Or Never", Brian Mcknight "From There To here 1989-2002", Rod Stuart "The Grat American Songbook", New Order "International", Justin Timberlake "Justified", Manic Street Prachers "Forever Delayed - Greatest Hits", LHB "Tell 'Em Who We Are"

  6. Applying Multiculturalism to a High School American Literature Course: Changing Lenses and Crossing Borders.

    Science.gov (United States)

    Noskin, David; Marshalek, Angela

    1995-01-01

    Describes a nine-week, secondary-school, language arts unit on the American dream with an emphasis on multicultural issues, particularly as they concern those students who are apathetic about or resistant to the multicultural program. Reviews specific lesson approaches to "The Great Gatsby,""Baseball in April,""Justin and…

  7. Rebel Integration in Conflict Settlements: Past Lessons and the Prospects of MILF Reintegration

    Science.gov (United States)

    2017-12-01

    School. I would like to express my sincere gratitude to the Singapore Armed Forces for granting me the Postgraduate Award, and the Naval Leadership of the...the keys to my accomplishments at the Naval Postgraduate School. —Justin Lai At the outset, let me express my gratitude to God Almighty for

  8. Fulltext PDF

    Indian Academy of Sciences (India)

    Roeder I, de Haan G, Engel C, Nijhof W, Dontje B and Loeffler M 1998 ... this question, Justin Harris at the University of New South Wales, Australia ... The next step was to develop a simple test to look at such a transfer of learning in humans.

  9. Päästa enda sisemine hunt valla! / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2009-01-01

    Ameerika 2008.a. mängufilmist "Mässajate tänav" ("Revolutionary Road"), stsenarist Richard Yates'i samanimelise raamatu järgi Justin Haythe, režissöör Sam Mendes, peaosades Kate Winslet, Leonardo DiCaprio

  10. Unistuste ravi kontrollitud / Andris Feldmanis

    Index Scriptorium Estoniae

    Feldmanis, Andris, 1982-

    2009-01-01

    Ameerika 2008.a. mängufilmist "Mässajate tänav" ("Revolutionary Road"), stsenarist Richard Yates'i samanimelise raamatu järgi Justin Haythe, režissöör Sam Mendes, operaator Roger Deakins, peaosades Kate Winslet, Leonardo DiCaprio

  11. Differences Between British and Americans’ Cultures in Values

    Institute of Scientific and Technical Information of China (English)

    潘巍巍; 戴立黎

    2008-01-01

    <正>Values are the most important issue in identifying one particular culture.Social values are the feelings people have about what is important,worthwhile,and just.In this paper,the differences between British and American values are discussed in two aspects which mainly lie respectively in the comparisons of values and characteristics in both cultures.

  12. IN SEARCH OF THE ORIGINAL TEXT IN MARK 9:38

    African Journals Online (AJOL)

    “Teacher, we saw someone in your name driving out demons and we tried .... Luke.” Maybe Lagrange and Taylor and Cranfield deserve more attention. 5. ..... Justin). In the Revue Biblique (Hendriks 2007:266-271) I divided Mark 8:26 into five ...

  13. Bulletin of the Chemical Society of Ethiopia - Vol 20, No 2 (2006)

    African Journals Online (AJOL)

    Antioxidant benzophenones and xanthones from the root bark of Garcinia smeathmannii · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Alain Meli Lannang, Justin Komguem, Fernande Ngounou Ngninzeko, Jean Gustave Tangmouo, David Lontsi, Asma Ajaz, ...

  14. Mode transition and change in variable use in perceptual learning

    NARCIS (Netherlands)

    Hajnal, A; Grocki, M; Jacobs, DM; Zaal, FTJM; Michaels, CF

    2006-01-01

    Runeson, Justin, and Olsson (2000) proposed (a) that perceptual learning entails a transition from an inferential to a direct-perceptual mode of apprehension, and (b) that relative confidence-the difference between estimated and actual performance-indicates whether apprehension is inferential or

  15. Globaalne konteiner, järjekorranumbriga 8 / Maarin Mürk

    Index Scriptorium Estoniae

    Mürk, Maarin

    2009-01-01

    Kunstikonteineri rahvusvaheline kunsti- ja performance'iüritus "Global Container 8" 27. augustil kultuuritehases Polymer. Justin Tyler Tate'i, Auseklis/Usinsi ja Sandra Jõgeva esinemisest. Tom Russotti ja Ernest Truely ürituse kohta valminud dokumentaalist. Simon B. Haefele vestlusringist teemal "Kunsti võim"

  16. Philostr., Her. XXXV 9-10: ¿un testimonio de Eurísaces de Sófocles?

    Directory of Open Access Journals (Sweden)

    Miryam Librán Moreno

    2005-06-01

    Full Text Available Philostr. Her.. XXXV 9-10 may preserve hints of a rhesis from Sophocles' Eurysaces. Taking that as a departure point, a reconstruction of the general lines of this play is attempted from the evidence supplied by Accius, Pacuvius and Justin, as interpreted through the narrative pattern evinced in Oedipus at Colonus.

  17. Natali Portman : "Ljubov i izmenõ bõli vsegda" / Natalie Portman

    Index Scriptorium Estoniae

    Portman, Natalie

    2008-01-01

    Näitlejanna endast ja oma rollidest, lähemalt rollist uusimas filmis - Suurbritannia - USA mängufilm "Teine Boleyni tüdruk" Philippa Gregory romaani ainetel (režissöör Justin Chadwick) (Tõlgitud väljaandest "Focus")

  18. Exploring the science-policy interface.

    Science.gov (United States)

    Davies, Justine

    2010-04-30

    The sacking of David Nutt from his position as Chair of a UK government science advisory council has thrown the interface between science and policy into sharp relief. Justine Davies takes a look behind the scenes. 2010 Elsevier Inc. All rights reserved.

  19. Reorganization of brain function after a short-term behavioral intervention for stuttering.

    Science.gov (United States)

    Lu, Chunming; Zheng, Lifen; Long, Yuhang; Yan, Qian; Ding, Guosheng; Liu, Li; Peng, Danling; Howell, Peter

    2017-05-01

    This study investigated changes in brain function that occurred over a 7-day behavioral intervention for adults who stutter (AWS). Thirteen AWS received the intervention (AWS+), and 13 AWS did not receive the intervention (AWS-). There were 13 fluent controls (FC-). All participants were scanned before and after the intervention. Whole-brain analysis pre-intervention showed significant differences in task-related brain activation between AWS and FC- in the right inferior frontal cortex (IFC) and left middle temporal cortex, but there were no differences between the two AWS groups. Across the 7-day period of the intervention, AWS+ alone showed a significant increase of brain activation in the left ventral IFC/insula. There were no changes in brain function for the other two groups. Further analysis revealed that the change did not correlate with resting-state functional connectivity (RSFC) that AWS showed in the cerebellum (Lu et al., 2012). However, both changes in task-related brain function and RSFC correlated with changes in speech fluency level. Together, these findings suggest that functional reorganization in a brain region close to the left IFC that shows anomalous function in AWS, occurs after a short-term behavioral intervention for stuttering. Copyright © 2017 Elsevier Inc. All rights reserved.

  20. Actin Waves Do Not Boost Neurite Outgrowth in the Early Stages of Neuron Maturation

    Directory of Open Access Journals (Sweden)

    Simone Mortal

    2017-12-01

    Full Text Available During neurite development, Actin Waves (AWs emerge at the neurite base and move up to its tip, causing a transient retraction of the Growth Cone (GC. Many studies have shown that AWs are linked to outbursts of neurite growth and, therefore, contribute to the fast elongation of the nascent axon. Using long term live cell-imaging, we show that AWs do not boost neurite outgrowth and that neurites without AWs can elongate for several hundred microns. Inhibition of Myosin II abolishes the transient GC retraction and strongly modifies the AWs morphology. Super-resolution nanoscopy shows that Myosin IIB shapes the growth cone-like AWs structure and is differently distributed in AWs and GCs. Interestingly, depletion of membrane cholesterol and inhibition of Rho GTPases decrease AWs frequency and velocity. Our results indicate that Myosin IIB, membrane tension, and small Rho GTPases are important players in the regulation of the AW dynamics. Finally, we suggest a role for AWs in maintaining the GCs active during environmental exploration.

  1. Anthropogenic water sources and the effects on Sonoran Desert small mammal communities

    OpenAIRE

    Aaron B. Switalski; Heather L. Bateman

    2017-01-01

    Anthropogenic water sources (AWS) are developed water sources used as a management tool for desert wildlife species. Studies documenting the effects of AWS are often focused on game species; whereas, the effects on non-target wildlife are less understood. We used live trapping techniques to investigate rodent abundance, biomass, and diversity metrics near AWS and paired control sites; we sampled vegetation to determine rodent-habitat associations in the Sauceda Mountains of the Sonoran Desert...

  2. The Future of the United States Antarctic Program

    Science.gov (United States)

    Thom, J. E.; Weidner, G. A.; Lazzara, M. A.; Knuth, S. L.; Cassano, J. J.

    2009-04-01

    The last three decades have seen Antarctic surface meteorological observations augmented by an increasing number of automated weather stations (AWS). Since 1980, the University of Wisconsin-Madison has managed an expanding array of AWS in Antarctica that are funded through the United States' National Science Foundation. The AWS network began with six stations and has grown to approximately 60 stations. The majority of the AWS use a custom electronics package designed in the 1970s and modified over approximately 20 years. However, dramatic changes in the electronics industry have led the UW-Madison to transition its AWS to commercial-off-the-shelf (COTS) components capable of integrating on-station storage, varied sensors, multiple data telemetry options, and a flexible operating system. Among the important technical issues arising from adopting a COTS-based AWS system are limited temperature certification for Antarctic conditions; non-standard integration of the varied telecommunications equipment; potentially inflexible data acquisition schemes; and frequent product upgrades, changes, and obsolescence. The UW-Madison presents the current status of its AWS system; its recent experience with new data loggers, sensors, and communication options; and its attempts to obtain a standardized AWS. The intent is to encourage the development of a forum where groups can document their experiences with varied AWS systems in the extreme polar climate. Recent events have added another challenge within the United States Antarctic Program, as it has become clear that budgetary and logistic limitations will drastically impact the AWS program. With logistical costs playing a bigger factor in funding AWS operations, international coordination and cooperation will be important in deploying and maintaining the AWS networks (such as GCOS) that are critical to monitoring the world's climate.

  3. Barańczak i Ulro

    Directory of Open Access Journals (Sweden)

    Andrzej Skrendo

    2016-12-01

    Full Text Available The article comprises sketches by Stanisław Barańczak and Konstanty Jeleński on Czesław Miłosz’s The Land of Ulro. By comparing these three texts, important features of the thought of each author are described. The main figure is, however, Stanisław Barańczak: his thoughts on religion and literature.

  4. Survival and Filamentation of Salmonella enterica Serovar Enteritidis PT4 and Salmonella enterica Serovar Typhimurium DT104 at Low Water Activity

    Science.gov (United States)

    Mattick, K. L.; Jørgensen, F.; Legan, J. D.; Cole, M. B.; Porter, J.; Lappin-Scott, H. M.; Humphrey, T. J.

