WorldWideScience

Sample records for vami sila ili

  1. Spherical sila- and germa-homoaromaticity.

    Science.gov (United States)

    Chen, Zhongfang; Hirsch, Andreas; Nagase, Shigeru; Thiel, Walter; Schleyer, Paul von Ragué

    2003-12-17

    Guided by the 2(N + 1)2 electron-counting rule for spherical aromatic molecules, we have designed various spherical sila- and germa-homoaromatic systems rich in group 14 elements. Their aromaticity is revealed by density-functional computations of their structures and the nucleus-independent chemical shifts (NICS). Besides the formerly used endohedral inclusion strategy, spherical homoaromaticity is another way to stabilize silicon and germanium clusters.

  2. Subliminalne poruke: mit ili stvarnost

    OpenAIRE

    Baj, Igor

    2017-01-01

    Subliminalne poruke dugi su niz godina prisutne u gotovo svim medijima, a u ovom je radu naglasak stavljen na praksu koja se odnosi na vizualnu komunikaciju. Pojašnjeni su osnovni pojmovi kao što su subliminalne poruke i šest temeljnih audiovizualnih tehnika pomoću kojih se prenose subliminalne ili podsvjesne informacije. Pored povijesnog prikaza i navedenih primjera uporabe subliminalnih poruka u medijima analizirana su brojna sekundarna istraživanja koja upućuju da nema znanstvenog istraživ...

  3. Ab initio design on new push pull sila- and germastilbene

    Science.gov (United States)

    Amatatsu, Yoshiaki; Ohara, Yuhki

    2003-05-01

    Ab initio complete active space self-consistent field and second order Möller-Plesset perturbation calculations have been performed to examine the capabilities of the second order non-linear optics (NLO) of 4-dimethylamino,4 '-cyano,i-sila(or germa)stilbenes (i-DCSS, or i-DCSG) where the carbon at the position i of the parent 4-dimethylamino,4 '-cyanostilbene (DCS) is replaced by more electro-positive silicon or germanium atom. 1-DCSS and 1-DCSG, which have not been synthesized yet, were found to have better NLO properties than DCS.

  4. A Western apache writing system: the symbols of silas john.

    Science.gov (United States)

    Basso, K H; Anderson, N

    1973-06-08

    At the outset of this article, it was observed that the adequacy of an etic typology of written symbols could be judged by its ability to describe all the emic distinctions in all the writing systems of the world. In conclusion, we should like to return to this point and briefly examine the extent to which currently available etic concepts can be used to describe the distinctions made by Western Apaches in relation to the writing system of Silas John. Every symbol in the Silas John script may be classified as a phonetic-semantic sign. Symbols of this type denote linguistic expressions that consist of one or more words and contrast as a class with phonetic-nonsemantic signs, which denote phonemes (or phoneme clusters), syllables (or syllable clusters), and various prosodic phenomena (2, pp. 2, 248). Phonetic semantic signs are commonly partitioned into two subclasses: alogographs (which denote single words) and phraseographs (which denote on or more words). Although every symbol in the Silas John script can be assigned to one or the other of these categories, such an exercise is without justification (21). We have no evidence to suggest that Western Apaches classify symbols according to the length or complexity of their linguistic referents, and therefore the imposition of distinctions based on these criteria would be inappropriate and misleading. A far more useful contrast, and one we have already employed, is presented in most etic typologies as an opposition between compound (composite) and noncompound (noncomposite) symbols. Used to break down the category of phonetic-semantic signs, these two concepts enable us to describe more or less exactly the distinction Apaches draw between "symbol elements put together" (ke?escin ledidilgoh) and "symbol elements standing alone" (ke?- escin doledidildaahi). The former may now be defined as consisting of compound phonetic-semantic signs, while the latter is composed of noncompound phonetic-semantic signs. Up to this point

  5. Pipeline integrity: ILI baseline data for QRA

    Energy Technology Data Exchange (ETDEWEB)

    Porter, Todd R. [Tuboscope Pipeline Services, Houston, TX (United States)]. E-mail: tporter@varco.com; Silva, Jose Augusto Pereira da [Pipeway Engenharia, Rio de Janeiro, RJ (Brazil)]. E-mail: guto@pipeway.com; Marr, James [MARR and Associates, Calgary, AB (Canada)]. E-mail: jmarr@marr-associates.com

    2003-07-01

    The initial phase of a pipeline integrity management program (IMP) is conducting a baseline assessment of the pipeline system and segments as part of Quantitative Risk Assessment (QRA). This gives the operator's integrity team the opportunity to identify critical areas and deficiencies in the protection, maintenance, and mitigation strategies. As a part of data gathering and integration of a wide variety of sources, in-line inspection (ILI) data is a key element. In order to move forward in the integrity program development and execution, the baseline geometry of the pipeline must be determined with accuracy and confidence. From this, all subsequent analysis and conclusions will be derived. Tuboscope Pipeline Services (TPS), in conjunction with Pipeway Engenharia of Brazil, operate ILI inertial navigation system (INS) and Caliper geometry tools, to address this integrity requirement. This INS and Caliper ILI tool data provides pipeline trajectory at centimeter level resolution and sub-metre 3D position accuracy along with internal geometry - ovality, dents, misalignment, and wrinkle/buckle characterization. Global strain can be derived from precise INS curvature measurements and departure from the initial pipeline state. Accurate pipeline elevation profile data is essential in the identification of sag/over bend sections for fluid dynamic and hydrostatic calculations. This data, along with pipeline construction, operations, direct assessment and maintenance data is integrated in LinaViewPRO{sup TM}, a pipeline data management system for decision support functions, and subsequent QRA operations. This technology provides the baseline for an informed, accurate and confident integrity management program. This paper/presentation will detail these aspects of an effective IMP, and experience will be presented, showing the benefits for liquid and gas pipeline systems. (author)

  6. A Journey, the Pain of Others, and Historical Experience: Susan Silas

    Directory of Open Access Journals (Sweden)

    Sendyka, Roma

    2014-12-01

    Full Text Available The author interprets Susan Silas' Helmbrechts walk (1998-2003, a unique series of forty-five photographs and supplementing visual and textual materials collected during the walk along the route of two hundred and twenty-five miles. The walk repeats the route which in 1945 had to undertake women prisoners from the concentration camp in Helmbrechts near Flossenbürg in their death march to Prachatice in Czech Republic. The pictures Silas takes, the people she meets, and finally the trees, the very materiality of the road become the factors of creating her own, individual memory of the event from the past. Silas selects an object from "the margins of the Holocaust" – a forgotten event that she re-presents by reacting to contemporary objects placed along the route of the event. Silas' work offers an opportunity to critically review the concept of memory landscapes (where is memory located in a landscape? and the phenomenon of dark tourism (is following in the footsteps of the prisoners a kind of pilgrimage, tourism, or therapy?. Silas problematises the question of memory, as well as examines different kinds of non-memory. Her camera is directed at locations that can be termed "the non-sites of memory."

  7. Agonum tulliae sp. n. from the Sila National Park (Calabria, southern Italy (Coleoptera: Carabidae: Platynini

    Directory of Open Access Journals (Sweden)

    A. Mazzei

    2017-04-01

    Full Text Available Agonum tulliae sp. n. is described from the Sila Massif upland in Calabria, Italy. This species is similar to Agonum (Olisares sexpunctatum (Linné, 1758 as far as the external morphology is concerned, but it is easy to distinguish by the colour pattern, the shape of pronotum, and at best by the morphology of male genitalia. The study includes some remarks about the habitat and ecology of the new species. It lives only in the eastern part of the Sila massif and occupies the southernmost part of the distribution area of the Agonum sexpunctatum (Linné, 1758 complex in Italy.

  8. Tracing Landscape Evolution of the Sila Massif using 10Be

    Science.gov (United States)

    Raab, Gerald; Ruppli, Annina; Brandová, Dagmar; Scarciglia, Fabio; Norton, Kevin; Christl, Marcus; Egli, Markus

    2017-04-01

    Erosion distinctly shapes earth's surface and therefore influences landscape and, in particular, also soils. The evolution of landscapes and soils are known to evolve in discontinuous ways over thousands of years. Several studies have tried to compare erosion rates over different time periods, thereby trying to derive a chronology of process rates. These studies, however, often had a catchment-wide approach and, thus, basically lack in a distinction of soil erosion from erosion as a general landscape process. To decipher soil erosion rates over millennia time-scales, new approaches are therefore needed. Landscapes affected by intense erosion and denudation may be characterised by boulder fields or "tor" landforms, i.e. tower-like or dome-shaped, often castellated, residual rock boulders (resistant to erosion) "growing" from gentle landforms. Determining the speed of boulder exhumation, soil erosion rates over different time periods can be deduced. The Sila Massif upland plateau in Calabria (Italy) exhibits boulder fields that seemed to be exhumed over time. 10Be-dating along vertical profiles of such granitic boulders was now used as a new approach to unravel long-term erosional phases and to reconstruct the lowering of the surface. The results cover a time span of the last 140 ka and revealed several phases of their exhumation. The different trends could be connected to specific climate conditions, yet a major tectonic influence could be excluded, as the main uplift ended about 400 ka ago. This new approach provides a new insight into soil erosion and denudation rates during the Pleistocene and Holocene.

  9. Virtual Visit to the ATLAS Control Room by University of M`sila

    CERN Multimedia

    2013-01-01

    The University of M`sila is one of the largest universities in Algeria. It includes seven faculties, 30 departments and two institutes, it offers courses at undergraduate and postgraduate levels to around 30,000 students, graduating of them more than 4000 students each year.

  10. Monitoring Peripheral Populations Of The Eurasian Otter (Lutra lutra) In Southern Italy: New Occurrences In The Sila National Park

    OpenAIRE

    Manlio Marcelli

    2009-01-01

    After a period of strong decline, the Eurasian otter (Lutra lutra) has re-expanded its area of distribution in Italy from 1984 to 2004, mainly toward the southern periphery of its range. The Sila National Park is located in a strategic position along a drainage divide separating southern peripheral otter populations from unoccupied but potentially recolonizable habitats. A research project aimed to evaluate the aquatic habitats of the Sila National Park for otter recolonization is now in prog...

  11. Podróż, cudze cierpienie i doświadczenie historyczne: Susan Silas

    Directory of Open Access Journals (Sweden)

    Sendyka, Roma

    2014-12-01

    Full Text Available Autorka interpretuje pracę Susan Silas Helmbrechts walk (1998-2003, szczególny cykl czterdziestu pięciu zdjęć i dołączonych do nich materiałów wizualnych oraz tekstowych zbudowany podczas przejścia trasy dwustu dwudziestu pięciu mil, które w 1945 roku musiały przebyć kobiety pędzone w marszu śmierci z Helmbrecht koło Flossenbürga do czeskich Prachatic. Wykonywane zdjęcia, napotykani ludzie, w końcu – drzewa, sama materialność drogi stają się czynnikami wytwarzania własnej, indywidualnej pamięci wydarzenia sprzed lat. Silas wybiera szczególny obiekt "z marginesów Zagłady" – zapomniane zdarzenie, które przedstawia obserwując współczesne obiekty położone wzdłuż trasy tego zdarzenia. Praca Silas pozwala przyjrzeć się krytycznie koncepcji memory landscapes (gdzie w krajobrazie umiejscawia się pamięć? i zjawisku dark tourism (czy podążanie śladami więźniarek to pielgrzymka, turystyka czy terapia?. Silas problematyzuje nie tylko kwestię pamięci, bada również rodzaje nie-pamiętania. Jej kamera zostaje zwrócona ku lokalizacjom, które można nazwać "nie-miejscami pamięci".

  12. Traditional use of medicinal plants in a city at steppic character (M’sila, Algeria

    Directory of Open Access Journals (Sweden)

    Madani Sarri

    2014-04-01

    Full Text Available Context: M’sila city occupies a privileged position in the central part of northern Algeria. The climate of this area is continental, subject in part to the Saharan influences of which vegetation is steppic. Aims: Highlight traditional usage of plants despite environmental characteristics. Methods: An ethnobotanical survey in the city of M’sila was conducted during the period 2011-2012 in collaboration with traditional practitioners, herbalists and healers. A total of 85 adults were able to determine the species and answer questions about the traditional use of plants in artisanal processing, nutritional and medicinal domains. Results: Medicinal plants recorded in the city of M’sila were 36 divided into 16 families and 31 genera. Lamiaceae family predominates (27.8%, followed by Asteraceae (13.9%. Leaves are the most frequently used (27.4%, the aerial parts (18.5% and thus the seeds (16.3%. It appears that the population is highly dependent on these plants that allow them to treat different pathologies (digestive, stomach, diarrhea, constipation, vomiting with a percentage (18.6%, carminative (5.7% and antidiabetic (12.2%. In general, the remedies are administered orally. Indeed, therapeutic use forms are: the tisane or decoction (44.7%, infusion (27.1% and powder (12.2%. Conclusions: The ethnobotanical survey conducted among traditional healers, herbalists and healers in the M’sila city has created an inventory of 36 species and a database that collected all the information on local and traditional therapeutic applications as well as all the diseases treated.

  13. Laccase SilA from Streptomyces ipomoeae CECT 3341, a key enzyme for the degradation of lignin from agricultural residues?

    Science.gov (United States)

    Blánquez, Alba; Ball, Andrew S; González-Pérez, José Antonio; Jiménez-Morillo, Nicasio T; González-Vila, Francisco; Arias, M Enriqueta; Hernández, Manuel

    2017-01-01

    The role of laccase SilA produced by Streptomyces ipomoeae CECT 3341 in lignocellulose degradation was investigated. A comparison of the properties and activities of a laccase-negative mutant strain (SilA-) with that of the wild-type was studied in terms of their ability to degrade lignin from grass lignocellulose. The yields of solubilized lignin (acid precipitable polymeric lignin, APPL) obtained from wheat straw by both strains in Solid State Fermentation (SSF) conditions demonstrated the importance of SilA laccase in lignin degradation with the wild-type showing 5-fold more APPL produced compared with the mutant strain (SilA-). Analytical pyrolysis and FT-IR (Fourier Transform Infrared Spectroscopy) confirmed that the APPL obtained from the substrate fermented by wild-type strain was dominated by lignin derived methoxyphenols whereas those from SilA- and control APPLs were composed mainly of polysaccharides. This is the first report highlighting the role of this laccase in lignin degradation.

  14. Opto-electronic properties of adamantane and hydrogen-terminated sila- and germa-adamantane: A comparative study

    Science.gov (United States)

    Marsusi, Farah; Mirabbaszadeh, Kavoos; Ali Mansoori, G.

    2009-06-01

    We present the opto-electronic properties of adamantane (C 10H 16) compared to hydrogen-terminated sila- and germa-adamantane (Si 10H 16 and Ge 10H 16) as calculated by the density functional theory. We have shown that the electronic properties of adamantane in comparison to sila- and germa-adamantane are more affected by hydrogen atoms. Our calculations show that the electron affinity of C 10H 16 is negative, while those of Si 10H 16 and Ge 10H 16 are positive. Electronic properties and optical gaps resulting from hybrid functionals are in close agreement with quantum Monte Carlo results.

  15. Linking tephrochronology and soil characteristics in the Sila and Nebrodi Mountains, Italy

    Science.gov (United States)

    Raab, Gerald; Halpern, Dieter; Scarciglia, Fabio; Raimondi, Salvatore; de Castro Portes, Raquel; Norton, Kevin; Egli, Markus

    2017-04-01

    Mediterranean soils are an important key to understanding past volcanic events and landscape evolution. The influence and timing of Quaternary volcanic events on soils, however, remains still poorly understood in southern Italy. We used a multi-method approach to explore the origin and age of volcanic deposits (soils) in Sicily and Calabria. By comparing the geochemical signature of the soils with the chemical fingerprint of magmatic effusive rocks in southern Italy, we tried to identify the source material. It seems that the investigated soils on the Nebrodi (Sicily) and Sila (Calabria) mountains were both influenced by volcanic deposits having a high-K calc-alkaline series volcanic background. The Aeolian islands (Lipari and Vulcano) are the most likely sources of origin. Due to weathering processes of the volcanic sediments and the partial mixing with the underlying non-volcanic parent material, a direct relation with the potential source areas was not always straightforward. Immobile elements and their corresponding ratios (e.g. the Nb/Y vs Zr/Ti plot) or trace elements (Co, Th) and rare earth elements gave better hints of the origin of the deposits. Radiocarbon dating of the stable soil organic fraction (H2O2 resistant) indicated a minimum age of 8 - 10 ka of the Nebrodi and Sila soils. The chemical proxy of alteration (CPA) and weathering index according to Parker (WIP) were tested as proxies for an age estimate of the volcanic deposits and duration of soil formation. The soils and, subsequently, landscape are characterized by multiple volcanic depositional phases for the last 30 - 50 ka in the Sila mountains and about 70 ka in the Nebrodi mountains. We show that a multi-method approach (numerical dating, relative dating using weathering indices and the forensic procedure) enabled the identification of potential source areas, gave tentative age estimates of the ash deposits, duration of soil formation and, therefore, improved our understanding of volcanic

  16. An ethnobotanical survey of galactogenic plants of the Berhoum District (M'sila, Algeria).

    Science.gov (United States)

    Madani, Sarri; Amel, Boudjelal; Noui, Hendel; Djamel, Sarri; Hadjer, Hamdaoui

    2017-01-01

    This work aimed an ethnobatanical study on the galactogenic plants used in the Berhoum region (East of M'sila, Algeria) as a part of different studies on the medicinal plants related to M'sila region. The fieldwork was undertaken as an ethnobotanical survey involving 76 informants (mean age: 50; 64% women, 36% men). Used the medicinal plants were identified, and the results were analyzed according to literature investigation dealing with ethnobotany. Use value (UV), fidelity level, and informant consensus factor (ICF) were used to analyze the obtained data. A total of 29 plant species belonging to 29 genera and 12 families (mainly, Apiaceae and Fabaceae) have been registered. Fruits and seeds were the most commonly used plant parts (80%). The used plants are mainly prepared as an infusion and decoction (69%). Trigonella foenum-graecum L. (UV = 0.58) were the species most commonly used by local healers. The FIC factors ranging from 0.45 to 0.89 for the six uses categories retained for this study. The ICF (0.65) was registered for the use galactogenic category with 29 species. This work showed that the population of the Berhoum District uses various medicinal plants for galactogenic purposes. Furthermore, ethnobotanical analysis will provide data on sustainable use and valorization of this plant heritage for ethnopharmacological and phytochemical studies.

  17. An ethnobotanical survey of galactogenic plants of the Berhoum District (M’sila, Algeria)

    Science.gov (United States)

    Madani, Sarri; Amel, Boudjelal; Noui, Hendel; Djamel, Sarri; Hadjer, Hamdaoui

    2017-01-01

    Background/Aim: This work aimed an ethnobatanical study on the galactogenic plants used in the Berhoum region (East of M’sila, Algeria) as a part of different studies on the medicinal plants related to M’sila region. Methods: The fieldwork was undertaken as an ethnobotanical survey involving 76 informants (mean age: 50; 64% women, 36% men). Used the medicinal plants were identified, and the results were analyzed according to literature investigation dealing with ethnobotany. Use value (UV), fidelity level, and informant consensus factor (ICF) were used to analyze the obtained data. Results: A total of 29 plant species belonging to 29 genera and 12 families (mainly, Apiaceae and Fabaceae) have been registered. Fruits and seeds were the most commonly used plant parts (80%). The used plants are mainly prepared as an infusion and decoction (69%). Trigonella foenum-graecum L. (UV = 0.58) were the species most commonly used by local healers. The FIC factors ranging from 0.45 to 0.89 for the six uses categories retained for this study. The ICF (0.65) was registered for the use galactogenic category with 29 species. Conclusion: This work showed that the population of the Berhoum District uses various medicinal plants for galactogenic purposes. Furthermore, ethnobotanical analysis will provide data on sustainable use and valorization of this plant heritage for ethnopharmacological and phytochemical studies. PMID:28894630

  18. Uboinaja sila

    Index Scriptorium Estoniae

    2006-01-01

    Legendaarne fantastiline seiklusfilm "Superman : The Movie" (1978) on eeskujuks ja aluseks uuele sama koomiksi ainelisele mängufilmile "Superman tuleb tagasi" ("Superman Returns") : režissöör Bryan Singer : nimiosas kunagisele nimiosalisele Christopher Reeve'le sarnanev Brandon Routh : Ameerika Ühendriigid 2006

  19. Integrating Information Literacy Instruction (ILI) through Resource-Based School Projects: An Interpretive Exploration

    Science.gov (United States)

    Yu, Halida; Noordin, Siti Arpah; Mokhtar, Sobariah Awang; Abrizah, A.

    2011-01-01

    Resource-based school projects have good potential to be an effective approach in information literacy instruction (ILI). These projects offer the opportunity for students to engage in information problem-solving learning activities and employ various learning skills, including information literacy (IL). The researchers seek to explore ILI through…

  20. Silas Weir Mitchell: Neurologists and Neurology during the American Civil War.

    Science.gov (United States)

    Boller, François; Birnbaum, Daniel

    2016-01-01

    With few exceptions, neurology was nonexistent in the United States until the Civil War years. From 1861 to 1865, the United States saw a bitter armed conflict between the North (the Union) and the South (the Confederate States or Confederacy), and during those years, neurology was born in the United States. In 1861, Silas Weir Mitchell, together with George Morehouse and William Keen, opened and operated the first neurological hospital in Philadelphia, with the backing of the Surgeon General William Hammond. They treated and studied many peripheral nerve diseases, which led to their making the medical world aware of several conditions, including causalgia (now known as complex regional pain syndrome) and the phantom limb phenomenon. Progress in neurology, both at that time and in subsequent years, owed a great deal to cross-fertilization from Europe. Charles Edouard Brown-Séquard exemplified this. He held multiple medical positions on both sides of the Atlantic, including a position at Harvard in 1864. His teachings, to some extent, contributed to the development of neurology in the United States. In the Confederate states, medical care was less well organized, and neurology only developed later. After the war, in 1874, Mitchell, Hammond, and a few others founded the American Neurological Association. While war influenced the development of medicine, and neurology in particular, medicine also helped to shape the outcome of the war. © 2016 S. Karger AG, Basel.

  1. Endophytic fungi isolated from Pinus halepensis needles in M'sila (Algeria) region and their bioactivities.

    Science.gov (United States)

    Ladjal, S; Harzallah, D; Dahamna, S; Bouamra, D; Bouharati, S; Khennouf, S

    2013-01-01

    Fungal endophytes grow asymptomatically within the tissues of all vascular plants and some are known to provide their host plants with tolerance to different types of environmental stress. Endophytic fungi were detected, isolated and collected from healthy needles of Alep pine (Pinus halepensis Mill.) from the canton of El-Haourane in M'sila, Algeria. For the author's knowledge, these fungi are reported from this conifer for the first time in this region. A survey has been conducted using randomly sampled needles of symptomless trees for two categories of needles (old and young). From 600 surface-sterilized needles collected from 15 trees (300 needles for each age), 29 fungal isolates were obtained and identified on the basis of the morphological characterization using microscopic observations. The fungal isolates were grouped in Deuteromycetes and Zygomycetes. Species of Moniliales were the most common fungi assaciated with P. halepensis. It appears from the results also that the colonization frequency (CF%) was dependant on the age of the needles; older needles were more densely colonized than the younger needles with a 68.5%. The results of this study indicate that P. halepensis serves as a host to numerous endophytic fungi. These fungi could have significance as a source of novel metabolites. And therefore the mycoendophytes genera of Penicillium, Acremonium, Aspergillus, Rhizopus, Trichosporon, Cladosporium, Fusarium, Trichoderma. Expressed an antagonistic and antibiotic effect against pathogenic microorganisms to humans and plants.

  2. Mindblindness: metaphor and neuroaesthetics in the works of Silas Weir Mitchell and Simon Baron-Cohen.

    Science.gov (United States)

    Swenson, Kristine

    2013-01-01

    Silas Weir Mitchell's novel, When All the Woods are Green (1894), acknowledges the medical use of mindblindness (agnosia) but also casts it as a developmental disorder, bringing it provocatively close to how current neuropsychologist, Simon Baron-Cohen and his followers use the term in relation to autism. This chapter traces the mindblindess metaphor in the works of Mitchell and Baron-Cohen to show how mindblindness informs the larger paradigms by which they theorize the brain. This analysis suggests that Baron-Cohen, and thus much current thinking about autism spectrum conditions, is influenced by Victorian-era cultural assumptions and neurosexism, a connection that calls for scrutiny of Baron-Cohen's current models of the brain and theories of autism. This chapter also demonstrates the extent to which Mitchell used fiction and advocated writing as neuroaesthetic tools and thus bridged in his work cognitive science and aesthetics--a connection that current scholars of neuroaesthetics are now theorizing. © 2013 Elsevier B.V. All rights reserved.

  3. Extremely arid soils of the Ili Depression in Kazakhstan

    Science.gov (United States)

    Lebedeva, M. P.; Gerasimova, M. I.; Golovanov, D. L.; Yamnova, I. A.

    2015-01-01

    On the basis of macro- and micromorphological and analytical studies of extremely arid soils of the Ili Depression in Kazakhstan, a comparative analysis of pedogenetic processes shaping these soils on piedmont plains of different ages and heights is performed. The types of soil horizons and their combinations are analyzed in the context opf modern Russian and international soil classification systems. The genesis of extremely arid soils is controlled by the climatic conditions and by their geomorphic position on alluvial fans of piedmont plains. The following processes are diagnosed in these soils: soil crusting with vesicular porosity, the development of desert pavements with rock varnish, rubification, surface salinization, and iron depletion around the pores. It is suggested that the initial factor-based name (extremely arid) of these soils can be replaced by the name vesicular-crusty soils with the corresponding AKL diagnostic horizon, which is more consistent with the principles of substantive-genetic classification systems. In order to determine the classification position of these soils in terms of the new Russian soil classification system, new diagnostic horizons—AKL and CS—have to be introduced in this system. According to the WRB classification, the studied soils belong to the group of Gypsisols; the soil with strong salinization fits the criteria of the group of Solonchaks. A qualifier [yermic] is to be added to reflect the development of desert pavement and vesicular layer under extreme arid conditions.

  4. Financial and tax risks at implementation of "Chayanda- Lensk" section of "Sila Sibiri" gas transportation system construction project

    Science.gov (United States)

    Sharf, I. V.; Chukhareva, N. V.; Kuznetsova, L. P.

    2014-08-01

    High social and economic importance of large-scale projects on gasification of East Siberian regions of Russia and diversifying gas exports poses the problem of complex risk analysis of the project. This article discusses the various types of risks that could significantly affect the timing of the implementation and effectiveness of the project for the construction of the first line of "Sila Sibiri", the "Chayanda-Lensk" section. Special attention is paid to financial and tax aspects of the project. Graphically presented analysis of the dynamics of financial indicators reflect certain periods of effectiveness in implementing the project. Authors also discuss the possible causes and consequences of risks.

  5. Lämmitettävän liimasäiliön suunnittelu ja valmistus

    OpenAIRE

    Tuhkanen, Kari

    2013-01-01

    Opinnäytetyön aiheena oli suunnitella ja valmistaa lämmitettävä liimasäiliö ajoneuvokäyttöön. Säiliön tärkeimmiksi ominaisuuksiksi lukeutuvat lämmitys ja helppokäyttöisyys. Suunnittelu toteutettiin yhteistyössä VM Eristyspalvelun Oy:n työntekijöiden kanssa. Suunnittelussa käytettiin apuna Solidworks-mallinnusohjelmaa. Säiliö suunniteltiin asiakasyrityksen toiveiden mukaan, koska VM Eristyspalvelu Oy:n osatavoitteena on kehittää työssä tarvittavia apuvälineitä. Säiliö valmistettiin asiak...

  6. La préservation de la reserve d'El Mergueb (M'Sila, Algerie

    Directory of Open Access Journals (Sweden)

    MAKHLOUFI HADJAB

    2016-12-01

    Full Text Available La zone d’El Mergueb est une zone naturelle steppique qui se trouve à la limite ouest de la cuvette du Hodna. Elle couvre une superficie de 16.481 hectares 42 ares et 67 centiares, qui touche trois communes steppiques du versant Nord de l’Atlas saharien et appartenant à la Wilaya de M’sila. De part son importance et sa richesse faunistique et floristique, elle a été l’objet de plusieurs études dans le cadre de recherches académiques à ce jour et dont l’une des plus anciennes et celles de Charles Killian (1961. Elle abrite la gazelle de cuvier qui est classée sur la liste rouge de l’Union Internationale de la Conservation de la Nature (UICN, ainsi qu’un arbre typique de l’Atlas saharien en voie de disparition (Pistacia atlantica, appelé localement le Betoum. C’est la raison pour laquelle le Programme des Nations Unies pour le Développement et l’Union Internationale de la Conservation de la Nature (PNUD et UICN ont accepté de financer la réhabilitation et la mise en valeur de la réserve, afin de permettre son classement dans le cadre de la convention internationale sur la biodiversité. Pour l’Algérie cette initiative a coïncidé avec le lancement du programme national du développement agricole (PNDA. Donc, le projet aura un double objectif : la préservation et la protection du site naturel, et la mise en place d’infrastructure pour les populations locales qui y vivent au sein de la réserve et leur intégration dans la gestion de la réserve ce qui permet d’assurer le développement socio-économique dans le cadre du développement durable. Il s’agit de voir les actions lancées et les contraintes auxquelles est confronté le projet.

  7. Temperature and salinity profiles from STD casts in the Bering Sea from the SILAS BENT as part of the Outer Continental Shelf Environmental Assessment Program (OCSEAP) from 01 September 1975 to 26 September 1975 (NODC Accession 7600747)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Temperature and salinity profiles were collected from STD casts in the Bering Sea from the SILAS BENT. Data were collected by the University of Alaska - Fairbanks...

  8. Benthic organism and other data from the Gulf of Alaska from the USNS SILAS BENT as part of the Outer Continental Shelf Environmental Assessment Program (OCSEAP) from 31 August 1975 to 14 September 1975 (NODC Accession 7700434)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Benthic organism and other data were collected in the Gulf of Alaska from the USNS SILAS BENT by University of Alaska; Institute of Marine Science (UAK/IMS). Data...

  9. Primjena tehnologije GIS-a za izradu interaktivne web karte Sveučilišta u Zagrebu

    OpenAIRE

    Župan, Robert; Vračar, Jelena

    2014-01-01

    Obrađena je tema ažuriranja interaktivne karte Sveučilišta u Zagrebu i njezine vizualizacije na webu upotrebom ArcGIS Online tehnologije. Rad se sastoji od informacija o gradu Zagrebu i o Sveučilištu u Zagrebu, zatim od analize postojećih interaktivnih karata različitih sveučilišta u svijetu i analize već postojeće interaktivne karte Sveučilišta u Zagrebu. Opisan je i praktični postupak izrade interaktivne karte s objašnjenjima o korištenim programima.

  10. L’Agésilas de Xénophon : comment on réécrit l’histoire

    Directory of Open Access Journals (Sweden)

    Pierre Pontier

    2010-03-01

    Full Text Available Si l’on accorde foi au récit de l’Anabase, on peut considérer Xénophon comme un homme politique, ou du moins comme un « homme d’action ». À cette expérience marquante du commandement peut s’ajouter la fréquentation du roi spartiate Agésilas à peu près à la même époque, lors de son expédition en Asie mineure et sans doute tout au long des années d’exil à Scillonte. L’existence et l’œuvre de Xénophon ont été orientées par ces deux faits notables de la première partie de sa vie. Ce sont peut-êtr...

  11. Silvicultural and phytosanitary researches in thinned chestnut coppices at different elevations in Sila (Calabria

    Directory of Open Access Journals (Sweden)

    Silvano Avolio

    2010-12-01

    Full Text Available The results of mensurational and phytosanitary researches ten years after thinning trials in chestnut coppices (Castanea sativa Miller in Sila, are reported.. Eight experimental areas, four located at an average elevation of 1200 m a.s.l. aged 20 yrs and four located on average at 1050 m a.s.l. aged 13 yrs, were compared. Three sub-plots were installed in each area and mensurational and phytosanitary surveys were carried out in 1997 (before and after thinning trials and ten years later (2007 on 30 stools per sub-plot to assess bio-ecological, structural and compositional status of the standing crops. At each elevation, the experimental protocol included the following theses: thesis T (control: release of the standing crop and removal of dried up stems on the ground, only; thesis A (light thinning: removal of the dominated storey, on average 30% of coppice shoots, poorly shaped, both withered and green; thesis B (moderate thinning: removal from the dominated up to the dominant storey = 43% of the shoots, both dried up and green; thesis C (heavy thinning: removal = 62% of coppice shoots, both withered and green. Results highlighted the significance of thinnings in the cultivation of chestnut coppices. As for silviculture and growth pattern, the surveying ten years later showed the following outcomes: reduction of shoots mortality, according to the thinning intensity from A to C (by comparing the number of dried up coppice shoots surveyed in the control theses; a higher number of coppice shoots in the commercial category “average stems” in the thinned plots; the higher percentage increment in dbh, basal area and volume in the sub-plots undergoing thinning A and C at the elevation of 1050 m and, in general, with thesis C at both elevations; the complete recovery of canopy cover even in the sub-plots heavily thinned. As for the phytosanitary aspects, the research has been oriented on the chestnut blight caused by Cryphonectria parasitica, due to

  12. Geoethics and pedagogy of mountain and risk: the case of transhumance in Sila (Southern Italy)

    Science.gov (United States)

    Bernardo, Marcello; Muto, Francesco; De Pascale, Francesco

    2015-04-01

    , could bring out the range of perceptions that mountains can arouse in a child or pre-adolescent: from images of sadness and unhappiness to others of joy and elation. Perception is, of course, the first operational level and is essential in the exploration and understanding of space. This exploration and understanding is initially based on sensory perceptions and is then added to by perceptions of the environmental condition of the mountains, the weaknesses and risks, the links to history and to demographic, economic, social and cultural trends. The school, traditionally delegated to the training of the boy, can contribute to the acquisition of a new consciousness that can change the current image that the public has of the mountain and the phenomena connected with it as, indeed, the transhumance. Transhumance is a technical term of the pastoral economy, the "best" that is to point out a typical aspect of life, almost symbiotic, leading, for the whole year, men and flocks, with a double seasonal allocation, in mountain and plain, and a dual path (outward and return), almost always quite long, and for particular routes. In Calabria, the most significant and sustained transhumance settled between Sila plateau and Crotone plains.

  13. Igor’ Šajtanov, Komparativistika i/ili poètika

    Directory of Open Access Journals (Sweden)

    Elizaveta Illarionova

    2012-06-01

    Full Text Available Recensiamo il libro di Igor’ Šajtanov Komparativistika i/ili poètika. Anglijskie sjužety glazami istoričeskoj poètiki [Comparatistica e/o poetica. Intrecci inglesi agli occhi della poetica storica]. Moskva: RGGU, 2010.

  14. Analyzing Idioms and Their Frequency in Three Advanced ILI Textbooks: A Corpus-Based Study

    Science.gov (United States)

    Alavi, Sepideh; Rajabpoor, Aboozar

    2015-01-01

    The present study aimed at identifying and quantifying the idioms used in three ILI "Advanced" level textbooks based on three different English corpora; MICASE, BNC and the Brown Corpus, and comparing the frequencies of the idioms across the three corpora. The first step of the study involved searching the books to find multi-word…

  15. Analysis on Cu and Zn Concentrations in Agricultural Soils of Ili District, Xinjiang Autonomous Region, China

    Directory of Open Access Journals (Sweden)

    YANG Jing-na

    2015-02-01

    Full Text Available The aim of this work is mainly to investigate the contents of copper(Cuand zinc(Znin agricultural soils to provide basic infor-mation for the establishment of green and organic production base in Ili District, Xinjiang Autonomous Region. 600 topsoil samples of the a-gricultural land were collected from eight counties of Ili District, and the contents of Cu and Zn were determined by AAS after microwave di-gestion. The statistics analysis showed that the mean contents of Cu and Zn in the agricultural soils of Ili District were 28.68 mg·kg-1 and 83.17 mg·kg-1, respectively. The concentrations of Cu in the agricultural soils of Ili District ranged from 11.07 mg·kg-1 to 59.90 mg·kg-1, 85% of which ranged from 20 mg·kg-1 to 40 mg·kg-1; and the concentrations of Zn in the agricultural soils of Ili District ranged from 39.58 mg·kg-1 to 160.40 mg·kg-1, 90%of which ranged from 60 mg·kg-1 to 110 mg·kg-1. Furthermore, compared the Cu and Zn contents of the tested soils among the eight counties, Cu contents in Tekes County were higher than other counties, while Zn contents showed little difference. The con-tents of Cu and Zn in the tested soils were all below the threshold values that were established in the national environmental quality standard for soils(secondary standards, GB 15618-1995, but about 7% and 21% were higher than the Cu and Zn background values of soil in Ili District, respectively. Furthermore, the concentrations of Cu and Zn in soils of Ili District accord with the environmental requirements for or-ganic and green production base regulated by national standard of organic products(GB/T 19630-2011and industrial standard of green food(NY/T 391-2013.

  16. Probabilistic daily ILI syndromic surveillance with a spatio-temporal Bayesian hierarchical model.

    Directory of Open Access Journals (Sweden)

    Ta-Chien Chan

    Full Text Available BACKGROUND: For daily syndromic surveillance to be effective, an efficient and sensible algorithm would be expected to detect aberrations in influenza illness, and alert public health workers prior to any impending epidemic. This detection or alert surely contains uncertainty, and thus should be evaluated with a proper probabilistic measure. However, traditional monitoring mechanisms simply provide a binary alert, failing to adequately address this uncertainty. METHODS AND FINDINGS: Based on the Bayesian posterior probability of influenza-like illness (ILI visits, the intensity of outbreak can be directly assessed. The numbers of daily emergency room ILI visits at five community hospitals in Taipei City during 2006-2007 were collected and fitted with a Bayesian hierarchical model containing meteorological factors such as temperature and vapor pressure, spatial interaction with conditional autoregressive structure, weekend and holiday effects, seasonality factors, and previous ILI visits. The proposed algorithm recommends an alert for action if the posterior probability is larger than 70%. External data from January to February of 2008 were retained for validation. The decision rule detects successfully the peak in the validation period. When comparing the posterior probability evaluation with the modified Cusum method, results show that the proposed method is able to detect the signals 1-2 days prior to the rise of ILI visits. CONCLUSIONS: This Bayesian hierarchical model not only constitutes a dynamic surveillance system but also constructs a stochastic evaluation of the need to call for alert. The monitoring mechanism provides earlier detection as well as a complementary tool for current surveillance programs.

  17. [Epidemiological investigation on natural infection of different canine breeds with Borna disease virus in Ili, China].

    Science.gov (United States)

    Zhan, Qun-ling; Zhang, Ying-ying; Xu, Ming-ming; Hu, Yong-bo; Wu, Xiu-ling; Yu, Jian-ping; Chen, Xiao; Zhu, Dan; Yang, De-yu; Xie, Peng

    2009-10-01

    To investigate the epidemiological pattern of Borna disease virus (BDV) among different canine breeds in Ili, China, and to analyze its potential phylogeny. BDV p24 RNA fragments were detected from peripheral blood mononuclear cells (PBMCs) of canine by modified nested RT-PCR (nRT-PCR). Possible false positives were excluded by determination of both BDV p40 RNA fragments and PMD19 plasmid standards. Analysis were performed on genetic sequence, homologous comparison, amino acid sequence and phylogeny after p24 positive products were validated. BDV p24 RNA fragments were found only in Kazakh Tobet (a shepherd dog) in 8 breeds of 150 cases and their overall positive rate was 11.0% (10/91). Compared with the strain of He/80 from horse and that of S6 from sheep in Germany, the homologous similarities of Kazakh Tobet was 99.2% and 95.7%, and that of amino acid as 100% and 89.3%, respectively. The kinship of Kazakh Tobet was close to He/80 and next to S6. There was potential natural BDV infection in Kazakh Tobet in Ili, and its endemic strain was concerned with He/80 infecting Ili horse and S6 of German Merino sheep introduced into the region from Germany.