    2000-01-01

    In this study we investigated the long-term survival of and morphological changes in Salmonella strains at low water activity (aw). Salmonella enterica serovar Enteritidis PT4 and Salmonella enterica serovar Typhimurium DT104 survived at low aw for long periods, but minimum humectant concentrations of 8% NaCl (aw, 0.95), 96% sucrose (aw, 0.94), and 32% glycerol (aw, 0.92) were bactericidal under most conditions. Salmonella rpoS mutants were usually more sensitive to bactericidal levels of NaCl, sucrose, and glycerol. At a lethal aw, incubation at 37°C resulted in more rapid loss of viability than incubation at 21°C. At aw values of 0.93 to 0.98, strains of S. enterica serovar Enteritidis and S. enterica serovar Typhimurium formed filaments, some of which were at least 200 μm long. Filamentation was independent of rpoS expression. When the preparations were returned to high-aw conditions, the filaments formed septa, and division was complete within approximately 2 to 3 h. The variable survival of Salmonella strains at low aw highlights the importance of strain choice when researchers produce modelling data to simulate worst-case scenarios or conduct risk assessments based on laboratory data. The continued increase in Salmonella biomass at low aw (without a concomitant increase in microbial count) would not have been detected by traditional microbiological enumeration tests if the tests had been performed immediately after low-aw storage. If Salmonella strains form filaments in food products that have low aw values (0.92 to 0.98), there are significant implications for public health and for designing methods for microbiological monitoring. PMID:10742199

  5. The in vitro antibiotic release from anti-washout apatite cement using chitosan.

    Science.gov (United States)

    Takechi, Masaaki; Miyamoto, Youji; Momota, Yukihiro; Yuasa, Tetsuya; Tatehara, Seikou; Nagayama, Masaru; Ishikawa, Kunio; Suzuki, Kazuomi

    2002-10-01

    The in vitro antibiotic release from anti-washout apatite cement using chitosan (aw-AC(chi)) was investigated in a preliminary evaluation. Flomoxef sodium was employed as the antibiotic and was incorporated into the powder phase aw-AC(chi) at up to 10%. The setting times were measured for aw-AC(chi) containing various amounts of flomoxef sodium. X-ray diffraction (XRD) analysis was also conducted for the identification of products. To evaluate the drug release profile, set aw-AC was immersed in saline and the released flomoxef sodium was determined at regular intervals. The setting time was prolonged slightly with the addition of flomoxef sodium. The difference at 10% flomoxef sodium (0% vs. 10%) was not significant (p>0.05), and can be negligible in clinic. The XRD analysis revealed that formation of hydroxyapatite (HAP) from aw-AC(chi) was reduced, even after 24 h, when the aw-AC(chi) contained flomoxef sodium at 8% or more. The flomoxef sodium release from aw-AC(chi) showed the typical profile observed in skeleton type drug delivery system (DDS). Changing the concentration of chitosan can control the rate of drug release from aw-AC. Therefore, we conclude that aw-AC(chi) is a good candidate for potential use as a DDS carrier that may be useful in surgical operations.

  6. Three dimensional magnetohydrodynamic simulation of linearly polarised Alfven wave dynamics in Arnold-Beltrami-Childress magnetic field

    International Nuclear Information System (INIS)

    Tsiklauri, D.

    2014-01-01

    Previous studies (e.g., Malara et al., Astrophys. J. 533, 523 (2000)) considered small-amplitude Alfven wave (AW) packets in Arnold-Beltrami-Childress (ABC) magnetic field using WKB approximation. They draw a distinction between 2D AW dissipation via phase mixing and 3D AW dissipation via exponentially divergent magnetic field lines. In the former case, AW dissipation time scales as S 1∕3 and in the latter as log(S), where S is the Lundquist number. In this work, linearly polarised Alfven wave dynamics in ABC magnetic field via direct 3D magnetohydrodynamic (MHD) numerical simulation is studied for the first time. A Gaussian AW pulse with length-scale much shorter than ABC domain length and a harmonic AW with wavelength equal to ABC domain length are studied for four different resistivities. While it is found that AWs dissipate quickly in the ABC field, contrary to an expectation, it is found the AW perturbation energy increases in time. In the case of the harmonic AW, the perturbation energy growth is transient in time, attaining peaks in both velocity and magnetic perturbation energies within timescales much smaller than the resistive time. In the case of the Gaussian AW pulse, the velocity perturbation energy growth is still transient in time, attaining a peak within few resistive times, while magnetic perturbation energy continues to grow. It is also shown that the total magnetic energy decreases in time and this is governed by the resistive evolution of the background ABC magnetic field rather than AW damping. On contrary, when the background magnetic field is uniform, the total magnetic energy decrease is prescribed by AW damping, because there is no resistive evolution of the background. By considering runs with different amplitudes and by analysing the perturbation spectra, possible dynamo action by AW perturbation-induced peristaltic flow and inverse cascade of magnetic energy have been excluded. Therefore, the perturbation energy growth is attributed to

  7. Three dimensional magnetohydrodynamic simulation of linearly polarised Alfven wave dynamics in Arnold-Beltrami-Childress magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Tsiklauri, D. [School of Physics and Astronomy, Queen Mary University of London, London E1 4NS (United Kingdom)

    2014-05-15

    Previous studies (e.g., Malara et al., Astrophys. J. 533, 523 (2000)) considered small-amplitude Alfven wave (AW) packets in Arnold-Beltrami-Childress (ABC) magnetic field using WKB approximation. They draw a distinction between 2D AW dissipation via phase mixing and 3D AW dissipation via exponentially divergent magnetic field lines. In the former case, AW dissipation time scales as S{sup 1∕3} and in the latter as log(S), where S is the Lundquist number. In this work, linearly polarised Alfven wave dynamics in ABC magnetic field via direct 3D magnetohydrodynamic (MHD) numerical simulation is studied for the first time. A Gaussian AW pulse with length-scale much shorter than ABC domain length and a harmonic AW with wavelength equal to ABC domain length are studied for four different resistivities. While it is found that AWs dissipate quickly in the ABC field, contrary to an expectation, it is found the AW perturbation energy increases in time. In the case of the harmonic AW, the perturbation energy growth is transient in time, attaining peaks in both velocity and magnetic perturbation energies within timescales much smaller than the resistive time. In the case of the Gaussian AW pulse, the velocity perturbation energy growth is still transient in time, attaining a peak within few resistive times, while magnetic perturbation energy continues to grow. It is also shown that the total magnetic energy decreases in time and this is governed by the resistive evolution of the background ABC magnetic field rather than AW damping. On contrary, when the background magnetic field is uniform, the total magnetic energy decrease is prescribed by AW damping, because there is no resistive evolution of the background. By considering runs with different amplitudes and by analysing the perturbation spectra, possible dynamo action by AW perturbation-induced peristaltic flow and inverse cascade of magnetic energy have been excluded. Therefore, the perturbation energy growth is

  8. The surface climatology of the Ross Ice Shelf Antarctica.

    Science.gov (United States)

    Costanza, Carol A; Lazzara, Matthew A; Keller, Linda M; Cassano, John J

    2016-12-01

    The University of Wisconsin-Madison Antarctic Automatic Weather Station (AWS) project has been making meteorological surface observations on the Ross Ice Shelf (RIS) for approximately 30 years. This network offers the most continuous set of routine measurements of surface meteorological variables in this region. The Ross Island area is excluded from this study. The surface climate of the RIS is described using the AWS measurements. Temperature, pressure, and wind data are analysed on daily, monthly, seasonal, and annual time periods for 13 AWS across the RIS. The AWS are separated into three representative regions - central, coastal, and the area along the Transantarctic Mountains - in order to describe specific characteristics of sections of the RIS. The climatology describes general characteristics of the region and significant changes over time. The central AWS experiences the coldest mean temperature, and the lowest resultant wind speed. These AWSs also experience the coldest potential temperatures with a minimum of 209.3 K at Gill AWS. The AWS along the Transantarctic Mountains experiences the warmest mean temperature, the highest mean sea-level pressure, and the highest mean resultant wind speed. Finally, the coastal AWS experiences the lowest mean pressure. Climate indices (MEI, SAM, and SAO) are compared to temperature and pressure data of four of the AWS with the longest observation periods, and significant correlation is found for most AWS in sea-level pressure and temperature. This climatology study highlights characteristics that influence the climate of the RIS, and the challenges of maintaining a long-term Antarctic AWS network. Results from this effort are essential for the broader Antarctic meteorology community for future research.

  9. Face me I face you

    Directory of Open Access Journals (Sweden)

    Mirka Koro-Ljungberg

    2016-11-01

    Full Text Available This iterative and a-signifying sound experimentation project started from simple wonderings that emerged from undocumented college students’ interview data. As the researchers began to reflect on the data provided by these students, conversations around noise and gossip began to emerge. Over time, the conversations about noise and gossip transmogrified into various soundscapes and audio recordings that extended also beyond noise and gossip. "Let’s work more with the sound and try to extend effects and create affects. Maybe produce another extension of that video in such a way that we would still be working with the thing, whatever the thing was" stated Mirka and Justin. Justin would go on to say, "It's less and less representational and signifying. Our sound encounters produce something different than what we originally intended them to be. Or they work, or function as whatever."

  10. Depression og/eller apokalypse

    DEFF Research Database (Denmark)

    Frantzen, Mikkel Krause; Bjering, Jens Christian Borrebye

    2015-01-01

    The article sets out by investigating how depression is represented in Lars von Trier´s disaster movie Melancholia with the specific intent to detach mental illness from classic, somewhat romantic notions of metaphoric and epistemological connections between psychopathology and deeper “truths......” about the world. Employing what one could call a symptomatological view on the depression of the main protagonist Justine, the article concludes that her depression should be seen as a temporal disorder in the sense that she lacks the ability to project and plan a future. From here, the article turns...... to Eve Kosofsky Sedgwick´s concept of a “reparative praxis” as a possible ethico-practical way out of the depressive situation, arguing that such a reparative praxis is exactly what ends up pulling Justine out of her depression and enabling her to act. In a concluding step, the article relates depression...

  11. Baseline Assessment of Petroleum Contamination and Soil Properties at Contaminated Sites in Utqiagvik, Alaska

    Science.gov (United States)

    2017-08-01

    microbial community, including high bacterial numbers in these soils. The results from this baseline study indicate that stimulating biodegradation...CEERD-RR), ERDC- CRREL. At the time of publication, Dr. Justin Berman was Chief, CEERD- RRN; CDR J. D. Horne, USN (Ret), was Chief, CEERD-RR; and Dr...of the fractions of petroleum hydrocarbons and microbial activity in ERDC/CRREL TR-17-13 3 situ to reveal the status of each site at the time of

  12. Popnädal. Inglismaa TOP 20 Albumid / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    Okt. lõpus USAs Brooklyni muusikaakadeemias esiettekandele tulevast ooperist "Woyzeck". 12. nov. müügile saabuvast Bondi-filmi "Die Another Day" soundtrackist (filmi nimiloo esitajaks Madonna). Ansamblite Wu-Tang Clani ja Limp Bizkiti plaanidest anda järgmisel aastal välja oma uued albumid. Ansamblist Bet Shop Boys. 4. nov. müügile saabuvast Justin Timberlake'i sooloalbumist "Justified".

  13. Factors that influence exercise activity among women post hip fracture participating in the Exercise Plus Program

    OpenAIRE

    Barbara Resnick; Denise Orwig; Christopher D′Adamo; Janet Yu-Yahiro; William Hawkes; et al

    2007-01-01

    Barbara Resnick1, Denise Orwig2, Christopher D’Adamo2, Janet Yu-Yahiro3, William Hawkes2, Michelle Shardell2, Justine Golden2, Sheryl Zimmerman4, Jay Magaziner21University of Maryland School of Nursing, 655 West Lombard Street, Baltimore, MD,21201, USA; 2University of Maryland School of Medicine, Howard Hall, Redwood Street, Baltimore MD 21201, USA; 3Department of Orthopaedic Surgery, Union Memorial Hospital, Baltimore, USA; 4University of North Carolina Chapel Hill, 301 Pittsboro St., ...

  14. Uyghurs in Xinjiang: United or Divided Against the PRC?

    Science.gov (United States)

    2012-09-01

    them). Uyghurs have responded in stressing even more so their distinction from the Han Chinese people and culture. However, despite this improved...UyghurLanguageUnderAttack.pdf. 10 Justin Rudelson and William Jankowiak. “ Acculturation and Resistance: Xinjiang Identities in Flux,” in Xinjiang: China’s Muslim...the Uyghur people. Rudelson and Jankowiak argue that the responses of the Uyghurs are varied and divided—ranging from acculturation , to non-violent

  15. Energy Guiding and Harvesting through Phonon-Engineered Graphene

    Science.gov (United States)

    2016-01-28

    Graphene The views, opinions and/or findings contained in this report are those of the author(s) and should not contrued as an official Department of the...ABSTRACT Final Report: Energy Guiding and Harvesting through Phonon-Engineered Graphene Report Title The work performed under this proposal was primarily...Justin Wu, Xinran Wang, Kristof Tahy, Debdeep Jena, Hongjie Dai, Eric Pop. Thermally Limited Current Carrying Ability of Graphene Nanoribbons

  16. Ohustatud homopingviinid / Udo Uibo

    Index Scriptorium Estoniae

    Uibo, Udo, 1956-

    2011-01-01

    Ameerika Raamatukoguühingu (American Library Association) sõnavabaduse osakond paneb igal aastal kokku nimekirja raamatutest, mille kohta on esitatud kõige rohkem kaebusi nõudega teose kättesaadavust sobimatu sisu tõttu piirata või teos raamatukogust üldse kõrvaldada. 2010 a. nimekirja juhib Peter Parnelli ja Justin Richardsoni lasteraamat "Tangoga kolmekesi" (And Tango Makes Three), kus lugejad panevad pahaks selle homoseksuaalsust, religioosseid vaateid ja sobimatust laste lugemisvaraks

  17. In vitro Toxicity and Inflammatory Response Induced by Copper Nanoparticles in Rat Alveolar Macrophages

    Science.gov (United States)

    2008-03-01

    blood from intestinal mucosal cells (Linder and Hazegh-Azam, 1996:799S). Wilson’s disease is a genetic disorder that causes ineffective copper...mucociliary escalator, is via the trachea and subsequently cleared in the esophagus (Lam, et al., 2004:131). However, various situations exist in which...to motor oil,” Wear, 252(1-2): 63-69 (January 2002). Teeguarden, Justin G., Paul M. Hinderliter, Galya Orr, Brian D. Thrall, and Joel G. Pounds

  18. Contribution à l'étude de la gestion intégrée de la fertilité du sol pour ...

    African Journals Online (AJOL)

    Contribution à l'étude de la gestion intégrée de la fertilité du sol pour la culture de maïs (Zea mays) dans la Région de Mbujimayi, RDC. Michel Nkongolo Mulambuila, Jean Michel Mutombo Tshibamba, Justin Cibanda Mutombo, Pierrot Muka Mulamba, Thèrese Masengu Tshibuyi, Grégoire Tshibangu Kabongo ...

  19. Silicon-Based Examination of Gamma-Ray and Neutron Interactions with Solid State Materials

    Science.gov (United States)

    2018-05-02

    58 1) Mark Hammig, Ass. Research Scientist, Nuclear Engineering and Rad. Sciences (NERS), 30 % effort 2) Justin Sanders, Grad..Stud., Ph.D...Junior (Chemical Engineering ), part-time during school year. 7) Joseph Karbowski, Undergraduate Student, Senior (NERS), full-time in summer, part...scientific collaborations with the leading nanotechnology research groups in the world. Geehyun Kim, the main funded graduate student during most of the

  20. Architecture for people who can manage without it? : 13th Venice Architecture Biennale Common Ground / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2012-01-01

    13. Venezia arhitektuuribiennaalist "Ühisosa". Üldkuraator David Chipperfield. Biennaali Kuldlõvi pälvisid Justin McGuirk, Iwan Baan ja Urban-Think Tank (Torre David/Gran Horizonte, Venezuela), Jaapani paviljon (kuraator Toyo Ito). Eesti ekspositsioonist "Kui pikk on ühe maja elu?", mis käsitleb väärika modernismipärandi hääbumist Tallinna Linnahalli näitel

  1. A portable virtual machine target for proof-carrying code

    DEFF Research Database (Denmark)

    Franz, Michael; Chandra, Deepak; Gal, Andreas

    2005-01-01

    Virtual Machines (VMs) and Proof-Carrying Code (PCC) are two techniques that have been used independently to provide safety for (mobile) code. Existing virtual machines, such as the Java VM, have several drawbacks: First, the effort required for safety verification is considerable. Second and mor...... simultaneously providing efficient justin-time compilation and target-machine independence. In particular, our approach reduces the complexity of the required proofs, resulting in fewer proof obligations that need to be discharged at the target machine....

  2. Identity Use and Misuse of Public Persona on Twitter

    OpenAIRE

    Köse, Dicle Berfin; Veijalainen, Jari; Semenov, Alexander

    2016-01-01

    Social media sites have appeared during the last 10 years and their use has exploded all over the world. Twitter is a microblogging service that has currently 320 million user profiles and over 100 million daily active users. Many celebrities and leading politicians have a verified profile on Twitter, including Justin Bieber, president Obama, and the Pope. In this paper we investigate the '‘hundreds of Putins and Obamas phenomenon’ on Twitter. We collected two data sets in 2015 co...

  3. Annotated Bibliography for Lake Erie. Volume II. Chemical,

    Science.gov (United States)

    1974-10-01

    ural forces tending to restore equilibrium. Bieber , Glen F. - See: Frank J. Little, Jr., et al, No. 212. 37. Bird, John. 1966. Our dying waters...research should indicate more definite trends. 207. Leonard, Justin W. 1962. Environmental requirements of Ephemeroptera. In: Clarence M. Tarzwell (Ed... Bieber , Thomas J. Horst and Danley F. Brown. 1973. Possible accelerated eutrophication thresholds in the Great Lakes rela- tive to human population

  4. East African Medical Journal - Vol 86, No 3 (2009)

    African Journals Online (AJOL)

    Anti-diabetic drugs in the private and public sector in Dar es Salaam, Tanzania · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. M Justin-Temu, R.S.O Nondo, K Wiedenmayer, K.L Ramaiya, A Teuscher, 110-114. http://dx.doi.org/10.4314/eamj.v86i3.54962 ...

  5. Analysis of return on investment for Naval air station fallon energy project Alternatives

    Science.gov (United States)

    2017-06-01

    Manager (Justin Sielsch, personal communication ). Lack of in-house skill related to HVAC retrofits would require substantial effort by Public Works ...bill. An ESPC project is financed by the contractor performing the work . The contractor guarantees a certain annual energy savings because of their... work . The Navy installation uses the annual savings from its energy budget to pay back the contractor. ESPCs include contractor performance

  6. Exploring the Relationships Between Just-In-Time Technique and Manufacturing Performance: Empirical Evidence From Selected Nigerian Firms

    OpenAIRE

    Ph. D. John Kolade Obamiro

    2009-01-01

    This study explores the relationship between just-in-time technique and manufacturing performance of some selected Nigerian companies. Just-in time was considered to be an overall organisational phenomenon. Data were obtained through a structured questionnaire from a sample size of 300 knowledgeable employees to test the developed model and formulated hypotheses that cover both just-intime and the supporting infrastructures. Bivariate correlation analysis was used to test the three hypotheses...

  7. Validating a Finite Element Model of a Structure Subjected to Mine Blast with Experimental Modal Analysis

    Science.gov (United States)

    2017-11-01

    Howle, Dmitriy Krayterman, Justin E Pritchett, and Ryan Sorenson 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING...The Under-body Blast Methodology (UBM) for the Test and Evaluation (T&E) program was established to provide a capability for the US Army Test and...and must be validated. The UBM for the T&E program has completed efforts to validate soil models but not structural dynamics models. Modal testing

  8. Siim Nestor soovitab : Wicked Beat. President of Funk. Muuseumiööl. Springz Bashmendil / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2002-01-01

    16. mail toimub Emajõe äärses klubis Atlantis Eesti esimene nu-skool breaks õhtu Wicked Beat, kus peaesinejaks on DJ ja produtsent Databass (plaadifirma Freakaboom "juhatuse esimees" Justin Owen). 18. mail house-muusika pidu Tartus muusikagaleriis Damtan Dance. 17. mai ööl Rotermanni soolalaos triod: 1. Riho Sibul, Jaak Sooäär ja Raul Saaremets ning 2. Tõnis Leemets, Robert Jürjendal ja Aivar Tõnso. 17. mail Von Krahlis Dj Dr. Koit

  9. Reforming U.S. Export Controls Reforms: Advancing U.S. Army Interests

    Science.gov (United States)

    2015-12-01

    The author wishes to thank several anonymous and peer re- viewers as well as Alex Barnes, Rachel Bauman, Justin Blaszczyk, William Cardon ...is worth noting in that it requires, pursuant to the Arms Export Control Act, that: certification be provided to Congress prior to the granting of...security. Otherwise, approval cannot be granted until 15 days after Congress has re- ceived the certification for the manufacturing license or technical

  10. Ethics and the Military Profession. Sports and the Military

    Science.gov (United States)

    1980-01-01

    virtues, it would strive for an additional objective you both have chosen to ignore: aesthetic achievement. VICTOR: Uh, oh. H.D. is going to Wax artistic on...HENRY-DAVID: Easy. Think of the events in gymnastics . They require strength, timing, coordination, and endurance; and acquiring the skills demands...aesthetically. What more can you ask of a sport? JUSTIN: But gymnastics is competitive. VICTOR: And it doesn’t really develop team skills. HENRY-DAVID: You’re

  11. Political pugilists: recuperative gender strategies in canadian electoral politics.

    Science.gov (United States)

    Maiolino, Elise

    2015-05-01

    This paper offers the concept recuperative gender strategies to describe how political leaders work to restore their public gender identities. The author examines a charity-boxing match between two Canadian politicians, Justin Trudeau and Patrick Brazeau. Trudeau is the current leader of the Liberal Party of Canada and son of former Prime Minister, Pierre Trudeau. Brazeau was a Conservative Senator. Through a discourse analysis of 222 national newspaper articles published on the match, this paper chronicles Justin Trudeau's transition from "precariously masculine" to "sufficiently masculine" and discusses the significance of this transformation for Trudeau's suitability for Liberal Party leadership. Cet article propose le concept de stratégies de récupération des sexes pour décrire et expliquer comment des dirigeants politiques travaillent à rétablir leurs identités sexuelles publiques. J'analyse la couverture médiatique du combat de boxe caritatif datant de mars 2012 et opposant deux politiciens canadiens : Justin Trudeau, le chef du Parti libéral du Canada, et Patrick Brazeau, un sénateur conservateur. En m'appuyant sur une analyse de discours de 222 articles de journaux nationaux publiés au sujet de ce combat, je détaille la transition de Justin Trudeau d'une forme de masculinité « précaire » à une « masculinité suffisante », et je discute de l'importance de cette transformation pour l'aptitude perçue de Trudeau comme chef du Parti libéral. © 2015 Canadian Sociological Association/La Société canadienne de sociologie.

  12. Northwest Manufacturing Initiative

    Science.gov (United States)

    2012-03-27

    HRC 60 were obtained . UIT also changed the ESD induced residual stress distribution from about +100ksi to - 250ksi. This compressive stress extended...Staff. Justin Jangraw profiled PNDC companies. In addition to directly creating profiles, Navindra focused on obtaining lists of companies from...NW Connectory to source parts for their Biogas Filtration systems. • Connected with Vigor Industrial . • Resulted in $750,000 and 10 new Portland

  13. Justice in the Air: Tracking Toxic Pollution from America's Industries and Companies to Our States, Cities, and Neighborhoods

    OpenAIRE

    Michael Ash; James Boyce; Grace Chang; Justin Scoggins; Manuel Pastor

    2009-01-01

    This new environmental justice study, (co-authored by PERI’s James Boyce, Michael Ash, & Grace Chang, along with Manuel Pastor, Justin Scoggins, & Jennifer Tran of the Program for Environmental and Regional Equity at the University of Southern California) examines not only who receives the disproportionate share of toxic air releases -- low-income communities and people of color -- but who is releasing them. Justice in the Air: Tracking Toxic Pollution from America's Industries and Companies ...