  18. Miocene thrusting in the eastern Sila Massif: Implication for the evolution of the Calabria-Peloritani orogenic wedge (southern Italy)

    Science.gov (United States)

    Vignaroli, G.; Minelli, L.; Rossetti, F.; Balestrieri, M. L.; Faccenna, C.

    2012-05-01

    Alpine orogens in the central Mediterranean region have revealed the concomitance of crustal extension in back-arc domain and crustal shortening in frontal domain. Quantitative data of deformation in the frontal orogenic wedges are necessary to understand how the shortening-extension pair evolves in terms of structures, orogenic transport, timing, and exhumation rate. This paper deals with kinematics and ages of the frontal thrust systems of the Calabria-Peloritani Arc (Italy) exposed in the eastern Sila Massif. We first present structural fieldwork, onshore and offshore well log data, and new apatite fission-track (AFT) thermochronology. Then, we describe the structural architecture of the studied area as an ENE-verging stacking of thrust sheets involving basement units and syn-orogenic sediments. The AFT study documents that thrust sheets entered the partial annealing zone from 18 Ma to 13 Ma. This Early-Middle Miocene thrusting phase was coeval with exhumation of high-pressure/low temperature metamorphic rocks in the hinterland of the orogen (Coastal Chain area), mainly driven by top-to-the-W extensional tectonics. Opposite kinematic shear senses (contractional top-to-the-E and extensional top-to-the-W) and different exhumation rates (slow in the frontal, more rapid in the hinterland) are framed in a tectonic scenario of a critically tapered orogenic wedge during the eastward retreating of the Apennine slab.

  19. Novel sila-amide derivatives of N-acetylcysteine protects platelets from oxidative stress-induced apoptosis.

    Science.gov (United States)

    Paul, Manoj; Thushara, Ram M; Jagadish, Swamy; Zakai, Uzma I; West, Robert; Kemparaju, Kempaiah; Girish, Kesturu S

    2017-02-01

    Oxidative stress-induced platelet apoptosis is one among the many causes for the development and progression of many disorders like cardiovascular diseases, arthritis, Alzheimer's disease and many chronic inflammatory responses. Many studies have demonstrated the less optimal effect of N-acetyl cysteine (NAC) in oxidative stress-induced cellular damage. This could be due to its less lipophilicity which makes it difficult to enter the cellular membrane. Therefore in the present study, lipophilic sila-amide derivatives (6a and 6b) synthesized through the reaction of NAC with 3-Aminopropyltrimethylsilane and aminomethyltrimethylsilane were used to determine their protective property against oxidative stress-induced platelet apoptosis. At a concentration of 10 µM, compound 6a and 6b were able to significantly inhibit Rotenone/H2O2 induced platelet apoptotic markers like reactive oxygen species, intracellular calcium level, mitochondrial membrane potential, cytochrome c release from mitochondrial to the cytosol, caspase-9 and -3 activity and phosphatidylserine externalization. Therefore, the compounds can be extrapolated as therapeutic agents to protect platelets from oxidative stress-induced platelet apoptosis and its associated complications.

  20. Kolorektal Karsinomlarda p53 İmmunoreaktivitesinin Klinik ve Histopatolojik Parametreler ile ilişkisi

    OpenAIRE

    Karahan, Nermin; Çandır, Özden; Çetin, Recep

    2009-01-01

    SüleymanDemirel Üniversitesi TIP FAKÜLTESİ DERGİSİ: 2001 ; 8(2) Kolorektal Karsinomlarda p53 İmmunoreaktivitesinin Klinik ve Histopatolojik Parametreler ile ilişkisi Nermin Karahan, Özden Çandır, Recep Çetin Özet Kolorektal karsinomlar tümör süpresör genlerde mutasyonel inaktivasyonlar ve onkojenlerde mutasyonlar sonucu ortaya çıkarlar. Kolorektal karsinoma etyoloji ve patogenezinde bütün genetik değişikliklerin içinde en önemlilerinden birisi p53 g...

  1. De la « rurbanisation » du héros américain : The Rise of Silas Lapham

    Directory of Open Access Journals (Sweden)

    Guillaume TANGUY

    2010-03-01

    Full Text Available La représentation bipolaire de la ville (cité céleste d’un côté, grande Babylone de l’autre est une caractéristique bien connue de l’imaginaire américain. Cette ambivalence se prolonge dans l’affrontement idéologique de deux discours, l’un pastoral, l’autre mercantiliste, et dans les visions qui en découlent : célébration d’un paysage édénique menacé par la machine et par l’urbanisation, ou au contraire prophétie d’une cité utopique qui parachèverait le rêve américain. La réflexion sur la ville qui sous-tend l’œuvre de W.D. Howells revêt une importance particulière dans son roman de 1885, The Rise of Silas Lapham. Mais le fait que le protagoniste regagne in fine sa campagne natale suffit-il à faire de ce récit une pastorale américaine ? Le retour à la nature préfigurant l’exploitation industrielle de celle-ci, la trajectoire de Silas s’inscrit bien plutôt dans une entreprise de « rurbanisation » – de subordination du paysage à une démarche civilisatrice, réalisant ainsi le programme esquissé par Charles Wilson Peale dans son tableau emblématique, The Exhumation of the Mastodon (1806. En évoquant deux scènes fondatrices, la découverte de la mine dans la campagne du Vermont et la pose des fondations de la maison de Silas sur Beacon Street, le roman de Howells se place sous le signe de l’industrialisation. Dès lors, la ville apparaît bel et bien comme l’inévitable destin de l’homo americanus.The bipolar representation of the city (the celestial city vs. Babylon the great is a distinguishing feature of the American psyche. A similar ambivalence can be traced in the ideological conflict between two types of discourse, one pastoral and one mercantilist, the former celebrating the “garden” as opposed to the “machine” (to use the terms of Leo Marx, the latter advocating the quest for the utopian city. The question of the city, which is recurrent in the novels of W

  2. Size-differentiated REE characteristics and environmental significance of aeolian sediments in the Ili Basin of Xinjiang, NW China

    Science.gov (United States)

    Chen, Xiuling; Song, Yougui; Li, Jinchan; Fang, Hong; Li, Zhizhong; Liu, Xiuming; Li, Yue; Orozbaev, Rustam

    2017-08-01

    Aeolian loess in the Ili Basin is an important geological archive for studying the changes in paleoclimate and sources of dust particles. Size-differentiated rare earth elements (REE) may help to distinguish potential dust sources. This study investigates the size-differentiated REE characteristics from three sites including the Zhaosu loess and the Kekdala desert sediments from the Ili Basin, and the Chaona loess from the Chinese Loess Plateau (CLP). Our results show that the patterns of variation of the REE characteristics in different size fractions can act as improved source tracers for aeolian sediments. Moreover, the REE characteristics of the CLP due to the post-depositional chemical weathering. The REE characteristics of coarse fractions are effective tracers for tracking changes in proximal dust sources and regional boundary level circulations. Our study has implications for identifying the exact source(s) of the Ili loess, which is helpful to understand paleoclimate changes and westerly circulation patterns in Central Asia.

  3. Survival and Transcendence of Transnational Indigenous Latina Immigrants (ILIs in the US

    Directory of Open Access Journals (Sweden)

    Margarita Machado-Casas

    2013-12-01

    Full Text Available Transnational indigenous Latino immigrants today seem to live multiple lives across multiple borders. Based on a 3-year Mix methods research study that took place in a new immigrant-receiving community in North Carolina, the manuscript describes the experiences of Indigenous Latina Immigrants (ILIs living in the United States, specifically pedagogies of survival based on fluid social identities. The indigenous women who took part in this study had to adopt fluid unknown identities both in the home for cultural survival, and also outside the home (external identities for physical and social survival, often in hostile environments. In addition, it raises questions about the ways multilingualism affects border mobility and transnationality as well as how indigenous Latina immigrants become Camaleónas guerreras (Chameleon Warriors who use “critical survival tools” as a transnational bridge to facilitate their survival in a hostile US environment, the community, and in schools.

  4. A disputa pela laicidade: Uma análise das interações discursivas entre Jean Wyllys e Silas Malafaia

    Directory of Open Access Journals (Sweden)

    Roberta Bivar Carneiro Campos

    2015-12-01

    Full Text Available Resumo Este artigo analisa conflitos envolvendo lideranças laicas e religiosas na esfera pública brasileira entre os anos de 2010 e 2013. O pastor Silas Malafaia protagoniza os confrontos aqui recapitulados, primeiro contra a deputada Iara Bernardi, na ocasião de um debate sobre o PLC 122/2006, passando por sua tão repercutida entrevista no programa de Marília Gabriela e culminando no embate travado contra o deputado Jean Wyllys por ocasião do PDC que ficou conhecido como da “cura gay”. Partindo de um diálogo entre a teoria social contemporânea e a filosofia política, avaliamos os dilemas apresentados a partir dos pontos de vista últimos em disputa, iluminando os sentidos que definem as respectivas concepções do que seja a vida numa sociedade laica e democrática.

  5. [Environmental geochemical baseline of heavy metals in soils of the Ili river basin and pollution evaluation].

    Science.gov (United States)

    Zhao, Xin-Ru; Nasier, Telajin; Cheng, Yong-Yi; Zhan, Jiang-Yu; Yang, Jian-Hong

    2014-06-01

    Environmental geochemical baseline models of Cu, Zn, Pb, As, Hg were established by standardized method in the ehernozem, chestnut soil, sierozem and saline soil from the Ili river valley region. The theoretical baseline values were calculated. Baseline factor pollution index evaluation method, environmental background value evaluation method and heavy metal cleanliness evaluation method were used to compare soil pollution degrees. The baseline factor pollution index evaluation showed that As pollution was the most prominent among the four typical types of soils within the river basin, with 7.14%, 9.76%, 7.50% of sampling points in chernozem, chestnut soil and sierozem reached the heavy pollution, respectively. 7.32% of sampling points of chestnut soil reached the permitted heavy metal Pb pollution index in the chestnut soil. The variation extent of As and Pb was the largest, indicating large human disturbance. Environmental background value evaluation showed that As was the main pollution element, followed by Cu, Zn and Pb. Heavy metal cleanliness evaluation showed that Cu, Zn and Pb were better than cleanliness level 2 and Hg was the of cleanliness level 1 in all four types of soils. As showed moderate pollution in sierozem, and it was of cleanliness level 2 or better in chernozem, chestnut soil and saline-alkali soil. Comparing the three evaluation systems, the baseline factor pollution index evaluation more comprehensively reflected the geochemical migration characteristics of elements and the soil formation processes, and the pollution assessment could be specific to the sampling points. The environmental background value evaluation neglected the natural migration of heavy metals and the deposition process in the soil since it was established on the regional background values. The main purpose of the heavy metal cleanliness evaluation was to evaluate the safety degree of soil environment.

  6. Integrity management and optimization of planning activities from results of the ILI run

    Energy Technology Data Exchange (ETDEWEB)

    Farinas, Jaime [TRANSIERRA S.A., Santa Cruz (Bolivia)

    2009-07-01

    Transierra owns and operates the Yacuiba - Rio Grande pipeline (GASYRG), 432 kilometers in length and 32 inches in diameter, which transports natural gas from the fields of San Alberto and San Antonio (southern Bolivia) to the Rio Grande compression station (Santa Cruz), and is part of the gas export system to Brazil. This pipeline system has a sustained capacity to transport 17,6 million of cubic meter per day. Within the Integrity Management Program (IMP) has been developing and implementing activities and techniques that seeking to ensure the technical integrity of the pipeline, from the good practices of the industry, which also get an optimization for the use of resources for inspection, operation and maintenance activities. In response to that goal at the beginning of 2008, it was concluded the baseline of the GASYRG ILI runs, getting a very good stage of both the internal and external condition of the pipeline, found some stables anomalies (manufacturing and construction) which do not affect the safe operation status of the pipeline, in this way, it was appropriate to re-planning the maintenance programs of all facilities and main elements, in order to achieve a balance between safety operation condition of the pipeline and the resources used for these purposes, which means that there is a 'before' and an 'after' regarding to planning and maintenance activities are concerned. All of this re-planning gives us a cost optimization for the main activities in the order of 30%. Additionally there has been a very particular approach to care for and prevent threats related to corrosion, maintaining a stable cathodic protection system, taking into account the presence of interfering elements (crossing with pipelines, power lines, railroads, etc.). Also important steps have been taken regarding to the changing dynamic to the action of third parties, it is part of a specific program for strengthening contingency plans. Concluding the above, the

  7. Analiza uticaja armiranobetonskog rama od sopstvenog opterećenja i spoljašnjih sila/Structural analysis of a prestressed concrete

    Directory of Open Access Journals (Sweden)

    Miloš Z. Petrović

    2014-10-01

    Full Text Available U radu je prikazano delovanje sile prednaprezanja na armiranobetonski ram (u daljem tekstu AB ram. Posmatrani sistem je statički neodređen sa dva ukleštenja. Na njega deluje opterećenje prednaprezanje kablom silom Nk=600 kN, kao i sopstveno opterećenje. Visina rama je 6.00 m, a osovinski razmak 20.00 m. Opterećenje od sopstvene težine elemenata je od rigle i stuba. Opterećenje konstrukcije usled prednaprezanja spada u unutrašnja opterećenja, koja zamenjujemo ekvivalentnim opterećenjem koje predstavlja spoljašnje opterećenje. Proračun je izvršen metodom sila i metodom deformacija, kao i u softverskom programu 'Tower'. Metodom sila se uklanja ukleštenje i preseku se omogućava obrtanje. Statički neodređena veličina tada je moment ukleštenja. Kod metode deformacije sve statičke i deformacijske veličine izražavaju se putem izvesnog broja međusobno nezavisnih deformacijskih veličina, koje su određene iz uslova ravnoteže sistema. Broj nezavisnih deformacijskih neodređenih veličina predstavlja deformacijsku neodređenost nosača. Sve deformacijski neodređene veličine mogu se svrstati u dve grupe: prvu grupu čine uglovi obrtanja na krajevima kruto vezanih štapova, a drugu grupu komponente pomeranja čvorova. / The effects of prestressing forces on a reinforced concrete frame are shown in the paper. The structure is a statically indeterminate frame with two fixed supports. The load is due to tendon prestressing with Nk = 600 kN and due to self-weight of columns and beam. The columns height is 6.00 m and the beam span is 20.00 m. Effects of prestressing can be replaced by an external equivalent load. Calculations are performed by the force method, by the direct stiffness method and using the 'Tower' software. The rotational restraints are released at fixed supports and the restraint moments are calculated by the force method. The direct stiffness method uses the members' stiffness relations for computing member forces and

  8. Intensity of Influenza-Like Illness (ILI) and Congestive Heart Failure (CHF) Deaths: A Correlation Study in Louisiana, 2000-2012.

    Science.gov (United States)

    LaSyone, Lukas; Hand, Julie; Ratard, Raoult C

    2015-01-01

    Influenza infection has been linked to significant morbidity and mortality, especially in vulnerable populations including the elderly and those with chronic disease, such as congestive heart failure (CHF). This correlation analysis used influenza surveillance data and vital statistics mortality data to assess the correlation between influenza-like illness (ILI) and CHF deaths in Louisiana from 2000-2012 on a weekly level and at the seasonal level. The correlation between ILI proportion and mean number of deaths for the entire study period was 0.23. The comparisons made at the seasonal level showed some association between season's intensity and CHF mortality. The clinical implication of this study is that ILI surveillance can be used to issue alert to clinicians who treat CHF patient in order to stress measures aimed at preventing deaths from CHF.

  9. Znanstveno-istraživački rad na Sveučilištu u Rijeci: percepcije, stavovi i iskustva studenata

    OpenAIRE

    Dundović, Ana

    2016-01-01

    Uloga znanosti i istraživanja u gospodarskom i društvenom razvoju prepoznata je na razini javnog mnijenja, akademske rasprave te policy i strateških dokumenata u kontekstu EU i Republike Hrvatske. Važnost razvoja istraživanja prepoznata je i na razini domaćih sveučilišta, te je kao jedan od ciljeva implementirana u Strategiju razvoja Sveučilišta u Rijeci 2014-2020. Studenti kao aktivni dionici visokog obrazovanja i velik dio njegovog ljudskog kapitala trebaju biti uključeni u znanstveno-istra...

  10. 3D modeling of circumferential SH guided waves in pipeline for axial cracking detection in ILI tools.

    Science.gov (United States)

    Wang, Shen; Huang, Songling; Zhao, Wei; Wei, Zheng

    2015-02-01

    In this paper, SH (shear horizontal) guided waves propagating in the circumferential direction of pipeline are modeled in 3 dimensions, with the aim for axial cracking detection implementation in ILI (in-line inspection) tools in mind. A theoretical formulation is given first, followed by an explanation about the 3D numerical modeling work. Displacement wave structures from the simulation and dispersion equation are compared to verify the effectiveness of the FEM package. Transverse slots along the axial direction are modeled to simulate axial cracking. Reflection and transmission coefficients curves are obtained to provide insight in using circumferential SH guided waves for quantitative testing of axial pipeline cracking. Copyright © 2014 Elsevier B.V. All rights reserved.

  11. ‘Nothing is true, everything is permitted.’ : The portrayal of the Nizari Isma’ilis in the Assassin’s Creed game series

    NARCIS (Netherlands)

    Bosman, Frank

    Ubisoft’s Assassin’s Creed does a remarkable – though not flawless – job in presenting a well-balanced game narrative, which incorporates not only a historically justified representation of the Nizari Isma’ilis, but also implicitly corrects one of the most famous Western legends about the so-called

  12. Critical Evaluation of the New Headway Advanced and the ILI Advanced Series: A Comparison of Curricular Components and CLT Objectives Based on ACTFL

    Directory of Open Access Journals (Sweden)

    Esmail Zare-Behtash

    2017-07-01

    Full Text Available The critical evaluation of systematic planning, development and review practices of instructional materials intend to improve the quality of teaching and learning. This study investigates the objectives of communicative language teaching and curricular components of two important textbooks which are widely studied in Iran: the New Headway Advanced Series (2015, the Iran Language Institute (ILI Advanced1 (2008. The evaluation is done in terms of two prospects; firstly, the interpretation of communicative language teaching objectives and secondly, curricular components of the books. To this aim, a checklist of 5 Cs standards and seven curricular components evaluation developed by American Council on the Teaching of Foreign Languages (ACTFL was employed. The evaluation reveals that the New Headway advanced series is more preferable and desirable than the ILI Advanced 1 due to the design and organization, authenticity, attractiveness, functionality, practicality and the other qualities mentioned above regarding communication, cultures, connection, comparison, and community in all aspects. The evaluation based on the seven curricular components- language systems, communication strategies, cultural knowledge, learning strategies, content from other subject areas, critical thinking skills, technology and the other features- indicates that the ILI textbook enjoys low standards and is not well developed in all components. The ILI textbook is highly reading and writing oriented and not appropriate for transactional and interactional learning purposes. This study acquaints language teachers and learners with the more desirable and cogent book.

  13. Chemical composition and antimicrobial activity of the essential oil from Satureja horvatii Šilić (Lamiaceae

    Directory of Open Access Journals (Sweden)

    BRANISLAVA LAKUSIC

    2008-07-01

    Full Text Available The present paper describes the chemical composition and antimicrobial activity of the essential oil of the endemic species Satureja horvatii Šilić, collected in Montenegro. The essential oil was obtained from the aerial parts of the plant by hydrodistillation and analyzed by GC–MS. From the 34 compounds representing 100 % of the oil, the major compound was the phenolic monoterpene thymol (63.37 %. The oil contained smaller amounts of g-terpinene (7.49 %, carvacrol methyl ether (4.92 %, carvacrol (4.67 %, p-cymene (4.52%, a-terpinene (1.81 %, borneol (1.58 %, a-thujene (1.56 %, b-caryophyllene (1.55 % and b-myrcene (1.44 %. The antimicrobial activity of the essential oil of S. horvatii was evaluated using the agar diffusion and broth microdilution methods. The essential oil exhibited antimicrobial activity to varying degrees against all the tested strains. The maximum activity of S. horvatii oil was observed against Gram-positive bacteria (Micrococcus luteus, Staphylococcus epidermidis, Staphylococcus aureus and Enterococcus faecalis and against the yeast (Candida albicans. The oil exhibited moderate activity against the Gram-negative bacteria Escherichia coli and Klebsiella pneumoniae and weak activity against Pseudomonas aeruginosa. This study confirms that the essential oil of S. horvatii possesses antimicrobial activities in vitro against medically important pathogens.

  14. Koroner yavaş akım ile karotis intima-media kalınlığı arasındaki ilişki

    National Research Council Canada - National Science Library

    AVŞAR, Özgür; DEMİR, İbrahim; YALÇINKAYA, Selim; ALTEKİN, R. Emre; EKİZ, Özgür

    2007-01-01

    Amaç: Çalışmamız arteryel sistemdeki erken dönem aterosklerotik değişikliklerin göstergelerinden biri olan karotis intima-media kalınlığı (KİMK) ile koroner yavaş akım (KYA) arasındaki ilişkiyi araştırmak üzere planlandı. Yöntemler...

  15. Land-use impacts on profile distribution of labile and recalcitrant carbon in the Ili River Valley, northwest China.

    Science.gov (United States)

    Liu, Xiang; Li, Lanhai; Qi, Zhiming; Han, Jiangang; Zhu, Yongli

    2017-05-15

    There is a growing evidence that the decomposition of recalcitrant carbon (C) can be stimulated by environmental changes, such as fresh C supply and increased temperature. However, the effect of land-use on profile distribution of recalcitrant C content is still poorly understood. In this study, soil samples were collected to a depth of 100cm from pastures and four major croplands including maize field, wheat field, paddy and apple orchard in the Ili River Valley, northwest China, to investigate the effects of land-use on profile distribution of labile organic C (LOC), semi-labile organic C (SLOC), recalcitrant organic C (ROC) and their relative proportions in total organic C (TOC), and evaluate whether such effects can be different between topsoil (0-20cm) and subsoil (20-100cm). The results showed that soil ROC accounting for 49.4-66.3% of TOC for different land-uses, implying that ROC is the major form of soil organic C (SOC). Soil TOC contents of croplands were 20.4-85.2% lower than those of pastures along the soil profile, indicating that SOC pool may be decreased by agricultural land-uses. The lower contents of LOC, SLOC and ROC in croplands than in pastures suggested that the decreases in TOC content in croplands are not only due to the decreases in labile C pool but also the reductions in recalcitrant C pool. The differences in SOC fractions among land-uses were similar in topsoil and subsoil, while the proportions of each SOC fraction in TOC did not differ significantly between the two soil layers in most cases, indicating that each SOC fraction in subsoil can be also influenced by land-use types. Therefore, it is suggested that the ROC in subsoil, which plays a crucial role in C sequestration, should be taken into account when estimating the effect of land-use on SOC kinetic. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. Dora Sečić, Kraljevska sveučilišna knjižnica u Zagrebu. Razvoj i djelovanje srednjoeuropske knjižnice od 1874. do 1918. Lokve: Nacionalna i sveučilišna knjižnica — Benja, 2007.

    Directory of Open Access Journals (Sweden)

    Nikša Stančić

    2008-01-01

    Full Text Available Monografija dr. sc. Dore Sečić posvećena je Kraljevskoj sveučilišnoj knjižnici u Zagrebu u razdoblju od njezina osnivanja 1874. do kraja Prvoga svjetskog rata 1918. godine. Autorica je utvrdila društvene i političke uvjete njezina osnivanja i djelovanja, objasnila njezinu specifičnu funkciju sveučilišne i istodobno nacionalne knjižnice, odredila njezin položaj u sklopu knjižnica u Austro-Ugarskoj Monarhiji, razinu uključenosti knjižničarske struke koja je u njoj razvijana u domete suvremene knjižničarske struke u svijetu i napose na srednjoeuropskom prostoru, te opisala organizaciju i djelovanje Knjižnice u obrađivanom razdoblju. Monografija započinje prikazom položaja sjeverne Hrvatske u Austro-Ugarskoj Monarhiji u uvjetima dualizma i ograničene hrvatske političke i gospodarske autonomije te upravne odvojenosti Dalmacije i Istre. Pritom je za monografiju posvećenu osnivanju i djelovanju sveučilišne knjižnice napose relevantno pitanje razvoja visokog školstva, odnosno osnivanja i djelovanja zagrebačkog sveučilišta. Prikaz stanja u znanstvenim knjižnicama i knjižničarstvu u Europi, napose u sveučilišnim knjižnicama u Austro-Ugarskoj i vodećoj Sveučilišnoj knjižnici u Beču, a zatim prikaz pruskog knjižničarstva koje je pred kraj 19. st. izradilo suvremene metode poslovanja znanstvenih knjižnica i obrade knjižne građe, referentni je okvir uz pomoć kojega je autorica mogla ocijeniti kvalitetu djelovanja novoosnovane znanstvene knjižnice koja je postala jedna od središnjih hrvatskih nacionalnih kulturnih institucija. Autorica prati organizaciju i djelovanje Kraljevske sveučilišne knjižnice od njezina osnivanja i prvobitnog smještaja na Gornjem gradu, a zatim i njezino djelovanje nakon preseljenja 1882. zajedno sa Sveučilištem u njegovu današnju zgradu pa do useljenja 1913. u novu zgradu na Marulićevu trgu, što je svaki put bilo popraćeno preustrojem knjižnice. U monografiji je napose, na

  17. Landau - genii ili manjak?

    Index Scriptorium Estoniae

    2008-01-01

    Telefilm vene füüsikust Lev Landaust "Minu mees - geenius" ("Moi muzh - genii"), Cora Landau memuaaride raamatu "Kuidas me elasime" ("Kak mõ zhili") ekraniseering, on enne esilinastust tekitanud Venemaal skandaali

  18. Environmental and seasonal impacts on the chemical composition of Satureja horvatii Šilić (Lamiaceae) essential oils.

    Science.gov (United States)

    Lakušić, Branislava; Ristić, Mihailo; Slavkovska, Violeta; Milenković, Marina; Lakušić, Dmitar

    2011-03-01

    The chemical composition of the essential oils of Satureja horvatii Šilić from two natural habitats (Mt. Orjen and Mt. Lovćen in Montenegro) and from cultivated plants (Belgrade, Serbia) were characterized. For the latter, plants from the locus classicus, i.e., Orjenske Lokve (Mt. Orjen), were transferred to Belgrade and, after three years of cultivation, the chemical composition of their essential oils at different phenological stages was analyzed. The essential oils were obtained from the aerial parts of the plants by hydrodistillation and analyzed by GC and GC/MS. The yields and chemical compositions of the S. horvatii oils showed significant differences between the plants collected in the natural habitats and those from cultivation, as well as between the plants at different phenological stages. In the populations from the natural habitats, growing in Mediterranean conditions, the most abundant oil constituents were the phenols thymol (63.7% in the samples from Mt. Orjen) or carvacrol (68.1% in the samples from Mt. Lovćen), while the oils from the cultivated plants (Belgrade), growing in continental conditions, were dominated by linalool (up to 65.8 and 55.9% in average). The basic characteristics of the essential oil from plants at the early phenological stage (before flowering) were high percentages of linalool (37.4%), thymol (27.3%), and carvacrol (12.2%). At the stage of flowering, the percentage of linalool (56.6-57.5%) increased, while those of thymol (15.5-15.8%) and carvacrol (1.4-1.5%) significantly decreased. The essential oil of plants in the full stage of fruiting was characterized by the domination of linalool (58.4 and 65.8%) and lower percentages of thymol (7.6 and 1.3%) and carvacrol (0.7 and 0.1%). In conclusion, the oil composition of S. horvatii was found to depend on the pedoclimatic conditions of the habitat and the phenological stage of the plants. Copyright © 2011 Verlag Helvetica Chimica Acta AG, Zürich.

  19. The prevalence and subjective handicap of epilepsy in Ilie--a rural riverine community in South West Nigeria: a door-to-door survey.

    Science.gov (United States)

    Mustapha, A F; Preux, P M; Sanya, E O; Akinleye, C A

    2014-08-01

    The prevalence of epilepsy is high in tropical countries, particularly in Africa with an estimated mean prevalence of 15 per 1000. There is lack of recent data on epilepsy prevalence in Nigeria. The main objective of this study was to determine the prevalence of epilepsy in Ilie in South West (SW) Nigeria, and the secondary objectives were to determine the clinical characteristics, the seizure types with electroencephalography (EEG) recording, the pattern of treatment, and to evaluate the subjective handicap of people with epilepsy (PWE). The study, which was descriptive cross-sectional, was carried out in Ilie, a rural community in South West Nigeria, using a simple random sampling technique. The survey was done in 2 phases from January 2013 to April 2013. Phase 1: Door-to-door screening using the WHO Neuroscience Research Protocol to detect neurological disorders by health workers. Phase 2: Individuals with positive screening had complete neurologic examination by neurologists as well as an EEG recording. The questionnaires for survey of epilepsy in tropical countries and subjective handicap of epilepsy were administered to all PWE. Two thousand two hundred twelve individuals from 231 households were screened during the first phase, and 33 cases of neurologic diseases were detected. During the second phase, 10 cases were confirmed to be epilepsy by neurologists, thus giving a crude lifetime prevalence of 10/2212=4.5/1000 population (95% CI=2.30-8.04). The prevalence of epilepsy in Ilie in South West Nigeria is rather low compared with previous figures from studies in rural Africa. Copyright © 2014 Elsevier Inc. All rights reserved.

  20. Prikaz knjige: Berislav Pavišić i suradnici - KAZNENO POSTUPOVNO PRAVO, Pravni fakultet Sveučilišta u Rijeci, 2010.

    OpenAIRE

    Trbojević Palalić, Milana

    2010-01-01

    U nakladi Pravnog fakulteta Sveučilišta u Rijeci iz tiska je 2010. godine izašlo treće izdanje udžbenika Kaznenopostupovnopravo. Uzdr. se. Berislava Pavišića, redovitog profesora, dio materijala na osnovi drugog izdanja pripremili su: dr. se. Eduard Kunštek, izvanredni profesor (odlomci 146.-149., 874.-880., 886.-891.), dr. se. Petar Veić, izvanredni profesor (odlomci 336.-388.), i dr. se. Tadija Bubalović, docent (odlomci 621.-766.). Knjigu su recenzirali i dali pozitivne ocjene prof. dr. se...

  1. Siber Kimliklerin Kişiliğe Yansıması: Proteus Etki (Tanımı, Nedenleri Ve Önlenmesi)

    OpenAIRE

    Tanhan, Fuat; ALAV, Özlem

    2015-01-01

    Hayatın vazgeçilmez bir parçası haline gelmiş olan teknoloji ve internet bireyi ve toplumu farklı yönlerden etkisi altına alabilmektedir. Teknoloji ve internet sanal çevre diye bilinen yeni bir sosyal dünyanın oluşmasına neden olmuştur. Sanal dünya, sınırları neredeyse çizilemeyen bir çevre sunmakta ve bu çevre içinde bulunan bireyleri, kurumları etkilemekte ve dönüştürmektedir.  Söz konusu etki, kimi yönlerden olumlu, kimi yönlerden ise olumsuzlaşmaktadır. Sanal dünyadaki ilişkiler, kimlikle...

  2. "Örgüt Kültürü” Ve “Liderlik” türlerine ilişkin algılamalar ile yöneticilerin demografik özellikleri arasındaki ilişki: Bir alan araştırması

    OpenAIRE

    Bakan, İsmail

    2008-01-01

    Literatürde, liderliğin örgütün etkinliği ve örgütsel kültürün oluşumu ve değişiminde önemli rol oynadığı ileri sürülmektedir. Bu nedenle, bu araştırmada, liderlik ve örgüt kültürü kavramları çalışmanın temel değişkenleri olarak kullanılmıştır. Bu çalışmada farklı “liderlik” ve “örgüt kültürü” türlerine ilişkin yöneticilerin algılamaları ile demografik özellikleri arasındaki ilişkiler incelenmiştir. Araştırma verileri, Kahramanmaraş’ta faaliyette bulunan 12 firmada çalışan yöneticilere uygula...

  3. Knjižnična podrška studentskom učenju i istraživanju: ocjena kvalitete hrvatskih visokoškolskih knjižnica u postupku reakreditacije visokih učilišta

    Directory of Open Access Journals (Sweden)

    Aleksandra Pikić

    2016-12-01

    Full Text Available Potpisivanjem Bolonjske deklaracije Republika Hrvatska obavezala se na kontinuirano praćenje kvalitete sustava za visoko obrazovanje, koje se u praksi između ostaloga odvija postupkom reakreditacije. Cilj ovog istraživanja bio je ispitati razinu uspješnosti hrvatskih visokoškolskih knjižnica pomoću analize ocjena knjižničnih resursa koje su dali članovi stručnih povjerenstava prvog ciklusa reakreditacije hrvatskih visokih učilišta. Istraživanje obuhvaća sva hrvatska visoka učilišta koja su prošla postupak reakreditacije od samog početka njezina provođenja (ak. god. 2010./11. pa do kraja 2015. U tom periodu kroz postupak je prošlo ukupno 129 visokih učilišta ili dijelova visokih učilišta. Rezultati su pokazali da su, ukupno gledajući, hrvatske visokoškolske knjižnice u prosjeku dobile ocjenu 3. Također se pokazalo da nema razlike u ocjeni knjižničnih resursa između sveučilišnih sastavnica te veleučilišta i visokih škola, zatim između javnih i privatnih visokih učilišta te na kraju između glavnih sveučilišnih središta: Zagreba, Splita, Rijeke i Osijeka.

  4. Info- ili reformatsija / Julia Rodina

    Index Scriptorium Estoniae

    Rodina, Julia

    2007-01-01

    Haridusministeerium on vastu, et poliitikud külastavad koole. Riigikogu liikme Tatjana Muravjova sõnul ta ei tegele koolis agitatsiooniga, vaid poliitilise selgitustööga. Parlamendiliikmete Mailis Repsi ja Peeter Kreitzbergi selgitusi

  5. Montazh ili pravda / Valentin Zvegintsev

    Index Scriptorium Estoniae

    Zvegintsev, Valentin

    2003-01-01

    Venemaa Paremjõudude Liidu (VPL) pressisekretär Lilija Dubovaja Boriss Nemtsovi intervjuust, kus ta rääkis Res Publica rahastamisest Vene partei poolt. Lühiintervjuu VPL-i kaasesimehe Irina Hakamada pressisekretäri Vitali Jevstignejeviga

  6. Winthrop-University Hospital Infectious Disease Division's swine influenza (H1N1) pneumonia diagnostic weighted point score system for hospitalized adults with influenza-like illnesses (ILIs) and negative rapid influenza diagnostic tests (RIDTs).

    Science.gov (United States)

    Cunha, Burke A; Syed, Uzma; Stroll, Stephanie; Mickail, Nardeen; Laguerre, Marianne

    2009-01-01

    In spring 2009, a novel strain of influenza A originating in Veracruz, Mexico, quickly spread to the United States and throughout the world. This influenza A virus was the product of gene reassortment of 4 different genetic elements: human influenza, swine influenza, avian influenza, and Eurasian swine influenza. In the United States, New York was the epicenter of the swine influenza (H1N1) pandemic. Hospital emergency departments (EDs) were inundated with patients with influenza-like illnesses (ILIs) requesting screening for H1N1. Our ED screening, as well as many others, used a rapid screening test for influenza A (QuickVue A/B) because H1N1 was a variant of influenza A. The definitive laboratory test i.e., RT-PCR for H1N1 was developed by the Centers for Disease Control (Atlanta, GA) and subsequently distributed to health departments. Because of the extraordinary volume of test requests, health authorities restricted reverse transcription polymerase chain reaction (RT-PCR) testing. Hence most EDs, including our own, were dependent on rapid influenza diagnostic tests (RIDTs) for swine influenza. A positive rapid influenza A test was usually predictive of RT-PCR H1N1 positivity, but the rapid influenza A screening test (QuickVue A/B) was associated with 30% false negatives. The inability to rely on RIDTs for H1N1 diagnosis resulted in underdiagnosing H1N1. Confronted with adults admitted with ILIs, negative RIDTs, and restricted RT-PCR testing, there was a critical need to develop clinical criteria to diagnose probable swine influenza H1N1 pneumonia. During the pandemic, the Infectious Disease Division at Winthrop-University Hospital developed clinical criteria for adult admitted patients with ILIs and negative RIDTs. Similar to the one developed for the clinical diagnosis of legionnaire's disease. The Winthrop-University Hospital Infectious Disease Division's diagnostic weighted point score system for swine influenza H1N1 pneumonia is based on key clinical and

  7. Sila jest - nuzhna sluzhba / Jevgenija Garanzha

    Index Scriptorium Estoniae

    Garanža, Jevgenija, 1979-

    2004-01-01

    Euroopa Liidu laienemine toob muudatused politsei tegevusesse Läänemere piirkonnas ja see sundis kümne riigi politseiteenistuste juhte kogunema ning arutama edaspidist koostööd, eelkõige narkokaubanduse, varastatud autode, illlegaalse migratsiooni ja inimkaubanduse valdkonnas

  8. Evli erkeklerde eşlerine yönelik şiddet ve ilişkili etmenler/Spouse violence and related factors in married men

    Directory of Open Access Journals (Sweden)

    Guljan Dönmez

    2012-12-01

    Full Text Available Amaç: Araştırmanın amacı 25-49 yaş arası evli erkeklerde eşlerine yönelik şiddet uygulama durumunun, türlerinin ve etkileyen etmenlerin belirlenmesidir. Yöntem: Kesitsel tipteki çalışmanın evreni, İzmir’in Konak İlçesi’nde bulunan Esentepe Sağlık Ocağı Bölgesi’nde yaşayan 25-49 yaş arası 2615 evli erkektir. Sistematik örnekleme yöntemi ile seçilen 254 kişiye ulaşılmıştır. Bağımlı değişken olan şiddet varlığı “Yeniden Gözden Geçirilen Çatışma Taktikleri Ölçeği” (The Revised Conflict Tactics Scales=CTS 2 ile belirlenmiştir. Bağımsız değişkenler erkeğe ve eşine ilişkin sosyodemografik değişkenler, evliliğe ve aileye, sağlık durumuna, cinsel yaşama ilişkin özelliklerdir. Veri t Testi, Ki-kare, Lojistik Regresyon Analizi ile çözümlenmiştir. Bulgular: Eşe yönelik psikolojik şiddet sıklığı %93, fiziksel şiddet %37.5, ekonomik şiddet %34.4, cinsel şiddet %3.9 olarak saptanmıştır. Psikolojik şiddete maruziyet, ortaokul ve üzeri öğrenimli kadınlarda anlamlı olarak daha fazladır. Erkeklerin işsiz olması ya da düzensiz işlerde çalışması, haftada birkaç kez ya da her gün alkol kullanması, istenmeyen gebelik varlığı, kadının 25-34 yaş grubunda olması fiziksel şiddette belirleyici etmenler olarak saptanmıştır. Sonuç: Eşleri tarafından kadına yönelik olarak uygulanan psikolojik şiddet sıklığı beklenenden çok yüksek bulunmuştur. Üç erkekten biri ekonomik ve fiziksel şiddet uygulamaktadır. Cinsel şiddet düşük saptanmasına karşın sorunun daha büyük boyutlarda olabileceği düşünülmektedir. Anahtar Kelimeler: Aile içi şiddet, toplumsal cinsiyet, kadın sağlığı Spouse violence and related factors in married men Objective:The purpose of this study is to examine the presence, patterns and related factors of spouse violence among 25-49 years old men. Methods: The cross-sectional study was conducted in the

  9. Türkiye'nin 7 akarsu havzasında horozbina, Salaria fluviatilis (Asso,1801, balığına ait boy-ağırlık ilişkisi.

    Directory of Open Access Journals (Sweden)

    Ali İlhan

    2015-12-01

    Full Text Available Bu çalışmada Türkiye‟nin 7 akarsu havzasından toplanmış olan Horozbina Balığı (Salaria fluviatilis‟na ait boy-ağırlık ilişkisinin ortaya çıkarılması amaçlanmıştır. Marmara, Küçük Menderes, Batı Karadeniz, Antalya, Doğu Akdeniz, Seyhan ve Ceyhan havzalarına ait akarsulardan toplanmış olan 652 birey incelenmiştir. Tüm bireyler dikkate alındığında türün Türkiye içsularındaki total boy dağılımı 2.0-12.9 cm, total ağırlık dağılımı 0.10-33.82 g, boy-ağırlık ilişkisi parametreleri a= 0.0135, b= 3.004, r2= 0.986 olarak hesaplanmıştır. Ayrıca, büyüme tipi havzaların 5‟inde izometrik, 1 havzada pozitif allometrik ve 1 havzada da negatif allometrik olarak belirlenmiştir

  10. Spor eğitimi gören öğrencilerin, sosyal beceri, fiziksel benlik algısı ve fiziksel aktivite düzeyleri arasındaki ilişkinin incelenmesi

    OpenAIRE

    MAKAR, Emre

    2016-01-01

    Bu araştırmanın amacını; spor eğitimi gören öğrencilerin sosyal beceri, fiziksel benlik algısı ve fiziksel aktivite düzeyleri arasındaki ilişkinin incelenmesidir. Çalışmaya toplam 453 (167 kadın, 286 erkek) Bartın Üniversitesi Beden Eğitimi ve Spor Yüksek Okulu öğrencisi gönüllü olarak katılmıştır. Bu çalışmada sosyal becerinin belirlenmesinde sosyal beceri skalası kullanılırken, fiziksel benlik algısı skalası da fiziksel benlik algısının belirlenmesinde kullanılmıştır. Fiziksel aktivite düze...