  14. Browse Author Index

    African Journals Online (AJOL)

    Items 1 - 47 of 47 ... Ikhuoria, E.U. · Ikiz, Serkan · Ikram, Muhammad · Ikram, Muhammad · Ilomo, O. O. · Ilomo, O.O. · Ilukhor, P.E.P. · Imanieh, Hossein · Imeokparia, F.E. · Imran, M. Inayat, M. Ipinmoroti, K.O. · Iqbal, M. Iqbal Choudhary, M. Iqbal Choudhary, Muhammad · Iranmanesh, P. Irfan, A. Irfan, A. Irina, Justin · Isabirye, D.A.

  15. [The psychosocial challenges of epilepsy and the role of the clinical nurse specialist].

    Science.gov (United States)

    Chartrand, Dominic

    2015-01-01

    Epilepsy in children is a complex disease with significant psychosocial consequences for the child and their family. The intervention of a multidisciplinary team enables the care to be adapted and provides support for the families. At Sainte-Justine Hospital in Montreal, Canada, the nurse clinician specialised in epilepsy plays a key role in this team. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  16. A Lean Six Sigma Analysis of Student In-Processing

    Science.gov (United States)

    2012-12-01

    improvements. 4. Lt Justin Whipple : NPS Student Services representative, primary stakeholder and key source of implementation and control. xvi THIS...Internet connections took over a week. The entire move process took two weeks and had to be scheduled around required check-in procedures . CPT Johnson...processing procedure which represents, as such, a very important stakeholder. They are, however, a type 4 mixed blessing stakeholder. Although they

  17. National security and the impact of cyber threats on the average citizen

    CSIR Research Space (South Africa)

    Jansen van Vuuren, JC

    2010-09-01

    Full Text Available LinkedIn account Work information Company name Intecon Occupation Programmer Colleagues Trevor Mohasoa ? Help desk Marista Conradie ? Receptionist and Personal Assistant Personal information Email address and username/alias einad5@gmail....com Contacts Stephen Swart Justin Booth Ivan Burke Francois Joubert Nicolaas Strecker Hanno Combrink Data gathered from Google profile and gmail email address ? Information gathered from Google Buzz account ? Operating System preference (complains...

  18. Cost analysis of consolidated federally provided health care

    Science.gov (United States)

    2017-06-01

    Government Accountability Office JIT just-in time KPO Kaizen promotion offices LT lead time MHS Military Health System MRI magnetic resonance...a hospital that is only large enough for one MRI unit may need to hold it idle much of the time to permit emergency testing; whereas, a hospital...Center San Diego and San Diego VA hospital both provide outpatient pharmaceutical services. Duplication and redundancy of operating two separate

  19. Spræng boblen

    DEFF Research Database (Denmark)

    Hendricks, Vincent Fella

    Hvad har en dansk Justin Bieber look-a-like, Dovne Robert og frokostfrikadeller – eller mangel på samme – i landets børnehaver til fælles? De kan forstås og forklares med bobleteori. Bortset fra de af slagsen, der laves af sæbe eller findes i champagne, forbindes bobler typisk med situationer i...

  20. Aproximación al estudio de los discursos en el epítome de Justino

    OpenAIRE

    Ballesteros Pastor, Luis

    2009-01-01

    Justin’s Epitome records some speeches that Trogus had included in the Historiae Philippicae . Justin abridges and modifies a great deal of these passages, which appear in most cases in oratio obliqua, following an option that he attributes to Trogus. Justin’s manipulation of the text makes these discourses very problematic to study: sometimes they are extremely shortened, or they completely lack any kind of settings, or they are moved from their original place, or they may even appear in dir...

  1. STS-59 crewmembers in training for onboard Earth observations

    Science.gov (United States)

    1993-01-01

    The six astronauts in training for the STS-59 mission are shown onboard Earth observations tips by Justin Wilkinson (standing, foreground) of the Space Shuttle Earth Observations Project (SSEOP) group. Astronaut Sidney M. Gutierrez, mission commander, is at center on the left side of the table. Others, left to right, are Astronauts Kevin P. Chilton, pilot; Jerome (Jay) Apt and Michael R.U. (Rich) Clifford, both mission specialists; Linda M. Godwin, payload commander; and Thomas D. Jones, mission specialist.

  2. Economic evaluation of an area-wide integrated pest management program to control the Asian tiger mosquito in New Jersey

    Science.gov (United States)

    Aedes albopictus is the most invasive mosquito in the world, an important disease vector, and a biting nuisance that limits outdoor activities. Area-wide integrated pest management (AW-IPM) is the recommended control strategy. We conducted an economic evaluation of the AW-IPM project in Mercer and ...

  3. 29 CFR 1926.453 - Aerial lifts.

    Science.gov (United States)

    2010-07-01

    ... entity, such as a nationally recognized testing laboratory, to be in conformity with all applicable...) Welding standards. All welding shall conform to the following standards as applicable: (i) Standard Qualification Procedure, AWS B3.0-41. (ii) Recommended Practices for Automotive Welding Design, AWS D8.4-61...

  4. 49 CFR 179.200-10 - Welding.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.200-10 Section 179.200-10... Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.200-10 Welding. (a) All joints... W (IBR, see § 171.7 of this subchapter). Welding procedures, welders and fabricators shall be...

  5. 49 CFR 179.220-10 - Welding.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.220-10 Section 179.220-10... Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.220-10 Welding. (a) All joints... of this subchapter). Welding procedures, welders, and fabricators shall be approved. (b) Radioscopy...

  6. Alternative Work Schedules: Many Agencies Do Not Allow Employees the Full Flexibility Permitted by Law. Report to Congressional Committees.

    Science.gov (United States)

    General Accounting Office, Washington, DC. General Government Div.

    A review was conducted of the extent to which selected federal agencies are allowing employees to use alternative work schedules (AWS) as authorized by the Federal Employees Flexible and Compressed Work Schedules Act. The statute permits, rather than requires, agencies to institute AWS programs. The study surveyed the policies and practices of 59…

  7. Tracing Atlantic Water Signature in the Arctic Sea Ice Cover East of Svalbard

    Directory of Open Access Journals (Sweden)

    Vladimir V. Ivanov

    2012-01-01

    Full Text Available We focus on the Arctic Ocean between Svalbard and Franz Joseph Land in order to elucidate the possible role of Atlantic water (AW inflow in shaping ice conditions. Ice conditions substantially affect the temperature regime of the Spitsbergen archipelago, particularly in winter. We test the hypothesis that intensive vertical mixing at the upper AW boundary releases substantial heat upwards that eventually reaches the under-ice water layer, thinning the ice cover. We examine spatial and temporal variation of ice concentration against time series of wind, air temperature, and AW temperature. Analysis of 1979–2011 ice properties revealed a general tendency of decreasing ice concentration that commenced after the mid-1990s. AW temperature time series in Fram Strait feature a monotonic increase after the mid-1990s, consistent with shrinking ice cover. Ice thins due to increased sensible heat flux from AW; ice erosion from below allows wind and local currents to more effectively break ice. The winter spatial pattern of sea ice concentration is collocated with patterns of surface heat flux anomalies. Winter minimum sea ice thickness occurs in the ice pack interior above the AW path, clearly indicating AW influence on ice thickness. Our study indicates that in the AW inflow region heat flux from the ocean reduces the ice thickness.

  8. Relative survival of four serotypes of Salmonella enterica in low-water activity whey protein powder held at 36 and 70°C at various water activity levels

    Science.gov (United States)

    Salmonella enterica is the leading cause of health burdens in the United States. Although the pathogen is not able to grow at aw levels below 0.94, it can survive in low-moisture foods for long periods of time. Temperature, aw, substrate and serotype affect its persistence. The aim of this study was...

  9. Genetic polymorphisms related to delirium tremens: a systematic review

    NARCIS (Netherlands)

    van Munster, Barbara C.; Korevaar, Johanna C.; de Rooij, Sophia E.; Levi, Marcel; Zwinderman, Aeilko H.

    2007-01-01

    BACKGROUND: Delirium tremens (DT) is one of the more severe complications of alcohol withdrawal (AW), with a 5 to 10% lifetime risk for alcohol-dependent patients. The 2 most important neurosystems involved in AW are gamma-aminobutyric acid and glutamate. It is unknown whether these neurosystems are

  10. 30th April 2009 - Signature of the guest book and exchange of gifts between the Ambassador of Poland to Switzerland J. Starzyk and CERN Coordinator for External Relations F. Pauss.

    CERN Multimedia

    Maximilien Brice

    2009-01-01

    List of the delegation: H.E Mr Jarosław Starzyk, Ambassador of Poland to Switzerland Mrs Iwona Starzyk, Ambassador’s spouse Mr Jerzy Wieczorek, First Counsellor Mr Mariusz Sawiński, Counsellor, Head of the trade and the investment section Mr Jarosław Bajaczyk, Cultural Attaché Mr Marcin Król, Consul

  11. What Drives the Variability of the Atlantic Water Circulation in the Arctic Ocean?

    Science.gov (United States)

    Lique, C.; Johnson, H. L.

    2016-02-01

    The Atlantic Water (AW) layer in the Arctic Basin is isolated from the atmosphere by the overlaying surface layer; yet observations of the AW pan-Arctic boundary current have revealed that the velocities in this layer exhibit significant variations on all timescales. Here, analysis of a global ocean/sea ice model hindcast, complemented by experiments performed with an idealized process model, are used to investigate what controls the variability of AW circulation, with a focus on the role of wind forcing. The AW circulation carries the imprint of wind variations, both remotely over the Nordic and Barents seas where they force variability on the AW inflow to the Arctic Basin, and locally over the Arctic Basin through the forcing of the wind-driven Beaufort gyre, which modulates and transfers the wind variability to the AW layer. Our results further suggest that understanding variability in the large amount of heat contained within the AW layer requires a better understanding of the circulation within both AW and surface layers.

  12. Root response of Jerusalem artichoke genotypes to different water regimes

    Science.gov (United States)

    The objective of this study was to determine effects of drought on selected root growth parameters and develop relationships between root parameters and tuber yield for selected Jerusalem artichoke (JA) genotypes. Three water regimes (Field capacity, 50% available water (AW) and 25% AW) and five JA...

  13. Physiological response of Pseudomonas putida S12 subjected to reduced water activity.

    NARCIS (Netherlands)

    Kets, E.P.W.; Bont, de J.A.M.; Heipieper, H.J.

    1996-01-01

    The effect of osmotic stress, given as decreased water activity (aw), on growth and the accumulation of potassium and the compatible solute betaine by Pseudomonas putida S12 was investigated. Reduced aw was imposed by addition of sodium chloride, sucrose, glycerol or polyethylene glycol to the

  14. Susceptibility to corrosion and in vitro biocompatibility of a laser-welded composite orthodontic arch wire.

    Science.gov (United States)

    Zhang, Chao; Sun, Xinhua; Zhao, Shuang; Yu, Wenwen; Sun, Daqian

    2014-01-01

    Composite arch-wire (CoAW) is an arch wire formed by solder connection of nickel titanium shape memory alloy and stainless steel wire. The purpose of the present study was to investigate the biocompatibility of CoAW as an important foundation for its clinical application. The electrochemical corrosion and ion release behavior of CoAW upon immersion in solutions simulating oral cavity conditions were measured to evaluate the corrosion behavior of CoAW. Murine L-929 cells were co-cultured with CoAW extract to evaluate the cytotoxicity of the corrosion products in vitro. Polarization tests indicated that CoAW is resistant to corrosion in the tested artificial saliva (AS)-based solutions (chloric solution, simple AS, fluorinated AS, and protein-containing AS), and the amount of toxic copper ions released after immersion was lower than average daily dietary intake levels. The cytotoxicity experiments demonstrated the in vitro biocompatibility of CoAW. Based on the combined advantages of its base materials CoAW, with its resistance to biocorrosion and in vitro cytocompatibility, is a promising alternative material for use in orthodontic fixation applications.

  15. Alternative Work Schedules in Office and Nonoffice Work Settings.

    Science.gov (United States)

    Kirk, Raymond J.; Barton, H. David

    A rapidly growing change in the workplace is the replacement of a fixed work schedule with a variety of alternative work schedules (AWS), including both flexible and compressed schedules. Experimenting organizations (N=901) evaluated one of four major categories of AWS in office and nonoffice settings, i.e., a flexible 8-hour day;…

  16. “Alice in Wonderland” Syndrome: A Manifestation of Infectious Mononucleosis in Children

    Directory of Open Access Journals (Sweden)

    Eliezer Lahat

    1991-01-01

    Full Text Available The association between “Alice in Wonderland” Syndrome (AWS and infectious mononucleosis (IM has been previously described in three patients. We describe two additional cases in children, where in one case, the visual symptoms of AWS appeared during the course of active IM and in the second, 2 weeks following a clinically mild, but serologically proven attack.

  17. A conceptual approach for a quantitative economic analysis of farmers’ decision-making regarding animal welfare

    NARCIS (Netherlands)

    Gocsik, E.; Saatkamp, H.W.; Lauwere, de C.C.; Oude Lansink, A.G.J.M.

    2014-01-01

    Decisions related to animal welfare (AW) standards depend on farmer’s multiple goals and values and are constrained by a wide range of external and internal forces. The aim of this paper is twofold, i.e., (1) to develop a theoretical framework for farmers’ AW decisions that incorporates farmers’

  18. Nonword repetition in adults who stutter: The effects of stimuli stress and auditory-orthographic cues.

    Directory of Open Access Journals (Sweden)

    Geoffrey A Coalson

    Full Text Available Adults who stutter (AWS are less accurate in their immediate repetition of novel phonological sequences compared to adults who do not stutter (AWNS. The present study examined whether manipulation of the following two aspects of traditional nonword repetition tasks unmask distinct weaknesses in phonological working memory in AWS: (1 presentation of stimuli with less-frequent stress patterns, and (2 removal of auditory-orthographic cues immediately prior to response.Fifty-two participants (26 AWS, 26 AWNS produced 12 bisyllabic nonwords in the presence of corresponding auditory-orthographic cues (i.e., immediate repetition task, and the absence of auditory-orthographic cues (i.e., short-term recall task. Half of each cohort (13 AWS, 13 AWNS were exposed to the stimuli with high-frequency trochaic stress, and half (13 AWS, 13 AWNS were exposed to identical stimuli with lower-frequency iambic stress.No differences in immediate repetition accuracy for trochaic or iambic nonwords were observed for either group. However, AWS were less accurate when recalling iambic nonwords than trochaic nonwords in the absence of auditory-orthographic cues.Manipulation of two factors which may minimize phonological demand during standard nonword repetition tasks increased the number of errors in AWS compared to AWNS. These findings suggest greater vulnerability in phonological working memory in AWS, even when producing nonwords as short as two syllables.

  19. Data List | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available ne Name in SGD Growth rate BM/BW Rate of growth in non-strees condition (Mutant/Wild-type) Growth rate (AM/A...W)/(BM/BW) AM/AW represents rate of growth after exposure to freeze-thaw strees (Mutant/Wild-type), (AM/AW)/

  20. Phenome data - Freeze-thaw stress - DGBY | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available ndard Gene Name in SGD Growth rate BM/BW Rate of growth in non-strees condition (Mutant/Wild-type) Growth ra...te (AM/AW)/(BM/BW) AM/AW represents rate of growth after exposure to freeze-thaw strees

  1. Increase of baclofen intoxications : risks involved and management

    NARCIS (Netherlands)

    Arbouw, M E L; Hoge, H L; Meulenbelt, J; Jansman, F G A

    2014-01-01

    Baclofen has been increasingly used in the treatment of alcohol withdrawal syndrome (AWS). We present a patient with AWS and psychiatric comorbidity who ingested 700 mg of baclofen. ICU admission was necessary for ventilatory support and symptomatic treatment. The patient was dismissed without

  2. The seasonal cycle and interannual variability of surface energy balance and melt in the ablation zone of the west Greenland ice sheet

    NARCIS (Netherlands)

    van den Broeke, M.R.; Smeets, C.J.P.P.; van de Wal, R.S.W.

    2011-01-01

    We present the seasonal cycle and interannual variability of the surface energy balance (SEB) in the ablation zone of the west Greenland ice sheet, using seven years (September 2003–August 2010) of hourly observations from three automatic weather stations (AWS). The AWS are situated along the 67◦ N

  3. Effects of added antibiotics on the basic properties of anti-washout-type fast-setting calcium phosphate cement.

    Science.gov (United States)

    Takechi, M; Miyamoto, Y; Ishikawa, K; Nagayama, M; Kon, M; Asaoka, K; Suzuki, K

    1998-02-01

    The effect of added antibiotics on the basic properties of anti-washout-type fast-setting calcium phosphate cement (aw-FSCPC) was investigated in a preliminary evaluation of aw-FSCPC containing drugs. Flomoxef sodium was employed as the antibiotic and was incorporated into the powder-phase aw-FSCPC at up to 10%. The setting time, consistency, wet diametral tensile strength (DTS) value, and porosity were measured for aw-FSCPC containing various amounts of flomoxef sodium. X-ray diffraction (XRD) analysis was also conducted for the identification of products. To evaluate the drug-release profile, set aw-FSCPC was immersed in saline and the released flomoxef sodium was determined at regular intervals. The spread area of the cement paste as an index of consistency of the cement increased progressively with the addition of flomoxef sodium, and it doubled when the aw-FSCPC contained 8% flomoxef sodium. In contrast, the wet DTS value decreased with increase in flomoxef sodium content. Bulk density measurement and scanning electron microscopic observation revealed that the set mass was more porous with the amount of flomoxef sodium contained in the aw-FSCPC. The XRD analysis revealed that formation of hydroxyapatite (HAP) from aw-FSCPC was reduced even after 24 h, when the aw-FSCPC contained flomoxef sodium at > or = 6%. Therefore, the decrease of wet DTS value was thought to be partly the result of the increased porosity and inhibition of HAP formation in aw-FSCPC containing large amounts of flomoxef sodium. The flomoxef sodium release from aw-FSCPC showed the typical profile observed in a skeleton-type drug delivery system (DDS). The rate of drug release from aw-FSCPC can be controlled by changing the concentration of sodium alginate. Although flomoxef sodium addition has certain disadvantageous effects on the basic properties of aw-FSCPC, we conclude that aw-FSCPC is a good candidate for potential use as a DDS carrier that may be useful in surgical operations.

  4. Using the AUDIT-PC to predict alcohol withdrawal in hospitalized patients.

    Science.gov (United States)

    Pecoraro, Anna; Ewen, Edward; Horton, Terry; Mooney, Ruth; Kolm, Paul; McGraw, Patty; Woody, George

    2014-01-01

    Alcohol withdrawal syndrome (AWS) occurs when alcohol-dependent individuals abruptly reduce or stop drinking. Hospitalized alcohol-dependent patients are at risk. Hospitals need a validated screening tool to assess withdrawal risk, but no validated tools are currently available. To examine the admission Alcohol Use Disorders Identification Test-(Piccinelli) Consumption (AUDIT-PC) ability to predict the subsequent development of AWS among hospitalized medical-surgical patients admitted to a non-intensive care setting. Retrospective case–control study of patients discharged from the hospital with a diagnosis of AWS. All patients with AWS were classified as presenting with AWS or developing AWS later during admission. Patients admitted to an intensive care setting and those missing AUDIT-PC scores were excluded from analysis. A hierarchical (by hospital unit) logistic regression was performed and receiver-operating characteristics were examined on those developing AWS after admission and randomly selected controls. Because those diagnosing AWS were not blinded to the AUDIT-PC scores, a sensitivity analysis was performed. The study cohort included all patients age ≥18 years admitted to any medical or surgical units in a single health care system from 6 October 2009 to 7 October 2010. After exclusions, 414 patients were identified with AWS. The 223 (53.9 %) who developed AWS after admission were compared to 466 randomly selected controls without AWS. An AUDIT-PC score ≥4 at admission provides 91.0 % sensitivity and 89.7 % specificity (AUC=0.95; 95 % CI, 0.94–0.97) for AWS, and maximizes the correct classification while resulting in 17 false positives for every true positive identified. Performance remained excellent on sensitivity analysis (AUC=0.92; 95 % CI, 0.90–0.93). Increasing AUDIT-PC scores were associated with an increased risk of AWS (OR=1.68, 95 % CI 1.55–1.82, pAUDIT-PC score is an excellent discriminator of AWS and could be an important component

  5. Influence of water activity and temperature on growth and mycotoxin production by Alternaria alternata on irradiated soya beans.

    Science.gov (United States)

    Oviedo, Maria Silvina; Ramirez, Maria Laura; Barros, Germán Gustavo; Chulze, Sofia Noemi

    2011-09-15

    The aim of this study was to determine the effects of water activity (a(w)) (0.99-0.90), temperature (15, 25 and 30°C) and their interactions on growth and alternariol (AOH) and alternariol monomethyl ether (AME) production by Alternaria alternata on irradiated soya beans. Maximum growth rates were obtained at 0.980 a(w) and 25°C. Minimum a(w) level for growth was dependent on temperature. Both strains were able to grow at the lowest a(w) assayed (0.90). Maximum amount of AOH was produced at 0.98 a(w) but at different temperatures, 15 and 25°C, for the strains RC 21 and RC 39 respectively. Maximum AME production was obtained at 0.98 a(w) and 30°C for both strains. The concentration range of both toxins varied considerably depending on a(w) and temperature interactions. The two metabolites were produced over the temperature range 15 to 30°C and a(w) range 0.99 to 0.96. The limiting a(w) for detectable mycotoxin production is slightly greater than that for growth. Two-dimensional profiles of a(w)× temperature were developed from these data to identify areas where conditions indicate a significant risk from AOH and AME accumulation on soya bean. Knowledge of AOH and AME production under marginal or sub-optimal temperature and a(w) conditions for growth can be important since improper storage conditions accompanied by elevated temperature and moisture content in the grain can favour further mycotoxin production and lead to reduction in grain quality. This could present a hazard if the grain is used for human consumption or animal feedstuff. Copyright © 2011 Elsevier B.V. All rights reserved.

  6. Speech Timing Deficit of Stuttering: Evidence from Contingent Negative Variations.

    Directory of Open Access Journals (Sweden)

    Ning Ning

    Full Text Available The aim of the present study was to investigate the speech preparation processes of adults who stutter (AWS. Fifteen AWS and fifteen adults with fluent speech (AFS participated in the experiment. The event-related potentials (ERPs were recorded in a foreperiod paradigm. The warning signal (S1 was a color square, and the following imperative stimulus (S2 was either a white square (the Go signal that required participants to name the color of S1 or a white dot (the NoGo signal that prevents participants from speaking. Three differences were found between AWS and AFS. First, the mean amplitude of the ERP component parietal positivity elicited by S1 (S1-P3 was smaller in AWS than in AFS, which implies that AWS may have deficits in investing working memory on phonological programming. Second, the topographic shift from the early phase to the late phase of contingent negative variation occurred earlier for AWS than for AFS, thus suggesting that the motor preparation process is promoted in AWS. Third, the NoGo effect in the ERP component parietal positivity elicited by S2 (S2-P3 was larger for AFS than for AWS, indicating that AWS have difficulties in inhibiting a planned speech response. These results provide a full picture of the speech preparation and response inhibition processes of AWS. The relationship among these three findings is discussed. However, as stuttering was not manipulated in this study, it is still unclear whether the effects are the causes or the results of stuttering. Further studies are suggested to explore the relationship between stuttering and the effects found in the present study.