  11. Kadın öğretmenlerin kariyer engelleri ile iş doyum düzeyleri arasındaki ilişki / Effect of career barriers facing women teachers on their level of job satisfaction

    Directory of Open Access Journals (Sweden)

    Yusuf İNANDI

    2012-12-01

    Full Text Available ÖZETBu çalışmada, kadın öğretmenlerin kariyer engellerinin, onların iş doyum düzeyleriyle ilişkisini ve yordama düzeyini belirlemek amaçlanmaktadır. Araştırmanın çalışma grubunu Türkiye’deki 21 ilin kent merkezlerindeki ilköğretim okullarında görev yapan 1.070 kadın öğretmen oluşturmaktadır. Betimsel nitelikte olan araştırmada, veriler ‘Kadınların Kariyer Engelleri Ölçeği’ (KKEÖ ve ‘İş Doyum Ölçeği’ (İDÖ ile toplanmıştır. Araştırma sonuçları, kadınların kariyer engelleri ile iş doyum düzeyleri arasında güçlü bir ilişki ortaya koymamaktadır. Yine araştırma sonuçlarına göre kadınların kariyer engelleri, iş doyumunun alt boyutları üzerinde sınırlı etkiye sahiptir. Kadın öğretmenlerin kariyer engelleri, iş doyumunun, sırasıyla, ‘iletişim’, ‘sosyal haklar’, ‘işin yapılma şekli’, ‘çalışma koşulları’, ‘maaş’, ‘işin yapısı’, ‘ilk amirle ilişkiler’, ‘yönetim’ ve ‘çalışma arkadaşları’ alt boyutlarını etkilemektedir. Kadın öğretmenlerin iş doyumları, en fazla, ‘toplumdaki cinsiyete ilişkin kalıp yargıları, ailevi durumlar ve kadınların kendi bakış açıları’ kaynaklı engellerden etkilenmektedir. Kadın öğretmenlerin kariyer engellerinin, onların iş doyumlarını düşük düzeyde yordaması, kadınların ve erkeklerin, kadınların yönetim süreçlerinde az olma durumlarını içselleştirmelerinden kaynaklanmış olabilir.

  12. Kırgız Türklerinin kültüründe müzikterapi uygulamaları ve maneviyat ilişkisi

    OpenAIRE

    ERGESHOV, Ermamat

    2011-01-01

    ÖZET Ermamat Ergeshov, Kırgız Türklerinin Kültüründe Müzikterapi Uygulamaları Ve Maneviyat ilişkisi, Yüksek Lisans Tezi, Danışman: Doç. Dr. Öznur Özdoğan, 192 s. Tarihte III. yüzyıllarda Kırgız Türklerinde Faginun, Kam ve Bak!ı/0aman olarak bilinen doktorlar ya!amı!tır. Onlar Komuz, Kıl/Kıyak ve Davul gibi müzik aletlerinin yardımıyla ruhi rahatsızlığı olan insanları tedavi etmi! ve gelecekten haber vermi!lerdir. Doktorlar bu tür uygulamalarda müzik ve dans e!liğinde transa girere...

  13. Meme kanseri riskinin beslenme ile ilişkili faktörler açısından değerlendirilmesi/The evaluation of risk of breast cancer from the perspective of nutritional factors

    Directory of Open Access Journals (Sweden)

    M. Soner Yılmaz

    2014-04-01

    Full Text Available ÖzetBu çalışmanın amacı, meme kanseri riskinin beslenme ile ilişkili faktörler açısından değerlendirilmesidir. Gelişmiş ülkelerde önemli bir Halk Sağlığı sorunu olan meme kanserinin, gelişmekte olan ülkelerde de doğumda beklenen yaşam süresinin uzaması ve batılı yaşam biçiminin benimsenmesi sonucu insidansı artmaktadır. Yaşam biçimi davranışlarının özellikle de beslenmenin, kronik hastalıklarla olan ilişkisinin belirlenmesi ile birlikte, gelişmiş ve gelişmekte olan ülkelerdeki kadınlarda en sık görülen kanser olan meme kanserinde, beslenme ile ilişkili faktörlerin etkisini değerlendirmek amacıyla geçerli veri tabanları ve arama motorlarına “meme kanseri biyolojisi”, “meme kanseri prevalansı”, “meme kanseri ve risk faktörleri”, “meme kanseri ve beslenme” anahtar sözcükleri girilerek tam metnine ulaşılabilen ilgili makaleler çalışma kapsamına alınmıştır. Meme kanseri, çok nedenli bir sağlık sorunudur. Erken menarş, nulliparite, ilk doğumun geç yaşlarda yapılması, kısa süreli emzirme, geç menopoz değiştirilmesi güç olan temel risk faktörleri olup, meme kanserinin % 25’inden sorumludur. Bu faktörlerin yanı sıra obezite, fiziksel inktivite, beslenme ve diyet gibi değiştirilebilir risk faktörleri de hastalığın ortaya çıkmasını etkilemektedir. Korunma açısından değerlendirildiğinde, birincil koruma kapsamında sağlıklı beslenme, özellikle hormon bağımlı kanserler başta olmak üzere kanser riskini azaltmaktadır. Beslenme, kardiyometabolik hastalıklarla da ilişkili olup, meme kanseri gelişiminde de rol oynamaktadır. Bu konuda bazı önemli sonuçlara ulaşılmış olsa da, beslenme ve meme kanseri arasındaki karmaşık ilişkilerin aydınlatılması için, ileriye dönük geniş kapsamlı çalışmalara gereksinim bulunmaktadır.Anahtar Kelimeler: Meme kanseri, risk faktörleri, beslenme ile ilişkili fakt

  14. Geochemistry of the Miocene oil shale (Hançili Formation) in the Çankırı-Çorum Basin, Central Turkey: Implications for Paleoclimate conditions, source-area weathering, provenance and tectonic setting

    Science.gov (United States)

    Vosoughi Moradi, A.; Sarı, A.; Akkaya, P.

    2016-07-01

    The geochemistry of oil shale units of Hançili Formation in the Çankırı-Çorum Basin (Central Turkey) was studied using various chemical analyses. The mineralogical composition of the samples were preliminarily investigated using Pearson's correlation coefficients of selected elements, indicating that the samples contain abundant clay minerals as well as K-feldspar and carbonate. The K2O/Al2O3 and SiO2/Al2O3 ratios indicate that the major proportion of clay minerals is composed of smectite. Si, Al, Ti, K, Na, and Fe reside in clay minerals, while Ca, Mg, and Mn are mostly associated with carbonates (e.g., calcite and dolomite) and phosphorous (P) is present as apatite. The total REE content of the oil shale range from 19 to 113 ppm. The chondrite-normalized patterns of the oil shale show LREE enrichments, HREE deficits, negative Eu anomalies and negligible Ce anomalies. In general, major, trace and rare earth element abundances suggest that the studied oil shale in the Çankırı-Çorum Basin are mainly from the intermediate rocks, mixed with small amounts of basic rocks, and that their source rocks are mostly deposited in the continental collision setting. The REE geochemistry of the oil shale suggests that these samples were derived from a consistent terrigenous source and the Eu anomaly was inherited from the source rocks. The paleoclimate index (C-value), varies between 0.07 and 1.22 reflecting a generally semi-arid to humid conditions. In addition, Rb/Sr ( 0.22) and Sr/Cu ( 9.09) ratios support the idea that warm and humid conditions prevailed during deposition of the Hançili Formation. Sr/Ba ratios (0.54-3.7) of the studied samples suggest a paleoenvironment with variable salinity. The co-variation among this factor and paleoclimate indicators suggest that variations in climatic conditions exerted a primary control on salinity. The substantially low C-value and Rb/Sr ratio and significantly high ratios of Sr/Cu and Sr/Ba and also elevated carbonate

  15. Periodontal hastalıklar ile erken yaşlarda görülen ateroskleroza bağlı koroner hastalıklar arasındaki ilişkinin değerlendirilmesi

    OpenAIRE

    KARAGÖZ, Şükran

    2011-01-01

    Bu çalışmada erken yaşta (?50 yaş) koroner arter hastalığı (KAH) tanısı almış olan kişilerle aterosklerotik kardiyovasküler hastalığı olmayanlar arasında bazı periodontal parametreler ve bazı kan tahlili parametreleri bakımından kıyaslama yaparak, periodontal hastalık gibi enflamatuvar bir durumun erken yaşlarda ortaya çıkışı ile erken yaşlarda KAH gelişimi arasındaki olası ilişkinin değerlendirilmesi amaçlanmıştır.Çalışmamızda KAH tanısı almış, yaşları 31-50 arasında (or...

  16. Emeklilik Fonları ve Finansal İstikrar: Şili ve Türkiye Örneklerinden Dersler(Pension Funds and Financial Stability: Lessons from Chile and Turkey

    Directory of Open Access Journals (Sweden)

    Vedat Akgiray

    2016-03-01

    Full Text Available Emeklilik fonları, i uzun vadeli yatırım perspektifine sahip olması, ii finansal piyasalardaki oynaklığı uzun vadeye yayarak absorbe edebilmesi, ve iii yatırımlarını hisse senedi ve altyapı fonları ile reel ekonomiye aktarmaları sayesinde; finansal piyasalardaki oynaklığın azalmasına katkıda bulunmaktadır. Bu çalışma, gelişmekte olan ülkelerde (GOÜ,  emeklilik fonlarının ekonomideki payının en düşük olduğu ülkelerden Türkiye'de (%2 ve en yüksek olduğu ülkelerden Şili'de (%66 emeklilik sistemlerinin karşılaştırmalı analizini sunarak, emeklilik fonlarının finansal piyasalardaki oynaklığa olan etkisini 2004-2014 dönemi için incelemektedir. Çalışma aynı zamanda, Türkiye’de uygulanması planlanan ‘otomatik katılım sistemi’ ve bu sistemi tamamlayıcı ‘fon ürünleri’ üzerine politika önerilerini de kapsamaktadır.

  17. Soğuk stres sırasında zihinsel aritmetik çözümlere karşı ortaya çıkan olaya ilişkin beyin potansiyelleri

    OpenAIRE

    Ermutlu, Numan; Eskikurt, Gökçer; İşoğlu-Alkaç, Ümmühan; Karamürsel, Sacit

    2011-01-01

    AMAÇ: Tek başına ve soğuk stres (SS) sırasında Zihinsel aritmetik hesaplamanın (ZA) Go/NoGo paradigması kullanılarak olaya ilişkin beyin potansiyelleri bağlamında incelenmesi. GEREÇ ve YÖNTEM: Gönüllü üniversite öğrencisi 7 deneğin 11 kanaldan EEG kaydı yapıldı. Deneklerin işlem yapmadıkları, soğuk stres altında oldukları, aritmetik işlem yaptıkları ve soğuk stres sırasında aritmetik işlem yaptıkları durumlarda kan basınçları ve kalp atımları ölçüldü. EEG kayıtlar ZA ve ZA +SS koşullarınd...

  18. Eğitim kurumu müdürlerinin liderliği ile okul çıktıları arasındaki ilişkilerin meta-analiz yöntemiyle incelenmesi

    OpenAIRE

    Sarıer, Yılmaz

    2013-01-01

    Amaç: Bu çalışmanın amacı, eğitim kurumu müdürlerinin liderliği ile okul çıktıları arasındaki ilişkilerin meta-analiz yöntemiyle incelenmesidir. Yöntem: Çalışmada ulaşılan veriler, betimsel ve meta-analiz yöntemleri kullanılarak analiz edilmiştir. Araştırma kapsamına, 01.01.2000 ile 31.12.2011 tarihleri arasında Türkiye’de üretilen, çalışmanın amacına ve sınırlılıklarına uygun, 55 adet bildiri, makale ve tez alınmıştır. Çalışmada, etki büyüklüğü, anlamlılık ve heterojenlik d...

  19. Baz istasyonlarının olası sağlık etkilerine ilişkin bir güncelleme/An update on the possible health effects of mobile phone base stations

    Directory of Open Access Journals (Sweden)

    Hür Hassoy

    2012-12-01

    Full Text Available Amaç: Bu derlemenin amacı baz istasyonlarının insan sağlığına etkilerini inceleyen uluslararası ve güncel bilimsel yayınları derleyerek bu konudaki bilimsel bilgi gereksinimini karşılamaya katkıda bulunmaktır. Yöntem: 27 Eylül 2012 tarihine dek PubMed ve Google Scholar arama motorunda “baz istasyonu”, “sağlık etkileri” anahtar sözcükleri kullanılarak bulunan yayınlar ve bu yayınların kaynakçalarından yararlanılarak elde edilen çalışmalar içinden toplam 22 orijinal araştırma makalesini derlemeye dahil edilmiştir. Bulgular: Araştırmaların 15’inde farklı sağlık göstergeleri ile elektromanyetik alan (EMA arasında ilişki saptandığı görülmektedir. Çalışmaların dördünde herhangi bir ilişki saptanmamış, üçünde ise kurulan hipotez tam doğrulanmamıştır. Araştırmaların 11’i baz istasyonu kaynaklı EMA’nın akut, sekizi kronik, üçü de hem akut hem kronik sağlık etkilerini incelemiştir. Altı araştırmada EMA ölçümü yapılmamış, şiddetinin dolaylı göstergesi olarak mesafe kullanılmıştır. Bir çalışmada ölçüm yapılmış ancak sağlık verileri mesafe üzerinden değerlendirilmiştir. Araştırmaların 12 tanesi bir kurum ya da kuruluştan finansal destek almıştır. Çalışmalardan iki tanesinin finansmanının yarısı cep telefonu firmaları tarafından yapılmıştır. Çalışmaların altı tanesi deneysel araştırma tipindedir ve üç çalışmada doz-yanıt ilişkisi bulunmaktadır. Sonuç ve Öneriler: Araştırmalar baz istasyonun sağlık riski taşıyabileceğine ilişkin işaretler göstermektedir. Uyku bozukluğu, depresif semptomlar, baş ağrısı, baş dönmesi, konsantrasyon güçlüğü, en sık tespit edilen semptomlardır. Bu alanda yapılacak ileriye dönük izlem çalışmalarına ihtiyaç bulunmaktadır. Baz istasyonlarıyla ilgili sınır değerler akut etkiler göz önünde bulundurularak yapılmıştır. Uzun erimde baz

  20. Evre IV küçük hücreli dışı akciğer kanserinde serum vasküler endotelyal büyüme faktörü ve Bcl-2 düzeyleri ve aralarındaki ilişki

    National Research Council Canada - National Science Library

    TAŞ, Faruk; ÖZGÜL, Akif; YAZAR, Aziz; ÇAMLICA, Hakan; SOYDİNÇ, Hilal Oğuz; YILMAZ, Veysel; YASASEVER, Vildan; YAZAR, Esra Ertan

    2007-01-01

    ... amacımız evre III ve evre IV hücreli dışı akc iğer kans eri'nde (KHDAK) VEBF ve Bcl-2 düzeylerini ve aralarındaki olası ilişkiyi araştırmaktır. GEREÇ VE YÖNTEM Çalışmaya 28 evre III ve 24 evre IV KHDAK'li hasta ile kontrol grubuna...

  1. Öğretmen algılarına göre ilk ve ortaokul yöneticilerinin demokratik tutumları ile okul kültürü arasındaki ilişki [The relationship between democratic attitudes of primary and secondary school managers and school culture as measured by teachers’ perceptions

    Directory of Open Access Journals (Sweden)

    Durdağı AKAN

    2014-10-01

    Full Text Available Bu araştırmanın amacı, öğretmen algılarına göre ilk ve ortaokul yöneticilerinin demokratik tutumları ile okul kültürü arasındaki ilişkiyi belirlemektir. Çalışma ilişkisel tarama modelinde tasarlanmıştır. Araştırmada bulundukları okulda en az üç yıl görev yapan 180 ilk ve ortaokul öğretmenine yanıtlamaları için Demokratik Tutum Ölçeği ve Örgüt Kültürü Ölçeği yöneltilmiştir. Elde edilen verilerin analizinde Aritmetik Ortalama, Standart Sapma, Pearson Momentler Çarpımı Korelasyonu ve Basit Doğrusal Regresyon Analizinden yararlanılmıştır. Bulgular, öğretmenlerin algıladıkları okul yöneticilerinin demokratik tutumları ile okul kültürü arasında istatistiksel olarak pozitif yönde anlamlı bir ilişkinin bulunduğunu göstermektedir.

  2. NATO ili ne nado? / Dmitri Zvjagintsev

    Index Scriptorium Estoniae

    Zvjagintsev, Dmitri

    2002-01-01

    Ühtset arvamust, kas liitumine NATO-ga toob Eestile rohkem kasu või kahju, ei ole. Küsimusele, millist majanduslikku kasu toob liitumine NATO-ga. Vastavad Madis Mikko, Viktor Andrejev. Parlamendisaadik

  3. Feminizam ili poslanje žene?

    OpenAIRE

    Mišić, Anto

    2005-01-01

    Premda ni feminizam ni poslanje žene nisu tipično filozofske (metafizičke) teme, filozofsko promišljanje pomaže jasnijem poimanju, žene, njezina odnosa i uloge u društvu. Bez ispravnog shvaćanja ljudske naravi, a ona jednako pripada ženi i muškarcu, lako se upada u jednostranost i isključivost stavova i djelovanja. Premda ljudska narav, osobnost, jednako pripada i muškarcu i ženi, ona se u njima ipak različito ostvaruje. Zbog individualnih razlika, ljudska se narav na različite načine izriče,...

  4. Sloboda u istini ili sloboda kao istina?

    OpenAIRE

    Lukšić, Branimir

    1995-01-01

    In this paper the author analyses political and economic liberalism, its contribution to and implications in the philosophy of law, and investigates its philosophical and metaphysical presu- ppositions, before subjecting it to a critical assessment. In this context he discusses various modifications of the utilitarian theory of values which underpins the classical political liberalism, the cult of freedom, freedom as a happening and the philosophical modifi-cations of the basic lib...

  5. Kiberataki - ugroza realnaja ili virtualnaja? / Jevgenija Garanzha

    Index Scriptorium Estoniae

    Garanža, Jevgenija, 1979-

    2008-01-01

    Autor arutleb koos kaitseministeeriumi side- ja infotehnoloogia osakonna juhataja Mihkel Tammetiga, milline on küberrünnakutest tulenev reaalne ja virtuaalne oht. Vt. samas: Ajalehe märkus NATO juures tegutseva küberkaitse keskuse kohta; Mõistest "botnet"

  6. Absorption of Stationary Elastic Vibrations ili Rocks

    Directory of Open Access Journals (Sweden)

    e. v. Karus

    1958-06-01

    Full Text Available Il carattere di divergenze e d'assorbimentodelle onde sismiche è stato investigato medianteil metodo sismo-acustico basato sullemisurazioni di ampiezze e fasi delle oscillazioniquali sono eccitate nelle roccia da unasorgente d'oscillazioni armoniche stazionarie.I risultati d'investigazione sperimentalemediante il m. s.-a. d'assorbimento della rocciapermettono di differenziare le roccie diversesecondo i parametri d'assorbimento. L'assorbimentomassimo è proprio di roccia sedimentariail minimo di roccia d'eruzione edi roccia sottoposta a un metamorfismo.La proporzionalità inversa è stata osservatatra la velocità delle onde elastiche e ladiminuzione d'assorbimento per i tipi diversidi roccia. È dimostrato che il coefficiente d'assorbimentoè aumentato linearmente con lafrequenza. È osservato il fenomeno della dispersioneanomala della velocità di fase.I dati sperimentali ottenuti confermano leconclusioni della teoria basata sul fenomenod'elasticità in seguito a quella svolta daB. V. Derjagin.

  7. Made in Narva ili nashi v Seule

    Index Scriptorium Estoniae

    2008-01-01

    Hiigelsuure titaanskulptuuri "Post-Mapping" valmistamisest saksa firma Trinon Titanium Narva tehases ja selle paigaldamisest tehnoloogiainstituudi hoone fuajeesse Soulis. Skulptuuri autor on arhitekt Lawrence Wallen

  8. PC-3 Prostat Kanser Hücreleri Üzerinde İndosyanin Yeşili Kullanarak Yapılan Fotodinamik Terapinin AO/PI Boyama Testi Sonuçları

    Directory of Open Access Journals (Sweden)

    Mustafa Kemal RUHİ

    2017-06-01

    Full Text Available Fotodinamik terapi (FDT prostat kanseri tedavisinde henüz araştırma aşamasında olan sağaltıcı bir alternatiftir. FDT, ışığa duyarlı bir kimyasal maddenin (fotosensitizan ışık ile aktive edilmesi ve aktive olan kimyasalın kanserli bölgedeki hücre canlılığını baskılayıcı etkiye neden olması prensibine dayanmaktadır. Bu yeni tedavi yöntemi hem seçiciliği hem de yan etkilerinin azlığı nedeniyle alternatifler arasında ön plana çıkmaktadır. FDT’de kullanılan fotosensitizanın ışıksız ortamda sitotoksik olmaması ve vücuttan kolay atılabilmesi istenmektedir. Ayrıca herhangi bir fotosensitizanın yakın kızılaltı ışık ile aktive olması, bu dalgaboyunun deriye ve diğer dokulara daha fazla nüfuz etmesinden dolayı tercih sebebidir. Bu özelliklere sahip olan İndosiyanin Yeşili (ISY daha çok floresans özelliği ile ön plana çıkmış ve görüntüleme amaçlı olarak kullanılmıştır. Bu in vitro çalışmada ISY-FDT’nin farklı inkübasyon süreleri sonundaki etkisi AO/PI boyama yöntemi kullanarak ortaya konmuştur. Elde edilen sonuçlar ISY-FDT’nin hücre canlılığını baskıladığını göstermektedir.

  9. Samsun ili Terme ilçesinde çeltik üretiminde çalışan bir grup işçide Schistosoma haematobium taraması

    Directory of Open Access Journals (Sweden)

    Hafize Özdemir Alkanat

    2016-12-01

    Full Text Available Amaç: Kontamine sular ile deri teması tarım işçilerinin sağlığı açısından önemli bir risk faktörüdür. Ülkemizde çeltik üretiminde çalışan işçilerde kontamine su aracılığıyla bulaşan şistozomiyazis taraması konusunda çalışma bulunmamaktadır. Bu çalışma çeltik tarlasında çalışan işçilerde schistosoma haemotobium varlığını saptamak amacıyla yapıldı. Yöntem: Samsun ili Terme ilçesindeki dokuz köyde yapılan saha çalışmasında araştırmaya katılan bireylerden alınan idrar örneği mikroskop altında schistosoma haemotobium yumurtalarının varlığı yönünden tarandı. Bulgular: Çalışmaya katılan 84 gönüllü bireyde yapılan taramada schistosoma haemotobium yumurtalarına rastlanmadı. Sonuç: Günümüzde tarım teknolojilerinin gelişmesinin, işçilerin etkenle temas riskini önleyerek şistozomiyazis insidansını düşürdüğü düşünülmektedir.Anahtar Kelimeler: Schistosoma haematobium, iş sağlığı, tarım işçileri hastalıkları

  10. Stok yönetimi ve karlılık ilişkisinin finansal oranlar aracılığıyla incelenmesi : İMKB imalat sektöründe bir araştırma

    National Research Council Canada - National Science Library

    KİRACI, Murat

    2009-01-01

    ... ve bulundurulması, karlılığa olumlu bir katkı yapmaktadır. Araştırma stok yönetiminin işletmenin finansal başarısının göstergesi olan karlılıkla ilişkisini açıklamayı amaçlamaktadır. Çalışmada 2002-2006 dönemindeki İMKB imalat sektöründe yer alan...

  11. İlköğretim İngilizce dersi öğretim programlarının uygulanmasında karşılaşılan güçlüklerin belirlenmesi: Ankara ili örneği

    OpenAIRE

    ÖZEL, Rabia Tekin

    2011-01-01

    Bu araştırmanın amacı, İlköğretim İngilizce dersi öğretim programına yönelik öğretmen görüşlerini saptamak, programı uygulamada öğretmenlerin karşılaştıkları güçlükleri belirlemek, bu güçlüklerin nedenlerini ortaya koymak, bu güçlüklere yönelik çözüm önerileri geliştirmek ve İngilizce dersinin işlenişine ilişkin öğrenci görüşlerini tespit etmektir. Betimsel model niteliğinde olan araştırmanın evrenini, 2009-2010 eğitim-öğretim yılında Ankara ili merkez ilçelerindeki resmi ilkö...

  12. Yusuf Ziya Yörükan'ın Hayatı, Eserleri ve İslam Tarihçiliği Life, Works And Islamic Historiography of Yusuf Ziya Yörükan

    Directory of Open Access Journals (Sweden)

    Zekeriya AKMAN

    2013-03-01

    görevinin yanı sıra akademik çalışmalarına da devam etmiştir. Daha sonra Üniversitelerde çalışmaya başlayan Yusuf Ziya Yörükan, İstanbul ve Ankara Üniversitelerinde İslam Dini tarihi, Mezhepler tarihi ve Felsefe hocası olarak görev yapmıştır. Hayatını kaybetmiş olduğu 5. 6. 1954 tarihine kadar hocalık görevine, akademik ve ilmi çalışmalarına devam etmiştir. Yusuf Ziya Yörükan, İslam düşüncesinin birçok alanı ile ilgilenmiştir. Felsefe, Kelam, Türk tarihi, İslam tarihi, Dinler tarihi, Mezhepler tarihi ve Hadis gibi alanlarda çok sayıda çalışmalar yapmış ve bu ilim dallarına dair soru ve iddialara cevaplar vermiştir. Çok sayıda kitap ve makaleler yazmıştır. Özellikle Alevilik, Bektaşilik ve Türklerin eski inançları ile ilgili çalışmaları ön plana çıkmıştır. Yusuf Ziya Yörükan, branşı İslam tarihi olmayan bir akademisyendir. Bazen yazmış olduğu bir kitabın içerisinde İslami ilimlerin birçok alanı ile ilgili bilgilere yer vermiştir. İslam Dini Tarihi ve Peygamberimiz isimli kitaplarında Hz. Peygamberin hayatını anlatmıştır. İslam tarihçilerinden farklı bir tarzda konuları ele alarak değerlendirmiştir. Kitaplarında, İslam tarihinde meydana gelmiş olayları anlatırken, bunlarla bağlantılı olabilecek dini ve hukuki konulara da yer vermiştir. Öğretici bir tarzda yazmış olduğu eserleri, okullarda ders kitabı olarak okutulmuşlardır. Bu makalede onun Hz. Muhammed’in hayatını anlatan kitaplarını tanıtmaya ve İslam tarihçiliğini değerlendirmeye çalıştık.

  13. 5 February 2010: Romanian Former Minister of Justice V. Stoica (4th from left) visiting SM18 with, from left to right, University of Bucharest Faculty of Physics A. Costescu, DESY Hamburg C. Diaconu; Mrs Valeriu Stoica; Université de Montpellier II S. Ciulli; Technology Department Vacuum, Surfaces and Coatings group S. Ilie; Technology Department Head F. Bordry and Adviser for Russian Federation, Central and Eastern Europe T. Kurtyka.

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    5 February 2010: Romanian Former Minister of Justice V. Stoica (4th from left) visiting SM18 with, from left to right, University of Bucharest Faculty of Physics A. Costescu, DESY Hamburg C. Diaconu; Mrs Valeriu Stoica; Université de Montpellier II S. Ciulli; Technology Department Vacuum, Surfaces and Coatings group S. Ilie; Technology Department Head F. Bordry and Adviser for Russian Federation, Central and Eastern Europe T. Kurtyka.

  14. Koroner arter hastalığında aspirin direnci ile koroner arter hastalığı yaygınlığı ve tekrarlayan perkütan koroner girişimler arasındaki ilişki

    OpenAIRE

    Kahraman, Serkan

    2013-01-01

    Giriş: Vasküler yataklardaki akut iskemik sendromların primer nedeni olan aterotromboz tüm dünyadaki ölümlerin %35’inden fazlasını oluşturmakta olup trombotik komplikasyonlarla ilişkili aterotrombotik lezyon rüptürü ile karakterizedir. Aspirin aterotrombotik hastalıklardan ve komplikasyonlarından primer ve sekonder korunmada kullanılan etkili bir antitrombositer ilaçtır. Aspirin trombositlerdeki siklooksijenaz-1 (COX-1) enzimini serin rezidülerini asetilleyerek geridönüşümsüz olarak inhibe ed...

  15. Sağlık yüksekokulu öğrencilerinin evlilik dışı cinsel ilişki, istemli düşükler ve kontraseptif kullanımı konusundaki görüşleri

    Directory of Open Access Journals (Sweden)

    Burcu Tokuç

    2011-12-01

    Full Text Available Amaç: Bu çalışmanın amacı; sağlık yüksekokulu öğrencilerinin evlilik öncesi cinsel ilişki, istemli düşükler ve kontraseptif yöntem kullanımı konusunda görüşlerini belirlemek ve toplumsal değer yargılarını mesleki yaşantılarına yansıtmamaları konusunda farkındalık yaratmaktır. Yöntem: Kesitsel olarak planlanan araştırmaya, Mayıs-2008’de Trakya ve Namık Kemal Üniversitesi sağlık yüksek okullarında öğrenim gören toplam 338 ebelik ve hemşirelik öğrencisinin katılmıştır. Veriler araştırmacılar tarafından hazırlanan 25 maddelik bir soru formu ile toplanmıştır. Bulgular: Araştırmaya katılanların yaş ortalaması 20.9±1.6’dır ve %97’si kadındır. Öğrencilerin %66.9’u “evlenmeden önce cinsel ilişkiye girmek yanlıştır”; %63.6’sı “evlilik dışı ilişkiler bizim ahlaki ve kültürel değerlerimizi tahrip ediyor”; %52.1’i “istemli düşük ahlaksal olarak yanlıştır”; yalnızca %2.1’i ise “kontraseptif yöntemler ile ilgili bilgi yalnızca evli çiftlere verilmelidir” önermesine katıldıklarını belirtmişlerdir. Sonuç: Geleceğin sağlık çalışanları evlilik dışı cinsel ilişki, istemli düşükler ve kontraseptif kullanımı ile ilgili konularda toplumsal değer yargıları ve mesleki yaklaşımları arasında ikilem yaşamaktadırlar. Evlilik dışı cinsel ilişki ve istemli düşükler ahlaksal olarak yanlış bulunurken; planlanmamış bir gebelik durumunda istemli düşüğün kabul edilebileceğini ve evli olmayan genç kadınların istemli düşük hizmetlerinin, kürtajın fiziksel ve psikolojik sonuçlarını da kapsayacak şekilde verilmesi bu ikilemi açıkça göstermektedir. Sağlık alanında toplumsal değer yargılarının mesleki bağımsızlığı ve tıbbi etik yaklaşımları etkilemesi olasılığını en aza indirmek amacıyla müfredat gözden geçirilmelidir. Anahtar Kelimeler: Üreme sağlığı hizmetleri

  16. KLJUČNE DILEME PODJETNIKOV V PROCESU IZGRADNJE STARTUP-OV

    OpenAIRE

    Marič, Matej

    2013-01-01

    Podjetništvo je gonilna sila vsakega gospodarstva. Uspeti v današnjem času je izjemno težka naloga. Na začetku ustanavljanja podjetja je pomembno, da vemo, katere so najpomembnejše odločitve, ki jih bomo morali sprejeti. Pri tem moramo narediti čim manj napak. Zaradi pomembnosti teh odločitev za sam nadaljnji razvoj podjetja smo se odločili, da bomo proučili in predstavili dileme, ki se najpogosteje pojavljajo v začetkih ustanavljanju podjetij. V prvem delu diplomskega seminarja smo se os...

  17. Bir tıp fakültesi birinci sınıf öğrencilerinde toplumsal cinsiyet algı düzeyi ve ilişkili faktörlerin değerlendirilmesi

    OpenAIRE

    Varol, Zeynep Sedef; Çiçeklioğlu, Meltem; Taner, Şafak

    2016-01-01

    Amaç: Bu çalışmanın amacı bir tıp fakültesi birinci sınıf öğrencilerinin toplumsal cinsiyet algı düzeyi ve ilişkili faktörleri değerlendirmektir. Gereç ve Yöntem: Kesitsel araştırma şeklinde yürütülen çalışma Ege Üniversitesi Tıp Fakültesi 2013-2014 eğitim yılında birinci sınıfta okuyan 435 öğrenciden 352'sine (%81) ulaşılarak gerçekleştirilmiştir. Veri toplama aracı olarak 24 sorudan ve iki alt skaladan oluşan Cinsiyet Eşitliği Ölçeğinin (CEÖ) Türkçe versiyonu ve sosyo-demografik özell...

  18. Teatr v kino ili kino v teatre? / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2008-01-01

    Võimalusest jälgida Metropolitan Opera lavastusi kinolavalt Tallinna kobarkinos ja Tartu kinos Ekraan. The Metropolitan Operas 26. IX etendunud R. Straussi ooperist "Salome", lavastaja J. Flimm, dirigent P. Summers, peaosas K. Mattila.

  19. Benzin iz rapsa : utopija ili realnaja perspektiva? / Oleg Samorodni

    Index Scriptorium Estoniae

    Samorodni, Oleg, 1961-

    2006-01-01

    Suurärimees Rein Kilgi eesmärgiks on viia Lõuna Toiduainetööstus Lõuna-Eesti juhtivaks ettevõtteks, seepärast käib ka võitlus rapsitööstuse Werol Tehased ostmise ümber ärimeeste Oliver Kruuda ja Urmas Sõõrumaaga

  20. Psihushka, ili Poljot nad Berlinale? / Lauri Kärk

    Index Scriptorium Estoniae

    Kärk, Lauri, 1954-

    2007-01-01

    57. Berlinalelt avamise järel : Eldar Rjazanovi "Andersen. Elu ilma armastuseta", korealase Park Chan-wooki "Olen küborg, aga muidu OK", festivali avafilm - Olivier Dahani "La Mõme" prantsuse lauljast Edith Piafist. Rain Tolk esindab Eestit Euroopa noorte näitlejate tutvustuspromotsioonis Shooting Star

  1. Narnija, ili V platjanoi shkaf i obratno / Nikolai Karajev

    Index Scriptorium Estoniae

    Karajev, Nikolai, 1978-

    2005-01-01

    Ekraniseering C.S. Lewise 1950.a. ilmunud romaanist "Narnia lood : Lõvi, nõid ja riidekapp" ("Chronicles of Narnia : The Lion, the Witch and the Wardrobe") : režissöör Andrew Adamson : Ameerika Ühendriigid 2005

  2. Hedzh-fondõ : istotshnik riska ili likvidnosti / Fuad Rasulov

    Index Scriptorium Estoniae

    Rasulov, Fuad

    2007-01-01

    Järg 14. märts lk. 37. G7 riikide rahandusministrid tegid FSF-ile (Financial Stability Forum) ülesandeks teha ettekanne ohtudest, mis tulenevad hedge-fondidest, et selle põhjal võtta vastu fondide tegevust reguleerivate seadusandlike dokumentide pakett. Vt. samas: Mis on hedge-fond?

  3. Din-kimlik ilişkisi üzerine

    OpenAIRE

    Gürsoy, Şahin; ÇAPCIOĞLU, İhsan

    2009-01-01

    On the relationship between religion and identity. Religion interacts with society as well as affects it and it is also affected from society and social facts. Within this interaction, religion affects culture, arts, population, economy, politics, daily life and religious ceremonies and sparetime activities. As a result, religion contributes to shape the social identity. In addition to its influence on the shape of social identity, it has a significant role in protecting the national identity...

  4. Povorot ljubimoi mõsli, ili Zhenshtshina na trone

    Index Scriptorium Estoniae

    2003-01-01

    Moskva Noorsooteatri lavastused : A. Thehhovi "Ivanov ja teised", lavastaja H. Janovskaja ; show-paroodia "Good-bye, America!" S. Marshaki luuletuse "Mister Twister" ainetel, lavastaja H. Janovskaja ; K. Ginkase Tshehhovi tõlgendus "Must munk". Venemaa ajakirjanduse põhjal

  5. Zamok krassotõ ili tsarstvo duhha / Tamara Unanova

    Index Scriptorium Estoniae

    Unanova, Tamara

    2005-01-01

    14. veebr. andsid Maria Teatri balletisolistid Tallinna Linnahallis galakontserdi. Esinesid teatri solistid Natalja Sologub, Darja Pavlenkova, Igor Kolb, Anton Korsakov ja tõmbenumbrina reklaamitud Farukh Ruzimatov

  6. Portret : dotsh ili mat? / Valeria Bobõleva

    Index Scriptorium Estoniae

    Bobõljova, Valeria, 1945-

    2003-01-01

    Moskvas Pushkini-nimelises Kujutava Kunsti Muuseumis oleva Henry Francois Viollier (1750-1829) miniatuurmaalist tundmatu autori poolt maalitud koopia atributsioon. Autor jõuab järeldusele, et maalil on Natalja Ivanovna Gontsharova asemel kujutatud Euphrosine Ulrika von Liphart-Posset

  7. Glaz da glaz ili gaz da gaz? / Jevgenija Garanzha

    Index Scriptorium Estoniae

    Garanža, Jevgenija, 1979-

    2005-01-01

    Euroopa Liidu ja Venemaa tippkohtumisest Londonis, kõnealusteks teemadeks lihtsustatud viisarežiim, piirilepingud Eesti ja Lätiga, vähemusrahvuste olukord nendes riikides, põhiteemaks kujuneb Euroopa sõltuvus Venemaa gaasist ja naftast

  8. Bogi i monstrõ, ili biografija Supermena / Olga Marsheva

    Index Scriptorium Estoniae

    Marsheva, Olga

    2007-01-01

    Ameerika tuntuimad koomiksikunstnikud Larry Hama, Stan Lee, Jerry Seagel, Bob Kain, Frank Miller ja nende loodud tegelaskujud. Ka briti kirjanik Alan Moore, kellele ei meeldi oma kangelastest tehtud ekraniseeringuid vaadata

  9. Imperatritsa ili sovetskaja zhenshtshina? / Aleksandr Vassiljev ; interv. N. Rumjantseva

    Index Scriptorium Estoniae

    Vassiljev, Aleksandr

    2002-01-01

    Kunstnik ja moeajaloolane oma intervjuust kuulsa baleriini Maia Plissetskajaga (1925), mille ta tegi detsembris Monte-Carlos esilinastuva baleriini portreefilmi jaoks. Telekanali "Arte" filmi stsenarist on Kristian Lvovski ja stsenarist krahvinna Jelizaveta Kapnist

  10. Shagrenevaja kozha pjatogo elementa, ili Klassika kak zrelishtshe / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2001-01-01

    Klassikalavastused - Mati Undi "Graal" (lav. Peeter Jalakas), Mihhail Bulgakovi "Meister ja Margarita" (lav. Mati Unt), W. Shakespeare'i "Kuningas Lear" (lav. Priit Pedajas), Pedro Calderoni "Elu on unenägu" (lav. Ingo Normet)

  11. Roskosh ili sredstvo dlja võzhivanija / Andrei Sokolov

    Index Scriptorium Estoniae

    Sokolov, Andrei

    2004-01-01

    Maailmas kasutusel olevatele standarditele MRP II/ERP vastavad ettevõtte juhtimissüsteemid on jõudnud Eesti ettevõtete juhtide ja omanike huviorbiiti. Tabel: ERP-süsteemi maksumus sõltuvalt ettevõtte aastakäibele

  12. Svjaz : s obshtshestvennostju ili s korruptsijei? / Virkko Lepassalu

    Index Scriptorium Estoniae

    Lepassalu, Virkko, 1971-

    2008-01-01

    Randvere tee detailplaneeringu lugu ja selle võimalik seos Tallinna abilinnapea nõuniku Ivo Parbuse korruptsioonisüüdistusega. Piir korruptsiooni ja seadusliku tegevuse vahel võib olla eristamatu. Lisa: Spravka "DD"

  13. Semeinaja politika - realnost ili populism? / Kadi Pärnits

    Index Scriptorium Estoniae

    Pärnits, Kadi, 1965-

    2003-01-01

    Ilmunud ka: Virumaa Teataja 23. okt. lk. 7, Hiiu Leht 28. okt. lk. 2 "Kas perepoliitika on tugi peredele või parempopulism". Riigikogus toimuvast vanemahüvitise seaduseelnõu arutelust ja Mõõdukate seisukohtadest

  14. Liberalnõi imperializm, ili Missija Rossii v XXI veke

    Index Scriptorium Estoniae

    2003-01-01

    Venemaa valmistub parlamendi- ja presidendivalimisteks. Tuntud poliitik Anatoli Tshubais esines hiljuti Peterburis, põhiteemaks Venemaa ajalooline missioon XXI sajandil, poliitiline know-how - liberaalne imperialism

  15. Võsokaja moda : v muzei ili na prodazhu? / Marina Radina

    Index Scriptorium Estoniae

    Radina, Marina

    2006-01-01

    Kõrgmoenädalast kevad/suvi 2006 Pariisis. Tuntud disainerite ja moemajade Jean Paul Gaultier', John Galliano (Christian Diori moemaja), Chaneli, Valentino, Christian Lacroix', Elie Saab'i kollektsioonidest. Chaneli moemaja demonstratsioonil osales ka Carmen Kass

  16. Industrialnõi mir sadov : utopija ili realnost? / Jevgeni Kapov

    Index Scriptorium Estoniae

    Kapov, Jevgeni

    2002-01-01

    Kohtla-Järve põlevkivimuuseumis avatud näitusest "Aedade industriaalmaailm": organiseerisid Bauhaus Dessau (saksa arhitektuuri- ja disainikool) töötajad. Esitatud on tööstuskeskkonna ümberkujundamise projekte

  17. Romantitsheskaja utopia, ili Progulka s fotokameroi / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2007-01-01

    Fotonäitus "The Belarusian Identity cArt" Tallinna Kunstihoone galeriis. Eksponeeritud on Artur Klinovi (Klinau) fotoseeria "Minsk - unenägude päikeselinn", Igor Savtshenko fotoseeria "Kommenteeritav maastik" ja Andrei Liankevitshi fotod

  18. Millî eğitim bakanlığının 652 sayılı kanun hükmünde kararname ile yeniden yapılandırılmasına ilişkin Ankara ili kamu ilkokul ve ortaokul yöneticilerinin görüşleri [Views of the state primary school and secondary school principals in Ankara province about the restructure of Ministry of National Education (By decree law No. 652

    Directory of Open Access Journals (Sweden)

    İnci ÖZTÜRK

    2014-04-01

    Full Text Available Bu araştırmada, Ankara ili merkez ilçelerindeki kamu ilkokul ve ortaokul yöneticilerinin, 652 sayılı Kanun Hükmünde Kararname (KHK ile Millî Eğitim Bakanlığı’nın (MEB yeniden yapılandırılması hakkındaki görüşlerinin belirlenmesi amaçlanmıştır. Tarama modelindeki araştırma, nicel ve nitel yöntemlerin birlikte kullanıldığı “karma araştırma” deseni ile gerçekleştirilmiştir. Araştırmanın nicel boyutuna 276 okul yöneticisi dâhil edilmiş, nitel boyutunda 11 okul yöneticisiyle görüşme yapılmıştır. Araştırmanın nicel boyutunun sonuçlarına göre; 652 sayılı KHK’nın, MEB’in amaç ve politikalarına uygunluğu görüşü en yüksek İktisadî ve İdarî Bilimler Fakültesi- Hukuk Fakültesi mezunlarında gözlenmiş, bunu sırasıyla diğer fakülteler, Eğitim/Eğitim Bilimleri Fakültesi mezunları ve son olarak Fen- Edebiyat Fakültesi mezunlarının izlediği görülmüştür. İlkokul yöneticilerinin, ortaokul yöneticilerine göre 652 sayılı KHK’nın, MEB’in amaç ve politikalarını gerçekleştirme konusunda daha olumlu düşündükleri sonucuna varılmıştır. Araştırmanın nitel boyutu bulgularından; - hizmetlerin değerlendirilmesinde performans değerlendirmesine gidilmesinin, performans ölçütlerinin açık olması ve objektif değerlendirme yapılması koşuluyla uygun olduğu, KHK’nın öngördüğü yapılanma hakkında kamuoyunun yeterince bilgilendirilmediği, eğitim-öğretim hizmetlerinin üst yönetim ve denetim birimlerinde, alan dışından kamu görevlilerinin istihdam edilmemesi gerektiği sonuçlarına ulaşılmıştır.

  19. İlköğretim okulu yöneticilerinin aile memnuniyetini karşılama düzeyine ilişkin veli görüşleri [Views of parents related to elementary education school administrators’ level of ensuring family satisfaction

    Directory of Open Access Journals (Sweden)

    Mehmet ÖZBAŞ

    2014-04-01

    Full Text Available Bu araştırmanın amacı, ilköğretim okulu yöneticilerinin aile memnuniyetini hangi yönde karşıladığını ortaya çıkarmaktır. Araştırmanın evrenini 2012-2013 öğretim yılında, Ankara ili Çankaya ilçesi Ayten-Şaban Diri İlköğretim Okulu’nda çocukları öğrenim gören 782; örneklemini ise bu evrenden seçkisiz örnekleme tekniğiyle belirlenen 264 veli oluşturmaktadır. Araştırmada kullanılan “İlköğretim Aile Memnuniyet Ölçeği” araştırmacı tarafından geliştirilmiştir. Faktör analizleri sonucu ölçeğin 4 faktörlü; faktörlerce açıklanan toplam varyansın ise % 70.252 olduğu saptanmıştır. Faktörlere göre Cronbach Alfa güvenirlik katsayılarının ise .906 ile .931 arasında değişmektedir. Araştırma bulgularına göre, araştırma sosyal çevresinde, anne ve baba öğrenim düzeyinin oldukça yüksek; baba öğreniminin, anneden hem orta hem de yükseköğretimde daha fazla olduğu saptanmıştır. Araştırma sonuçları, aile memnuniyetinin; anne-baba öğrenim düzeyi; anne-baba mesleği ve gelirine doğrudan bağlı olduğunu göstermektedir. Özellikle ebeveynin yükseköğrenim görmüş olmasının aile memnuniyet düzeyinin artışında önemli fark yarattığı ortaya çıkmıştır. Araştırma sonuçları doğrultusunda, ilköğretimin aile memnuniyetini hangi yönde karşıladığının saptanması amacıyla Türkiye çapında “aile memnuniyet araştırmalarının” desteklenmesi gerektiği önerilmiştir.

  20. Kaynaştırma öğrencilerinin haklarına ilişkin sınıf öğretmenlerinin görüşleri [Opinions of primary school teachers on mainstreaming students’ rights

    Directory of Open Access Journals (Sweden)

    Funda NAYIR

    2014-10-01

    Full Text Available Bu çalışmanın amacı ilkokullarda görev yapan sınıf öğretmenlerinin, sınıflarındaki kaynaştırma öğrencilerinin yaşamsal, gelişimsel, korunma ve katılım haklarının kullanılmasında yaşanan sorunlara ve bu sorunların çözümüne ilişkin görüşlerini ortaya koymaktır. Araştırmanın çalışma grubunu 2012-2013 eğitim-öğretim yılında Ankara İli merkezindeki ilkokullarda görev yapan, sınıflarında kaynaştırma öğrencisi bulunan ve araştırmaya katılmaya gönüllü olan 58 sınıf öğretmeni oluşturmuştur. Çalışmada nitel araştırma yöntemlerinden biri olan “nicel içerik çözümlemesi” kullanılmıştır.. Çalışmada öğretmenlerin görüşleri araştırmacılar tarafından geliştirilen ve yarı yapılandırılmış açık uçlu sorulardan oluşan bir anket ile toplanmıştır. Araştırma sonucunda sınıflarında kaynaştırma öğrencisi olan öğretmenlerin bu öğrencilerin haklarını kullanmada sorunlar yaşandığını gözledikleri ortaya çıkmıştır. Bu sorunların çözümü için öncelikle öğretmenler, veliler ve diğer öğrenciler konu ile ilgili olarak bilgilendirilmelidir. Ayrıca özellikle sınıflarında kaynaştırma öğrencisi olan öğretmenlerin sınıf mevcutlarının azaltılması, bu sınıfların öğrencinin ihtiyacına göre düzenlenmesi ve gerekirse öğretmene yardımcı olması için bir özel eğitim öğretmenin görevlendirilmesinin sorunların çözümüne katkı sağlayacağı düşünülmektedir.

  1. Türkiye’de eğitimsel eşitsizlik ve toplumsal tabakalaşma ilişkisine dair ampirik bir çalışma [The relationship between educational inequality and social stratification in Turkey: An empirical study

    Directory of Open Access Journals (Sweden)

    Yalın KILIÇ

    2014-10-01

    Full Text Available Bu çalışmada, Türkiye’deki eğitimsel eşitsizliklerin toplumsal tabakalar açısından çözümlenmesi amaçlanmıştır. Araştırma TÜİK tarafından uygulanan 2006 yılı Hane Halkı Bütçe Anketi verilerine dayalı olarak planlanmıştır. Hane Halkı Bütçe Anketleri, hanelerin sosyo-ekonomik yapıları, yaşam düzeyleri, tüketim kalıpları hakkında bilgi veren ve toplumun gereksinimlerinin belirlenmesi, kullanılabilir gelirin haneler ya da bireyler arasında ne şekilde dağıldığının bilinmesi ve uygulanan sosyo-ekonomik politikaların geçerliğinin test edilmesi amacıyla kullanılan en önemli kaynaklardan biridir. Dolayısıyla bu çalışmada hane halkı bütçe anketinin verileri toplumsal tabakaların oluşturulmasında temel veri kaynağını oluşturmuştur. Çalışmada, yetişkin nüfusun eğitim düzeyinin cinsiyetle ve elde edilen gelirle ve eğitim çağındaki çocukların eğitim kademeleri itibariyle okullaşma oranlarının cinsiyetle ve hanedeki kişi başı düşen ortalama gelirle ilişkileri toplumsal tabakalar açısından incelenmektir. Bu hedef doğrultusunda öncelikle TÜİK tarafından uygulanan 2006 yılı Hane Halkı Bütçe Anketi verileri işlenmiş ve analiz edilmiştir. Çalışmada verilerin özelliklerine ve kurulan hipotezlere göre; Kay-kare, korelasyon ve varyans analizi yapılmıştır. Yapılan çözümlemeler sonucunda toplumsal tabakaların eğitimsel eşitsizliklerin önemli bir açıklayıcısı olduğu belirlenmiştir.

  2. Internationalization of the Syrian Civil War

    OpenAIRE

    Kovačić, Kristijan

    2016-01-01

    Autor u radu prikazuje studiju slučaju Sirijskog građanskog rata. Pritom postavlja tezu da Sirijski građanski rat ne predstavlja konvencionalni građanski rat, već internacionalizirani građanski rat, odnosno rat preko posrednika. Koristi se argument da je sirijski građanski rat internacionaliziran je iz dva temeljna razloga. Prvo, zbog uplitanja vanjskih sila u tijek građanskog rata, bilo izravnim vojnim sudjelovanjem ili sponzoriranjem skupina koje sudjeluju u ratu od strane drugih država. Dr...

  3. Adolescents exposure to domestic violence and identity development / Malose Silas, Makhubela

    OpenAIRE

    Makhubela, Malose Silas

    2010-01-01

    Aim: This study examined the difference in identity development between adolescents exposed to domestic violence and those in non-violent homes, gender differences, as well as the interaction between gender and exposure to domestic violence on identity development of adolescents. Method: Participants consisted of 45 male and 64 female students from the University of Limpopo, whose ages ranged from 15 to 20 years. Adolescents were classified into one of the two domestic viole...

  4. Rabotshaja sila, gossudarstvennõi sektor i programma promõshlennogo razvitija / Eteri Kekelidze

    Index Scriptorium Estoniae

    Kekelidze, Eteri, 1944-

    2007-01-01

    Tööandjate Keskliidu juhatuse esimehe Enn Veskimägi arvamusi tööjõust, riiklikust sektorist ja tööstuse arenguprogrammist. Tööandjate keskliidu pöördumisest vabariigi valitsuse poole, milles juhitakse tähelepanu riigi majanduse ees seisvatele probleemidele. Vt. samas: Eesti eksport 2005-2007 esimene pool

  5. Uvodnik

    Directory of Open Access Journals (Sweden)

    Meta Lah

    2009-12-01

    Full Text Available Po dvoletnem premoru in nekaj težavah, povezanih s financiranjem, je Vestnik za tuje jezike zdaj spet pred Vami; tokrat v nekoliko skromnejšem obsegu kot ponavadi. Z revijo imamo ambicioznejše načrte, ki jih bomo lahko uresničili le z avtorji kakovostnih prispevkov in ob podpori bralcev in naročnikov. Pred nekaj tedni sem ob pospravljanju polic v kabinetu naletela na izdajo Vestnika iz leta 1963. Prav ganljivo je bilo listati revijo, ki je izšla v letu, ko sem se rodila. Ciklostirana izdaja na skromnem papirju je že prinašala zanimive prispevke avtorjev, katerih večino poznam le po imenu, so pa bili med tistimi, ki so v slovenskem prostoru orali ledino na naših področjih. Zaradi njih in zaradi vseh ostalih, ki so vsa leta vztrajali, se mi zdi še toliko bolj potrebno, da revija obstane. Imen tistih, ki so v več kot štiridesetih letih izhajanja Vestnika pri njegovem nastajanju sodelovali, je veliko. Vsem njim gre velika zahvala. Posebej pa je treba omeniti mag. Nika Hudeljo, ki je v zadnjih letih vztrajno, natančno in potrpežljivo urejal revijo. S kolegom Gregorjem Perkom in člani uredniškega odbora upamo, da se čez leto dni spet beremo.

  6. Örgütsel sosyalleşmenin, örgütsel özdeşleşme ve örgütsel vatandaşlıkla ilişkisi: ilköğretim okulu yöneticileri üzerinde bir araştırma / The relationship of organizational socialization to organizational identification and organizational citizenship: A search on Turkish primary school administrators

    Directory of Open Access Journals (Sweden)

    Ali BALCI

    2012-12-01

    Full Text Available ÖZETBu çalışmada; örgütsel sosyalleşmenin, örgütsel özdeşleşme ve örgütsel vatandaşlık kavramları ile ilişkileri yanında örgütsel özdeşleşme ve örgütsel vatandaşlık değişkenlerinin örgütsel sosyalleşmeyi yordama düzeyi araştırılmıştır. Araştırma, “karma araştırma” türünde desenlenmiştir. Dolayısıyla araştırmada nicel ve nitel araştırma teknikleri bir arada kullanılmıştır. Araştırmanın nicel boyutunda ilköğretim okulu müdürlerinin örgütsel sosyalleşme, örgütsel özdeşleşme ve örgütsel vatandaşlık davranışı düzeylerini belirlemek üzere ilgili ölçekler uygulanmıştır. Araştırmanın nitel boyutunda ise ilköğretim okulu yöneticilerinin örgütsel sosyalleşme strateji ve taktiklerini belirlemek üzere nitel görüşme tekniği uygulanmıştır. Araştırmanın hedef evrenini, Ankara İli dokuz merkez ilçesinde görev yapan 580 ilköğretim okul müdürü oluşturmaktadır. Araştırmada evrenin tamamına ulaşılarak, “tam sayım” tekniği kullanılmıştır. Araştırma verilerini toplamak üzere gerekli izinler alınarak Örgütsel Sosyalleşme Ölçeği (Taormina, 2004 ve Örgütsel Özdeşleşme Ölçeği (Cheney, 1982; Demirel, Çakınberk & Derin, 2011 Türkçeye uyarlanmıştır. Örgütsel Vatandaşlık Ölçeği ise araştırmacılar tarafından geliştirilmiştir. Araştırmanın nicel boyutunda sözü edilen ölçeklerle toplanan verilerin analizinde, ilköğretim okulu müdürlerinin örgütsel sosyalleşme, örgütsel özdeşleşme ve örgütsel vatandaşlık düzeylerini saptamak üzere frekans, yüzde, aritmetik ortalama ve standart sapma betimsel istatistik teknikleri hesaplanmıştır. Örgütsel sosyalleşmenin örgütsel özdeşleşme ve örgütsel vatandaşlıkla ilişki düzeyini ve bu iki değişkenin (örgütsel özdeşleşme ve örgütsel vatandaşlık örgütsel sosyalleşmeyi yordama düzeyini saptamak üzere de çoklu do

  7. Health-promoting lifestyles and related factors among pregnant women/Gebelerde sağlıklı yaşam biçimi davranışları ve ilişkili faktörler

    Directory of Open Access Journals (Sweden)

    Güliz Onat

    2014-08-01

    açısından özellikle gebelik sürecinde oldukça önemlidir. Bu çalışmada gebe kadınlaın sağlıklı yaşam biçimi davranışları ve ilişkili faktörlerinin araştırılması amaçlanmıştır. Yöntem: Tanımlayıcı nitelikte olan bu çalışma, Uşak’ta 255 gebe kadın üzerinde gerçekleşmiştir. Çalışmada Sağlıklı Yaşam Biçimi Davranışları Ölçeği-II (SYBDÖ-II kullanılmıştır. İstatistiksel değerlendirmede sıklık ve yüzdelik dağılım, t test, Mann Whitney U test and ANOVA kullanılmıştır. Bulgular:Kadınların yaş ortalaması 26.7±5.1 ve gestasyonel yaşı 25.2±10.9 haftadır. Toplam SYBDÖ-II puanı 130.7.±20.0 idi. Ölçeğe ait en düşük puan “fiziksel aktivite” alt grubuna, (14.4±5.0 en yüksek puan ise “manevi gelişim” e aittir (26.1±4.2. Gebelik öncesi sigara içme sıklığı %16.9 iken, gebelikte bu oran %3.9’dur (ortalama 4 sigara/gün. Kadınların gebelikte beslenme alışkanlıkları iyileşmiştir; öte yandan halen sigara içen gebeler bulunmaktadır ve fiziksel aktivitelerindeki değişimler yetersizdir. Ayrıca kadınlar gebelik ve doğum hakkında bilgi alma gereksinimindedir. Sonuç: Gebe kadınlarda SYBDÖ-II puanı üst-orta seviyededir. Eğitim seviyesi düşük, işsiz ve gebeliğini sonlandırmak isteyen kadınların, sağlıksız davranışlar açısından risk grubunda olduğu belirlenmiştir. Bu bulgular, doğum öncesi kliniklerde çalışan sağlık personeline riskli grubu belirleme açısından ipuçları sunar. Sağlık bakımı sunanların, sağlıklı yaşam biçimi davranışları açısından belirlenen riskli grubu daha dikkatli değerlendirilmesi önerilmektedir.Anahtar Kelimeler: Sağlıklı Yaşam Biçimi Davranışları; gebe kadınlar; Sağlıklı Yaşam Biçimi Davranışları Ölçeği-II

  8. Remedies to Fraud in Documentary Letters of Credit: A Comparative Perspective / Opravné Opatrenia Pri Podvodoch S Dokumentárnymi Akreditívami: Komparatívna Perspektíva

    Directory of Open Access Journals (Sweden)

    Alavi Hamed

    2016-06-01

    Full Text Available Article 4 of the Unified Customs and Practices of Documentary Letters of Credit establishes the notion of autonomy principle by separating credit from underlying contract between account party and beneficiary. Article 5 by recognizing the autonomy principle confirms that effectuate the payment under credit, banks only deal with documents and not with goods. As a result, while documentary letters of credit are meant to facilitate the process of international trade, their sole dependency on compliance of presented documents to bank by beneficiary to actualize the payment will increase the risk of fraud and forgery in the course of their operation. Interestingly, UCP (currently UCP600 takes a silent status regarding the problem of fraud in international LC operation and leaves the ground open for national laws to provide remedies to affected parties by fraudulent beneficiary. National Laws have different approaches to the problem of fraud in general and fraud in international LC operation in particular which makes the access of affected parties to possible remedies complicated and difficult. Current paper tries to find answer to the questions of (i what available remedies are provided to affected parties in international LC fraud by different legal systems? (ii And what are conditions for benefiting from such remedies under different legal systems? In achieving its objective, paper will be divided in two main parts to study remedies provided by intentional legal frameworks as well as the ones offered by national laws. Part one will study the position of UCP and UNCITRAL Convention on Independent Guarantees and Standby Letters of Credit (UNCITRAL Convention and remedies, which they provide to LC fraud in international trade. Part two in contrary will study available remedies to LC fraud and condition for access them under English and American legal system.

  9. İlk ve ortaokul öğretmenlerinin etik duyarlılıklarının çeşitli değişkenler açısından incelenmesi (Sinop ili örneği [An Analysis of ethical sensitivity of primary and secondary schools in the relations with students based on some variables (Case of Sinop province

    Directory of Open Access Journals (Sweden)

    Ayşe OTTEKİN-DEMİRBOLAT

    2014-04-01

    Full Text Available Etik problemlerin anlaşılma ve çözümlenmesi sürecinde, öğretmenlerin etik duyarlık becerilerinin önemine olan inanç bu çalışmanın nedenini oluşturmaktadır. Çalışmanın amacı ilk ve orta öğretim kademelerinde görev alan öğretmenlerin etik duyarlılık düzeyini çeşitli değişkenler açısından incelemektir. Değişkenler öğretmenlerin kıdem, görev kademesi, cinsiyet, görev aldıkları eğitim kademesi, anne ve baba eğitim düzeyleri, üniversite öncesi yaşadıkları yerleşim merkezi ve en son mezun oldukları öğretim kurumudur. Araştırmanın evrenini Sinop il merkez ve ilçelerinin resmi ilk ve ortaokullarda görev yapmakta olan 1101 öğretmen oluşturmaktadır. Bu ilköğretim okullarında görevli olan ve basit seçkisiz örnekleme yöntemi ile seçilen 451 öğretmen araştırmanın örneklemini oluşturmaktadır. Araştırma sonucunda, öğretmenlerin etik duyarlılık düzeyleri yüksek bulunmuştur. En yüksek etik duyarlılık becerisi, “başka insanlarla ilişki kurmaya özen gösterme”, “eylem ve seçenek sonuçlarının belirlenmesi” boyutlarında bulunurken, en düşük etik duyarlık becerisi “sosyal önyargıları engelleme” boyutunda bulunmuştur. Ayrıca etik duyarlık becerisi ile ilgili bazı boyutlarda cinsiyet, branş, kıdem, baba eğitim düzeyi ve mezun olunan eğitim kurumu değişkenlerine göre bazı anlamlı farklılıklar saptanmıştır.

  10. Tarihi Yeniden Kurma Kuramı: Kılıç Dede Bağlamında Kılıçlar Köyünün Kuruluşu ve Kılıç Dede’nin Efsanevi Kişiliği Historic Restoration Theory: In the Context of Establisment of Kılıçlar Villages and Legendary Personality of Kılıç Dede

    Directory of Open Access Journals (Sweden)

    Gülperi MEZKİT

    2013-03-01

    onlarla mukayese edildiğinde dahaaz tesirli olaylar sözlü tarihin hafızaya dayalı belleğinde muhafazaedilmiştir. Yerel tarih bilgisinin büyük çoğunluğu yazıyageçmemiş/geçememiş ve halkın hafızasına emanet edilmiştir. Bubağlamda, Ankara Çubuk ovasında vuku bulan Ankara Savaşı(1402sırasında Çubuk’a bağlı olan(daha sonra ayrılıp Kazan ilçesinebağlanan Çelençler Köyü’nde(daha sonra adı Kılıçlar olarakdeğiştirilmiştir yaşanan, Yıldırım Bayezid’in esir edilmesinin, halküzerinde yarattığı derin teessürün etkisiyle gölgelenen bir hadiseninyöre halkı tarafından sözlü hafızada saklanarak ve dilden dileaktarılarak korunmuş hikâyesi üzerinde durulacaktır. YıldırımBayezid’in ordusunda yer alan ve şehit düşen Kılıç Dede’nin köykuruculuğu ve etrafında gelişen anlatmaların köyün tarihini yenidenkurmasındaki rolü tartışılacaktır. Gerçekten yaşayan sıradan biraskerin kahramanı olduğu hadisenin ve bu hadise içinde şehitdüşmesinin köylü üzerinde yarattığı etkiler neticesinde efsaneleşmesi,kişiliği etrafında oluşan anlatmalarla bir köyün tarihinin yeniden nasılinşa edildiği mütalaa edilecektir.

  11. Robinson Crusoe and Silas Marner, or Two Stories on the Gendered Monetary Economy ( A Background Reader for Economic Literacy).

    NARCIS (Netherlands)

    I.P. van Staveren (Irene)

    1998-01-01

    markdownabstract__Abstract__ This paper will discuss issues around money and capital from a broad perspecdve - recognising women's assigned role in the care economy. From this perspective, the question is how the different - and sometimes conflicting - roles in the market and the care

  12. Contemporary Drought and Future Effects of Climate Change on the Endangered Blunt-Nosed Leopard Lizard, Gambelia sila.

    Directory of Open Access Journals (Sweden)

    Michael F Westphal

    Full Text Available Extreme weather events can provide unique opportunities for testing models that predict the effect of climate change. Droughts of increasing severity have been predicted under numerous models, thus contemporary droughts may allow us to test these models prior to the onset of the more extreme effects predicted with a changing climate. In the third year of an ongoing severe drought, surveys failed to detect neonate endangered blunt-nosed leopard lizards in a subset of previously surveyed populations where we expected to see them. By conducting surveys at a large number of sites across the range of the species over a short time span, we were able to establish a strong positive correlation between winter precipitation and the presence of neonate leopard lizards over geographic space. Our results are consistent with those of numerous longitudinal studies and are in accordance with predictive climate change models. We suggest that scientists can take immediate advantage of droughts while they are still in progress to test patterns of occurrence in other drought-sensitive species and thus provide for more robust models of climate change effects on biodiversity.

  13. Kventin Tarantino + Robert Rodriges = Grainhaus, ili Kinonostalgija po-amerikanski / Andrei Sozinov

    Index Scriptorium Estoniae

    Sozinov, Andrei

    2007-01-01

    Filmiprojekt "Grindhouse" koosneb Robert Rodrigueze retroõudukast "Grindhouse : Õuduste planeet" ("Planet Terror") ja Quentin Tarantino 70-ndatest inspireeritud õudusfilmist "Surmakindel" ("Death Proof") : Ameerika Ühendriigid 2007

  14. Recollections of a translator (Russian title: Vstrecha v verhah ili vospominania perevodchika)

    Science.gov (United States)

    Gaina, Alex

    The article includes recollections of the author-translator from few meetings in Moscow during 70-th years of the XX-th century. The recollections includes a visit to Moscow of a Romanian delegation of trade-unions, a visit of Nicolae Ceausescu and Elena Ceausescu to Moscow in november 1977 in view of the 60-th years of the Revolution of October celebration. A visit by Nicu Ceausescu, physicist and the leader of the Union of Communist Youth of Romania, to Central Comitee of the All Union Communist Youth Organization of the USSR (Komsomol) in Moscow during a transit fly to Beijing (China) is reported also. The recollections reffers also the following persons: Andrey Gromyko- minister of the foreign office of the USSR, Geidar Aliev - 1-st secretary of the Central Commitee of the Azerbaijan S.S.R. Communist party, Grigor'ev- a secretary of the Soviet Komsomol (All Union Organization of Communist Youth) and other.

  15. Uroki mastera, ili Fantazii na temõ Andersena / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2007-01-01

    Eldar Rjazanovi eluloofilm muinasjutuvestja Hans Christian Anderseni elust "Andersen. Elu ilma armastuseta" ("Andersen. Zhizn bez ljubvi"): stsenarist Irakli Kvirikadze : nimiosas Vanja Haratjan, Stanislav Rjadinski, Sergei Migitsko : Venemaa, 2006

  16. Žalovanje ili melankolija?: psihoanaliza i ekonomski problem Derridina marksizma

    OpenAIRE

    Jukić, Tatjana

    2011-01-01

    Autorica predlaže kritičko čitanje studije Sablasti Marxa: stanje duga, rad žalovanja i nova Internacionala Jacquesa Derride s pozicije s koje Derridino dovođenje u vezu žalovanja i Marxove političke ekonomije evidentno računa na spregu žalovanja i ekonomije kod Freuda, posebno u “Trauer und Melancholie”. Kod Freuda se žalovanje i ekonomija sprežu tek nakon što se žalovanje stavi u relaciju prema melankoliji, pri čemu melankolija dovodi u pitanje upravo ono što psihoanaliza ...

  17. Sigara ve periodontal hastalık ilişkisi

    OpenAIRE

    Ayhan Alkan, Eylem; Dikilitaş, Ahu; Alkan, Özer; Parlar, Ateş

    2013-01-01

    Smoking is recognized as the most important cause of preventable death and disease. Cigarette smoking is a strong risk factor for oral mucosal lesions and periodontal disease. An association between periodontal disease and smoking has been found in many studies. The negative influence of smoking on the response to non surgical and surgical periodontal therapy has also been indicated in the literature. The aim of this review is to update the general knowledge about the effects of smoking on pe...

  18. T he pow er m ean of tw o positive num bers (not necessar-ily ...

    Indian Academy of Sciences (India)

    http://www.ias.ac.in/article/fulltext/reso/012/09/0076-0079. Keywords. Power mean; arithmetic mean; harmonic mean; root mean square; logarithmic mean; geometric mean. Author Affiliations. Soubhik Chakraborty1. Department of Statistics and Computer Applications T M Bhagalpur University Bhagalpur 812 007, India.

  19. İç kontrolde COSO ve ICFR ilişkisi

    OpenAIRE

    Karakoç, Mehtap; Özdemir, Serkan

    2016-01-01

    In this study, COSO which is one of the internal control models was explained thoroughly and the relationship between COSO and Internal Control over Financial Reporting (ICFR), which American Capital Market (SEC) asked from companies regularly through Sarbanes Oxley Act (SOA), was mentioned. Within this scope, information about the development that COSO has gone through since 1985 was provided. The contributions of COSO to internal control and the emerging developments were investigated. Taki...

  20. Zametjat li v Pekine estonskii flag ili jego otsutstvije? / Viktoria Savtshuk, Susanna Berezina

    Index Scriptorium Estoniae

    Savtshuk, Viktoria

    2008-01-01

    Euroopa Liidu infokeskuses toimunud debatist, kus teemaks oli Pekingi olümpiamängude võimalik boikoteerimine seoses hiljutiste sündmustega Tiibetis. Debatis osalesid Riigikogu Tiibeti toetusrühma liige Silver Meikar ja parlamendiliige ning Eesti Olümpiakomitee asepresident Jüri Tamm

  1. Jezik – dispozitiv ili generička bit čovjeka?

    Directory of Open Access Journals (Sweden)

    Marijan Krivak

    2016-12-01

    Full Text Available How to preserve the connection between language and thinking? The paper moves on from this fundamental question in order to explain what is happening with philosophy today, as a medium of such a relationship (Badiou. Furthermore, it tries to explain the connection between the concept of apparatus (Foucault-Agamben and language. The goal of media apparatuses is the neutralisation of language’s profane power as pure means. By robbing the language from human use and its character of disclosing the Being, capitalism controls social communication. The capital uses language as a means to disperse its own ideology and induce the so called “free-willing” obedience. The language, which should be a pure means by itself, exposes its own emptiness in the media sphere. The language – as something inherent to all human entities – should be freed from its communicational purpose. We don’t need “more communication.” What we need is creating – resistance against contemporeanity (Deleuze & Guattari. We should manage in this goal if we renew language as a GENERIC ESSENCE of a human being. Finally, coming to language is also a medium for coming-to-the-world (Sloterdijk.

  2. Planeta Zemlja - matritsa ili nash metafizitsheski dom? / Peeter Liiv ; tõlk. Marina Tervonen

    Index Scriptorium Estoniae

    Liiv, Peeter, 1953-

    2005-01-01

    Metafüüsika nõrkusest Eesti kultuuris. Kannatuse ja rõõmu religioonidest, valgustumisest, "Brahma ööst" ja "Brahma päevast", miks ja kuidas on Jumal maailma loonud. Osho, Ken Wilberi, Maharishi Mahesh Yogi jt. mõtteid

  3. Keban metamorfitlerinin stratigrafisine ilişkin yeni yaş bulguları

    Directory of Open Access Journals (Sweden)

    Ali KAYA

    2016-06-01

    Full Text Available Doğu Toroslar’da yer alan Keban Metamorfitleri, yeşilşist fasiyesinde bölgesel metamorfizmaya uğramış platform tipi karbonat ve kırıntılı kayaçlardan oluşur. Keban metamorfitlerinin yaşı, Zeryanderedeki tek bir lokasyonda gözlenen ve Permiyen yaşlı olduğu tahmin edilen, türleri saptanamamış mikroorganizmalara ait iki fosil (Glomospira ve Ammodiscus familyasına ait fosiller bulgusuna dayandırılmıştır. Metamorfik istifteki diğer formasyonlar da bu seviyeyle korele edilerek, Keban metamorfitleri için Permo-Triyas/Permo-Karbonifer yaşları önerilmiş ve şimdiye kadar kullanılmıştır. Bölgenin bütün jeolojik değerlendirmeleri de bu yaşlara göre yapılmıştır. İlk defa bu çalışmada, çok yaygın bir şekilde Planolites, Rhizocorallium ve Thalassinoides gibi iz fosiller gözlenmiştir. Bu iz fosiller, Keban metamorfitlerinin orta seviyelerini temsil eden Nimri formasyonuna ait Gogodere tabakalı dolomitik-kristalize kireçtaşı üyesinin tabaka üst yüzeylerinde tespit edilmiştir. Bu iz fosilleri içeren kireçtaşı seviyeleri, Toroslar’da Erken-Orta Triyas’ı (Skitiyen-Anisiyen temsil eden tipik “vermiküler kireçtaşı fasiyesi”ne karşılık gelmektedir. Allokton konumlu Keban metamorfitleri, birbirlerini üzerleyen birkaç naptan oluşmaktadır. Çalışma alanı içinde üç nap vardır; en alt napı Erken Triyas-Jura yaşlı Nimri formasyonu oluşturur, orta napı Orta-Geç Devoniyen yaşlı Keban mermerleri ile Geç Devoniyen yaşlı Delimehmet formasyonu ve en üstteki napı ise Erken Karbonifer yaşlı Süleymanlı formasyonu oluşturmaktadır. Ayrıca orta ve üst nap içinde yeşil renkli metadiyabazlardan oluşan Triyas öncesi yaşlı metabazik arakatkılar da gözlenmiştir. Bölgesel deneştirmeler Keban metamorfitlerinin Bolkardağı Birliği’nin eşdeğeri olabileceğini göstermektedir.

  4. Bartın ili carabidae (coleoptera) türleri

    OpenAIRE

    Kara, Sema

    2016-01-01

    2014-2016 yılları arasında gerçekleştirilen bu çalışma ile Bartın ilinde yayılış gösteren Carabidae familyasına ait türlerin belirlenmesi amaçlanmıştır. Arazi çalışmalarında çukur tuzak yöntemi kullanılmış serbest dolaşan türler ise elle toplanmıştır. Bartın ilinin her bir ilçesinde (Merkez, Amasra, Ulus, Kurucaşile) farklı habitatlar tercih edilerek, çukur tuzaklar kurulmuştur. Çukur tuzak yöntemine ek olarak kış döneminde de Carabidae faunasına ait veriler elde etmek için kışın böceklerin s...

  5. Nõmmeski rõnok : kafe ili võstavotshnõi zal? / Urmas Tooming

    Index Scriptorium Estoniae

    Tooming, Urmas

    2006-01-01

    Peatselt valmiv Nõmme keskuse detailplaneering näeb ette ajaloolise Nõmme turuhoone renoveerimist. Turuplats kaetakse sillutisega ja ehitatakse uued hooned. Kommenteerib planeeringut koostava AS Entec'i arhitekt Elo Talvoja

  6. Pipeline mapping and strain assessment using ILI (In-line Inspection) tolls

    Energy Technology Data Exchange (ETDEWEB)

    Purvis, Brian [GE PII Pipeline Solutions, Rio de Janeiro, RJ (Brazil); Huewener, Thomas [E.ON Ruhrgas AG, Essen (Germany)

    2009-07-01

    GE PII IMU Mapping inspection system measures pipeline location coordinates (x, y, z) and provides data for determining pipeline curvature and consequential pipeline bending strain. The changes in strain can be used in the application of structural analyses and integrity evaluation of pipeline systems. This paper reviews the Inertia Measuring Unit (IMU) system and field investigation works performed on a high-pressure gas pipeline for E.ON Ruhrgas AG. The Inertial Measuring Unit of the pipeline inspection tool provides continuous measurement of the pipeline centreline coordinates. More than one inspection run was performed which allowed a more accurate strain comparison to be made. Repeatability is important to establish the reasons for increasing strain values detected at specific pipeline sections through in-line inspection surveys conducted in regular intervals over many years. Moreover, the flexibility resulting from a combination of different sensor technologies, makes it possible to provide a more complete picture of the overall situation. This paper reviews the work involved in detecting, locating and determining the magnitude and type of strain corresponding to the pipeline movement in field. (author)

  7. Sustainable Agriculture Management : A study case in the Ili-Balkhash basin. Xinjiang, China

    OpenAIRE

    Jequier Quintas, Roberto

    2009-01-01

    Water is the source of life. Leonardo da Vinci, constructor of the drainage system of a swamp area north of Rome, said that “water is the blood of the soil”. Without water there is not fertile soil and without any of them there is no harvest. Sustainable Agriculture Management is all about how to develop and improve the use of different resources to make agriculture more sustainable. This study is about how to apply this concept into the study area. The Balkhash Lake is among the biggest lake...