  7. When will a stuttering moment occur? The determining role of speech motor preparation.

    Science.gov (United States)

    Vanhoutte, Sarah; Cosyns, Marjan; van Mierlo, Pieter; Batens, Katja; Corthals, Paul; De Letter, Miet; Van Borsel, John; Santens, Patrick

    2016-06-01

    The present study aimed to evaluate whether increased activity related to speech motor preparation preceding fluently produced words reflects a successful compensation strategy in stuttering. For this purpose, a contingent negative variation (CNV) was evoked during a picture naming task and measured by use of electro-encephalography. A CNV is a slow, negative event-related potential known to reflect motor preparation generated by the basal ganglia-thalamo-cortical (BGTC) - loop. In a previous analysis, the CNV of 25 adults with developmental stuttering (AWS) was significantly increased, especially over the right hemisphere, compared to the CNV of 35 fluent speakers (FS) when both groups were speaking fluently (Vanhoutte et al., (2015) doi: 10.1016/j.neuropsychologia.2015.05.013). To elucidate whether this increase is a compensation strategy enabling fluent speech in AWS, the present analysis evaluated the CNV of 7 AWS who stuttered during this picture naming task. The CNV preceding AWS stuttered words was statistically compared to the CNV preceding AWS fluent words and FS fluent words. Though no difference emerged between the CNV of the AWS stuttered words and the FS fluent words, a significant reduction was observed when comparing the CNV preceding AWS stuttered words to the CNV preceding AWS fluent words. The latter seems to confirm the compensation hypothesis: the increased CNV prior to AWS fluent words is a successful compensation strategy, especially when it occurs over the right hemisphere. The words are produced fluently because of an enlarged activity during speech motor preparation. The left CNV preceding AWS stuttered words correlated negatively with stuttering frequency and severity suggestive for a link between the left BGTC - network and the stuttering pathology. Overall, speech motor preparatory activity generated by the BGTC - loop seems to have a determining role in stuttering. An important divergence between left and right hemisphere is

  8. Capability of some agricultural wastes for removing some heavy metals from polluted water stocked in combination with Nile tilapia, Oreochromis niloticus (L.

    Directory of Open Access Journals (Sweden)

    Mohsen Abdel-Tawwab

    2017-04-01

    Full Text Available Abstract Heavy metal (HM pollution is one of the major problems that adversely affect the aquatic ecosystem and inhabiting biota. Heavy metals adsorption by low-cost adsorbents is one of the techniques used for HM removing from polluted water. In the present study, agricultural wastes (AW, i.e., rice straw, sugarcane bagasse, and maize stalks, were washed with distilled water, dried in a dry-oven, cut into small pieces (<0.5 cm long, and immersed at 1.0 g/L in aquaria containing synthetic mixture of lead (Pb, cadmium (Cd, copper (Cu, and zinc (Zn. Nile tilapia, Oreochromis niloticus (L., fingerlings (25.2 ± 0.88 g were stocked at a density of ten fish per 100-L aquarium for 72 h, during which fish were fed on a fish diet containing 25% crude protein ad libitum twice daily. Samples of water, AW, and fish were collected at different times to determine HM concentrations. The HM removal from polluted water was depending on the type of the metal ions, AW, and the contact time. However, HM concentrations in aquaria waters of all AW treatments decreased significantly by increasing contact time up to 24 h after which their concentrations were almost the same. Concentrations of waterborne Pb, Cd, Cu, and Zn in AW-containing aquaria were significantly lower than those of AW-free aquaria. The presence of any AW reduced significantly HM concentrations. In AW-free aquaria, HM-exposed fish accumulated more HM in their body than those reared in AW-containing aquaria. The results of this experiment showed that all AW had the capability to remove HM levels from the polluted water and reduce their bioaccumulation in fish body. However, rice straw was the more efficient adsorbent for all metals.

  9. Evaluation of Endotracheal Tube Scraping on Airway Resistance.

    Science.gov (United States)

    Scott, J Brady; Dubosky, Meagan N; Vines, David L; Sulaiman, Adewunmi S; Jendral, Kyle R; Singh, Gagan; Patel, Ankeet; Kaplan, Carl A; Gurka, David P; Balk, Robert A

    2017-11-01

    Spontaneous breathing trials (SBTs) are used to assess the readiness for discontinuation of mechanical ventilation. When airway resistance (R aw ) is elevated, the imposed work of breathing can lead to prolongation of mechanical ventilation. Biofilm and mucus build-up within the endotracheal tube (ETT) can increase R aw . Scraping the ETT can remove the biofilm build-up and decrease mechanical R aw . The primary aim of this study was to evaluate the impact of ETT scraping on R aw . The secondary aim was to determine whether decreasing R aw would impact subsequent SBT success. Intubated, mechanically ventilated subjects were enrolled if they failed an SBT and had an R aw of > 10 cm H 2 O/L/s. SBT failure was based on institutional guidelines, and R aw was calculated by subtracting the difference between the measured peak and plateau pressures using a square flow waveform with an inspiratory flow set at 60 L/min. The endOclear device was inserted into the ETT and withdrawn per manufacturer's guidelines. Scraping was repeated until the ETT was cleared. Change in R aw was compared pre- and post-ETT scraping using a paired t test. A Mann-Whitney U test evaluated the difference in percentage change in R aw between SBT groups. Twenty-nine subjects completed the study. The mean pre- and post-ETT scraping R aw values were 15.17 ± 3.83 and 12.05 ± 3.19 cm H 2 O/L/s, respectively ( P < .001). Subsequent SBT success was 48%; however, there was no difference in percentage change in R aw between subsequent passed SBT (18.61% [interquartile range 8.90-33.93%]) and failed SBT (23.88% [interquartile range 0.00-34.80%]), U = 78.5, z = -0.284, P = .78. No adverse events were noted with ETT scraping. This study demonstrated that ETT scraping can reduce R aw . The decrease in R aw post-ETT scraping did not affect subsequent SBT success. Copyright © 2017 by Daedalus Enterprises.

  10. Neotropical dry forest wildlife water hole use and management

    Directory of Open Access Journals (Sweden)

    Christopher Vaughan

    1999-12-01

    Full Text Available Selected wildlife species diurnal use of a natural water hole (QD and an artificial water hole (AW were studied during 1990 dry season at Guanacaste Conservation Area, Costa Rica. In total, 919 individuals (six mammal and one game bird species consumed water from QD, while 713 individuals (four mammal species consumed water from AW. Estimated daily water consumption by selected wildlife species was 29.7 l at QD and 27.3 l at AW. Estimated 24-h water consumed by all wildlife species or evaporated was 44.6 l at QD and 41.1 l at AW. This resulted from summing: a water consumed by studied species, b estimated 24-hour water consumed by other wildlife (QD = 14.85 l, AW = 13.65 l and c daily water evaporation (QD = 0.04 l, AW = 0.10 l. During a 120-day dry season, AW required about 4 932 l of water from the park administration. Management implications for neotropical dry forest water holes are discussed.Se estudió el uso diurno de un ojo de agua natural (QD y otro artificial (AW a finales de la época seca de 1990 en el Area de Conservacion de Guanacaste, Costa Rica. En total 919 individuos (seis especies de mamíferos y una de ave cinegética consumieron agua de QD y 713 individuos (cuatro especies de mamíferos de AQ. Se estimó que en un dia, las especies de vida silvestre estudiados tomaron 29.7 l y 27.3 l de agua de QD y AW, respectivamente. El total de agua consumido o evaporado de cada ojo de agua durante 24-horas fue estimado en 44.6 l en QD y 41.1 l en AW, con base en: a agua bebida durante 12 h por las especies seleccionadas, b agua bebida por todos los otros individuos durante 24 h (QD = 14.85 l, AW = 13.65 l y c evaporación diaria (QD = 0.04 l, AW = 0.01 l. Para abastecer AW durante una epoca seca de 120 días, la administración del parque debe proveer 4 932 l de agua. Se discute las implicaciones de manejo en las regiones de bosque seco neotropical.

  11. The Impact of Social–Cognitive Stress on Speech Variability, Determinism, and Stability in Adults Who Do and Do Not Stutter

    Science.gov (United States)

    Tiede, Mark; Beal, Deryk; Whalen, D. H.

    2016-01-01

    Purpose This study examined the impact of social–cognitive stress on sentence-level speech variability, determinism, and stability in adults who stutter (AWS) and adults who do not stutter (AWNS). We demonstrated that complementing the spatiotemporal index (STI) with recurrence quantification analysis (RQA) provides a novel approach to both assessing and interpreting speech variability in stuttering. Method Twenty AWS and 21 AWNS repeated sentences in audience and nonaudience conditions while their lip movements were tracked. Across-sentence variability was assessed via the STI; within-sentence determinism and stability were assessed via RQA. Results Compared with the AWNS, the AWS produced speech that was more variable across sentences and more deterministic and stable within sentences. Audience presence contributed to greater within-sentence determinism and stability in the AWS. A subset of AWS who were more susceptible to experiencing anxiety exhibited reduced across-sentence variability in the audience condition compared with the nonaudience condition. Conclusions This study extends the assessment of speech variability in AWS and AWNS into the social–cognitive domain and demonstrates that the characterization of speech within sentences using RQA is complementary to the across-sentence STI measure. AWS seem to adopt a more restrictive, less flexible speaking approach in response to social–cognitive stress, which is presumably a strategy for maintaining observably fluent speech. PMID:27936276

  12. Increased airway reactivity in a neonatal mouse model of Continuous Positive Airway Pressure (CPAP)

    Science.gov (United States)

    Mayer, Catherine A.; Martin, Richard J.; MacFarlane, Peter M.

    2015-01-01

    Background Continuous positive airway pressure (CPAP) is a primary form of respiratory support used in the intensive care of preterm infants, but its long-term effects on airway (AW) function are unknown. Methods We developed a neonatal mouse model of CPAP treatment to determine whether it modifies later AW reactivity. Un-anesthetized spontaneously breathing mice were fitted with a mask to deliver CPAP (6cmH2O, 3hrs/day) for 7 consecutive days starting at postnatal day 1. Airway reactivity to methacholine was assessed using the in vitro living lung slice preparation. Results One week of CPAP increased AW responsiveness to methacholine in male, but not female mice, compared to untreated control animals. The AW hyper-reactivity of male mice persisted for 2 weeks (at P21) after CPAP treatment ended. 4 days of CPAP, however, did not significantly increase AW reactivity. Females also exhibited AW hyper-reactivity at P21, suggesting a delayed response to early (7 days) CPAP treatment. The effects of 7 days of CPAP on hyper-reactivity to methacholine were unique to smaller AWs whereas larger ones were relatively unaffected. Conclusion These data may be important to our understanding of the potential long-term consequences of neonatal CPAP therapy used in the intensive care of preterm infants. PMID:25950451

  13. Effect of variations in treatment regimen and liver cirrhosis on exposure to benzodiazepines during treatment of alcohol withdrawal syndrome

    Directory of Open Access Journals (Sweden)

    Pavel Gershokovich

    2015-08-01

    Full Text Available Purpose: Benzodiazepines (BDZs are the drugs of choice to prevent the symptoms of alcohol withdrawal syndrome (AWS. Various treatment protocols are published and have been shown to be effective in both office-managed and facility-managed treatment of AWS. The aim of this scientific commentary is to demonstrate the differences in the expected exposure to BDZs during AWS treatment using different treatment regimens available in the literature, in patients with or without alcoholic liver cirrhosis. Methods: Diazepam and lorazepam AWS protocols were examined and reviewed in the literature, and blood plasma levels were examined and compared, respectively. Results: Considerable variation in the blood levels with the different dosing schedules was found. Because the drugs are metabolized differently, we have also shown that liver disease affects the blood levels of diazepam, but not of lorazepam. Conclusions: Differences in treatment regimens, the choice of BDZ, as well as the presence of liver cirrhosis can substantially alter the exposure of patients to drugs used for AWS treatment. Outpatient treatment of AWS has been shown to be relatively safe and effective for the treatment of AWS but patients should be carefully monitored.

  14. Awake tracheal intubation using Pentax airway scope in 30 patients: A Case series

    Directory of Open Access Journals (Sweden)

    Payal Kajekar

    2014-01-01

    Full Text Available Background and Aims: Pentax airway scope (AWS has been successfully used for managing difficult intubations. In this case series, we aimed to evaluate the success rate and time taken to complete intubation, when AWS was used for awake tracheal intubation. Methods: We prospectively evaluated the use of AWS for awake tracheal intubation in 30 patients. Indication for awake intubation, intubation time, total time to complete tracheal intubation, laryngoscopic view (Cormack and Lehane grade, total dose of local anaesthetic used, anaesthetists rating and patient′s tolerance of the procedure were recorded. Results: The procedure was successful in 25 out of the 30 patients (83%. The mean (standard deviation intubation time and total time to complete the tracheal intubation was 5.4 (2.4 and 13.9 (3.7 min, respectively in successful cases. The laryngeal view was grade 1 in 24 and grade 2 in one of 25 successful intubations. In three out of the five patients where the AWS failed, awake tracheal intubation was successfully completed with the assistance of flexible fibre optic scope (FOS. Conclusion: Awake tracheal intubation using AWS was successful in 83% of patients. Success rate can be further improved using a combination of AWS and FOS. Anaesthesiologists who do not routinely use FOS may find AWS easier to use for awake tracheal intubation using an oral route.

  15. Anthropogenic water sources and the effects on Sonoran Desert small mammal communities

    Directory of Open Access Journals (Sweden)

    Aaron B. Switalski

    2017-11-01

    Full Text Available Anthropogenic water sources (AWS are developed water sources used as a management tool for desert wildlife species. Studies documenting the effects of AWS are often focused on game species; whereas, the effects on non-target wildlife are less understood. We used live trapping techniques to investigate rodent abundance, biomass, and diversity metrics near AWS and paired control sites; we sampled vegetation to determine rodent-habitat associations in the Sauceda Mountains of the Sonoran Desert in Arizona. A total of 370 individual mammals representing three genera and eight species were captured in 4,800 trap nights from winter 2011 to spring 2012. A multi-response permutation procedure was used to identify differences in small mammal community abundance and biomass by season and treatment. Rodent abundance, biomass, and richness were greater at AWS compared to control sites. Patterns of abundance and biomass were driven by the desert pocket mouse (Chaetodipus penicillatus which was the most common capture and two times more numerous at AWS compared to controls. Vegetation characteristics, explored using principal components analysis, were similar between AWS and controls. Two species that prefer vegetation structure, Bailey’s pocket mouse (C. baileyi and white-throated woodrat (Neotoma albigula, had greater abundances and biomass near AWS and were associated with habitat having high cactus density. Although small mammals do not drink free-water, perhaps higher abundances of some species of desert rodents at AWS could be related to artificial structure associated with construction or other resources. Compared to the 30-year average of precipitation for the area, the period of our study occurred during a dry winter. During dry periods, perhaps AWS provide resources to rodents related to moisture.

  16. Anthropogenic water sources and the effects on Sonoran Desert small mammal communities.

    Science.gov (United States)

    Switalski, Aaron B; Bateman, Heather L

    2017-01-01

    Anthropogenic water sources (AWS) are developed water sources used as a management tool for desert wildlife species. Studies documenting the effects of AWS are often focused on game species; whereas, the effects on non-target wildlife are less understood. We used live trapping techniques to investigate rodent abundance, biomass, and diversity metrics near AWS and paired control sites; we sampled vegetation to determine rodent-habitat associations in the Sauceda Mountains of the Sonoran Desert in Arizona. A total of 370 individual mammals representing three genera and eight species were captured in 4,800 trap nights from winter 2011 to spring 2012. A multi-response permutation procedure was used to identify differences in small mammal community abundance and biomass by season and treatment. Rodent abundance, biomass, and richness were greater at AWS compared to control sites. Patterns of abundance and biomass were driven by the desert pocket mouse ( Chaetodipus penicillatus ) which was the most common capture and two times more numerous at AWS compared to controls. Vegetation characteristics, explored using principal components analysis, were similar between AWS and controls. Two species that prefer vegetation structure, Bailey's pocket mouse ( C. baileyi ) and white-throated woodrat ( Neotoma albigula) , had greater abundances and biomass near AWS and were associated with habitat having high cactus density. Although small mammals do not drink free-water, perhaps higher abundances of some species of desert rodents at AWS could be related to artificial structure associated with construction or other resources. Compared to the 30-year average of precipitation for the area, the period of our study occurred during a dry winter. During dry periods, perhaps AWS provide resources to rodents related to moisture.

  17. Influence of temperature, water activity and pH on growth of some xerophilic fungi.

    Science.gov (United States)

    Gock, Melissa A; Hocking, Ailsa D; Pitt, John I; Poulos, Peter G

    2003-02-25

    The combined effects of water activity (aw), pH and temperature on the germination and growth of seven xerophilic fungi important in the spoilage of baked goods and confectionery were examined. Eurotium rubrum, E. repens, Wallemia sebi, Aspergillus penicillioides, Penicillium roqueforti, Chrysosporium xerophilum and Xeromyces bisporus were grown at 25, 30 and 37 degrees C on media with pH values of 4.5, 5.5, 6.5 and 7.5 and a range of water activities (aw) from 0.92 to 0.70. The aw of the media was controlled with a mixture of equal parts of glucose and fructose. Temperature affected the minimum aw for germination for most species. For example, P. roqueforti germinated at 0.82 aw at 25 degrees C, 0.86 aw at 30 degrees C and was unable to germinate at 37 degrees C. E. repens germinated at 0.70 aw at 30 degrees C, but at 25 and 37 degrees C, its minimum aw for germination was 0.74. C. xerophilum and X. bisporus germinated at 0.70 aw at all three temperatures. The optimum growth occurred at 25 degrees C for P. roqueforti and W. sebi, at 30 degrees C for Eurotium species, A. penicillioides and X. bisporus and at 37 degrees C for C. xerophilum. These fungi all grew faster under acidic than neutral pH conditions. The data presented here provide a matrix that will be used in the development of a mathematical model for the prediction of the shelf life of baked goods and confectionery.

  18. Robust joint score tests in the application of DNA methylation data analysis.

    Science.gov (United States)

    Li, Xuan; Fu, Yuejiao; Wang, Xiaogang; Qiu, Weiliang

    2018-05-18

    Recently differential variability has been showed to be valuable in evaluating the association of DNA methylation to the risks of complex human diseases. The statistical tests based on both differential methylation level and differential variability can be more powerful than those based only on differential methylation level. Anh and Wang (2013) proposed a joint score test (AW) to simultaneously detect for differential methylation and differential variability. However, AW's method seems to be quite conservative and has not been fully compared with existing joint tests. We proposed three improved joint score tests, namely iAW.Lev, iAW.BF, and iAW.TM, and have made extensive comparisons with the joint likelihood ratio test (jointLRT), the Kolmogorov-Smirnov (KS) test, and the AW test. Systematic simulation studies showed that: 1) the three improved tests performed better (i.e., having larger power, while keeping nominal Type I error rates) than the other three tests for data with outliers and having different variances between cases and controls; 2) for data from normal distributions, the three improved tests had slightly lower power than jointLRT and AW. The analyses of two Illumina HumanMethylation27 data sets GSE37020 and GSE20080 and one Illumina Infinium MethylationEPIC data set GSE107080 demonstrated that three improved tests had higher true validation rates than those from jointLRT, KS, and AW. The three proposed joint score tests are robust against the violation of normality assumption and presence of outlying observations in comparison with other three existing tests. Among the three proposed tests, iAW.BF seems to be the most robust and effective one for all simulated scenarios and also in real data analyses.

  19. Sensorimotor oscillations prior to speech onset reflect altered motor networks in adults who stutter

    Directory of Open Access Journals (Sweden)

    Anna-Maria Mersov

    2016-09-01

    Full Text Available Adults who stutter (AWS have demonstrated atypical coordination of motor and sensory regions during speech production. Yet little is known of the speech-motor network in AWS in the brief time window preceding audible speech onset. The purpose of the current study was to characterize neural oscillations in the speech-motor network during preparation for and execution of overt speech production in AWS using magnetoencephalography (MEG. Twelve AWS and twelve age-matched controls were presented with 220 words, each word embedded in a carrier phrase. Controls were presented with the same word list as their matched AWS participant. Neural oscillatory activity was localized using minimum-variance beamforming during two time periods of interest: speech preparation (prior to speech onset and speech execution (following speech onset. Compared to controls, AWS showed stronger beta (15-25Hz suppression in the speech preparation stage, followed by stronger beta synchronization in the bilateral mouth motor cortex. AWS also recruited the right mouth motor cortex significantly earlier in the speech preparation stage compared to controls. Exaggerated motor preparation is discussed in the context of reduced coordination in the speech-motor network of AWS. It is further proposed that exaggerated beta synchronization may reflect a more strongly inhibited motor system that requires a stronger beta suppression to disengage prior to speech initiation. These novel findings highlight critical differences in the speech-motor network of AWS that occur prior to speech onset and emphasize the need to investigate further the speech-motor assembly in the stuttering population.

  20. Short communication: Little change takes place in Camembert-type cheese water activities throughout ripening in terms of relative humidity and salt.

    Science.gov (United States)

    Leclercq-Perlat, M-N; Hélias, A; Corrieu, G

    2013-01-01

    Water activity (a(w)) affects the growth and activity of ripening microorganisms. Moreover, it is generally accepted that a(w) depends on relative humidity (RH) and salt content; these 3 variables were usually measured on a given day in a cheese without the microorganism layer and without accounting for a distinction between the rind, the underrind, and the core. However, a(w) dynamics have never been thoroughly studied throughout cheese ripening. Experimental Camembert cheeses were ripened under controlled and aseptic conditions (temperature, gaseous atmosphere, and RH) for 14 d. In this study, only RH was varied. Samples were taken from the cheese (microorganism layer)-air interface, the rind, and the core. The aw of the cheese-air interface did not change over ripening when RH varied between 91 and 92% or between 97 and 98%. However, on d 5, we observed a small but significant increase in a(w), which coincided with the beginning of growth of Penicillium camemberti mycelia. After d 3, no significant differences were found between the a(w) of the cheese-air interface, the rind, and the core. From d 0 to 3, cheese rind a(w) increased from 0.94 to 0.97, which was probably due to the diffusion of salt from the rind to the core: NaCl content in the rind decreased from 3.7 to 1.6% and NaCl content in the core increased from 0.0 to 1.6%. Nevertheless, aw did not significantly vary in the core, raising questions about the real effect of salt on a(w).