  8. Vizantiiskoje zerkalo. Novõi rossiiski agitprop ili otsherednaja strashilka? / Pavel Kuzenkov ; interv. Sergei Bõtshkov

    Index Scriptorium Estoniae

    Kuzenkov, Pavel

    2008-01-01

    Isa Tihhoni autorlusena valminud Venemaa dokumentaalfilm "Impeeriumi hukk. Bütsantsi õppetunnid" ("Gibel imperii. Uroki Vizantii"). Filmi ideestikust, mis suunatud tänase Venemaa suunas, räägib filmi teaduslik konsultant

  9. Belaja koalitsija : vperjod, v XXI vek, ili nazad, v XX / Aleksandr Tshaplõgin

    Index Scriptorium Estoniae

    Tšaplõgin, Aleksandr, 1964-

    2007-01-01

    Reformierakond alustas koalitsiooniläbirääkimisi IRL-i, SDE ja EER-iga, keerulisim küsimus on tulumaksu edasine vähendamine. Autori hinnangul jääb tulumaksu alandamine valdavale osale elanikest märkamata. Jääb küsimus, kuidas maksude alandamisel suudab valitsus täita lubadusi suurendada kulutusi haridusele

  10. Beta talasemi mutasyonları ve beta globin gen ailesi haplotip ilişkileri

    OpenAIRE

    Bahadır, Anzel

    2009-01-01

    Bu tez, Pamukkale Üniversitesi Bilimsel Araştırma Projeleri Birimi tarafından 2008SBE001 proje numarası ile desteklenmiştir. Kalıtsal kan hastalıkları içerisinde yer alan talasemiler, hemoglobin molekülünün üretimi süresince, alfa (?) ve beta (ß) globin zincir sentezlerindeki düzenlenme dengesizliklerine dayalı, globin zincir sentez bozukluğudur. Beta talasemi mutasyonları molekülsel ve fenotipik açıdan büyük çeşitlilik göstermektedir. Denizli ülkemizde hemoglobinopati kontrol programı uyg...

  11. Letnii otpusk Barrossu, ili Uravnenije s 25 neizvestnõmi / Marko Saaret

    Index Scriptorium Estoniae

    Saaret, Marko

    2004-01-01

    Euroopa Komisjoni juht Jose Manuel Durao Barroso seisab raske valiku ees - kuidas jagada 25 portfelli 25 esitatud kandidaadi vahel. Liikmesriikide poolt Euroopa Komisjoni voliniku kohale esitatud kandidaadid

  12. A Comparison of Fossils of the Two Whale Fam ilies: Physeteridae and Monodentidae (Cetacea

    Directory of Open Access Journals (Sweden)

    Pankaj S. Bhatnagar

    2016-12-01

    Full Text Available Whales are a group of marine creatures that have elicited scientifi c and layman’s curiosity since long. The present paper has a focus on elucidating fossils of two Odontoceti families viz. Physeteridae and Monodentidae. Extant Physeteridae is a monotypic family, while Monodentidae is restricted geographically to cold waters of the Arctic and adjoining seas. Physeteridae fossil data showed a total of 28 species, while Monodentidae had only half a dozen species. Warming of the climate in the past appears to have played a role in northward migration of Monodentids.

  13. Potravinovou bilanci České republiky vylepšily exporty obilovin

    OpenAIRE

    Český statistický úřad

    2013-01-01

    Analýza zahraničního obchodu České republiky s potravinami. Dopady rekordních dovozů, především masa a masných výrobků, na domácí prvovýrobce (zemědělce) a zpracovatele (firmy v potravinářském průmyslu).

  14. Kak eto nam poljubitsa, ili Ljubov i nenavist Timofeja Sopoleva / Timofei Sopoljov ; interv. Boris Tuch

    Index Scriptorium Estoniae

    Sopoljov, Timofei

    2006-01-01

    William Shakespeare'i "Kuidas teile meeldib", lavastaja Timofei Sopoljov, muusika autor helilooja Aleksei Shelõgin. Lavastaja meenutab ka oma teatriõpinguid lavastaja ja teatripedagoogi Andrei Gontsharovi käe all

  15. Rar o koshmare ili intervju, kotorogo ne bõlo / Alexander Rahr ; interv. Jana Toom

    Index Scriptorium Estoniae

    Rahr, Alexander

    2008-01-01

    Tallinnas toimus 2007. a. aprillisündmustele pühendatud V Kodurahu foorum. Esinejate hulgas oli ka tuntud Saksa politoloog Alexander Rahr, kes Eestisse saabus loenguga teemal "Saksamaa-Venemaa: strateegilise partnerluse ülesehitamise kogemused". Lääneriigid on veendunud, et NATO ja Euroopa Liidu laienemine tugevdab ja konsolideerib demokraatlikku Euroopat, kuid Venemaad uude Euroopasse mitteintegreerides teeb Lääs strateegilise vea, mille eest tasumine jääb järgnevatele põlvedele. Kahjuks aitab eneseisolatsioonile kaasa ka Moskva tegevus. Euroopa ühise kodu idee, vanade ja uute Euroopa Liidu liikmete suhted Venemaaga, teemad, mis vajaksid kogu Euroopa koostööd

  16. TREBA LI U BIOETICI GOVORITI O ČOVJEKU ILI O OSOBI?

    OpenAIRE

    Koprek, Ivan

    1997-01-01

    Mnogi suvremeni bioetičari preuzimaju Lockeov pojam osobe za koji je bitna svijest vlastitoga identiteta. Pozivajući se na klasičnu filozofsku tradiciju, u prvome redu Aristotela, Tomu Akvinskoga i Kanta, autor kritizira ovakav stav i zagovara da se u etičkoj raspravi rabi pojam »čovjek«. Čovjek je sve do svojih vegetativnih mogućnosti čovjek. Argument mogućnosti (potencijalnosti) ne niječe da postoje po naravi različite razine. On nije univočan nego analogan. Stoga etika, ali i bioetika n...

  17. Effect of Salt Stress on Three Green Bean (Phaseolus vulgaris i>L.)> Cultivars

    OpenAIRE

    Anna ASSIMAKOPOULOU; Ioannis SALMAS; Kallimachos NIFAKOS; Panagiotis KALOGEROPOULOS

    2015-01-01

    Agriculture is increasingly forced to utilize marginal waters to meet its increasing demands, which in turn increases the risks of soil salinization and yield reduction in the arid and semi-arid areas of the Mediterranean basin. Given that the bean is an extremely salt sensitive species, the purpose of the present work was to study the effect of 0 and 75 mM sodium chloride (NaCl) on leaf characteristics, growth, pod yield and ion accumulation of three green bean (Phaseolus vulgaris L.) culti...

  18. Täyttökone- ja runkolinjapesujen optimointi sekä säiliöpesutaulujen suunnittelu

    OpenAIRE

    Välikangas, Roni

    2011-01-01

    Puhtaudesta huolehtiminen on olennainen asia elintarvikelaatuisia tuotteita valmistettaessa. Tässä opinnäytetyössä oli tarkoituksena optimoida alkoholituotteiden pullotuksessa käytettyjen täyttökoneiden pesuja sekä kehittää pesujärjestelmän toimintaa tehtaan valmistusosastolla. Täyttökoneiden ja runkolinjojen puhdistuksessa hyödynnettiin CIP –pesua. CIP (Cleaning In Place) tarkoittaa kiertopesutekniikkaa, jossa tuotantolaitteita ja linjoja pestään niitä avaamatta. Kiertopesussa putkistot...

  19. Endovascular Treatment of Isolated Bilateral Internal Ili- ac Artery Aneurysms with a Branched Endograft: A Case Report

    Directory of Open Access Journals (Sweden)

    SeyedEbrahim Kassaian

    2015-10-01

    Full Text Available Isolated bilateral internal iliac artery (IIA aneurysm is a rare and potentially lethal disease. Endovascular repair of this disorder is a matter of debate. A symptomatic 68-year-old male presented with severe pelvic pains. Computed tomography revealed a leaking 46-mm aneurysm in the right IIA, a 27-mm aneurysm in the left IIA, and ectatic changes at a diameter of 31 mm in the right common iliac artery (CIA. Due to lower rates of morbidity and mortality, an endovascular approach was chosen instead of open surgical repair. However, due to anatomical constraints, an endograft had to be implanted in a healthy aorta in order to support an iliac branch endograft in the left CIA. Subsequently, following coil embolization of the left IIA, an iliac stent graft was extended to the right external iliac artery (EIA. Two-year follow-up CT imaging showed complete exclusion of all the aneurysms and patency of the pelvic visceral arteries. The patient is currently asymptomatic.Endovascular repair of bilateral isolated IIAs can be a feasible treatment option. However, due to limited availability of sizes in iliac branch devices currently on the market, a main body device is sometimes required to be deployed in a healthy aorta for additional endograft support.

  20. Borsa İstanbul'da kısa ve uzun dönemli denge ilişkileri

    OpenAIRE

    Aras, Atilla

    2014-01-01

    It is aimed by this article to examine the short and long run equlibrium relations between Borsa İstanbul and some macroeconomic variables. The monthly BIST-100 Index is used to represent the stock market and (i) monthly weighted average interest rates for deposits, (ii) monthly money supply, (iii) monthly Dollar exchange rate, (iv) monthly Euro exchange rate, (v) monthly 1 ons gold London selling price, (vi) monthly interest rates on domestic borrowing, (vii) monthly SP-500 Stock Price Index...

  1. 5651 sayılı kanun ve bilgi güvenliği ilişkisi

    OpenAIRE

    Gök, Mehmet Salih

    2013-01-01

    73 page İnternet kullanım oranı tüm dünyada hızla artmaktadır. Bu nedenle günümüzde iletişimin hem sınırları genişlemiş, hem hızı artmış, hem de iletişim büyük oranda İnternet üzerine kaymış durumdadır. Bunun sonucunda, yeryüzünde her zaman olagelmiş olan, yöneticilerin kitleleri etkileme ve yönlendirme arzusu İnternetin dünya toplumları içinde elde etmiş olduğu konumu görmezden gelmemektedir. İnternet bugün dünyanın hemen her yerinde sansüre uğramaktadır. Ayrıca bazı ülkelerde sansürden i...

  2. Hemşire ve hekimlerin ötanaziye ilişkin görüşleri

    OpenAIRE

    Beder, Alper; Pınar, Gül; Aydoğmuş, Gamze; Can, Mahmure; Eren, Handan; İşler, Nihal; Yılmaz, Sevinç; Birli, Müberra

    2015-01-01

    Objective: The research was conducted to investigate the opinions of nurses and physicians pertaining to euthanasia who are working at Internal Medicine, Surgery and Intensive Care Unit departments at Baskent University Ankara hospital. Methods: The research is a descriptive one. The sample consisted of 154 nurses and physicians who are working at Internal Medicine, Surgery and Intensive Care Unit departments at Baskent University Ankara hospital and accepted to participate and could be re...

  3. Delo o 15 millionah dollarov, ili Istorija s kontrabandoi, krazhami, obmanom i podozrenijem v ubiistve / Tatjana Jurassova

    Index Scriptorium Estoniae

    Jurassova, Tatjana

    1998-01-01

    Nikolai Hardzhijevi (1903-1996) arhiivi saatusest. Arhiivi kunsti-osa moodustasid Malevitshi, Larionovi, Tatlini, Gontsharovi, Lissitski jt. (1355 eks.) tööd. N. Hardzhijev oli teadlane, vene avangardi (kunstnikud, poeedid) parim tundja

  4. Hipertiroidizm insulin rezistansına rağmen hipoleptinemi ile ilişkili olabilir

    OpenAIRE

    Arıkan Durmaz, Şenay; Atay, Çiğdem; Tuzcu, Alpaslan; Bahçeci, Mithat; Karaahmetoğlu, Selma; Gökalp, Deniz

    2015-01-01

    Aim: Influences of thyroid hormones on leptin levels are controversial. We aimed to evaluate serum leptin levels in women with hyperthyroidism before and after treatment.Material and Methods: Newly diagnosed 27 hyperthyroid women (age 35±10 years, body mass index (BMI) 26.21±5.44 kg/m²) and 30 healthy women were included the study. BMI, body fat mass (FM) and fat percent (F%) were determined. Standard oral glucose tolerance test (OGTT) was performed and area under the curve (AUCglu120) of glu...

  5. KuMu KUMUs, ili Tshto nas zhdjot v novom Dome iskusstva XXI veka? / Natalja Saveljeva-Sikkemäe

    Index Scriptorium Estoniae

    Saveljeva-Sikkemäe, Natalja

    2006-01-01

    Eesti Interpreetide Liidu etendustesarjast "KuMu KUMUs". 2. märtsil kontsert-etendus "Mäng" ansambel U: esituses (Taavi Kerkimäe ja Mart Kangro idee). 23. märtsil Jüri Reinvere multimeediaetendus "Taevas" Monika Mattiiseni ja Küberstuudio esituses, 6. aprillil esinevad Jaan Toomiku videote foonil Ursula Saal ja Anne-Liis Poll ning 11. mail toimub kontsert-installatsioon ReVISIOON ansambel Resonabilise osavõtul

  6. Leadership as social identity management: Introducing the Identity Leadership Inventory (ILI) to assess and validate a four-dimensional model

    OpenAIRE

    Steffens, Niklas K.; Haslam, S. Alexander; Reicher, Stephen D.; Platow, Michael J.; Fransen, Katrien; Yang, Jie; Ryan, Michelle K.; Jetten, Jolanda; Peters, Kim; Boen, Filip

    2014-01-01

    Although nearly two decades of research has provided support for the social identity approach to leadership, most previous work has focused on leaders’ identity prototypicality while neglecting the assessment of other equally important dimensions of social identity management. However, recent theoretical developments have argued that in order to mobilize and direct followers’ energies, leaders need not only to ‘be one of us’ (identity prototypicality), but also to ‘do it for us’ (identity adv...

  7. Taqiyya and the Fast of Ramadan: some Isma,ili Reflexions on the Esoteric Meaning of the Shari,a

    OpenAIRE

    De Smet, Daniel

    2013-01-01

    [fr] En cet article nous analysons les notions de taqiyya et kitmān telles qu’elles ont été élaborées par des auteurs ismaéliens des 10e et 11e siècles. Tout au long du présent « cycle d’occultation », la « science véritable » est voilée sous la lettre des textes révélés et des lois qui en découlent. Seuls les imāms et leurs disciples ont accès à cette science, mais ils n’ont pas le droit de la divulguer au tout venant. Cette obligation de garder le secret fait partie du sermon d’allégeance q...

  8. A Study to Develop a Case Mix Model for the Allocation of Impatient Workload for Silas B. Hays Army Community Hospital Fort Ord, California

    Science.gov (United States)

    1987-06-26

    CELLULITIS AGE 18-69 WIO C. C. 0.7582 453 HA 19 1.6 EXTRAOCULAR PROCEDURES EXCEPT ORBIT AGE 0-17 0.3657 453 HA 3 2.0 ACUTE MAJOR EYE INFECTIONS 0.6395 453 HA...0.5719 040 002 S EMX1A R PRM U EMT ORBIT AGE >17 0.4133 041 002 S ERA0WLAR PRL) E T CWU AGE 0-17 0.3657 042 002 S INWAOMAR PR IEES MT REINA, IRIS + zas... CELLULITIS AGE )69 AND/OR C. C. 0.8861 39 AA 8 3.5 POISONING AND TOXIC EFFECTS OF DRUGS AGE )69 AND/OR C. C. 0.6951 39 AA 1 5.0 MALIGNANT BREAST

  9. Detailed Requirements Analysis for a Management Information System for the Department of Family Practice and Community Medicine at Silas B. Hays Army Community Hospital, Fort Ord, California

    Science.gov (United States)

    1989-03-01

    eit_subit READ SET COI6VINM ON SET CONFIRM OFF STOR " ’ TO wait subit CASE selectnm - 3 * 23,0 SAY ’Proes any key to continue...’ GET * DO CAPR...CATEGORY RETURN 228 * Mort IUNU3S.PR0 * Program..1 4 .PR@ * Author... i JOAN ZIMMPh4AN a ELUERT SHAW * Date ..... : 02/16/59 * Notice...I Copyright (c... subit READ Program: SET CONFIRM ON PIUU.PRG * Author.: ELBERT T. SA" & JOAN ZIMISRMAN CASE aelectnum - 5 * Date... : 02/02/a9 * DO Update Leave and

  10. Meanings and function of mythical places in "new culture": A comparative analysis of biographies of Miroslav Ilić and Željko Joksimović

    Directory of Open Access Journals (Sweden)

    Stojanović Marko

    2006-01-01

    Full Text Available The paper analyses mythical places in careers of two singers of new folk music, who marked the time periods after Tito and Milošević. The analysis shows that the development and establishment of a certain value system in "newly created culture", could point out to important consequences to socio-cultural changes in periods after death (political or otherwise of "leaders". The establishment of newly created culture into local community was facilitated by mixing of very different value systems.

  11. Forenzične znanosti: 20 godina forenzične stomatologije na Sveučilištu u Zagrebu, 1994. – 2014.

    OpenAIRE

    Brkić, Hrvoje

    2014-01-01

    Podatci iz dostupne literature upućuju na rani početak forenzične stomatologije u Hrvatskoj, a vezuju se za vještačenje smrti pacijentice nakon intervencije stomatologa tridesetih godina prošlog stoljeća. Nakon toga, na teritoriju Hrvatske dogodilo se nekoliko masovnih stradavanja zbog sudara i pada zrakoplova te željezničke nesreće na glavnom kolodvoru u Zagrebu u kojima se identitet dokazivao na temelju zubnih obilježja. U većini navedenih stradavanja kao forenzičari sudjelovali su inozemni...

  12. Etičeskaja «dyra» v centre naučnoj paradigmy «publikujsja ili umri»

    Czech Academy of Sciences Publication Activity Database

    Kravjar, J.; Hladík, Marek

    2016-01-01

    Roč. 2016, č. 1 (2016), s. 29-31 ISSN 1994-2443 Institutional support: RVO:68081758 Keywords : academic publishing * publishing ethics * predatory publishing * scientists * publishers * open access * evaluation of science Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. Eğitim ve Gelir Dağılımı ilişkisi: Türkiye Değerlendirmesi

    OpenAIRE

    AKÇA, Yrd.Doç. Dr. Haşim; ELA, Arş.Gör.Mehmet

    2013-01-01

    Economic development and growing income is the main purpose of countries but on the other hand income distribution is an important component of economy too The case of income distribution has been keeping up to date but its significative components can change from country to country and so importance of each component is changing too Equality in income distribution is among main purposes of countries and decisive components of it must be specified particularly So permanent improvement ...

  14. Yeni bir TSH reseptör aktive edici mutasyon ile ilişkili ailevi hipertiroidi: Beş vaka takdimi

    NARCIS (Netherlands)

    K. Demir (Korcan); Tunç, S. (Selma); A.A.A. van Mullem (Alies); T.J. Visser (Theo)

    2015-01-01

    textabstractFamilial non-autoimmune hyperthyroidism, a rare disorder that results from activating germline mutations in the TSH receptor gene, is inherited in an autosomal dominant fashion and has a variable age at onset. Here, we present a family, five members of which were determined to have

  15. Türkiye’deki iç Denetim Profilinin Belirlenmesine ilişkin Bir Araştırma

    OpenAIRE

    MEMİŞ, Arş. Gör. Dr. Mehmet Ünsal

    2013-01-01

    In recent year internal auditing has been taken into account more importantantly because of some company failures and bankrupcies such as seen in giant firms Enron Worldcom and Parmalat Accordingly by the help of efficient working internal auditing system the flaws of the firms may be predetermined and necessary precuations may be held to prevent the failures Owing to the vital importance of internal auditing for the firms the internal auditing profile in Turkey has been evaluated Key...

  16. Elektromagnetni top - istraživački projekat ili uskoro u upotrebi? / Electromagnetic gun: Still just a research project or the reality of the operational use?

    Directory of Open Access Journals (Sweden)

    Selena P. Bakić

    2010-07-01

    Full Text Available Više od jednog veka istraživači u mnogim zemljama sveta bave se istraživanjem i razvojem elektromagnetnog (EM topa koji bi bio u mogućnosti da lansira projektil vrlo velikim brzinama. U publikovanoj stručnoj literaturi veći broj radova odnosi se na teorijska razmatranja pojedinih fenomena električnog pogona projektila i na hardverska rešenja električnih uređaja i komponenata, a manje su dostupni javnosti radovi koji se odnose na borbenu upotrebu, koncepciju rešenja i mogućnosti primene takvog oružja u borbenim sistemima vojske. U radu se ukazuje na osnovne probleme projektovanja takvog sistema naoružanja i saopštavaju se informacije na osnovu kojih se može proceniti da li će, kada i na kakvoj platformi EM top biti uveden u operativnu upotrebu. / For more than a century researchers in many countries have been engaged in research and development of electromagnetic (EM guns in order to launch projectiles with very high speed. In published sources many papers are related to theoretical considerations of certain phenomena of electrically driven projectiles and hardware solutions for electrical devices and components required for projectile launching. The works related to the philosophy of combat use, the concept of solutions and possibilities of application of such weapon systems are, however, less available to the public. The intention of the authors of this paper is to point out the basic problems of designing such weapon systems, and to give the readers the information on the basis of which they can assess whether it is possible, when and on what kind of platform for the EM gun to be approved for the operational use.

  17. Tko su za nas Turci / Osmanlije? Ili kako su predstavljeni u hrvatskim udžbenicima povijesti i sintezama / pregledima hrvatske povijesti

    Directory of Open Access Journals (Sweden)

    Damir Agičić

    2015-08-01

    Turcy osmańscy w późnym średniowieczu i wczesnej epoce nowożytnej mieli istotny wpływ na historię Europy, w tym także na historię Chorwacji. Zarówno w podręcznikach, jak w poddanych analizie syntezach historii Chorwacji widoczne są dwie przeciwstawne wizje stosunków turecko-chorwackich, jak zresztą i innych momentów narodowej historii: pierwsza, etnocentryczna, wyolbrzymia własną przeszłość i charakteryzuje się w wielu miejscach nietolerancją w stosunku do innych, szczególnie sąsiadów, druga natomiast jest bardziej nowoczesna, otwarta i wyważona. W artykule wymienione są przykłady, które wizje te potwierdzają.

  18. Gabriele d'Annunzio edebi kişiliği ve çağdaş İtalyan edebiyatındaki konumu

    OpenAIRE

    ÖZKAN PERETTİ, Nevin

    1996-01-01

      Gabriele d'Annunzio üzerine yapmış olduğum bu çalışma bana çok büyük deneyim kazandırdı. Çünkü olağan bir kütüphane araştırması yapmak yerine, yazarın yapıtlarının ve onun hakkında yazılmış olan yapıtların ana kaynağı kabul edilen, yazarın son dönemini geçirmiş olduğu ve bugün müze olan "II Vittoriale degli Italiani"de, doğrudan doğruya arşiv araştırması yapma imkanı bulabildim. Bu tez, böyle bir çalışma için aldığım burs ve arşivlere girmek için özel izin saye...

  19. Snježana Kordić, Riječi na granici punoznačnosti. Zagreb: Hrvatska vseučilišna naklada, 2002.

    Directory of Open Access Journals (Sweden)

    Marina Zorman

    2003-12-01

    Full Text Available Riječina granici punoznačnosti je habilitacijsko delo Snjefane Kordić, predavateljice slovanskega jezikoslovja v Münstru, ki se posveča raziskovanju sintakse sodobnega hrvaškega standardnega jezika, kakor imenuje jezik tistega dela nekdanje Jugoslavije, ki sloni na stokavškem narečju. Delo je obranila v začetku leta 2002, istega leta je v Zagrebu izslo v hrvaščini, ze leto prej pa pod naslovom Worter im Grenzbereich von Lexikon und Grammatik im Serbokroatischen tudi v nemskem prevo­ du pri založbi Lincom Europa v Münchnu.

  20. A Study to Determine the Ambulatory Quality Assurance Impact of a Computer-Stored Medical Records System Upon the Family Practice Clinic, Silas B. Hays Army Community Hospital, Fort Ord, California

    Science.gov (United States)

    1982-08-01

    PrescribedStandards E.g.: For prenatal care Deviation 1. Blood group & type? 2. Serology? 3. Counseling? 4. Diet ? Yes Deviation Initiate Correction during Current...include Aleut G 0 Baptist - Other Groups H 0 Brethren H 0 Aleut 1 0 Buddhism J 0 Christian Science 1 0 Cuban-American K 0 Church of Christ L 0 Church of...months if on insulin or hypoolycemics; every 6-12 months if diet controlled . Basic laboratory data: Renal function test, lytes, CBC, urine, urine

  1. Single-incision appendectomy is comparable to conventional laparoscopic appendectomy: a systematic review and pooled analysis.

    Science.gov (United States)

    Gill, Richdeep S; Shi, Xinzhe; Al-Adra, David P; Birch, Daniel W; Karmali, Shahzeer

    2012-08-01

    Acute appendicitis remains the common gastrointestinal emergency in adults. Single-incision laparoscopic appendectomy (SILA) has been proposed as the next evolution in minimally invasive surgery. SILA is postulated to reduce postoperative pain and enhance cosmesis, while effectively removing an inflamed appendix. However, the efficacy and benefits of SILA compared with conventional laparoscopic appendectomy (CLA) remain to be determined. Our objectives were to systematically review the literature comparing SILA with CLA for acute appendicitis and perform a pooled analysis on the efficacy of SILA. Published English-language manuscripts were considered for review inclusion. A comprehensive search of electronic databases (eg, MEDLINE, EMBASE, SCOPUS, BIOSIS Previews, and the Cochrane Library) using broad search terms was completed. All comparative studies were included if they incorporated adult patients undergoing appendectomy for acute appendicitis by SILA. The primary outcomes of interest were operative time and length of hospital stay. From a total of 366 articles, 34 articles were identified. A total of 9 comparative studies were included for pooled analysis. There was no significant difference in operative time, length of stay, pain scores, and conversion or complication rates between SILA and CLA for acute appendicitis. This systematic review and pooled analysis demonstrates that SILA is comparable to CLA for acute appendicitis in adults. However, this review identifies the need for randomized controlled trials to clarify the efficacy of SILA compared with CLA.

  2. Single-incision versus conventional laparoscopic appendectomy in 688 patients: a retrospective comparative analysis

    Science.gov (United States)

    Liang, Hung-Hua; Hung, Chin-Sheng; Wang, Weu; Tam, Ka-Wai; Chang, Chun-Chao; Liu, Hui-Hsiung; Yen, Ko-Li; Wei, Po-Li

    2014-01-01

    Background Laparoscopic surgery has become the standard for treating appendicitis. The cosmetic benefits of using single-incision laparoscopy are well known, but its duration, complications and time to recovery have not been well documented. We compared 2 laparoscopic approaches for treating appendicitis and evaluated postoperative pain, complications and time to full recovery. Methods We retrospectively reviewed the cases of consecutive patients with appendicitis and compared those who underwent conventional laparoscopic appendectomy (CLA) performed using 3 incisions and those who underwent single-incision laparoscopic appendectomy (SILA). During SILA, the single port was prepared to increase visibility of the operative site. Results Our analysis included 688 consecutive patients: 618 who underwent CLA and 70 who underwent SILA. Postsurgical complications occurred more frequently in the CLA than the SILA group (18.1% v. 7.1%, p = 0.018). Patients who underwent SILA returned to oral feeding sooner than those who underwent CLA (median 12 h v. 22 h, p factors. Direct comparison of only nonperforated cases, which was determined by pathological examination, revealed that SILA was significantly longer than CLA (60 min v. 50 min, p cosmetic advantages, SILA led to rapid recovery and no increase in postsurgical pain or complications. PMID:24869622

  3. Uporaba službenih psov za različne namene delovnih procesov

    OpenAIRE

    Rejc, Sara

    2017-01-01

    Pred vami se nahaja diplomsko delo z naslovom Uporaba službenih psov za različne namene delovnih procesov. Glavni namen in cilj diplomskega dela je proučiti in opisati uporabo službenega psa, predvsem v policiji, vojski in zaporih, kar predstavlja jedro tega diplomskega dela. Želeli smo prikazati vsestransko uporabnost psov v svetu ljudi. Ugotovili smo, da je enota reševalnih psov pomemben del ekipe pri iskanju pogrešanih in poškodovanih oseb. Na tem mestu je podrobneje opisano šolanje psa in...

  4. EPIDEMIOLOŠKE KARAKTERISTIKE NOVOROĐENČADI S RASCJEPOM USNE I/ILI NEPCA U OPĆOJ BOLNICI PULA U 10-GODIŠNJEM PERIODU (2003-2012)

    OpenAIRE

    Jašić, Mladen; Trifoni, Nastasja; Milevoj Ražem, Mirna; Zupičić, Branko; KALAGAC FABRIS, LADA

    2014-01-01

    Cleft lip and palate are common craniofacial anomalies, requiring complex multidisciplinary treatment and having lifelong implications on affected individuals. The etiology is multifactorial. In our study, we are present 18 neonates with cleft lip and/or palate born at General Hospital Pula in the ten-year period (January 2003 - December 2012). The overall incidence of cleft lip and/or palate was 1,25/1000. The diagnosis was made after birth in all cases. Ultrasound exams of heart...

  5. Dva nepoznata Marulićeva rukopisa u Velikoj Britaniji: MS. ADD. A. 25 u oxfordskoj Bodleiani i Hunter 334 u Sveučilišnoj knjižnici u Glasgowu

    OpenAIRE

    Novaković, Darko

    1997-01-01

    Kristeller’s monumental reference work records only one of Marulić’s manuscripts on the territory of Great Britain: The Life of St. Jerome (Vita diui Hieronymi) in the British Library (cf. P.O. Kristeller, Iter Italicum. Volume IV /Alia itinera II/: Great Britan to Spain, London & Leiden 1989 and Colloquia Maruliana III, 1994, pp. 6-66). However, the libraries on the Island hold two further manuscripts, each invaluable in its own way. The older of the two is Marulić’s autograph of the In ...

  6. Çukurova Üniversitesi Beden E?itimi ve Spor Yüksekokulu Özel Yetenek Synavyny Kazanan ö?rencilerin Genel Ba?arylary ile ÖSS puanlary arasynda ili?kinin incelenmesi

    OpenAIRE

    Dilek SEVİMLİ; DİNÇ, Zeynep Filiz

    2010-01-01

    Purpose: The main purpose of this study was to determine OSS scores and academic achievement among students succeed in Cukurova University Physical Education and Sports School special ability exam in 2008-2009 academic seasons. Method: The subjects were 140 successful students from 506 candidates in the exam. The average age of the subjects was 20, 42±2, 46 years (min: 17-max: 30). OSS scores of the students were obtained from OSYM center and academic achievement scores (GNO) were obtained...

  7. Medyada şiddetin dönüşümüne bilinçaltı etki yöntemleri ve mutlu şiddet ilişkisi

    OpenAIRE

    AYDEMIR, Mustafa

    2014-01-01

    Medya bir iletişim modeli olarak çeşitli rollere sahiptir. Kültürün hızla değişmesi şiddetin sunum biçimlerinin de değişmesine neden olmaktadır. Medyanın şiddete aracılık etmesi şiddeti toplum içinde daha fazla yasallaştırmaktadır. Bu konuda özellikle televizyon reklamlarında geniş çaplı bir inandırma eyleminin olduğu görülmektedir. Şiddetin mutlu bir nitelik yüklenerek aktarılması şiddet suçlarının önüne geçilmesine engel oluşturmaktadır. Çalışmada ulusal ve uluslararası medyada yayıncılık a...

  8. Yenilikçiliğe Yönelik Devlet Uygulamaları ve AB Karşılaştırması(Government Applications Towards Innovation and Comparison with European Union

    Directory of Open Access Journals (Sweden)

    Bernur AÇIKGÖZ ERSOY

    2008-01-01

    Full Text Available Innovation which includes all processes activating new or improved products, services, systems or programs is considered a fundamental component of entrepreneurship and business success. Innovation has been widely recognized as the key driver of economic growth and sustainable development. So, in many countries, firstly the developed ones, innovation became a focus element to governmental policies. Enabling the appropriate conditions needed for innovation In line of these policies became one of the most important missions of the governments. This paper aims to show the innovation profile of Turkey, basing on EU countries’ progresses and to bring up a road map to make a progress.

  9. Yapağı ağırlığı ile bazı azotlu kan bileşikleri arasındaki ilişkiler

    National Research Council Canada - National Science Library

    KARAALP, Musa; ÇİMEN, Murat

    2004-01-01

    ...). In this experiment, 7-8 months old Karayaka single male hoggets were used. The relationships between fleece weight and blood urea nitrogen , total protein, albumin, globulin, uric acid, keratin levels were investigated...

  10. Correlation between depression and eating attitudes and behaviors among those who performed regular physical activitiesDüzenli fiziksel aktivite yapan bireylerde depresyon ve yeme tutum ve davranışları ilişkisi

    OpenAIRE

    İrfan Yıldırım; Özkan Işık; Gözde Ersöz; Melek Büyükkök; Güler Zengin; Özge Özel

    2016-01-01

    The current study aimed at identifying correlational status between depression level and eating attitudes and behaviors among those who performed regular physical activities. The study designed in descriptive model was done with relational screening model. The sample of the study was composed of 294 individuals who performed regular physical activities at least three days a week in Afyonkarahisar Province. The data of the study were collected using a questionnaire consisted of Personal Inform...

  11. Bilişim teknolojileri öğretmen adaylarının teknoloji entegrasyonuna ve bu süreçteki rollerine ilişkin görüşlerinin incelenmesi

    OpenAIRE

    Demiraslan Çevik, Yasemin; Dağhan, Gökhan; Barın, Sibel; Savran, Rukiye

    2015-01-01

    Integrating technology into teaching-learning is a complex process including a number of elements such as teacher, student, school administration, infrastructure, and curriculum. Information and Communication Technology (ICT) teachers’ perceptions regarding the nature of integration process and their roles in this process are of great importance. This study examines how prospective ICT teachers perceive technology integration process and their roles and responsibilities in this process. The p...

  12. 教団法(戒律)と心掛け(戒) : 日本人の気づかなかった区別

    OpenAIRE

    小林, 信彦; Nobuhiko, Kobayashi; 桃山学院大学文学部

    2000-01-01

    In ancient India, the Buddhist samgha as a self-governing community maintained order by means of its own law called "vinaya." Violators were punished according to vinaya. On the other hand, all Buddhists, whether monks or laymen, were expected to follow particular customs called "sila." Unlike vinaya, this was not compulsory and did not carry penalties. In Japan far away from the original land of Buddhism, no one paid attention to the distinction between vinaya and sila, because temples were ...

  13. È realmente esistita una polemica tra Arcesilao e la scuola epicurea? A-t-il vraiment existé une polémique entre Arcésilas et l'école épicurienne ? Did really exist any controversy between Arcesilaus and the Epicurean school?

    Directory of Open Access Journals (Sweden)

    Aurora Corti

    2013-05-01

    Full Text Available The purpose of this work is to attempt a reconstruction of the debate that existed between the Epicurean school and the Sceptic Academy in the 3rd century BC. At issue is a consideration of a section of Plutarch’s Against Colotes (1121E-1122F, which is a particularly important witness in favor of the actual existence of such a debate. The paper focuses not so much on the questions relevant such a debate – which are touched on here, but which themselves have an ample bibliography – but rather on the properly historiographical aspects, such as the identification of the beginner of the polemic or the reasons that brought it about. In reply to these inquiries it is possible to show that the originality of Colotes’ thought deserves much more serious consideration, also because Colotes played an important role within Epicureanism precisely as the originator of anti-Sceptic polemic.L’objet de cette étude est de chercher à reconstruire le débat entre l’école épicurienne et l’Académie sceptique au IIIe siècle avant J.-C. On examinera une section de l’Adversus Colotem de Plutarque (1121E-1122F, qui se présente comme un témoignage particulièrement significatif en faveur de l’existence effective d’un tel débat. On se concentrera non pas tant sur les questions qui sont en jeu – questions auxquelles on fera quelques allusions, mais sur lesquelles il existe déjà une vaste littérature –, que sur des aspects proprement historiographiques : de l’identification du promoteur de cette polémique aux raisons qui l’ont fait naître. En répondant à ces questions, on sera en mesure de montrer que l’originalité de la pensée de Colotès mérite d’être mieux mise en valeur, car Colotès a joué un rôle particulier au sein de l’épicurisme comme initiateur de la polémique anti-sceptique.Lo scopo del presente lavoro è cercare di ricostruire il dibattito intercorso tra la scuola epicurea e l’Accademia scettica nel III secolo a.C. Si prenderà in esame una sezione dell’Adversus Colotem plutarcheo (1121E-1122F, che si presenta come una testimonianza particolarmente significativa a favore dell’effettiva esistenza di tale dibattito. Si concentrerà l’attenzione non tanto sulle questioni in gioco in tale dibattito – alle quali si faranno alcuni accenni, ma su cui esiste un’ampia letteratura – quanto piuttosto su aspetti propriamente storiografici: dall’individuare il promotore di tale polemica alle ragioni che la fecero nascere. Rispondendo a questi quesiti sarà possibile mostrare che l’originalità del pensiero di Colote merita di essere maggiormente valorizzata, anche perché Colote svolse all’interno dell’Epicureismo un ruolo importante proprio come iniziatore della polemica antiscettica.

  14. OTROCI KOT POTROŠNIKI

    OpenAIRE

    Prosen, Nina

    2010-01-01

    Diplomsko delo, ki je pred Vami, obravnava vprašanje, če so otroci, ko so postavljeni v vlogo potrošnika, resnično tako zavarovani, kot to določa Ustava Republike Slovenije v 56. členu. Otrokove želje in mnenja so postali pomemben dejavnik pri sooblikovanju potrošniških odločitev v družinah. Otroci postanejo potrošniki že v rosni mladosti. Zato je neprecenljivega pomena, kakšne vzgoje so otroci in mladostniki deležni v okviru družine in kasneje v šoli. Na otrokove želje vplivajo potrošniška s...

  15. An overview of shipwreck explorations in Goa waters

    Digital Repository Service at National Institute of Oceanography (India)

    Tripati, S.

    countries (Gune 1990:117-136). The depiction of a naval battle in the memorial stones (l2th-13th centuries) exhibited in the Archaeological Museum, Old Goa, reflect the maritime activity of this region (Rajagopalan 1987:35; Sila Tripati 2006... Aguada and also resemble the anchors kept in the Archaeological Museum at Old Goa and Goa State Museum, Panaji (Sila Tripati, et al. 2003a: 97-106). The exploration led to the recovery of eight elephant tusks (65 to 32 cm in length) only partially...

  16. Simulation of a semiarid stream flow using the 1D model (Rubarbe) : case of Ksob Wadi in Algeria

    OpenAIRE

    Hasbaia, M.; Adoui, H.; Paquier, A.

    2015-01-01

    This study aims to show the ability of 1D model to simulate the wadi flow during the flood. The wadi is a semiarid stream characterized by the non uniform geometry and an intermittent flow. These complexities can be modelled by a robust 1D model such as Rubarbe. In this article we study the 1994 flood of Ksob wadi that caused a large inundation of M’sila town in the center of Algeria. The simulated reach located downstream the Ksob dam, crosses M’sila over a length of 6800 m w...

  17. The association between benzodiazepines and influenza-like illness-related pneumonia and mortality: a survival analysis using UK Primary Care data.

    Science.gov (United States)

    Nakafero, Georgina; Sanders, Robert D; Nguyen-Van-Tam, Jonathan S; Myles, Puja R

    2016-11-01

    Bacterial superinfections, including pneumonia, are frequent complications of influenza-like illness (ILI). Clinical and laboratory evidence suggests that benzodiazepines and Z-drugs may influence susceptibility to infections and mortality. We investigated whether benzodiazepines and zopiclone modify the occurrence of ILI-related pneumonia and mortality. We obtained data on 804 051 ILI patients from a comprehensive primary care database, the Clinical Practice Research Datalink. The follow-up period started from the diagnosis of ILI for 30 days. Pneumonia and deaths occurring within the 30-day follow-up period were considered as potentially 'ILI related'. Exposure to benzodiazepines and zopiclone was determined in the period preceding a diagnosis of ILI with current use defined as a prescription for benzodiazepines in the month prior to ILI diagnosis. Cox regression was used for the analyses. Adjusted hazard ratios (HRs) with 95% confidence intervals (CIs) are presented. Influenza-like illness-related pneumonia and mortality were noted in 1117 and 707 ILI patients, respectively. Current exposure to benzodiazepines was associated with increased occurrence of both ILI-related pneumonia and mortality (ILI-related pneumonia adjusted HR 4.24, 95%CI [2.27, 7.95]; ILI-related mortality adjusted HR 20.69, 95%CI [15.54, 27.54]). A similar increase in ILI-related mortality but not pneumonia was observed with current zopiclone use (ILI-related mortality adjusted HR 10.86, 95%CI [6.93, 17.02]; ILI-related pneumonia adjusted HR 1.97, 95%CI [0.63, 6.12]). Benzodiazepines may increase the likelihood of pneumonia and mortality related to ILI. A cautionary approach to prescribing benzodiazepine is suggested in people known to be at increased risk of pneumonia or mortality. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  18. Programlamaya ilişkin Öz Yeterlilik Algısı Ölçeğinin Türkçe Formunun Güvenirlik ve Geçerlik Çalışması

    Directory of Open Access Journals (Sweden)

    Arif ALTUN

    2012-12-01

    Full Text Available The purpose of this study is to adapt “Computer Programming Self-Efficacy Scale”, developed by Ramalingam and Wiedenbeck (1998, to Turkish and to examine individuals’ programming self-efficacy scores across demographic variables. The study group is consisted of 152 undergraduate students from different academic departments who have taken at least one programming course earlier. The original scale was a 7-likert type with 32 items in 4 factors (independence and persistence, ability to perform simple programming tasks, ability to perform complex programming tasks, self-regulation. In the adapted version, the scale was finalized with 9 items in 2 factors (ability to perform simple programming tasks and ability to perform complex programming tasks in Turkish form. Cronbach alpha coefficient was found to be .928 and McDonald’s  (omega, which is proposed as being more appropriate for congeneric measurement, was found to be .956. As a result of explanatory factor analysis, two factors have explained 80,814 % of the variance together and this factor structure has been confirmed with confirmatory factor analysis, which showed a valid and reliable scale to measure programming self efficacy.

  19. Muhasebe Bürolarinda Bilgisayar Ve Internet Kullaniminin Faydalari Ile Işyeri Özellikleri Arasindaki Ilişkiler: Bir Alan Araştirmasi/The Relationships Between The Benefits Of Using Computer And Internet And The Accounting Office's Features: An Empirical S

    OpenAIRE

    HATUNOĞLU, Zeynep; İsmail BAKAN

    2014-01-01

    Özet Genel anlamda işletmeler bilgi teknolojilerini müşterilerine değer sunmak, mevcut müşterilerini muhafaza etmek ve yenilerini kazanmak için kullanırlar. Muhasebe bürolarının mükelleflerin beklentilerine cevap verebilmeleri, onlara değer katabilmeleri, bunu zamanlı ve en uygun maliyetle yapabilmeleri ve faaliyetlerini etkin olarak sürdürebilmeleri bilgi teknolojisi araçlarını etkin olarak kullanabilmelerine bağlıdır. Bu çalışmada muhasebe bürolarının özelliklerine bağlı olarak bilgisayar v...

  20. Türk Yazınından Seçili İki Romanda Göç ve Göçmen Olgusunun Paydaşlık Bağlamında Yansımaları

    Directory of Open Access Journals (Sweden)

    Birkan KARGI

    2017-09-01

    Full Text Available Nazan Bekiroğlu’nun 2012 yılında yayınlanan Nar Ağacı romanı ve Ali Arslan’ın 2003 yılında yayınlanan Ama Sevgi Kalmalı adlı romanda, anlatıcılar kendi köklerini ve kendilerinden önceki kuşakların göç yazgılarının izlerini sürerler. Bu yapıtlarda biri batıdan doğuya, diğeri ise doğudan batıya evlerinden ayrılarak göç etmek zorunda kalan protogonistlerin yaşam öyküleri ele alınmıştır. Nar Ağacı romanında protogonistin göç serüveni İran’ın Tebriz kentinden başlayıp Tiflis, Bakü, Batum ve Trabzon zincirinde gelişirken, Ama Sevgi Kalmalı adlı roman da protogonistin göç serüveni Hannover’in Linden bölgesinden Filistin’e oradan da Anadolu’ya, Egenin Seki köyüne kadar devam eder. Yapıtların arka dokusunu Rus işgali, Birinci Dünya Savaşı, Milli Mücadele ve sonrası oluşturur. Göç serüveninde, göçmenlerin kimlikleri bölünür, parçalanır ve kendilerini yeniden gerçekleştirmek zorunda hissederler. Bu bağlamda Hans’ın Sofiya’ya, Settarhan’ın Zehra’ya olan aşkları protogonistler için varoluşsal bir işlev görür. Aslında her iki yapıttaki protogonistlerin göç nedenlerini, kurulu düzene ‘karşı olma’ ve kendi farklılıklarını ortaya koyma üzerine kuruludur. Derrida’nın da vurguladığı gibi, kimlikler ancak kendi farklılıklarıyla var olabilir ve bir anlamda her kimlik ötekidir. Benzer şekilde Laclau’ya göre de tüm kimliklerin temelinde antagonizma ve dışlanma bulunur. Hans, savaş karşıtı duruşuyla Almanya’da ötekidir. Settarhan ise gelenek ve törelere karşı duruşuyla öteki olmak durumuna düşmüştür. Her ikisi de göç nedeniyle yeniden varlık sorunlarını biçimlendirmeye çalışırlar. Her iki yapıtta da göç, benzer nedenlere dayanmaktadır. Bu benzerlik, batı ve doğu dünyasının karşıtlığında ortaya çıkar. Avrupa’da Aydınlanma anlayışının gelişim sürecinde egemen olan modernite, bir yandan insanlara özgürlük sağlarken öte yandan insanın varlığını derin bir baskı altına almıştır. Adorno da, Batılı anlayışın, ahlâkî ve insanî sorumluluktan yoksun olduğunu vurgular. Hans da işte bu nedenden ötürü savaş karşıtı olarak göçe zorlanır. Öte yandan gelenek ve göreneklerin hâkim olduğu doğu dünyasında Settarhan öç ve intikam duygusuna direndiği için yollara düşer. Karşıtlıklar ‘ insanı her şey için ölçü alan’ hümanizmde birleşir.

  1. The relationship between self-efficacy level and gender perception of university students: Beyşehir example

    Üniversite öğrencilerinin öz- yeterlilik düzeyi ile toplumsal cinsiyet algısı ilişkisi: Beyşehir örneği

    OpenAIRE

    Funda Özpulat

    2016-01-01

    Aim: The present study was planned to determine the relationship between self-efficacy level and gender perception of university students. Methods: The sample of the study consists of students attending to the Beysehir Faculty of Tourism, Selcuk University. The study was conducted between 1 December-28 December 2015. A questionnaire developed by the researchers, the General Self-Efficacy Scale and the Gender Perception Scale were used for data collection. The resulting data were analyzed ...

  2. İlköğretim 4. sınıf öğrencilerinde beden eğitimi ve sporun bedensel/kinestetik zeka alanı üzerine etkisi: Denizli ili örneği

    OpenAIRE

    Erturan, Ayşe Gökçe

    2006-01-01

    Bu çalışmanın amacı, öğrenci, öğretmen ve velilerin algılarına göre, ilköğretim dördüncü sınıf düzeyinde Beden Eğitimi Derslerinin, öğrencilerin Bedensel/Kinestetik Zeka gelişimleri üzerinde bir etkisi olup olmadığını, cinsiyet ve spor yapma durumlarına göre incelemektir. Araştırmanın örneklemini, Denizli İli Merkez İlçe’de öğrenim görmekte olan ilköğretim dördüncü sınıf öğrencileri arasından rasgele tabakalama yöntemi ile seçilen 309 öğrenci (160 kız - 189 erkek), 309 öğrenci velisi ve 13 s...

  3. Investigation of the relationship between high school students’ academic procrastination behaviors and their use of social media

    Lise öğrencilerinin akademik erteleme davranışları ve sosyal medya kullanımları arasındaki ilişkilerin incelenmesi

    OpenAIRE

    Ercan Gürültü; Levent Deniz

    2017-01-01

    The main aim of this study is to investigate the relationship between high school students’ academic procrastination and their use of social media. The sample of this study consisted of 473 students From 6 different schools of Eyüp district in İstanbul in 2014-2015 academic year. To indentify students’ academic procrastination behaviors, ‘Academic Procrastination Scale’, developed by Çakıcı (2003), was applied. A twelve item questionnare, which was developed by researchers, was used in order ...

  4. Investigating graduate and non-graduate teachers’ views about educational research / Lisansüstü öğretim alan ve almayan öğretmenlerin eğitim araştırmalarına ilişkin görüşlerinin incelenmesi

    Directory of Open Access Journals (Sweden)

    Derya YILMAZ

    2013-04-01

    Full Text Available ABSTRACTThe purpose of this study is to explore views of teachers who have graduate degrees vs. those who do not, regarding educational research with respect to concepts, conductors, and the value of educational research, in addition to sources that teachers follow and how those sources contribute to their professional life, if at all. In this study, survey research design is utilized. Participants of the study were chosen by random sampling technique and include 61 teachers with graduate degrees and 67 teachers without graduate degrees. The study findings revealed that teachers’ views about educational research are generally positive. Graduate degree holders state that educational research is valuable for society, university faculty, teachers, school principals and Ministry of National Education, while teachers with non-graduate degrees point out its value for society and teachers. Graduate degree teachers mostly follow educational research from websites, academic journals, books and graduate courses while half of the teachers who do not have graduate degrees follow forums, such as websites. Teachers with graduate degrees assert that educational research contributes to their professional life in terms of classroom practices, as well as in individual and professional development. More than half of teachers who do not have a graduate education indicate that educational research studies contribute to professional knowledge and practice; one-forth of them think that educational research studies comprise studies that stay in theory without becoming actualized in practice.

  5. Manisa İli'nde özkıyım girişimlerine ilişkin özellikler: Beş yıllık verinin değerlendirilmesi/Retrospective evaluation of attempted suicides based on a register in the province of Manisa: Age and gender based variations of methods and reasons

    Directory of Open Access Journals (Sweden)

    Hatice Şimşek

    2014-04-01

    Full Text Available ÖzetAmaç: Manisa’da 2007-2011 yılları arasındaki özkıyım girişiminde bulunan olguların özelliklerinin cinsiyete göre incelenmesidir. Yöntem: Tanımlayıcı tipteki araştırma, Manisa Halk Sağlığı Müdürlüğü’nün intihar girişimleri kayıt formlarının incelemesiyle yapılmıştır.  Bulgular: Toplam 6827 olgunun 5311’i (%77.8 kadındır. Özkıyım girişiminde bulunan olguların %57.3’ü 15-24 yaş grubunda, %51.6’sı bekar, %62.2’si ilköğretim mezunudur. Olguların %95.8’inin özkıyım girişimi yöntemi zehirleyici maddedir. En yaygın özkıyım nedeni genel toplamda ve kadınlarda aile geçimsizliği-evlilik-çocuklarken, erkeklerde ruhsal hastalıktır. Özkıyım nedeni en sık, 15 yaş altında ve 15-24 yaş grubunda ebeveyn çatışmaları, 25-64 yaş grubunda aile geçimsizliği-evlilik-çocuklar, 65 yaş ve üzerinde ruhsal ve bedensel hastalıktır. Sonuç: Özkıyım girişiminde bulunan olguların çoğunluğu kadın, ergen/genç yaş grubu, ilköğretim mezunu olanlar, çalışmayanlardır. Başlıca özkıyım girişimi yöntemi ilaç ve zehirleyici madde kullanımıdır. Nedenler de yaş grubu ve cinsiyete göre değişmektedir.Anahtar Kelimeler: Özkıyım,  özkıyım girişimi, epidemiyoloji, risk etmeniAbstractObjective: The study determined, by gender and age group, the characteristics of individuals who had attempted suicide in Manisa between the years 2007-2011.Method: This was a descriptive study conducted by retrospective research of "suicide attempt entry forms". Results:A total of 6827 suicides were evaluated. 5311 (77.8% were women, 57.3% were aged 15-24 years, 51.6% were single, 62.2% had graduated from primary schools. In 95.8% of the suicides the method of suicide was self-poisoning with drugs. The most common reasons for the suicide attempts in total and among women were family problems, marriage and children; mental illness among men. The most frequent reasons for the suicide attempts among those who were 15-24 years of age were conflicts with parents; among the age group of 25-64 the reasons were family problems, marriage or children, and among those who were 65 years and over the reasons were mental or physical illnesses.Conclusion: The main determinants of suicide attempts were female gender, adolescents and/or young adults, primary school as an educational level, unemployed individuals. The most frequent suicide method was self-poisoning. Reasons of attempts displayed variation based on age group and gender.Key words:  suicide, suicide attempt, epidemiology, risk factor  

  6. Školní a mimoškolní četba žáků středního odborného učiliště a nástavbového studia

    OpenAIRE

    Andrlová, Lenka

    2007-01-01

    The diploma work addresses the topič of reading. By means of the qualitative research it analyzes reading of the pupils of the secondary professional school and secondary extension courses, i.e. young people 15-32 years old. Primarily, it deals with two topics: the process of reading (choice of the book, process of reading itself and subsiding of reading) and the reading evolution. Moreover, using individual interviews, it surveys other subtle aspects of reading and accompanying experience. F...

  7. Nacrt geneze pojma stila u starijoj teorijsko-umetničkoj misli ili, prilog oblikovanju povesnog prostora umetnosti / The Scheme of Genesis of the Concept of Style in Older Theoretical and Artistic Thought or Addition to the Forming of Historical Space of Art

    Directory of Open Access Journals (Sweden)

    Radovan Popović

    2012-12-01

    Full Text Available During the course of its historical-intellectual shaping, the style, gradually but obviously and positively shifting from one framework of onto-logical deliberation – within which it was being constituted on the margin of what Plato determined to be the essence of mind as the essence in mind or, in other words, idea – to another, assuming the form of probable knowledge or the knowledge of things presumed, being the ability of creative imagination which reveals but does not make evident (ars inveniendi, the importance of which is pointed out in man’s practical self-accomplishment as a community-being, which disposes not only of the truth of apodictic reasoning but also of convictions and truisms (loci communes which, transposed into the canons of rhetoric, represent since Hellenism and the period of Roman domination (Cicero, Seneca, etc. not only a stronghold of variability and expressive abundance of dialectical argumentation but also a generic basis which gives to understand originality and irreducibility to normativity (Quintillian as motivators of the overall progress of civilization. Having considered that, and also reaching anew for the sources of antiquity, the uomini universali from the period of European history which we traditionally name the Renaissance assuming to their spiritual sensibility founded upon the religious experience of Christian subjectivity the heritage of logical and axiological structure of hellenico-roman pattern of thinking, form a notion or at least an idea of style which is then, probably for the first time, beginning to be brought in relation to literature and pictorial art as their differentia specifica, in opposition to philosophy, theology and jurisprudence. Until the end of the eighteenth century however, the style remains more or less firmly attached to purely contemplative aesthetic deliberations which tend to draw from the inexhaustible wealth of concretizations of style in the artistic creation examples to illustrate their proposed theses. The consideration of style outside aesthetics as a philosophical discipline emerges about the mid-nineteenth century and especially at the end of the nineteenth and the beginning of the twentieth century when, in the works of theorists such as Heinrich Wölfflin and Max Dvořák, the style assumes its role of analytical and critical category on the one hand, and the frameworks in which art acquires its own worth and importance on the other.

  8. Isparta il merkezi lise öğrencilerinde olası internet bağımlılığı ile saldırganlık ve empati düzeyleri arasındaki ilişkinin incelenmesi

    National Research Council Canada - National Science Library

    Orhan Kocaman; Evrim Aktepe; Yonca Sönmez

    2017-01-01

    .... [...]detecting adolescents with possible internet addiction (PIA) and revealing the relationship between their internet use and their mental health is quite important for the development of preventive measures. Conclusion...

  9. 11. sınıf öğrencilerinin düşünme stilleri, öğrenme stratejileri ve düşünme stilleri ile öğrenme stratejileri arasındaki ilişki

    OpenAIRE

    Çelik, Diren

    2016-01-01

    Toplumların geleceği, düşünebilen, yaratıcı ve muhakeme gücü yüksek bireyler yetiştirilmesiyle yön bulacaktır. Değişime uğrayan yaşam koşulları eğitim sistemine farklı bir bakış açısı kazandırmıştır. Günümüzde eğitimin amacı sadece bilginin kazandırılması, bilginin sorgulanmadan kabul edilip, davranışların bu doğrultuda sergileyen bireylerin yetiştirilmesi olmaktan çıkmıştır. Bunun yerine edinilen bilgiyi özümseyen, kendi tarzına uygun bir şekilde biçimlendiren, bağımsız düşünme becerilerine ...

  10. Interstitial lung involvement in rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    David Vladimirovich Bestaev

    2014-01-01

    Full Text Available Rheumatoid arthritis (RA is a systemic autoimmune rheumatic disease of unknown etiology, characterized by chronic erosive arthritis and extraarticular manifestations. Pulmonary involvement is one of the common extraarticular manifestations of RA and may show itself as bronchial tree lesions, rheumatoid nodules, Caplan's syndrome, and lesions in the pleura or pulmonary interstitium (interstitial lung involvement (ILI. High-resolution computed tomography allows the diagnosis of ILI in RA in nearly 70% of cases although the incidence of ILI may be lower (4 to 30% depending on diagnostic methods and patient selection criteria. There are several histopathological types of ILI, the differential diagnosis of which can be troublesome. Usual interstitial pneumonia (UIP and nonspecific interstitial pneumonia are major types of RA-associated ILI. UIP-pattern ILI has a more severe course than ILI with other histological patterns. The clinical presentation of ILI may be complicated by the likely toxic effect of a number of disease-modifying antirheumatic drugs (DMARDs used to treat RA, such as methotrexate and leflunomide, and biological agents (BAs, tumor necrosis factor-α (TNF-α inhibitors. The pathogenesis of pulmonary involvement in RA and the role of synthetic DMARDs and BAs in the development of ILI call for further investigations.An extraarticular manifestation, such as ILI, affects the choice of treatment policy in patients with RA.The relevance of a study of ILI is beyond question. The paper discusses the state-of-the-art of investigations in this area.

  11. Emergency department and 'Google flu trends' data as syndromic surveillance indicators for seasonal influenza.

    Science.gov (United States)

    Thompson, L H; Malik, M T; Gumel, A; Strome, T; Mahmud, S M

    2014-11-01

    We evaluated syndromic indicators of influenza disease activity developed using emergency department (ED) data - total ED visits attributed to influenza-like illness (ILI) ('ED ILI volume') and percentage of visits attributed to ILI ('ED ILI percent') - and Google flu trends (GFT) data (ILI cases/100 000 physician visits). Congruity and correlation among these indicators and between these indicators and weekly count of laboratory-confirmed influenza in Manitoba was assessed graphically using linear regression models. Both ED and GFT data performed well as syndromic indicators of influenza activity, and were highly correlated with each other in real time. The strongest correlations between virological data and ED ILI volume and ED ILI percent, respectively, were 0·77 and 0·71. The strongest correlation of GFT was 0·74. Seasonal influenza activity may be effectively monitored using ED and GFT data.

  12. The formation of volatile N-nitrosamines in kikuYl grass silage

    African Journals Online (AJOL)

    Kikuyu grass (Pennisetum clandestinum) often contains-high levels of nitrate and other NPN compounds. During sila.ge fermentation it is likely that nitrosaminesire form-ed which a;'e well known c"rcinoiens. An investigaiion on kikuyu silage con' firmed the presence-of at least two nlito."rnines while similar analyses ...

  13. Linear, branched and network polysilanes with thienyl/furyl ...

    Indian Academy of Sciences (India)

    Linear, branched and network polysilanes with thienyl/furyl substituted sila-alkyl side chains and their applications for the synthesis of fluorescent silver ... By virtue of -delocalized silicon backbone and variable HOMO-LUMO band gap energies, these polymers are found to be promising candidates as reducing agents for ...

  14. Láska není antipolitická síla

    Czech Academy of Sciences Publication Activity Database

    Bierhanzl, Jan

    -, č. 10 (2017), s. 1-3 ISSN 1210-4361 Institutional support: RVO:67985955 Keywords : láska * politika * tělesnost * veřejný prostor * citové menšiny Subject RIV: AA - Philosophy ; Religion http://protestant.evangnet.cz/laska-neni-antipoliticka-sila

  15. Mapping Soil Erosion in a Quaternary Catchment in Eastern Cape ...

    African Journals Online (AJOL)

    Temp

    2017-04-06

    Apr 6, 2017 ... Mapping Soil Erosion in a Quaternary Catchment in Eastern Cape. Using Geographic Information System and Remote Sensing. Kwanele Phinziª ⃰, Njoya Silas Ngetarª. ªSchool of Agricultural, Earth and Environmental Sciences, Discipline of Geography, University of. KwaZulu-Natal, Durban, South Africa.

  16. Underwater cultural heritage (Guest editorial)

    Digital Repository Service at National Institute of Oceanography (India)

    Gaur, A.S.; Vora, K.H.

    and in Lakshadweep. Sila Tripati and others ( page 1238 ) throw light on the two shipwrecks discovered off Goa. Ship - wreck at Sunchi reef dating back to the 17th century, obviously belongs to the Por - tu guese period and the paper reports of i ron cannon...

  17. Maritime trade contacts of Odisha, east coast of India with the Roman world: An appraisal

    Digital Repository Service at National Institute of Oceanography (India)

    Tripati, S.; Patnaik, S.K.; Pradhan, G.C.

    in the hinterland. This paper details the excavationfindings such as amphorae, bullion, coins, lamps, pottery, glass 216 Sila Tripati et al. beads from port sites and trade centres of ancient Odisha and theircontacts with the Roman world. Attempts have also been...

  18. Recent advances and future technologies for baled silages

    Science.gov (United States)

    Although the concept of ensiling large-round or large-square bales dates back to the late 1970’s, there have been many refinements to both equipment and management since that time, resulting in much greater acceptance by small or mid-sized dairy or beef producers. There are several reasons this sila...

  19. Moodne aeg : Moeuudised

    Index Scriptorium Estoniae

    2000-01-01

    Moes on puhvseelik, mis moekriitik Amanda Harlech'i arvates teeb naise keha inetuks. Londonis elava prantslanna Emma Cassid'i cool'id ridikülid. Sian Evansi toidukäruga sõrmused. Graafik James Jarvise disainitud Briti firma Silas'i Evil Martini nimeline kummilelu ning tema sõber kummikass Bubba the Car.

  20. Megaliths off the coast of Tranquebar

    Digital Repository Service at National Institute of Oceanography (India)

    Tripati, S.

    stream_size 23 stream_content_type text/plain stream_name Man_Environ_18_147.pdf.txt stream_source_info Man_Environ_18_147.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 Email: sila@nio.org ...

  1. 102 Approche phytosociologique d'une zone steppique : El ...

    African Journals Online (AJOL)

    PR BOKO

    Q2) est élevé. La station de. M'Sila appartient à l'étage bioclimatique aride à hiver tempérée et la zone d'étude El Haourane se trouve dans une ambiance bioclimatique semi-aride frais [2]. Figure 1 : Localisation géographique du canton El ...

  2. 2018-02-25T06:34:07Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    article/81259 2018-02-25T06:34:07Z nhj:ART An HIV-1 infected patient with Neurofibromatosis type 1: A case report Isa, SE Silas, A Daniyam, C Iroezindu, M Agaba, A Agbaji, O Neurofibromatosis type 1, HIV Infection, cutaneous lesions, HAART ...

  3. Uncovering the Relationships Between Military Community Health and Affects Expressed in Social Media

    Energy Technology Data Exchange (ETDEWEB)

    Volkova, Svitlana; Charles-Smith, Lauren E.; Harrison, Joshua J.; Corley, Courtney D.

    2017-06-08

    Recent literature has explored social media's ability to enhance influenza surveillance with encouraging results. We present a novel analysis of the relationships between in influenza-like illnesses (ILI) clinical data and affects (i.e., emotions and sentiments) extracted from social media around military facilities. Our analyses examine (1) differences in affects expressed by military and control populations, (2) affect changes over time by users, (3) differences in affects expressed during high and low ILI seasons, and (4) correlations and cross-correlations between ILI clinical visits and affects from an unprecedented scale -- 171M geo-tagged tweets across 31 global geolocations. Key findings include: Military and control populations differ in the way they express affects in social media over space and time. Control populations express more positive and less negative sentiments and less sadness, fear, disgust, and anger emotions than military. However, affects expressed in social media by both populations within the same area correlate similarly with ILI visits to military health facilities. We have identified potential responsible co-factors leading to location variability, e.g., region or state locale, military service type and/or the ratio of military to civilian populations. For most locations, ILI proportions positively correlate with sadness and neutral sentiment, which are the affects most often expressed during high ILI season. The ILI proportions negatively correlate with fear, disgust, surprise, and positive sentiment. These results are similar to the low ILI season where anger, surprise, and positive sentiment are highest. Finally, cross-correlation analysis shows that most affects lead ILI clinical visits, i.e. are predictive of ILI data, with affect-ILI leading intervals dependent on geolocation and affect type. Overall, information gained in this study exemplifies a usage of social media data to understand the correlation between psychological

  4. Effect of influenza-like illness and other wintertime respiratory illnesses on worker productivity: The child and household influenza-illness and employee function (CHIEF) study.

    Science.gov (United States)

    Palmer, Liisa A; Rousculp, Matthew D; Johnston, Stephen S; Mahadevia, Parthiv J; Nichol, Kristin L

    2010-07-12

    Acute respiratory illnesses (ARI), comprising influenza-like illness (ILI) and other wintertime respiratory illnesses (ORI), impose substantial health and economic burdens on the United States. Little is known about the impact of ILI among household members (HHM), particularly children, on employees' productivity. To quantify the impact of employee and HHM-ILI and ARI on employee productivity, a prospective, observational cohort study was conducted among employees from three large US companies. Employees who had at least one child living at home (N=2013) completed a monthly survey during the 2007-2008 influenza season, reporting the number of days missed from work and hours of presenteeism due to: (1) personal ILI, (2) HHM-ILI, and (3) personal and HHM-ARI. Employee ILI ranged from 4.8% (April) to 13.5% (February). Employees reporting ILI reported more absences than employees not reporting ILI (72% vs 30%, respectively; Pemployees surveyed had at least one child with an ILI; these employees missed more days of work due to HHM illness than employees without an ARI-ill child (0.9 days vs 0.3 days, respectively; PEmployees with ILI were less productive, on average, for 4.8h each day that they worked while sick, 2.5h of which was attributable to ILI. HHM illnesses accounted for 17.7% (1389/7868 days) of employee absenteeism, over half of which was due to HHM-ARI. ILI causes a significant amount of employee absence. Household members, particularly children, comprise a sizable proportion of general illness and injury-related employee absences. Copyright 2010 Elsevier Ltd. All rights reserved.

  5. Influenza-Like-Illness and Clinically Diagnosed Flu: Disease Burden, Costs and Quality of Life for Patients Seeking Ambulatory Care or No Professional Care at All

    OpenAIRE

    Bilcke, Joke; Coenen, Samuel; Beutels, Philippe

    2014-01-01

    This is one of the first studies to (1) describe the out-of-hospital burden of influenza-like-illness (ILI) and clinically diagnosed flu, also for patients not seeking professional medical care, (2) assess influential background characteristics, and (3) formally compare the burden of ILI in patients with and without a clinical diagnosis of flu. A general population sample with recent ILI experience was recruited during the 2011-2012 influenza season in Belgium. Half of the 2250 respondents so...

  6. Modifikacija klizno-rotirajućeg režnja napravljenog 1950. godine

    OpenAIRE

    Knežević, Predrag; Vuletić, Marko; Blivajs, Igor; Dediol, Emil; Macan, Darko; Virag, Mišo

    2017-01-01

    Rane tehnike zatvaranja rascjepa usne uključuju linearnu ili druge oblike geometrijskih linija (trokutasta ili četvrtasta zatvaranja). Prekretnica u operaciji rascjepa usana počela je 1955. godine kada je, na Prvom međunarodnom kongresu za plastičnu kirurgiju u Stockholmu, dr. Millard predstavio svoju metodu – klizno-rotirajuću tehniku ili režanj. Danas tu tehniku diljem svijeta, s modifikacijama ili bez njih, primjenjuje više od 85 posto kirurga za rascjepe. predstavljamo pacijenta s po...

  7. Dicty_cDB: AHA647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sqwqsl*slpqtilfrslpssp*g*lifstwwyesrri*scrnrpr*ily rctrdiytl*r*gsqe--- ---cfvx**vg*yctfxrf...itr*cwwcw*xsyqsnfn*ngwyerqxxrfhhwxyq*tryh rsxyppsrxfrsthlhsitrftixxchfqglfq*ixsrqgcrfxifgskxsrfxwxrf

  8. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ily [imported] - ... Caulobacter crescentus ... Length = 100 ... Query: 213 RIKRFID...DNLCDPELSVGRVAGALGVSPRYVQMVFAGMATTPLAYIXXXXXXXXXXXXXX 272 ... RIKRFIDDNLCDPELSVGRVAGALGV...SPRYVQMVFAGMATTPLAYI ... Sbjct: 1 ... RIKRFIDDNLCDPELSVGRVAGALGVSPRYVQMVFAGMATTPLAYIRRKRLERAARALRE 60 ...

  9. Analyzing the relationship between social networking addiction, interaction anxiousness and levels of loneliness of pre-service teachers

    Öğretmen adaylarının sosyal ağ bağımlılığı, etkileşim kaygısı ve yalnızlık düzeyi arasındaki ilişkinin incelenmesi

    OpenAIRE

    Hasan Özgür

    2013-01-01

    In this research, it was aimed to analyze the social networking addiction of pre-service teachers in terms of various variables and evaluate the relationship between social networking addiction and loneliness and interaction anxiousness. The research was designed according to the relational screening model. The study sample included 349 pre-service teachers studying at Trakya University Faculty of Education in 2012-2013 academic year fall term. The data were obtained using Facebook Addiction ...

  10. School principals’ and teachers’ views on reasons for the decrease of success in Turkish university entrance exams (case of Malatya [Üniversiteye giriş sınavlarındaki başarının düşme nedenlerine yönelik yönetici ve öğretmen görüşleri (Malatya ili örneği

    Directory of Open Access Journals (Sweden)

    Yeliz TEMLİ-DURMUŞ

    2015-04-01

    Full Text Available High schools’ success in Malatya province decreased during 2011-2012 in the Turkish National University Entrance Exams. The mean of high schools’ success in Turkey was higher for different score types than Malatya. The reasons for the decrease in success in the University Entrance Exams were researched based on school principals’ and teachers’ evaluations. One Science High School, one Anatolian High School, four General High Schools and two Vocational High Schools constitute the sample. In total, six school principals and 47 teachers voluntarily participated in the study. Findings were constructed into three categories as ‘Factors affecting Turkey’, ‘Factors affecting Malatya’, and ‘Solution Proposals’. The first category is composed of five themes; the ‘Problems originating from elementary education’, ‘Reduced authority and loss of respect for teachers’, ‘Rapid and frequent changes in the educational system’, ‘The exams not being perceived as a process by students’, and ‘Technological developments and failure in time-management’. The second category focused on Malatya City, and has six themes; ‘Immigration’, ‘Gangs’, ‘Partisan attitudes’, ‘Overuse of official complaint / request line (Call 147’, ‘Insensitivity of parents’, and ‘Limitation in teacher qualifications’. The third and final category is Solution Proposals and is composed of four themes; ‘Family teaching’, ‘Provincial council meetings for teachers’, ‘Collaboration among institutions’, and ‘Raising student awareness of exams’. School Principals and teachers’ evaluations were parallel with each other; therefore, the two groups have been analyzed together.

  11. Age-related differences in the accuracy of web query-based predictions of influenza-like illness.

    Science.gov (United States)

    Domnich, Alexander; Panatto, Donatella; Signori, Alessio; Lai, Piero Luigi; Gasparini, Roberto; Amicizia, Daniela

    2015-01-01

    Web queries are now widely used for modeling, nowcasting and forecasting influenza-like illness (ILI). However, given that ILI attack rates vary significantly across ages, in terms of both magnitude and timing, little is known about whether the association between ILI morbidity and ILI-related queries is comparable across different age-groups. The present study aimed to investigate features of the association between ILI morbidity and ILI-related query volume from the perspective of age. Since Google Flu Trends is unavailable in Italy, Google Trends was used to identify entry terms that correlated highly with official ILI surveillance data. All-age and age-class-specific modeling was performed by means of linear models with generalized least-square estimation. Hold-out validation was used to quantify prediction accuracy. For purposes of comparison, predictions generated by exponential smoothing were computed. Five search terms showed high correlation coefficients of > .6. In comparison with exponential smoothing, the all-age query-based model correctly predicted the peak time and yielded a higher correlation coefficient with observed ILI morbidity (.978 vs. .929). However, query-based prediction of ILI morbidity was associated with a greater error. Age-class-specific query-based models varied significantly in terms of prediction accuracy. In the 0-4 and 25-44-year age-groups, these did well and outperformed exponential smoothing predictions; in the 15-24 and ≥ 65-year age-classes, however, the query-based models were inaccurate and highly overestimated peak height. In all but one age-class, peak timing predicted by the query-based models coincided with observed timing. The accuracy of web query-based models in predicting ILI morbidity rates could differ among ages. Greater age-specific detail may be useful in flu query-based studies in order to account for age-specific features of the epidemiology of ILI.

  12. Age-related differences in the accuracy of web query-based predictions of influenza-like illness.

    Directory of Open Access Journals (Sweden)

    Alexander Domnich

    Full Text Available Web queries are now widely used for modeling, nowcasting and forecasting influenza-like illness (ILI. However, given that ILI attack rates vary significantly across ages, in terms of both magnitude and timing, little is known about whether the association between ILI morbidity and ILI-related queries is comparable across different age-groups. The present study aimed to investigate features of the association between ILI morbidity and ILI-related query volume from the perspective of age.Since Google Flu Trends is unavailable in Italy, Google Trends was used to identify entry terms that correlated highly with official ILI surveillance data. All-age and age-class-specific modeling was performed by means of linear models with generalized least-square estimation. Hold-out validation was used to quantify prediction accuracy. For purposes of comparison, predictions generated by exponential smoothing were computed.Five search terms showed high correlation coefficients of > .6. In comparison with exponential smoothing, the all-age query-based model correctly predicted the peak time and yielded a higher correlation coefficient with observed ILI morbidity (.978 vs. .929. However, query-based prediction of ILI morbidity was associated with a greater error. Age-class-specific query-based models varied significantly in terms of prediction accuracy. In the 0-4 and 25-44-year age-groups, these did well and outperformed exponential smoothing predictions; in the 15-24 and ≥ 65-year age-classes, however, the query-based models were inaccurate and highly overestimated peak height. In all but one age-class, peak timing predicted by the query-based models coincided with observed timing.The accuracy of web query-based models in predicting ILI morbidity rates could differ among ages. Greater age-specific detail may be useful in flu query-based studies in order to account for age-specific features of the epidemiology of ILI.

  13. Comparing Observed with Predicted Weekly Influenza-Like Illness Rates during the Winter Holiday Break, United States, 2004-2013.

    Science.gov (United States)

    Gao, Hongjiang; Wong, Karen K; Zheteyeva, Yenlik; Shi, Jianrong; Uzicanin, Amra; Rainey, Jeanette J

    2015-01-01

    In the United States, influenza season typically begins in October or November, peaks in February, and tapers off in April. During the winter holiday break, from the end of December to the beginning of January, changes in social mixing patterns, healthcare-seeking behaviors, and surveillance reporting could affect influenza-like illness (ILI) rates. We compared predicted with observed weekly ILI to examine trends around the winter break period. We examined weekly rates of ILI by region in the United States from influenza season 2003-2004 to 2012-2013. We compared observed and predicted ILI rates from week 44 to week 8 of each influenza season using the auto-regressive integrated moving average (ARIMA) method. Of 1,530 region, week, and year combinations, 64 observed ILI rates were significantly higher than predicted by the model. Of these, 21 occurred during the typical winter holiday break period (weeks 51-52); 12 occurred during influenza season 2012-2013. There were 46 observed ILI rates that were significantly lower than predicted. Of these, 16 occurred after the typical holiday break during week 1, eight of which occurred during season 2012-2013. Of 90 (10 HHS regions x 9 seasons) predictions during the peak week, 78 predicted ILI rates were lower than observed. Out of 73 predictions for the post-peak week, 62 ILI rates were higher than observed. There were 53 out of 73 models that had lower peak and higher post-peak predicted ILI rates than were actually observed. While most regions had ILI rates higher than predicted during winter holiday break and lower than predicted after the break during the 2012-2013 season, overall there was not a consistent relationship between observed and predicted ILI around the winter holiday break during the other influenza seasons.

  14. Tetramethyl-1-silacycloprop-2-ene: its characterization and reactions

    Energy Technology Data Exchange (ETDEWEB)

    Cornett, B.J.

    1980-05-01

    The object of this research is to fully characterize and study some of the reactions of tetramethyl-1-silacycloprop-2-ene. The final characterization of this compound was accomplished by obtaining both Si29 and 13C nuclear magnetic resonance spectra. The reactions studied included those with fluorenone, acetone, styrene, phenylacetylene, acetonitrile, t-butylcyanide, methyl isocyanate, phenyl azide, and azobenzene. Product analyses suggest that aside from addition reactions tetramethylsilacyclopropene can react either via a radical chain polymerization or an anionic chain polymerization mechanism with the latter being the more prevalent. Other reactions studied included the photolysis of tetramethylsilacyclopropene and its reactions in the presence of Pd(PPh/sub 3/)/sub 2/Cl/sub 2/. An appendix includes a study of trimethylsilyl radical disproportionation in the liquid phase to a sila olefin. Trimethylsilyl radicals in solution undergo disproportionation as well as recombination in a 1:5 ratio. The sila olefin formed by disproportionation was trapped by alcohols.

  15. Progress in the medicinal chemistry of silicon: C/Si exchange and beyond.

    Science.gov (United States)

    Fujii, Shinya; Hashimoto, Yuichi

    2017-04-01

    Application of silyl functionalities is one of the most promising strategies among various 'elements chemistry' approaches for the development of novel and distinctive drug candidates. Replacement of one or more carbon atoms of various biologically active compounds with silicon (so-called sila-substitution) has been intensively studied for decades, and is often effective for alteration of activity profile and improvement of metabolic profile. In addition to simple C/Si exchange, several novel approaches for utilizing silicon in medicinal chemistry have been suggested in recent years, focusing on the intrinsic differences between silicon and carbon. Sila-substitution offers great potential for enlarging the chemical space of medicinal chemistry, and provides many options for structural development of drug candidates.