  1. LONG-TERM OCCUPATIONAL AND ENVIRONMENTAL EXPOSURE TO PENCONAZOLE AND TEBUCONAZOLE BY HAIR BIOMONITORING.

    Science.gov (United States)

    Mercadante, Rosa; Polledri, Elisa; Moretto, Angelo; Fustinoni, Silvia

    2018-06-09

    Penconazole (PEN) and tebuconazole (TEB) are fungicides widely used in vineyards. The aim of this the study was to assess the suitability of hair to assess long-term exposure to PEN and TEB. Hair samples of agricultural workers exposed to PEN (AW-PEN, 18 subjects) or TEB (AW-TEB, 2 subjects) during the application of fungicides, agricultural workers relatives (AR, 4 subjects), and research staff technicians (RS, 5 subjects) were collected before (PRE-EXP) and after (POST-EXP) the application season. PEN in PRE-EXP samples was quantifiable in all AW and AR (medians from 1.4 to 7.9 pg/mg hair) and in one RS (1.4 pg/mg hair); PEN in POST-EXP samples was always quantifiable (medians from 2.6 to 23.7 pg/mg hair), with higher levels in AW. Comparing PRE- vs. POST-EXP samples, an increase in PEN level in AW and RS was found. TEB in PRE-EXP samples was quantifiable in most AW and AR (median from 2.1 to 15.5 pg/mg hair), but not in RS; TEB in POST-EXP samples was similarly quantifiable in AW and AR, and was quantifiable also in RS (from 1.4 to median of 141.3 pg/mg hair). Comparing PRE- vs. POST-EXP samples, an increase in TEB level in AW and RS was found. In AW, a positive correlation between the number of PEN treatments during the season and the POST-EXP level of PEN in hair was found (N = 8, Spearman rho = 0.794, p = 0.019). Our results suggest that PEN and TEB accumulate in hair during the agricultural season and that hair is a promising matrix for biomonitoring long-term exposure. Copyright © 2018 Elsevier B.V. All rights reserved.

  2. The alcohol withdrawal syndrome.

    LENUS (Irish Health Repository)

    McKeon, A

    2008-08-01

    The alcohol withdrawal syndrome (AWS) is a common management problem in hospital practice for neurologists, psychiatrists and general physicians alike. Although some patients have mild symptoms and may even be managed in the outpatient setting, others have more severe symptoms or a history of adverse outcomes that requires close inpatient supervision and benzodiazepine therapy. Many patients with AWS have multiple management issues (withdrawal symptoms, delirium tremens, the Wernicke-Korsakoff syndrome, seizures, depression, polysubstance abuse, electrolyte disturbances and liver disease), which requires a coordinated, multidisciplinary approach. Although AWS may be complex, careful evaluation and available treatments should ensure safe detoxification for most patients.

  3. Effects of posted point-of-sale warnings on alcohol consumption during pregnancy and on birth outcomes.

    Science.gov (United States)

    Cil, Gulcan

    2017-05-01

    In 23 states and Washington D.C., alcohol retailers are required by law to post alcohol warning signs (AWS) that warn against the risks of drinking during pregnancy. Using the variation in the adoption of these laws across states and within states over time, I find a statistically significant reduction in prenatal alcohol use associated with AWS. I then use this plausibly exogenous change in drinking behavior to establish a causal link between prenatal alcohol exposure and birth outcomes. I find that AWS laws are associated with decreases in the odds of very low birth weight and very pre-term birth. Copyright © 2017 Elsevier B.V. All rights reserved.

  4. Amazon Web Services- a Case Study

    OpenAIRE

    Narendula, Rammohan

    2012-01-01

    The Amazon Web Services (AWS) is a set (more than 25) of proprietary web-based services owned by Amazon.com. All these services ranging from simple storage to sophisticated database services constitute the cloud platform oered by Amazon. An extensive list of customers for AWS include Dropbox, UniLever, Airbnb, Nasdaq, Netflix. As of 2007, there are more than 300K developers actively using AWS. It is one of the pioneers which brought the cloud computing closer to masses helping number of start...

  5. The Corrosion Resistance of Composite Arch Wire Laser-Welded By NiTi Shape Memory Alloy and Stainless Steel Wires with Cu Interlayer in Artificial Saliva with Protein

    Science.gov (United States)

    Zhang, Chao; Sun, Xinhua; Hou, Xu; Li, Hongmei; Sun, Daqian

    2013-01-01

    In this paper, the corrosion resistance of laser-welded composite arch wire (CoAW) with Cu interlayer between NiTi shape memory alloy and stainless steel wire in artificial saliva with different concentrations of protein was studied. It was found that protein addition had a significant influence on the corrosion behavior of CoAW. Low concentration of protein caused the corrosion resistance of CoAW decrease in electrochemical corrosion and immersion corrosion tests. High concentration of protein could reduce this effect. PMID:23801895

  6. Anaerobic treatment of apple waste with swine manure for biogas production: Batch and continuous operation

    International Nuclear Information System (INIS)

    Kafle, Gopi Krishna; Kim, Sang Hun

    2013-01-01

    Highlights: ► Apple waste (AW) was co-digested with swine manure (SM). ► Mixture of AW and SM produced a higher biogas yield than SM only. ► Mixture of AW and SM produced a higher biogas yield at 55 °C than at 36.5 °C. ► Modified Gompertz model best fitted to the substrates used. ► Positive synergetic effect up to 33% AW during continuous digestion. -- Abstract: This study evaluated the performance of anaerobic digesters using a mixture of apple waste (AW) and swine manure (SM). Tests were performed using both batch and continuous digesters. The batch test evaluated the gas potential, gas production rate of the AW and SM (Experiment I), and the effect of AW co-digestion with SM (33:67,% volatile solids (VSs) basis) (Experiment II) at mesophilic and thermophilic temperatures. The first-order kinetic model and modified Gompertz model were also evaluated for methane yield. The continuous test evaluated the performance of a single stage completely stirred tank reactor (CSTR) with different mixture ratios of AW and SM at mesophilic temperature. The ultimate biogas and methane productivity of AW in terms of total chemical oxygen demand (TCOD) was determined to be 510 and 252 mL/g TCOD added, respectively. The mixture of AW and SM improved the biogas yield by approximately 16% and 48% at mesophilic and thermophilic temperatures, respectively, compared to the use of SM only, but no significant difference was found in the methane yield. The difference between the predicted and measured methane yield was higher with a first order kinetic model (4.6–18.1%) than with a modified Gompertz model (1.2–3.4%). When testing continuous digestion, the methane yield increased from 146 to 190 mL/g TCOD added when the AW content in the feed was increased from 25% to 33% (VS basis) at a constant organic loading rate (OLR) of 1.6 g VS/L/d and a hydraulic retention time (HRT) of 30 days. However, the total volatile fatty acids (TVFA) accumulation increased rapidly and the p

  7. A Study of Military Technopolitics

    DEFF Research Database (Denmark)

    Nørgaard, Katrine

    , governments and military services hope to introduce game-changing military technologies that are ‘better, faster and cheaper’, investing heavily in research and development of AWS. In this paper, I wish to map the different and competing practices of critique and justification that shape the technopolitical...... controversy of AWS, showing its complexity and internal contradictions. In addition to identifying the dominant regimes of justification, that organize the discourse of AWS, I argue that the military bureau and its officeholders become technopolitical mediators and translators of risk in an emergent practice...

  8. NASA Enterprise Managed Cloud Computing (EMCC): Delivering an Initial Operating Capability (IOC) for NASA use of Commercial Infrastructure-as-a-Service (IaaS)

    Science.gov (United States)

    O'Brien, Raymond

    2017-01-01

    In 2016, Ames supported the NASA CIO in delivering an initial operating capability for Agency use of commercial cloud computing. This presentation provides an overview of the project, the services approach followed, and the major components of the capability that was delivered. The presentation is being given at the request of Amazon Web Services to a contingent representing the Brazilian Federal Government and Defense Organization that is interested in the use of Amazon Web Services (AWS). NASA is currently a customer of AWS and delivered the Initial Operating Capability using AWS as its first commercial cloud provider. The IOC, however, designed to also support other cloud providers in the future.

  9. Impact of additional surface observation network on short range ...

    Indian Academy of Sciences (India)

    Stations (AWS) surface observations (temperature and moisture) on the short range forecast over the Indian ... models, which are able to resolve mesoscale fea- ... J. Earth Syst. Sci. ..... terization of the snow field in a cloud model; J. Climate.

  10. 21 CFR 111.3 - What definitions apply to this part?

    Science.gov (United States)

    2010-04-01

    ... product complaints are: Foul odor, off taste, illness or injury, disintegration time, color variation... production. Water activity (aw) is a measure of the free moisture in a component or dietary supplement and is...

  11. Symptoms and Treatment of Depression

    Medline Plus

    Full Text Available ... an awful person that there was no real reason for me to do anything for myself. NARRATOR : ... people, but sometimes treatments fall short. For this reason, NIMH continues to study the genetic, biological and ...

  12. Simple prostatectomy

    Science.gov (United States)

    ... Han M, Partin AW. Simple prostatectomy: open and robot-assisted laparoscopic approaches. In: Wein AJ, Kavoussi LR, ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...

  13. Prostate resection - minimally invasive - discharge

    Science.gov (United States)

    ... Han M, Partin AW. Simple prostatectomy: open and robot assisted laparoscopic approaches. In: Wein AJ, Kavoussi LR, ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...

  14. A Coast Guard Commander's Quick Reference Manual for Legal Issues

    National Research Council Canada - National Science Library

    1997-01-01

    ...). ̂ Following an alcohol incident, review the member's security clearance lAW COMDTlNST M5510.16. ̂ Review the status of members involved in alcohol abuse incidents and take appropriate disciplinary, remedial, educational and I or...

  15. Männilinna veevärk sai korraga kaks peremeest : senine operaator valmistub Elvaga kohut käima / Martin Pau

    Index Scriptorium Estoniae

    Pau, Martin, 1975-

    2010-01-01

    Elva linnavolikogu otsusega pidanuks omavalitsuste loodud firmast Emajõe Veevärk saama 1. juulil Elva veevärgi haldaja, kuid senine majandaja Aqua & Waste Services (AWS) keeldub võtmeid üle andmast

  16. Pop / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2004-01-01

    Heliplaatidest: Timbaland & Magoo "Under Construction Part II", Courtney, Love "America's Sweetheart", Lambchop "Aw C'mon / No You C'mon", Louie Vega "Elements of Life", Un Caddie Renverse Dans L'Herbre "Like a packed cupboard but quite..."

  17. Asthma - control drugs

    Science.gov (United States)

    ... Accessed February 28, 2018. Durrani SR, Busse WW. Management of asthma in adolescents and adults. In: Adkinson NF Jr, Bochner BS, Burks AW, et al, eds. Middleton's Allergy: Principles and Practice . 8th ed. Philadelphia, PA: Elsevier Saunders; 2014:chap ...

  18. Asthma - quick-relief drugs

    Science.gov (United States)

    ... Accessed February 28, 2018. Durrani SR, Busse WW. Management of asthma in adolescents and adults. In: Adkinson NF Jr, Bochner BS, Burks AW, et al, eds. Middleton's Allergy: Principles and Practice . 8th ed. Philadelphia, PA: Elsevier Saunders; 2014:chap ...

  19. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... and nails Skin dictionary Camp Discovery Good Skin Knowledge lesson plans and activities Video library Find a ... counter, this safe, but awful-tasting formula discourages many people from biting their nails. Get regular manicures: ...

  20. Renal cell carcinoma

    Science.gov (United States)

    ... kidney Patient Instructions Kidney removal - discharge Images Kidney anatomy Kidney tumor - CT scan Kidney metastases, CT scan Kidney - blood and urine flow References Campbell SC, Lane BR. Malignant renal tumors. In: Wein AJ, Kavoussi LR, Partin AW, ...