  16. Islamic Resurgence in Algeria: The Rise of the Islamic Salvation Front

    Science.gov (United States)

    1993-05-01

    Mascara 47 36 8 3 FIS Ouargla 21 4 17 FIJ Oran 26 24 1 1 FIB E1-Bayedh 22 2 14 6 PLY Ilizzi 6 6 FLN Arrerridj 34 15 17 1 1 FIS Boumerdes 38 36 2 PIS El-Tarf...505932 3.40 28 M’sila 38.2 604693 3.75 29 Mascara 38.4 566901 3.31 30 Ouargla 60.3 284454 3.68 31 Oran 86.5 932473 3.00 32 E1-Bayadh 40.8 153254 2.90 33...Boumerdes 650975 FIS 21 Skikda 622510 FIS 42 Tipaza 620151 FIS 28 M’sila 604693 FIS 14 Tiaret 575794 FIS 29 Mascara 566901 FIS 48 Relizane 544877 FIS 44 Ain

  17. La mirada transgenérica

    Directory of Open Access Journals (Sweden)

    Judith Halberstam

    2004-01-01

    Full Text Available This text studies the construction and development of the transgender look in contemporary queer cinema, specifically: The Crying Game (Neil Jordan, 1992, Boys don't Cry (Kimberly Peirce, 2000 and By Hook or by Crook (Harry Dodge and Silas Howard, 2001. The analysis examines carefully the constitution of a meaningful materiality of the body through the gaze and the dialogue-confrontation between the transgender look and mainstream cinema's gaze, in its capability to regulate pleasures and sexual identities.

  18. A traditional boats and navigational history of Odisha, East coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Tripati, S.

    . F. 1975. Arab Seafaring in the Indian Ocean in Ancient and Early Medieval Times. New York: Princeton University Press. Odisha State Museums Catalogue No. Ext.1, Ext. 25, Ext. 318, Ext. 319, Bhubaneswar. Jain, J. C. 1984. Life in Ancient India... Sudhanidhi of Kabisamrat Upendra Bhanja describes the different types of boats intended for pleasure and amusement trips (Tripathy 1986; Sila Tripati 2000). The Jayadev Museum, Bhubaneswar has a rich collection of palm leaf manuscripts in which four...

  19. Onshore and nearshore explorations along the Maharashtra Coast: With a view to locating ancient ports and submerged sites

    Digital Repository Service at National Institute of Oceanography (India)

    Tripati, S.; Gaur, A.S.

    and Nearshore Explorations along the Maharashtra Coast: with a View to Locating Ancient Ports and Submerged Sites Sila Tripati and A.S. Gaur Marine Archaeology Centre National Institute of Oceanography Dona Paula Goa 403 004 Abstract Coastal explorations... migrations by exploring and excavating defunct and submerged ports as well as sunken ships. A systematic attempt has been made by the National Institute of Oceanography (NIO) to explore and study the ancient ports and their locations all along the coast...

  20. Complex regional pain syndrome (CRPS) type I: historical perspective and critical issues

    OpenAIRE

    Iolascon, Giovanni; de Sire, Alessandro; Moretti, Antimo; Gimigliano, Francesca

    2015-01-01

    The history of algodystrophy is controversial and its denomination has changed significantly over time. Silas Weir Mitchell described several cases of causalgia due to gunshot wounds that occurred during the American Civil War, increasing knowledge about this clinical condition. A later key milestone in the history of CRPS is tied to the name of Paul Sudeck that, using X-ray examinations, described findings of bone atrophy following a traumatic event or infection of the upper limb. The most w...

  1. Collections Statistiques, n° 83 et 86

    OpenAIRE

    Bendjelid, Abed

    2013-01-01

    Dans la foulée, le n° 83 de cette série de l’exploitation du recensement de 1998 reprend les mêmes tableaux que ceux du n° 80, relatifs aux wilayas du Sud-Ouest (Naâma, El Bayadh, Béchar, Adrar et Tindouf), alors que le numéro 86 porte sur les wilayas de Saïda, Tiaret, Djelfa, M’sila et Biskra.

  2. Cutaneous leishmaniasis in Algeria: quadrennial assessment (2008-2011).

    Science.gov (United States)

    Benelmouffok, A B; Sellami, M; Boughoufalah, A

    2017-08-01

    To study the prevalence and epidemiological factors of cutaneous leishmaniasis in Algeria from 2008 through 2011. The endemic site of M'Sila is the most important in Algeria after the historic site of Biskra, but the disease has spread rapidly and created new and important sites of infection, including Batna, Bechar, El Oued and Ghardaïa. The increased number of cases and the spread of this zoonosis require increased surveillance of its evolution and the application of adequate control measures.

  3. Self-reported influenza-like illness and receipt of influenza antiviral drugs during the 2009 pandemic, United States, 2009-2010.

    Science.gov (United States)

    Biggerstaff, Matthew; Jhung, Michael; Kamimoto, Laurie; Balluz, Lina; Finelli, Lyn

    2012-10-01

    The purpose of our study was to more accurately characterize people reporting influenza-like illness (ILI) and evaluate trends in health care seeking and influenza diagnosis and treatment during the 2009 influenza pandemic. From September 2009 to March 2010, we ascertained ILI (fever with cough or sore throat), health care seeking, and clinical diagnosis and treatment of influenza with influenza antiviral drugs among adults in 51 jurisdictions, and ILI and health care seeking among children in 41 jurisdictions. Among 216,431 adults and 43,511 children, 8.1% and 28.4% reported ILI, respectively. ILI peaked during November interviews and was higher among young people and American Indian/Alaska Natives. Of those with ILI, 40% of adults and 56% of children reported seeking health care; 26% of adults who sought care reported receiving a diagnosis of influenza. Of adults reporting an influenza diagnosis, 36% were treated with influenza antiviral drugs; treatment was highest among adults aged 18 to 49 years. Analysis of ILI data from the Behavioral Risk Factor Surveillance System enabled a better understanding of the factors associated with self-reported ILI, health care seeking, and clinical influenza diagnosis and treatment, and will help inform year-to-year influenza trends.

  4. Kimi mantlipärija sai mõjukatele ametipostidele / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2010-01-01

    Põhja-Korea pealinnas toimunud Tööliste Partei kongressil määrati riigi liidri Kim Jong-ili noorim poeg Kim Jong-un kesksõjakomisjoni aseesimeheks ja keskkomitee liikmeks. Poliitbüroosse määrati alternatiivliikmena Kim Jong-ili õe abikaasa Chang Song-taek

  5. Influenza-Like Illness among University Students: Symptom Severity and Duration Due to Influenza Virus Infection Compared to Other Etiologies

    Science.gov (United States)

    Mullins, Jocelyn; Cook, Robert; Rinaldo, Charles; Yablonsky, Eric; Hess, Rachel; Piazza, Paolo

    2011-01-01

    Objective: University students with influenza-like illness (ILI) were assessed to determine whether symptom severity, duration, or missed days of school or work varied according to etiology. Participants: Sixty persons presenting to a university health clinic with ILI symptoms during 3 consecutive influenza seasons completed baseline survey and…

  6. Comparison of five influenza surveillance systems during the 2009 pandemic and their association with media attention.

    NARCIS (Netherlands)

    Lange, M.M.A. de; Meijer, A.; Friesema, I.H.M.; Donker, G.A.; Koppeschaar, C.E.; Hooiveld, M.; Ruigrok, N.; Hoek, W. van der

    2013-01-01

    Background: During the 2009 influenza pandemic period, routine surveillance of influenza-like-illness (ILI) was conducted in The Netherlands by a network of sentinel general practitioners (GPs). In addition during the pandemic period, four other ILI/influenza surveillance systems existed. For

  7. The Implementation of Web 2.0 Technology for Information Literacy Instruction in Thai University Libraries

    Science.gov (United States)

    Sawetrattanasatian, Oranuch

    2014-01-01

    Web 2.0 technology has drawn much attention recently as a fascinating tool for Information Literacy Instruction (ILI), especially in academic libraries. This research was aimed to investigate the implementation of Web 2.0 technology for ILI in Thai university libraries, in terms of information literacy skills being taught, types of Web 2.0…

  8. Awakening the Languages. Challenges of Enduring Language Programs: Field Reports from 15 Programs from Arizona, New Mexico and Oklahoma.

    Science.gov (United States)

    Linn, Mary S.; Naranjo, Tessie; Nicholas, Sheilah; Slaughter, Inee; Yamamoto, Akira; Zepeda, Ofelia

    The Indigenous Language Institute (ILI) collaborates with indigenous language communities to combat language decline. ILI facilitates community-based language programs, increases public awareness of language endangerment, and disseminates information on language preservation and successful language revitalization programs. In response to numerous…

  9. The Relationship Between Acute Malnutrition, Hygiene Practices, Water and Livestock, and Their Program Implications in Eastern Chad.

    Science.gov (United States)

    Marshak, Anastasia; Young, Helen; Bontrager, Elizabeth N; Boyd, Erin M

    2016-12-08

    The causes of acute malnutrition are complex and time and geography variant and need to be better understood in order to both design more effective nutrition programs and evaluate them. The findings reported here are part of an evaluation of a 4-year multisectoral nutrition program led by Concern Worldwide in the Sila Region of eastern Chad. To present evidence and learning about the relationships between acute malnutrition and potential drivers in Sila, Chad. Quantitative household-level data from a clustered randomized control trial were collected in November/December 2014. The survey was complemented with water quality testing and qualitative data collected in February and March 2013 and 2014. Households who reported not regularly cleaning the container used for transporting water for household consumption were almost twice as likely to have a malnourished child. Households living in villages with larger concentrations of cattle and having more livestock sharing the same water source as for human consumption were significantly more likely to have a malnourished child. However, cleaning the water container mediated the negative impact of living in a village with a large cattle concentration on wasting. These results demonstrate that hygiene practices and livestock water management are correlated with acute malnutrition in Sila, Chad. These findings provide a hypothesis for a possible pathogen driving acute malnutrition rates-Cryptosporidium-as part of a complex water chain, whereby the source of infection may be mitigated by hygiene behaviors with important implications for humanitarian programs. © The Author(s) 2016.

  10. The relation between 1 Thessalonians and 2 Thessalonians and the inauthenticity of 2 Thessalonians

    Directory of Open Access Journals (Sweden)

    Eduard Verhoef

    1997-01-01

    Full Text Available The relation between 1 Thessalonians and 2 Thessalonians is a disputed question. Many scholars argue that 2 Thessalonians is pseudepigraphic, written one or more decades after 1 Thessalonians.  Others defend the authenticity of 2 Thessalonians. Wanamaker argues in his recent commentary that 2 Thessalonians was written before 1 Thessalonians. In this way the problems raised by the complicated relation between the two letters would be solved. Wanamaker argues that Timothy on his visit to Thessalonica (1  Thes 3:1-5 brought the letter we call 2 Thessalonians. Lecompte argues that Silas wrote 1 Thessalonians and that Paul himself is the author of 2 Thessalonians, so he could correct the misunderstandings caused by Silas's writing. Or perhaps Silas did not exactly write what Paul had agreed with his co-workers. I will argue in this article that the arguments used by Wanamaker and Lecompte are invalid for grammatical reasons. The great resemblance between 1 Thessalonians and 2 Thessalonians in spite of these different opinions, is best explained if we see 2 Thessalonians as a pseudepigraphic epistle.

  11. Forecasting influenza-like illness dynamics for military populations using neural networks and social media.

    Directory of Open Access Journals (Sweden)

    Svitlana Volkova

    Full Text Available This work is the first to take advantage of recurrent neural networks to predict influenza-like illness (ILI dynamics from various linguistic signals extracted from social media data. Unlike other approaches that rely on timeseries analysis of historical ILI data and the state-of-the-art machine learning models, we build and evaluate the predictive power of neural network architectures based on Long Short Term Memory (LSTMs units capable of nowcasting (predicting in "real-time" and forecasting (predicting the future ILI dynamics in the 2011 - 2014 influenza seasons. To build our models we integrate information people post in social media e.g., topics, embeddings, word ngrams, stylistic patterns, and communication behavior using hashtags and mentions. We then quantitatively evaluate the predictive power of different social media signals and contrast the performance of the-state-of-the-art regression models with neural networks using a diverse set of evaluation metrics. Finally, we combine ILI and social media signals to build a joint neural network model for ILI dynamics prediction. Unlike the majority of the existing work, we specifically focus on developing models for local rather than national ILI surveillance, specifically for military rather than general populations in 26 U.S. and six international locations., and analyze how model performance depends on the amount of social media data available per location. Our approach demonstrates several advantages: (a Neural network architectures that rely on LSTM units trained on social media data yield the best performance compared to previously used regression models. (b Previously under-explored language and communication behavior features are more predictive of ILI dynamics than stylistic and topic signals expressed in social media. (c Neural network models learned exclusively from social media signals yield comparable or better performance to the models learned from ILI historical data, thus

  12. Forecasting influenza-like illness dynamics for military populations using neural networks and social media.

    Science.gov (United States)

    Volkova, Svitlana; Ayton, Ellyn; Porterfield, Katherine; Corley, Courtney D

    2017-01-01

    This work is the first to take advantage of recurrent neural networks to predict influenza-like illness (ILI) dynamics from various linguistic signals extracted from social media data. Unlike other approaches that rely on timeseries analysis of historical ILI data and the state-of-the-art machine learning models, we build and evaluate the predictive power of neural network architectures based on Long Short Term Memory (LSTMs) units capable of nowcasting (predicting in "real-time") and forecasting (predicting the future) ILI dynamics in the 2011 - 2014 influenza seasons. To build our models we integrate information people post in social media e.g., topics, embeddings, word ngrams, stylistic patterns, and communication behavior using hashtags and mentions. We then quantitatively evaluate the predictive power of different social media signals and contrast the performance of the-state-of-the-art regression models with neural networks using a diverse set of evaluation metrics. Finally, we combine ILI and social media signals to build a joint neural network model for ILI dynamics prediction. Unlike the majority of the existing work, we specifically focus on developing models for local rather than national ILI surveillance, specifically for military rather than general populations in 26 U.S. and six international locations., and analyze how model performance depends on the amount of social media data available per location. Our approach demonstrates several advantages: (a) Neural network architectures that rely on LSTM units trained on social media data yield the best performance compared to previously used regression models. (b) Previously under-explored language and communication behavior features are more predictive of ILI dynamics than stylistic and topic signals expressed in social media. (c) Neural network models learned exclusively from social media signals yield comparable or better performance to the models learned from ILI historical data, thus, signals from

  13. Association of indoor air pollution from coal combustion with influenza-like illness in housewives.

    Science.gov (United States)

    Wang, Bin; Liu, Yingying; Li, Zhenjiang; Li, Zhiwen

    2016-09-01

    An association of influenza-like illness (ILI) with outdoor air pollution has been reported. However, the effect of indoor air pollution on ILI was rarely investigated. We aimed to determine an association of indoor air pollution from coal combustion (IAPCC) and lifestyle with ILI risk in housewives, and the modification effect of phase II metabolic enzyme genes. We recruited 403 housewives for a cross-sectional study in Shanxi Province, China, including 135 with ILI frequency (≥1 time per year in the past ten years) as the case group and 268 with ILI frequency (<1 times per year) as the control group. Information on their energy usage characteristics and lifestyle was collected by questionnaires, as well as the single nucleotide polymorphisms (SNPs) of epoxide hydrolase 1 (rs1051740 and rs2234922), N-acetyltransferase 2 (rs1041983), and glutathione S-transferase (rs1695). We used exposure index to indicate the level of IAPCC among housewives. Our results revealed that the exposure index was positively correlated with ILI frequency. A significant dose-response trend between the exposure index and ILI risk was found with or without adjusting for confounders. Cooking frequency in kitchen with coal as primary fuel and ventilation frequency in the living room or bedroom with a coal-fueled stove for heating during the heating season were two important risk factors to affect ILI frequency. Only rs1051740 was found to be associated with exposure index, whereas it didn't have interaction effect with exposure index on ILI frequency. In conclusion, IAPCC and SNPs of rs1051740 were both associated with ILI frequency. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. Još o romaničkoj skulpturi s dubrovačke katedrale

    Directory of Open Access Journals (Sweden)

    Igor Fisković

    2015-12-01

    i sina uz pretpostavku da je Bolnardus bio nositelj, a Eustasius sljedbenik stila francuskih karakteristika fiksiranih u Palestini. Također se predlaže kronološka retrospektiva: 1187. pad Jeruzalema i povlačenje zapadnjačkih kipara s križarima, oko 1190. izvedba portala u Traniu kao njihovoj stanici, i to pod vodstvom Boltraniusa od kojeg se 1199. odvojio Eustasius preuzevši zadatke u Dubrovniku. Prema karakteristikama više ostale arhitektonske plastike cijeni ga se zaslužnim za podizanje katedrale po ukusu iz Apulije koji je i lokalnim naručiteljima bio ideal zbog permanentnih trgovačkih veza a i pripadnosti istom kulturnom ambijentu. Njega je definirala simbioza tradicija iz Bizanta i romaničkih struja nošenih od Normana temeljem činjenice da su Terre di Bari i Dubrovnik usporedno, makar ritmički nejednako priznavali vrhovnu vlast tih političkih sila. Autohtone crte romaničkog kiparstva u Dubrovniku iz druge četvrtine 13. stoljeća otkrivaju se na manjem broju djela, koji su ostavili odjeka u urešavanju javnih građevina iz gotičko-renesansnog doba. Svakako je izvor te difuzije bio u dekoraciji katedrale koju se gleda u svjetlu doticaja s jačom aktivnošću iz južne Italije, odakle je preuzimana ne samo tipologija nego i morfologija. Na toj je liniji morala nastati i oprema enterijera katedrale s naglaskom na pulpitu, arhivski spomenutom 1262. god. a arheološki mu je utvrđena dvanaesterostrana forma na stupovima. Skupa s ciborijem glavnog oltara hvalili su ga lokalni kroničari i strani putopisci tijekom 15. stoljeća, kao i prvi crkveni vizitatori od sredine seicenta. Po svemu sudeći oni su pripadali lancu tipiziranih apulsko-dalmatinskih ciborija i pulpita kakvi su sačuvani u katedralama Trogira i Splita a i u mnogim crkvama apeninskog juga, te se plediralo za jeruzalemsko podrijetlo. Ovdje se primat daje ciboriju rimske crkve S. Lorenzo fuori le mura iz 1148. g. a naročito ističe naturalistička obrada jednog kapitela poligonalnog

  15. Personality, psychological stress, and self-reported influenza symptomatology

    Directory of Open Access Journals (Sweden)

    Croon Marcel A

    2007-11-01

    Full Text Available Abstract Background Psychological stress and negative mood have been related to increased vulnerability to influenza-like illness (ILI. This prospective study re-evaluated the predictive value of perceived stress for self-reported ILI. We additionally explored the role of the negative affectivity and social inhibition traits. Methods In this study, 5,404 respondents from the general population were assessed in terms of perceived stress, personality, and control variables (vaccination, vitamin use, exercise, etc.. ILI were registered weekly using self-report measures during a follow-up period of four weeks. Results Multivariable logistic regression analysis on ILI was performed to test the predictive power of stress and personality. In this model, negative affectivity (OR = 1.05, p = 0.009, social inhibition (OR = 0.97, p = 0.011, and perceived stress (OR = 1.03, p = 0.048 predicted ILI reporting. Having a history of asthma (OR = 2.33, p = Conclusion Elderly and socially inhibited persons tend to report less ILI as compared to their younger and less socially inhibited counterparts. In contrast, asthma, trait negative affectivity, and perceived stress were associated with higher self-report of ILI. Our results demonstrate the importance of including trait markers in future studies examining the relation between stress and self-report symptom measures.

  16. Eight years of the Great Influenza Survey to monitor influenza-like illness in Flanders.

    Directory of Open Access Journals (Sweden)

    Yannick Vandendijck

    Full Text Available In 2003, an internet-based monitoring system of influenza-like illness (ILI, the Great Influenza Survey (GIS, was initiated in Belgium. For the Flemish part of Belgium, we investigate the representativeness of the GIS population and assess the validity of the survey in terms of ILI incidence during eight influenza seasons (from 2003 through 2011. The validity is investigated by comparing estimated ILI incidences from the GIS with recorded incidences from two other monitoring systems, (i the Belgian Sentinel Network and (ii the Google Flu Trends, and by performing a risk factor analysis to investigate whether the risks on acquiring ILI in the GIS population are comparable with results in the literature. A random walk model of first order is used to estimate ILI incidence trends based on the GIS. Good to excellent correspondence is observed between the estimated ILI trends in the GIS and the recorded trends in the Sentinel Network and the Google Flu Trends. The results of the risk factor analysis are in line with the literature. In conclusion, the GIS is a useful additional surveillance network for ILI monitoring in Flanders. The advantages are the speed at which information is available and the fact that data is gathered directly in the community at an individual level.

  17. Positive- and Negative-Control Pathways by Blood Components for Intermedilysin Production in Streptococcus intermedius.

    Science.gov (United States)

    Tomoyasu, Toshifumi; Yamasaki, Takahiro; Chiba, Shinya; Kusaka, Shingo; Tabata, Atsushi; Whiley, Robert A; Nagamune, Hideaki

    2017-09-01

    Streptococcus intermedius is an opportunistic bacterial pathogen secreting a human-specific cytolysin called intermedilysin (ILY) as a major pathogenic factor. This bacterium can degrade glycans into monosaccharides using two glycosidases, multisubstrate glycosidase A (MsgA) and neuraminidase (NanA). Here, we detected a stronger hemolytic activity mediated by ILY when S. intermedius PC574 was cultured in fetal bovine serum (FBS) than when it was grown in the standard culture medium. FBS-cultured cells also showed higher MsgA and NanA activity, although overproduction of ILY in FBS was undetectable in mutants nanA-null and msgA-null. Addition of purified MsgA and NanA to the FBS resulted in a release of 2.8 mM galactose and 4.3 mM N-acetylneuraminic acid; these sugar concentrations were sufficient to upregulate the expression of ILY, MsgA, and NanA. Conversely, when strain PC574 was cultured in human plasma, no similar increase in hemolytic activity was observed. Moreover, addition of human plasma to the culture in FBS appeared to inhibit the stimulatory effect of FBS on ILY, MsgA, and NanA, although there were individual differences among the plasma samples. We confirmed that human plasma contains immunoglobulins that can neutralize ILY, MsgA, and NanA activities. In addition, human plasma had a neutralizing effect on cytotoxicity of S. intermedius toward HepG2 cells in FBS, and a higher concentration of human plasma was necessary to reduce the cytotoxicity of an ILY-high-producing strain than an ILY-low-producing strain. Overall, our data show that blood contains factors that stimulate and inhibit ILY expression and activity, which may affect pathogenicity of S. intermedius. Copyright © 2017 American Society for Microbiology.

  18. Hospital triage system for adult patients using an influenza-like illness scoring system during the 2009 pandemic--Mexico.

    Directory of Open Access Journals (Sweden)

    Eduardo Rodriguez-Noriega

    Full Text Available BACKGROUND: Pandemic influenza A (H1N1 virus emerged during 2009. To help clinicians triage adults with acute respiratory illness, a scoring system for influenza-like illness (ILI was implemented at Hospital Civil de Guadalajara, Mexico. METHODS: A medical history, laboratory and radiology results were collected on emergency room (ER patients with acute respiratory illness to calculate an ILI-score. Patients were evaluated for admission by their ILI-score and clinicians' assessment of risk for developing complications. Nasal and throat swabs were collected from intermediate and high-risk patients for influenza testing by RT-PCR. The disposition and ILI-score of those oseltamivir-treated versus untreated, clinical characteristics of 2009 pandemic influenza A (H1N1 patients versus test-negative patients were compared by Pearson's Chi(2, Fisher's Exact, and Wilcoxon rank-sum tests. RESULTS: Of 1840 ER patients, 230 were initially hospitalized (mean ILI-score = 15, and the rest were discharged, including 286 ambulatory patients given oseltamivir (median ILI-score = 11, and 1324 untreated (median ILI-score = 5. Fourteen (1% untreated patients returned, and 3 were hospitalized on oseltamivir (median ILI-score = 19. Of 371 patients tested by RT-PCR, 104 (28% had pandemic influenza and 42 (11% had seasonal influenza A detected. Twenty (91% of 22 imaged hospitalized pandemic influenza patients had bilateral infiltrates compared to 23 (38% of 61 imaged hospital test-negative patients (p<0.001. One patient with confirmed pandemic influenza presented 6 days after symptom onset, required mechanical ventilation, and died. CONCLUSIONS: The triaging system that used an ILI-score complimented clinicians' judgment of who needed oseltamivir and inpatient care and helped hospital staff manage a surge in demand for services.

  19. Seasonality of absolute humidity explains seasonality of influenza-like illness in Vietnam.

    Science.gov (United States)

    Thai, Pham Quang; Choisy, Marc; Duong, Tran Nhu; Thiem, Vu Dinh; Yen, Nguyen Thu; Hien, Nguyen Tran; Weiss, Daniel J; Boni, Maciej F; Horby, Peter

    2015-12-01

    Experimental and ecological studies have shown the role of climatic factors in driving the epidemiology of influenza. In particular, low absolute humidity (AH) has been shown to increase influenza virus transmissibility and has been identified to explain the onset of epidemics in temperate regions. Here, we aim to study the potential climatic drivers of influenza-like illness (ILI) epidemiology in Vietnam, a tropical country characterized by a high diversity of climates. We specifically focus on quantifying and explaining the seasonality of ILI. We used 18 years (1993-2010) of monthly ILI notifications aggregated by province (52) and monthly climatic variables (minimum, mean, maximum temperatures, absolute and relative humidities, rainfall and hours of sunshine) from 67 weather stations across Vietnam. Seasonalities were quantified from global wavelet spectra, using the value of the power at the period of 1 year as a measure of the intensity of seasonality. The 7 climatic time series were characterized by 534 summary statistics which were entered into a regression tree to identify factors associated with the seasonality of AH. Results were extrapolated to the global scale using simulated climatic times series from the NCEP/NCAR project. The intensity of ILI seasonality in Vietnam is best explained by the intensity of AH seasonality. We find that ILI seasonality is weak in provinces experiencing weak seasonal fluctuations in AH (annual power 17.6). In Vietnam, AH and ILI are positively correlated. Our results identify a role for AH in driving the epidemiology of ILI in a tropical setting. However, in contrast to temperate regions, high rather than low AH is associated with increased ILI activity. Fluctuation in AH may be the climate factor that underlies and unifies the seasonality of ILI in both temperate and tropical regions. Alternatively, the mechanism of action of AH on disease transmission may be different in cold-dry versus hot-humid settings. Copyright

  20. The Look AHEAD Trial: bone loss at 4-year follow-up in type 2 diabetes.

    Science.gov (United States)

    Lipkin, Edward W; Schwartz, Ann V; Anderson, Andrea M; Davis, Cralen; Johnson, Karen C; Gregg, Edward W; Bray, George A; Berkowitz, Robert; Peters, Anne L; Hodges, Amelia; Lewis, Cora; Kahn, Steven E

    2014-10-01

    To determine whether an intensive lifestyle intervention (ILI) designed to sustain weight loss and improve physical fitness in overweight or obese persons with type 2 diabetes was associated with bone loss after 4 years of follow-up. This randomized controlled trial of intensive weight loss compared an ILI with a diabetes support and education (DSE) group among 1,309 overweight or obese subjects. Bone mineral density was assessed at baseline and after 1 year and 4 years of intervention. ILI was effective in producing significant weight loss (5.3% vs. 1.8% in ILI and DSE, respectively; P < 0.01) and increased fitness (6.4% vs. -0.8%) at year 4. In men, ILI participants had a greater rate of bone loss during the first year (-1.66% vs. -0.09% per year in ILI and DSE, respectively). Differences between groups were diminished by one-half after 4 years (-0.88% vs. -0.05% per year in ILI and DSE, respectively) but remained significant (P < 0.01). The difference in rate of hip bone loss between groups over 4 years was related to increased weight loss in ILI. Among women, the rate of bone loss did not differ between ILI and DSE after 4 years. A 4-year weight loss intervention was significantly associated with a modest increase in bone loss at the hip in men but not in women. © 2014 by the American Diabetes Association. Readers may use this article as long as the work is properly cited, the use is educational and not for profit, and the work is not altered.

  1. Tijela u tranziciji: transnacionalna ekonomija i nacionalna zajednica u Neuromanceru i Cosmopolisu

    Directory of Open Access Journals (Sweden)

    Sven Cvek

    2010-09-01

    razvoj globalnih komunikacijskih mreža i o njemu ovisilo. Sličnu tezu o "transnacionalnosti" SAD-a kao posljedici globalne cirkulacije kapitala nudi i Frederick Buell u svojoj analizi preobrazbe američkoga nacionalizma u “post-nacionalnom” dobu (neoliberalne globalizacije. Buell tvrdi da se američki “postnacionalni nacionalizam” oblikovao u dva koraka: prvo, 1980-ih, strahom od otvaranja američke ekonomije globalizacijskim procesima, a nacije ideji multikulturalizma, a zatim 1990-ih asimilacijom radikalnih aspekata multikulturalnosti u hegemonijsku nacionalnu ideologiju te diskurzivnim pripitomljavanjem “opasne” globalizacije i njezinim pretvaranjem u priliku za nove nacionalne uspjehe. Buell pritom stalno naglašava da je ključan moment u procesu “krhke konstrukcije novog [...] nacionalizma američki diskurz o globalizaciji i s njim povezana pripovijest o [nacionalnoj] obnovi” (561. Kapital, u svom globaliziranom, financijaliziranom i informatiziranom obliku, ovdje se dakle pojavljuje kao sila koja prijeti rastočiti nacionalnu državu prelazeći, zanemarujući ili razgrađujući granice njezina teritorija i imaginarija. (Osnovna je potka teze u skladu s često ponavljanom idejom o globalnom kruženju kapitala kao prijetnji nacionalnoj državi. Ali Buell naglašava da SAD istovremeno, u narušenoj poziciji dvadesetostoljetnog svjetskoga hegemona, reformira nacionalnu sferu (ekonomiju, politiku, imaginarij u pokušaju da obuzda deteritorijalizirajuću snagu kapitala. David Harvey je, oslanjajući se na Arrighija, sumirao tu ambivalentnu poziciju SAD-a u svojoj tezi o Americi kao “kapitalističkoj imperijalističkoj” sili, rastrganoj između pokušaja da stavi pod nadzor kaotične globalne tokove kapitala koje sama pokreće (Harvey 26.

  2. PRIPREMA U VODI TEŠKO TOPLJIVIH TVARI ZA EKOTOKSIKOLOŠKA ISPITIVANJA

    OpenAIRE

    Vržina, J.; Ulm, L.; Schiesl, V.; Šateva, M.

    2000-01-01

    Sažetak Metode za određivanje toksičnosti kemijskih tvari na vodene organizme, propisane organizacijama kao što su OECD, EU ili ISO odnose se na kemijske supstancije s točnim generičkim opisom, tj. propisuju ispitivanje vodotopljivih, kemijski stabilnih i nehlapljivih tvari. Međutim, ako se te metode primjenjuju za tvari koje ne podliježu navedenim svojstvima (tvari koje su samo djelomično ili slabo topljive u vodi, nestabilne, hlapljive ili kompleksnog sastava), mogu se očekivati teškoće ...

  3. Stigma i karizma

    OpenAIRE

    Blažević, Robert

    2004-01-01

    Autor tematizira važnost karizmatske vlasti u tradicionalnim društvima, napose u tzv. prijelomnim vremenima. Max Weber prvi je sociolog koji se sustavno bavio pojmom karizme i karizmatske vlasti u kontekstu tematiziranja problema legitimne političke vlasti. Karizma je osobina neke ličnosti zbog koje ona vrijedi kao iznimna, i zahvaljujući tome njezini je sljedbenici smatraju obdarenom natprirodnim ili nadljudskim moćima ili osobinama ne svakom dostupnim. Takva se osoba smatra bogomdanom ili u...

  4. Bralna kompetenca učencev v osnovni šoli

    OpenAIRE

    Hromin, Petra

    2009-01-01

    V teoretičnem delu smo se osredotočili na opredelitev pojma bralne motivacije ter prvine le-te. Osredotočili smo se na prvine notranje bralne motivacije, katero predstavlja bralna kompetenca ali lastna bralna učinkovitost, interes in zatopljenost. Pri prvinah zunanje bralne motivacije smo se osredotočili na socialno motivacijo za branje. Ugotoviti smo želeli bralno samopodobo in vrednotenje branja in bralnih gradiv (bralna kompetenca) ter priljubljenost posameznih bralnih gradiv glede na spol...

  5. Nadgradnja obstoječega sistema vodenja kakovosti in ravnanja z okoljem v podjetju Svea, lesna industrija, d.d., Zagorje

    OpenAIRE

    Frol, Rok

    2014-01-01

    V lesnem podjetju Svea, d.d. smo preučili in opisali postopke za izdelavo kakovostnejših izdelkov in doseganje boljših ekonomskih rezultatov. Predstavili in razložili smo možne nadgradnje sistema vodenja kakovosti in ravnanja z okoljem ter posledice le-teh. Predstavili smo pojem kakovosti, njegove opredelitve ter osnovna načela vodenja kakovosti, ki jih mora podjetje upoštevati, če želi oblikovati učinkovit sistem vodenja kakovosti. Vključili smo tudi predstavitvi skupin standardov ISO 9000 i...

  6. Impact of an Intensive Lifestyle Intervention on Use and Cost of Medical Services Among Overweight and Obese Adults With Type 2 Diabetes: The Action for Health in Diabetes

    OpenAIRE

    Espeland, Mark A.; Glick, Henry A.; Bertoni, Alain; Brancati, Frederick L.; Bray, George A.; Clark, Jeanne M.; Curtis, Jeffrey M.; Egan, Caitlin; Evans, Mary; Foreyt, John P.; Ghazarian, Siran; Gregg, Edward W.; Hazuda, Helen P.; Hill, James O.; Hire, Don

    2014-01-01

    OBJECTIVE To assess the relative impact of an intensive lifestyle intervention (ILI) on use and costs of health care within the Look AHEAD trial. RESEARCH DESIGN AND METHODS A total of 5,121 overweight or obese adults with type 2 diabetes were randomly assigned to an ILI that promoted weight loss or to a comparison condition of diabetes support and education (DSE). Use and costs of health-care services were recorded across an average of 10 years. RESULTS ILI led to reductions in annual hospit...

  7. Piridinijevi oksimi: razlozi za njihov odabir kao kauzalnih antidota protiv otrovanja organofosfatima i sadašnja rješenja za autoinjektore

    OpenAIRE

    Stojiljković, Miloš P.; Jokanović, Milan

    2006-01-01

    Tijekom proteklih pet desetljeća, za pet piridinijevih oksima ustanovljeno je da zavređuju da budu upotrijebljeni kod ljudi kao antidoti protiv živanih bojnih otrova: pralidoksim, u obliku klorida, PAM-2 Cl ili mesilat, P2S (protiv sarina, ciklosarina i VX-otrova), trimedoksim ili TMB-4 i obidoksim ili LüH-6 (oba protiv tabuna, sarin i VX-otrova), HI-6 (protiv sarina, somana, ciklosarina i VX-otrova) i HLö-7 (protiv svih pet živanih bojnih otrova). Radi osiguranja autoinjektora s najboljim i ...

  8. Drava, kao crta razgraničenja dvaju prostora - ovozemaljskog i onozemaljskog – mitska događanja oko rijeke u predajama podravskih Hrvata u Mađarskoj

    OpenAIRE

    Franković, Đuro

    2013-01-01

    Mitska zbivanja u tradiciji slavenskih i baltičkih naroda koja se događaju svagda i svugdje govore o gromovniku Perunu (Perkunas) i njegom suparniku Velesu ili Volosu (Velnias) bogu stoke, koji međusobno vode dvoboj. Božanski sukob započinje ciklično, obično u proljeće kada Velesove epikleze: zmije ili vrag napuštaju svoj prostor i pojavljuju se u prostoru Perunove epikleze Franje Marčetina, obično na njegovom svetom drvetu vrbi ili hrastu. Ishod božanskog dvoboja nije bez žrtava i poraza, na...

  9. Izrada polimernog kompozita ojačanog prirodnim vlaknima

    OpenAIRE

    KRAJINOVIĆ, Mario; Marić, Gojko; ŠNAJDAR, Mateja

    2011-01-01

    Jedan od velikih nedostataka sadašnjih kompozitnih materijala poput kompozita sa staklenim ili ugljičnim vlaknima jest nemogućnost njihova recikliranja. Nakon isteka vijeka trajanja proizvoda ili dijela, iz kompozitnih materijala trenutno nije moguće razdvojiti vlakna i matricu, niti ih reciklirati drugim metodama osim deponiranjem ili usitnjavanjem za agregat pri polaganju cesta. Bio-polimerni kompoziti imaju sve veću primjenu i svijetlu budućnost upravo iz razloga recikličnosti, lake obnovl...

  10. Deep sequence characterisation of a divergent HPIV-4a from an adult with prolonged influenza-like illness

    Directory of Open Access Journals (Sweden)

    Katherine E. Arden

    2015-12-01

    Deep sequencing allowed identification and genomic characterisation of a possible pathogen from an ILI as well as being an important tool to aid future understanding of the linkages between viral genetic variation, transmission and disease prognosis.

  11. Uporaba večkriterijskih odločitvenih modelov za ocenjevanje kakovosti ponudbe turističnih kmetij

    OpenAIRE

    Potočnik, Majda

    2016-01-01

    Obravnavani problem - kakovost ponudbe turističnih kmetij - smo razgradili na podprobleme oziroma parametre (kriterije) kakovosti ponudbe. Določili smo hierarhično strukturo štiridesetih kriterijev

  12. Environ: E00100 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available m heterotropoides [TAX:366663], Asarum sieboldii [TAX:76098] Same as: D06728 Aristolochiaceae (birthwort fam...ily) Asiasarum root Others: Aristolochiaceae (birthwort family) Asiasarum herb Major component: Eugenol methyl ether [CPD:C10454] ...

  13. Eesti album ehk elu läheb edasi / Igor Kotjuh

    Index Scriptorium Estoniae

    Kotjuh, Igor, 1978-

    2005-01-01

    Arvustus: Semenenko, Svetlan. Estonski albom, ili, Jeshtsho ne vsjo poterjano = Eesti album, ehk, Mitte kõik ei ole veel kaotatud = Estonian album, or, Not everything is lost yet. Tallinn : Ilo, 2004

  14. Globalizatsija : put dlja vsego tshelovetshestva / Viktor Vaseha

    Index Scriptorium Estoniae

    Vaseha, Viktor

    2000-01-01

    Globaliseeruva maailma sisemistest vastuoludest, "globaalse" eliidi tekkimisest, globaliseerumisest kui uuskolonialismi varjunimest. Vastukaja Mihhail Balev'i artiklile "Eksperiment po globalizatsii, ili Evrosojuz kak simpatitshnõi oksjumoron" Raduga, 2000, nr.1

  15. Effectiveness of homeopathic medicine associated with allopathic medicine in the outpatient management of influenza-like illnesses or ear, nose, and throat disorders by pharmacists

    National Research Council Canada - National Science Library

    Danno, Karine; Cognet-Dementhon, Brigitte; Thevenard, Geneviève; Duru, Gérard; Allaert, François-André; Bordet, Marie-France

    2013-01-01

    ... studied. To describe the sociodemographic and clinical characteristics of patients recommended allopathic and/or homeopathic medicines for ILI or ENT disorders by pharmacists in France and to investigate...

  16. Gene : CBRC-OPRI-01-0183 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ily transporter permease protein [Methylobacterium extorquens DM4] emb|CAX23124.1| ABC family transporter pe...rmease protein [Methylobacterium extorquens DM4] 3.3 27% MGLFRSSVVAGVSFGKWWESRNLSISKWLSNLLAYSXXXXXXXXXXXXXXX

  17. Protein (Cyanobacteria): 495508949 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ilies Richelia intracellularis MSIKVLVPTALQKFTHNQATLECGGATIAELFNSLEQNCPGIKSRLCDEQGQPRRFLNFYVNSEDIRFLDGTETPLKDGDEVSIVPAVAGG ... WP_008233595.1 ... 1117:270 ... 1161:3739 ... 1162:3768 98443:1747 1164990:1747 ... FIG038648: MoaD and/or ThiS fam

  18. Influenza and other respiratory viruses detected by influenza-like illness surveillance in Leyte Island, the Philippines, 2010-2013

    National Research Council Canada - National Science Library

    Otomaru, Hirono; Kamigaki, Taro; Tamaki, Raita; Opinion, Jamie; Santo, Arlene; Daya, Edgard; Okamoto, Michiko; Saito, Mariko; Tallo, Veronica; Lupisan, Soccoro; Suzuki, Akira; Oshitani, Hitoshi

    2015-01-01

    This study aimed to determine the role of influenza-like illness (ILI) surveillance conducted on Leyte Island, the Philippines, including involvement of other respiratory viruses, from 2010 to 2013...

  19. Estimating the population impact of a new pediatric influenza vaccination program in England using social media content

    DEFF Research Database (Denmark)

    Wagner, Moritz; Lampos, Vasileios; Yom-Tov, Elad

    2017-01-01

    was applied, which consisted of a nonlinear regression model that was trained to infer influenza-like illness (ILI) rates from Twitter posts originating in pilot (school-age vaccinated) and control (unvaccinated) areas. The control areas were then used to estimate ILI rates in pilot areas, had...... the intervention not taken place. These predictions were compared with their corresponding Twitter-based ILI estimates. Results: Results suggest a reduction in ILI rates of 14% (1-25%) and 17% (2-30%) across all ages in only the primary school-age vaccine pilot areas during the 2013/2014 and 2014/2015 influenza...... seasons, respectively. No significant impact was observed in areas where two age cohorts of secondary school children were vaccinated. Conclusions: These findings corroborate independent assessments from traditional surveillance data, thereby supporting the ongoing rollout of the program to primary school...

  20. Environ: E00615 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00615 Scilla scilloides bulb Crude drug Scilla scilloides [TAX:49652] Liliaceae (l...ily family) Scilla scilloides bulb (dried) Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) E00615 Scilla scilloides bulb ...

  1. Environ: E00596 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00596 Tulipa edulis bulb Crude drug Tulipa edulis, Tulipa [TAX:13305] Liliaceae (l...ily family) Tulipa edulis bulb (dried) Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) E00596 Tulipa edulis bulb ...

  2. Influenza surveillance in Europe. Comparing intensity levels calculated using the Moving Epidemic Method.

    LENUS (Irish Health Repository)

    Vega, Tomás

    2015-05-30

    Although influenza-like illnesses (ILI) and acute respiratory illnesses (ARI) surveillance are well established in Europe, the comparability of intensity among countries and seasons remains an unresolved challenge.

  3. African Journal of Drug & Alcohol Studies, 15(1), 2016 Copyright ...

    African Journals Online (AJOL)

    haviours have been linked to risky sexual activities .... Enforcement of regulation of drug and substance abuse ... behaviours such as alcohol, tobacco, and ... partners, making decisions that will affect ...... ily in preventing and intervening with.

  4. Environ: E00032 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00032 Cinnamon fruit Crude drug Cinnamon cassia [TAX:119260] Lauraceae (laurel fam...ily) Cinnamon cassia immature fruit Crude drugs [BR:br08305] Other flowering plants Lauraceae (laurel family) E00032 Cinnamon fruit ...

  5. Insomnia predicts long-term all-cause mortality after acute myocardial infarction: A prospective cohort study.

    Science.gov (United States)

    Condén, Emelie; Rosenblad, Andreas

    2016-07-15

    Sleep impairment such as insomnia is an established risk factor for the development of cardiovascular disease and acute myocardial infarction (AMI). The aim of the current study was to examine the association between insomnia and all-cause mortality among AMI patients. This prospective cohort study used data on n=732 patients recruited from September 2006 to May 2011 as part of the Västmanland Myocardial Infarction Study (VaMIS), a prospective cohort study of AMI patients living in Västmanland County, Sweden. Participants were followed up for all-cause mortality until December 9, 2015. The outcome of interest was time-to-death (TTD), with the presence of insomnia being the risk factor of main interest. Data were analyzed using a piecewise Cox regression model with change point for insomnia at two years of follow-up, adjusted for socioeconomic, lifestyle and clinical risk factors. In total, n=175 (23.9%) of the participants suffered from insomnia. During a mean (SD) follow-up time of 6.0 (2.5) years (4392person-years), a total of n=231 (31.6%) participants died, n=77 (44.0%) in the insomnia group and n=154 (27.6%) in the non-insomnia group (log-rank test p<0.001). In a multiple adjusted piecewise Cox regression model, insomnia did not imply a higher risk of death during the first two years after AMI (HR 0.849; 95% CI 0.508-1.421; p=0.534). During the period after the first two years, however, insomnia implied a 1.6 times higher risk of death (HR 1.597; 95% CI 1.090-2.341; p=0.016). Insomnia implies a higher risk of death among AMI patients in the long term. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  6. AcEST: DK959664 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ILI6|NS1A_TASV2 Non-structural polyprotein 1A OS=Turkey ast... 30 9.3 sp|Q9ILI5|N...S1AB_TASV2 Non-structural polyprotein 1AB OS=Turkey a... 30 9.3 sp|A5DGN9|NACA_PICGU Nascent polypeptide-ass

  7. A 1-year lifestyle intervention for weight loss in individuals with type 2 diabetes reduces high C-reactive protein levels and identifies metabolic predictors of change: from the Look AHEAD (Action for Health in Diabetes) study.

    Science.gov (United States)

    Belalcazar, L Maria; Reboussin, David M; Haffner, Steven M; Hoogeveen, Ron C; Kriska, Andrea M; Schwenke, Dawn C; Tracy, Russell P; Pi-Sunyer, F Xavier; Ballantyne, Christie M

    2010-11-01

    We examined whether a 1-year intensive lifestyle intervention (ILI) for weight loss reduced elevated high-sensitivity C-reactive protein (hs-CRP) levels in obese individuals with diabetes and identified metabolic and fitness predictors of hs-CRP change. Look AHEAD (Action for Health in Diabetes) is an ongoing multicenter clinical trial examining the effects of weight loss achieved through ILI on cardiovascular events and overall mortality in obese/overweight adults with type 2 diabetes. We report on 1,759 Look AHEAD participants who had hs-CRP and fitness data at baseline and 1 year. Subjects were randomly assigned to ILI or to usual care (diabetes support and education [DSE]). ILI involved frequent counseling to increase moderate-intensity exercise to 175 min/week, reduce caloric and saturated fat intake, and change macronutrient composition to improve glycemic control. ILI reduced median hs-CRP by 43.6% from baseline to 1 year, compared with a 16.7% reduction with DSE (P<0.001). ILI decreased weight (8.8%), A1C (0.7%), and triglycerides (17%) and increased fitness (19%) and HDL cholesterol (7.5%) (P<0.0001 vs. changes with DSE). Changes in adiposity and glucose control with ILI remained independent predictors of hs-CRP change at 1 year (P<0.0001 for each) after adjustment for demographics, smoking, cardiovascular history, statin and thiazolidinedione use, and changes in fitness and lipid control. Neither statin nor insulin therapy modified the association between ILI and hs-CRP. A 1-year lifestyle intervention for weight loss in obese individuals with diabetes was associated with substantial reductions in hs-CRP. Improved glycemic control and reduced adiposity had comparable effects on hs-CRP change.

  8. A 1-Year Lifestyle Intervention for Weight Loss in Individuals With Type 2 Diabetes Reduces High C-Reactive Protein Levels and Identifies Metabolic Predictors of Change

    Science.gov (United States)

    Belalcazar, L. Maria; Reboussin, David M.; Haffner, Steven M.; Hoogeveen, Ron C.; Kriska, Andrea M.; Schwenke, Dawn C.; Tracy, Russell P.; Pi-Sunyer, F. Xavier; Ballantyne, Christie M.

    2010-01-01

    OBJECTIVE We examined whether a 1-year intensive lifestyle intervention (ILI) for weight loss reduced elevated high-sensitivity C-reactive protein (hs-CRP) levels in obese individuals with diabetes and identified metabolic and fitness predictors of hs-CRP change. RESEARCH DESIGN AND METHODS Look AHEAD (Action for Health in Diabetes) is an ongoing multicenter clinical trial examining the effects of weight loss achieved through ILI on cardiovascular events and overall mortality in obese/overweight adults with type 2 diabetes. We report on 1,759 Look AHEAD participants who had hs-CRP and fitness data at baseline and 1 year. Subjects were randomly assigned to ILI or to usual care (diabetes support and education [DSE]). ILI involved frequent counseling to increase moderate-intensity exercise to 175 min/week, reduce caloric and saturated fat intake, and change macronutrient composition to improve glycemic control. RESULTS ILI reduced median hs-CRP by 43.6% from baseline to 1 year, compared with a 16.7% reduction with DSE (P < 0.001). ILI decreased weight (8.8%), A1C (0.7%), and triglycerides (17%) and increased fitness (19%) and HDL cholesterol (7.5%) (P < 0.0001 vs. changes with DSE). Changes in adiposity and glucose control with ILI remained independent predictors of hs-CRP change at 1 year (P < 0.0001 for each) after adjustment for demographics, smoking, cardiovascular history, statin and thiazolidinedione use, and changes in fitness and lipid control. Neither statin nor insulin therapy modified the association between ILI and hs-CRP. CONCLUSIONS A 1-year lifestyle intervention for weight loss in obese individuals with diabetes was associated with substantial reductions in hs-CRP. Improved glycemic control and reduced adiposity had comparable effects on hs-CRP change. PMID:20682679

  9. INTERLEIKIN 1 KAK MEDIATOR VOSPALENIYa I TERAPEVTIChESKAYa MIShEN''

    Directory of Open Access Journals (Sweden)

    A. E. Il'ina

    2011-01-01

    Full Text Available Interleikin 1 (IL 1 vpervye byl opisan v 40-kh go- dakh XX v. kak vyzyvayushchii likhoradku faktor, vysvobozh- daemyi aktivirovannymi leikotsitami. V to vremya on na- zyvalsya «pireksin» ili «endogennyi pirogen» [1]. Kak pravilo, kletki organizma ne sposobny k spontannomu sintezu IL 1, a otvechayut ego produktsiei na infektsiyu, deistvie mikrobnykh toksinov, vospalitel'nykh agentov, drugikh tsitokinov, aktivirovannykh komponentov komple- menta ili sistemy svertyvaniya krovi [2, 3].

  10. Lifelong learning in public libraries principles, programs, and people

    CERN Document Server

    Gilton, Donna L

    2012-01-01

    Lifelong Learning in Public Libraries demonstrates that public librarians can promote learning by combining the elements of Information Literacy Instruction (ILI) with traditional practices of public libraries. This approach contributes to the information enfranchisement of patrons and enhances the fulfillment of the traditional goals and purposes of libraries. Donna L. Gilton provides background on ILI and current developments in public library instruction and also examines educational the

  11. Outbreaks of influenza?like illness in long?term care facilities in Winnipeg, Canada

    OpenAIRE

    Mahmud, Salaheddin M.; Thompson, Laura H; Nowicki, Deborah L.; Plourde, Pierre J.

    2012-01-01

    Please cite this paper as: Mahmud et?al. (2012) Outbreaks of influenza?like illness in long?term care facilities in Winnipeg, Canada. Influenza and Other Respiratory Viruses 10.1111/irv.12052 Background? Outbreaks of influenza?like illness (ILI) are common in long?term care facilities (LTCFs) and result in significant morbidity and mortality among residents. Objectives? We describe patterns of reported ILI outbreaks in LTCFs in Winnipeg, Canada, and examine LTCF and outbreak characteristics t...

  12. Trygghet som handelsvara : Privat folkförsäkring i det framväxande välfärdssamhället 1900–1950

    OpenAIRE

    Sjöblom, Alf

    2016-01-01

    Industrial Life Insurance (ILI) was introduced in Sweden in the beginning of the 1900s. Following models already used in the United Kingdom and the United States, this insurance was specifically aimed at manual labourers, promising pension savings and compensation to surviving relatives. The insurance was an immediate success, with almost three million insurance policies in force by the mid-1900s. ILI was characterised by extensive and carefully monitored marketing practices. By managing an a...

  13. Mid-Season Influenza Vaccine Effectiveness Estimates for the 2016-2017 Influenza Season (Open Access Publisher’s Version)

    Science.gov (United States)

    2017-08-01

    ILI). Influenza cases were identified using reverse transcription–polymerase chain reaction (RT-PCR) or viral culture; controls were ILI patients...and no medical encounters for influenza during the season. Healthy controls were matched to cases by sex , age, date of encounter (±3 days), and...controls; AFHSB used healthy controls (matched to cases by sex , age, date [+/– 3 days] and location). bAFHSB-AF adjusted for age group, month of illness

  14. Research of the effects of shock and vibrations on the human body / Исследование влияния ударов и вибраций на человеческий организм / Istraživanje uticaja udara i vibracija na ljudsko telo

    Directory of Open Access Journals (Sweden)

    Zoran C. Petrović

    2017-01-01

    upotrebe širokog spektra specijalizovanih uređaja za simulaciju udara i vibracija za eksperimente na ljudima i životinjama. 'Antropometričke' ili 'antropomorfne' lutke, koje simuliraju osnovne statičke i dinamičke osobine ljudskog tela, uveliko se koriste u istraživanju avionskih i automobilskih nesreća. Tako, na primer, hibridna lutka, Hybrid III dummy, koristi se u slučaju čeonog automobilskog sudara. Razna istraživanja automobilskih i vazduhoplovnih nezgoda, kao i eksperimenti sa lutkama i živim bićima, pokazuju da potpuna potpora tela i ograničenje kretanja ekstremiteta obezbeđuju maksimalnu zaštitu od sila ubrzanja.

  15. Evolution, ecology and systematics of Soldanella (Primulaceae) in the southern Apennines (Italy).

    Science.gov (United States)

    Bellino, Alessandro; Bellino, Leonardo; Baldantoni, Daniela; Saracino, Antonio

    2015-08-11

    The populations of Soldanella (Primulaceae) of the southern Apennines (Italy) are unique within the genus for their distribution and ecology. Their highly fragmented distribution range, with three main metapopulations on some of the highest mountains (Gelbison, Sila and Aspromonte massifs) of the area, poses intriguing questions about their evolutionary history and biogeography, and about the possibility of local endemisms. In order to clarify the phylogeny and biogeography of the three metapopulations of Soldanella in the southern Apennines, attributed to S. calabrella to date, and to identify possible local endemisms, a comparative approach based on the study of molecular, morphological and ecological characteristics of the populations was employed. Specifically, one nuclear (total ITS) and two plastid (rbcL and trnL) markers were used for the phylogenetic analyses, performed through both maximum likelihood and Bayesian techniques. Among the morphological features, the glandular hair and leaf biometric traits were analysed, and the environment in which the populations grew was characterised for altitude, forest canopy composition and soil pH, C, N and organic matter. Our findings demonstrate that the lineage of Soldanella of southern Italy diverged from the Carpathians lineage during the Middle Pleistocene, and underwent an evolutionary radiation during the Late Pleistocene. The populations of the Sila and Aspromonte massifs diverged from the populations of the Gelbison massif around 380000 years ago and are probably undergoing a progressive differentiation due to their isolation. The populations on the Gelbison massif, moreover, have different morphological features from those of the Sila and Aspromonte massifs and a different ecological niche. The molecular, morphological and ecological data clearly demonstrate that the metapopulation of Soldanella on the Gelbison massif belongs to a new taxonomic unit at the species level, which we name Soldanella sacra A. & L

  16. Hygiene Behaviors Associated with Influenza-Like Illness among Adults in Beijing, China: A Large, Population-Based Survey.

    Directory of Open Access Journals (Sweden)

    Shuangsheng Wu

    Full Text Available The objective of this study was to identify possible hygiene behaviors associated with the incidence of ILI among adults in Beijing. In January 2011, we conducted a multi-stage sampling, cross-sectional survey of adults living in Beijing using self-administered anonymous questionnaires. The main outcome variable was self-reported ILI within the past year. Multivariate logistic regression was used to identify factors associated with self-reported ILI. A total of 13003 participants completed the questionnaires. 6068 (46.7% of all participants reported ILI during the past year. After adjusting for demographic characteristics, the variables significantly associated with a lower likelihood of reporting ILI were regular physical exercise (OR 0.80; 95% CI 0.74-0.87, optimal hand hygiene (OR 0.87; 95% CI 0.80-0.94, face mask use when going to hospitals (OR 0.87; 95% CI 0.80-0.95, and not sharing of towels and handkerchiefs (OR 0.68; 95% CI 0.63-0.73. These results highlight that personal hygiene behaviors were potential preventive factors against the incidence of ILI among adults in Beijing, and future interventions to improve personal hygiene behaviors are needed in Beijing.

  17. Influenza-like illness, the time to seek healthcare, and influenza antiviral receipt during the 2010–11 influenza season — United States

    Science.gov (United States)

    Biggerstaff, Matthew; Jhung, Michael A.; Reed, Carrie; Fry, Alicia M.; Balluz, Lina; Finelli, Lyn

    2015-01-01

    Background Few data exist describing health care seeking behaviors among persons with influenza-like illness (ILI) or adherence to influenza antiviral treatment recommendations. Methods We analyzed adult responses to the Behavioral Risk Factor Surveillance System in 31 states and the District of Columbia (D.C.) and pediatric responses in 25 states and D.C. for January – April 2011 by demographics and underlying health conditions. Results Among 75,088 adult and 15,649 child respondents, 8.9% and 33.9%, respectively, reported ILI. ILI was more frequent among adults with asthma (16%), chronic obstruction pulmonary disease (COPD; 26%), diabetes (12%), heart disease (19%), kidney disease (16%), or obesity (11%). Forty-five percent of adults and 57% of children sought health care for ILI. Thirty-five percent of adults sought care ≤2 days after ILI onset. Seeking care ≤2 days was more frequent among adults with COPD (48%) or heart disease (55%). Among adults with a self-reported physician diagnosis of influenza, 34% received treatment with antiviral medications. The only underlying health condition with a higher rate of treatment was diabetes (46%). Conclusion Adults with underlying health conditions were more likely to report ILI, but the majority did not seek care promptly, missing opportunities for early influenza antiviral treatment. PMID:24731959

  18. Influenza-like illness, the time to seek healthcare, and influenza antiviral receipt during the 2010-2011 influenza season-United States.

    Science.gov (United States)

    Biggerstaff, Matthew; Jhung, Michael A; Reed, Carrie; Fry, Alicia M; Balluz, Lina; Finelli, Lyn

    2014-08-15

    Few data exist describing healthcare-seeking behaviors among persons with influenza-like illness (ILI) or adherence to influenza antiviral treatment recommendations. We analyzed adult responses to the Behavioral Risk Factor Surveillance System in 31 states and the District of Columbia (DC) and pediatric responses in 25 states and DC for January-April 2011 by demographics and underlying health conditions. Among 75 088 adult and 15 649 child respondents, 8.9% and 33.9%, respectively, reported ILI. ILI was more frequent among adults with asthma (16%), chronic obstruction pulmonary disease (COPD; 26%), diabetes (12%), heart disease (19%), kidney disease (16%), or obesity (11%). Forty-five percent of adults and 57% of children sought healthcare for ILI. Thirty-five percent of adults sought care ≤ 2 days after ILI onset. Seeking care ≤ 2 days was more frequent among adults with COPD (48%) or heart disease (55%). Among adults with a self-reported physician diagnosis of influenza, 34% received treatment with antiviral medications. The only underlying health condition with a higher rate of treatment was diabetes (46%). Adults with underlying health conditions were more likely to report ILI, but the majority did not seek care promptly, missing opportunities for early influenza antiviral treatment. Published by Oxford University Press on behalf of the Infectious Diseases Society of America 2014. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  19. Nitric oxide metabolites as biomarkers for influenza-like acute respiratory infections presenting to the emergency room.

    Science.gov (United States)

    Mian, Asad I; Laham, Federico R; Cruz, Andrea T; Garg, Harsha; Macias, Charles G; Caviness, A Chantal; Piedra, Pedro A

    2012-01-01

    Nitric oxide (NO) is increased in the respiratory tract in pulmonary infections. The aim was to determine whether nasal wash NO metabolites could serve as biomarkers of viral pathogen and disease severity in children with influenza-like illness (ILI) presenting to the emergency department (ED) during the 2009 influenza A H1N1 pandemic. Children ≤18 years old presenting to the ED with ILI were eligible. Nasal wash specimens were tested for NO metabolites, nitrate and nitrite, by HPLC and for respiratory viruses by real-time PCR. Eighty-nine patients with ILI were prospectively enrolled during Oct-Dec, 2009. In the entire cohort, nasal wash nitrite was low to undetectable (interquartile range [IQR], 0 - 2 μM), while median nitrate was 3.4 μM (IQR 0-8.6). Rhinovirus (23%), respiratory syncytial virus (RSV) (20%), novel H1N1 (19%), and adenovirus (11%) were the most common viruses found. Children with RSV subtype B-associated ILI had higher nitrate compared to all other viruses combined (P=0.002). Concentration of NO-derived nitrate in nasal secretions in children in the ED is suggestive of viral pathogen causative for ILI, and thus might be of clinical utility. Predictive potential of this putative biomarker for ILI needs further evaluation in sicker patients in a prospective manner.

  20. Lifestyle intervention and/or statins for the reduction of C-reactive protein in type 2 diabetes: from the look AHEAD study.

    Science.gov (United States)

    Belalcazar, L Maria; Haffner, Steven M; Lang, Wei; Hoogeveen, Ron C; Rushing, Julia; Schwenke, Dawn C; Tracy, Russell P; Pi-Sunyer, F Xavier; Kriska, Andrea M; Ballantyne, Christie M

    2013-05-01

    Cardiovascular risk remains high despite statin use. Overweight/obese diabetic persons usually have normal/low LDL-cholesterol but high C-reactive protein (CRP) levels. We aimed to examine the effects of intensive lifestyle intervention for weight loss (ILI) on CRP levels in overweight/obese diabetic individuals by statin use. Look AHEAD was a randomized trial in overweight/obese type 2 diabetic individuals testing whether ILI would reduce cardiovascular mortality, when compared to usual care. CRP changes in 1,431 participants with biomarker levels, who remained on or off statin treatment for 1 year, were evaluated. The reduction in CRP levels with ILI at 1 year in men and women on statins was -44.9 and -42.3%, respectively, compared to -13.7 and -21.0% for those on statins and usual care (P < 0.0001). At 1 year, median CRP levels were: 1.8 mg L(-1) in participants randomized to ILI on statin therapy; 2.6 mg L(-1) for those on statins randomized to usual care and 2.9 mg L(-1) for participants not on statins but randomized to ILI. Weight loss was associated with 1-year CRP reduction (P < 0.0001) in statin and nonstatin users. Our findings suggest that in overweight/obese diabetic persons, ILI and statin therapy may have substantial additive anti-inflammatory benefits. Copyright © 2013 The Obesity Society.

  1. An Intensive Lifestyle Intervention Is an Effective Treatment of Morbid Obesity: The TRAMOMTANA Study—A Two-Year Randomized Controlled Clinical Trial

    Directory of Open Access Journals (Sweden)

    Bartolomé Burguera

    2015-01-01

    Full Text Available Bariatric surgery is currently the most effective therapy to induce weight loss in morbidly obese patients. Objective. This controlled, clinical trial with a two-year intervention was aimed at comparing the efficacy of two nonsurgical approaches versus bariatric surgery, on body weight changes and metabolic parameters in morbidly obese patients. Methods. Patients were randomized to an Intensive Lifestyle Intervention (ILI (n=60 or Conventional Obesity Therapy (COT (n=46. The ILI group received behavioral therapy and nutritional counseling. The COT group received standard medical treatment. They were compared with a third group, Surgical Obesity Group (SOG (n=37. Results. Patients who received ILI had a greater percentage of weight loss than patients receiving COT (−11.3% versus −1.6%; p<0.0044. Interestingly 31.4% of patients included in the ILI group were no longer morbidly obese after just six months of intervention, increasing to 44.4% after 24 months of intervention. The percentage weight loss in SOG was −29.6% after that same period of time. Conclusions. ILI was associated with significant weight loss when compared to COT, in a group of patients with obesity. An ILI approach could be an alternative therapy to patients with obesity, who are not candidates to undergo bariatric surgery. This trial is registered with EudraCT 2009-013737-24.

  2. Structural Basis for Recognition of the Pore-Forming Toxin Intermedilysin by Human Complement Receptor CD59

    Directory of Open Access Journals (Sweden)

    Steven Johnson

    2013-05-01

    Full Text Available Pore-forming proteins containing the structurally conserved membrane attack complex/perforin fold play an important role in immunity and host-pathogen interactions. Intermedilysin (ILY is an archetypal member of a cholesterol-dependent cytolysin subclass that hijacks the complement receptor CD59 to make cytotoxic pores in human cells. ILY directly competes for the membrane attack complex binding site on CD59, rendering cells susceptible to complement lysis. To understand how these bacterial pores form in lipid bilayers and the role CD59 plays in complement regulation, we determined the crystal structure of human CD59 bound to ILY. Here, we show the ILY-CD59 complex at 3.5 Å resolution and identify two interfaces mediating this host-pathogen interaction. An ILY-derived peptide based on the binding site inhibits pore formation in a CD59-containing liposome model system. These data provide insight into how CD59 coordinates ILY monomers, nucleating an early prepore state, and suggest a potential mechanism of inhibition for the complement terminal pathway.

  3. Safety and potential anticoagulant effects of nebulised heparin in burns patients with inhalational injury at Singapore General Hospital Burns Centre.

    Science.gov (United States)

    Yip, Lian Yee; Lim, Yen Fang; Chan, Hong Ngee

    2011-11-01

    Nebulised heparin, N-acetylcysteine (NAC) and salbutamol were shown to decrease reintubation rates, incidence of atelectasis and mortality in paediatric patients and reduce lung injury scores in adult burns patients with inhalational lung injury (ILI). Nebulised heparin, NAC and salbutamol treatment protocol was introduced in Singapore General Hospital (SGH) Burns Centre in 2006. However, safety data on the use of nebulised heparin and NAC for burns patients with ILI is not well established. In this study, we investigated the safety and potential anticoagulant effects of nebulised heparin in burns patients with ILI. A retrospective study with historical control was conducted. The treatment group consisted of 52 mechanically ventilated adult patients, with a diagnosis of ILI as confirmed by bronchoscopy, admitted to burn intensive care unit (BICU) from the year 2006 to 2009. The group was treated with nebulised heparin, NAC and salbutamol. The control group consists of 11 mechanically ventilated BICU ILI patients treated from year 2001 to 2005 before protocol initiation. Blood coagulation indices (prothrombin time (PT), activated partial thromboplastin time (APTT) and platelet count) were monitored and bleeding incidences were assessed. Blood coagulation indices did not suggest an increase risk of bleeding with nebulised heparin. The APTT, PT and platelet count followed a similar trend for both groups over 7 days. No clinically significant increase in bleeding risk was found to be associated with nebulised heparin. Nebulised heparin was not found to potentiate the risk of bleeding in burns patients with ILI. Copyright © 2011 Elsevier Ltd and ISBI. All rights reserved.

  4. Peran Kalsium Intraseluler pada Respon Seluler terhadap Intermedilysin Bakteri Komensal Oral Streptococcus Intermedius

    Directory of Open Access Journals (Sweden)

    Heni Susilowati

    2011-06-01

    Full Text Available Latar Belakang. Bakteri komensal oral Streptococcus intermedius mampu memproduksi intermedilysin (ILY, toksin yang berpotensi menyebabkan terbentuknya pori pada membran, yang termasuk dalam golongan cholesterol-dependent cytolysin. Toksin ini dikenal sebagai sitolisin yang unik karena sifatnya yang spesifik hanya menimbulkan respon pad a sel-sel manusia. Tujuan dari studi literatur ini adalah untuk memahami mekanisme sel-sel tubuh manusia dalam merespon paparan ILY. Ringkasan Pembahasan. Penelitian-penelitian terdahulu menunjukkan keterlibatan S. intermedius dalam infeksi purulen oral maupun nonoral karena kemampuannya memproduksi ILY. Intermedilysin diketahui meny.ebabkan ketidakseimbangan metabolisme sel dan kematian sel pada beberapa sel tubuh manusia seperti hepatosit, sel polimorfonuklear, bile duct cell, dan eritrosit. Spesifisitas ILY pada sel-sel tubuh manusia ditentukan oleh ikatan yang eksklusif hanya dengan reseptor membran human CD59. Pada beberapa kasus, ILY menimbulkan respon seluler melalui perubahan konsentrasi kalsium intraseluler ([Ca2+] i. Peningkatan konsentrasi [Ca2+]i mengakibatkan degranulasi sitoplasma pada sel PMN serta aktivasi kalsineurin yang diikuti dengan aktivasi faktor transkripsi NFAT1 pada sel HuCCT1 dan NF-KB pada sel HepG2. Kesimpulan. Studi literatur ini dapat disimpulkan bahwa peningkatan konsentrasi [Ca2+]i berperan penting dalam mekanisme respon seluler sel-sel tubuh manusia terhadap ILY yang diproduksi oleh S. intermedius.

  5. Sentinel surveillance of influenza-like-illness in two cities of the tropical country of Ecuador: 2006-2010.

    Science.gov (United States)

    Douce, Richard W; Aleman, Washington; Chicaiza-Ayala, Wilson; Madrid, Cesar; Sovero, Merly; Delgado, Franklin; Rodas, Mireya; Ampuero, Julia; Chauca, Gloria; Perez, Juan; Garcia, Josefina; Kochel, Tadeusz; Halsey, Eric S; Laguna-Torres, V Alberto

    2011-01-01

    Tropical countries are thought to play an important role in the global behavior of respiratory infections such as influenza. The tropical country of Ecuador has almost no documentation of the causes of acute respiratory infections. The objectives of this study were to identify the viral agents associated with influenza like illness (ILI) in Ecuador, describe what strains of influenza were circulating in the region along with their epidemiologic characteristics, and perform molecular characterization of those strains. This is a prospective surveillance study of the causes of ILI based on viral culture of oropharyngeal specimens and case report forms obtained in hospitals from two cities of Ecuador over 4 years. Out of 1,702 cases of ILI, nine viral agents were detected in 597 patients. During the time of the study, seven genetic variants of influenza circulated in Ecuador, causing six periods of increased activity. There appeared to be more heterogeneity in the cause of ILI in the tropical city of Guayaquil when compared with the Andean city of Quito. This was the most extensive documentation of the viral causes of ILI in Ecuador to date. Influenza was a common cause of ILI in Ecuador, causing more than one outbreak per year. There was no well defined influenza season although there were periods of time when no influenza was detected alternating with epidemics of different variant strains.

  6. Sentinel Surveillance of Influenza-Like-Illness in Two Cities of the Tropical Country of Ecuador: 2006–2010

    Science.gov (United States)

    Douce, Richard W.; Aleman, Washington; Chicaiza-Ayala, Wilson; Madrid, Cesar; Sovero, Merly; Delgado, Franklin; Rodas, Mireya; Ampuero, Julia; Chauca, Gloria; Perez, Juan; Garcia, Josefina; Kochel, Tadeusz; Halsey, Eric S.; Laguna-Torres, V. Alberto

    2011-01-01

    Background Tropical countries are thought to play an important role in the global behavior of respiratory infections such as influenza. The tropical country of Ecuador has almost no documentation of the causes of acute respiratory infections. The objectives of this study were to identify the viral agents associated with influenza like illness (ILI) in Ecuador, describe what strains of influenza were circulating in the region along with their epidemiologic characteristics, and perform molecular characterization of those strains. Methodology/Findings This is a prospective surveillance study of the causes of ILI based on viral culture of oropharyngeal specimens and case report forms obtained in hospitals from two cities of Ecuador over 4 years. Out of 1,702 cases of ILI, nine viral agents were detected in 597 patients. During the time of the study, seven genetic variants of influenza circulated in Ecuador, causing six periods of increased activity. There appeared to be more heterogeneity in the cause of ILI in the tropical city of Guayaquil when compared with the Andean city of Quito. Conclusions/Significance This was the most extensive documentation of the viral causes of ILI in Ecuador to date. Influenza was a common cause of ILI in Ecuador, causing more than one outbreak per year. There was no well defined influenza season although there were periods of time when no influenza was detected alternating with epidemics of different variant strains. PMID:21887216

  7. Sentinel surveillance of influenza-like-illness in two cities of the tropical country of Ecuador: 2006-2010.

    Directory of Open Access Journals (Sweden)

    Richard W Douce

    Full Text Available BACKGROUND: Tropical countries are thought to play an important role in the global behavior of respiratory infections such as influenza. The tropical country of Ecuador has almost no documentation of the causes of acute respiratory infections. The objectives of this study were to identify the viral agents associated with influenza like illness (ILI in Ecuador, describe what strains of influenza were circulating in the region along with their epidemiologic characteristics, and perform molecular characterization of those strains. METHODOLOGY/FINDINGS: This is a prospective surveillance study of the causes of ILI based on viral culture of oropharyngeal specimens and case report forms obtained in hospitals from two cities of Ecuador over 4 years. Out of 1,702 cases of ILI, nine viral agents were detected in 597 patients. During the time of the study, seven genetic variants of influenza circulated in Ecuador, causing six periods of increased activity. There appeared to be more heterogeneity in the cause of ILI in the tropical city of Guayaquil when compared with the Andean city of Quito. CONCLUSIONS/SIGNIFICANCE: This was the most extensive documentation of the viral causes of ILI in Ecuador to date. Influenza was a common cause of ILI in Ecuador, causing more than one outbreak per year. There was no well defined influenza season although there were periods of time when no influenza was detected alternating with epidemics of different variant strains.

  8. The impact of workplace policies and other social factors on self-reported influenza-like illness incidence during the 2009 H1N1 pandemic.

    Science.gov (United States)

    Kumar, Supriya; Quinn, Sandra Crouse; Kim, Kevin H; Daniel, Laura H; Freimuth, Vicki S

    2012-01-01

    We assessed the impact of social determinants of potential exposure to H1N1--which are unequally distributed by race/ethnicity in the United States--on incidence of influenza-like illness (ILI) during the 2009 H1N1 pandemic. In January 2010 we surveyed a nationally representative sample (n = 2079) of US adults from the Knowledge Networks online research panel, with Hispanic and African American oversamples. The completion rate was 56%. Path analysis examining ILI incidence, race, and social determinants of potential exposure to H1N1 demonstrated that higher ILI incidence was related to workplace policies, such as lack of access to sick leave, and structural factors, such as number of children in the household. Hispanic ethnicity was related to a greater risk of ILI attributable to these social determinants, even after we controlled for income and education. The absence of certain workplace policies, such as paid sick leave, confers a population-attributable risk of 5 million additional cases of ILI in the general population and 1.2 million cases among Hispanics. Federal mandates for sick leave could have significant health impacts by reducing morbidity from ILI, especially in Hispanics.

  9. JPRS Report, Science & Technology, USSR: Computers.

    Science.gov (United States)

    1988-07-08

    The question is whether the cooks ’ culinary art will rise to the challenge. /To be completed in the next issue./ FOOTNOTES 1, See ZNMfINE"SILA (No...Laboratory] Charter, Art 3, 1)1. As the crow flies, Vienna is just about 70 kilometers from Bratislava, and one sometimes gets the eerie feeling of...Charter, Art 3, UU 3,4. From Bratislava to Budapest is less than 200 kilometers, and Hungarian television is a nightly visitor in Slovak homes. That

  10. A study of the sewn-plank boats of Goa, India

    Digital Repository Service at National Institute of Oceanography (India)

    Shaikh, Z.A.; Tripati, S.; Shinde, V.

    ancient times. Early evidence The archaeological evidence regarding boats is very patchy in India. Recently, an iron fasten wooden boat was found in the excavations at Taikkal – Kadakkarapally (Tomalin et al., 2004) and a dugout made of single log... to this, boats are also portrayed on hero stones of Goa (950–1300 AD) which are displayed in the Archaeological Museum (ASI), Old Goa (Rajagopalan, 1987; and Sila Tripati, 2006). Recently, stone panels depicting boats) 10th–13th centuries AD) have been...

  11. Browse Author Index

    African Journals Online (AJOL)

    Items 101 - 150 of 1666 ... A B C D E F G H I J K L M N O P Q R S T U V W X Y Z All. O. Obomanu, FG · Obopile, M · Obroh, AA · Obueh, Henrietta O · Obukosia, SD · Obukosia, Silas D · Obuotor, EM · Obura, Pamela · Obute, GC · Obute, PN · Ocaña, A · Ocak, E · Ocak, S · Ocampo-Velazquez, RV · Ocampo-Velázquez, R

  12. Reconocimiento y discriminación ultrasónica. Aplicación a la descarga automática de contenedores

    OpenAIRE

    Suffo, Miguel

    2015-01-01

    La labor de los sensores estara dirigida a proporcionar informacion al robot de las posiciones de cada bandeja (silas hubiere) en el carro y, posteriormente, si se trata de un cajon ode una bandeja, yen este ultimo caso, a que perfil corresponde. Todo el proceso habra que realizarlo en un tiempo determinado, lo mas rapido posible con el fm de alcanzar una alta productividad. La informacion adquirida con los sensores sera transmitida al robot que tendra que acceder a las bandejas con su org...

  13. Simulation of Semiarid Stream Flow Using the 1D Model (Rubarbe), Case of Ksob Wadi in Algeria

    OpenAIRE

    Hasbaia, M.; Adoui, H.; Paquier, A.

    2015-01-01

    7th Groundwater Simposium of the IAHR, Perugia, ITA, 22-/09/2014 - 24/09/2014; International audience; This study aims to show the ability of 1D model to simulate the wadi flow during the flood. The wadi is a semiarid stream characterized by the non uniform geometry and an intermittent flow. These complexities can be modelled by a robust 1D model such as Rubarbe.In this article we study the 1994 flood of Ksob wadi that caused a large inundation of M'sila town in the center of Algeria. The sim...

  14. Timsko delo v v izobraževalnih organizacijah in analiza "insights" z metodo vpogleda do učinkovitega dela v timu

    Directory of Open Access Journals (Sweden)

    Darja Zorko Mencin

    2005-12-01

    Full Text Available Timsko delo je postalo realnost, potreba in nuja izobrazevalnih organizacij, ljudskih univerz in javnih ali zasebnih izobrazevalnih zavodov. Na podrocju izobrazevanja odraslih je zaradi specificnosti ciljnih skupin se toliko pomembneje, da namenjamo posebno pozornost timskemu delu. s pomocjo analize vpogleda v stevilnih mednarodnih organizacijah poteka transformacija posameznikov, delovnih timov in organizacije v doseganje dobrih poslovnih in razvojnih rezultatov. Analize kazejo, daje kljuc uspdnih podjetij v razvijanju odlicnih odnosov takas sodelavci kot s poslovnimi partnerji. Vedenje Clanov je postala gonilna sila pri organiziranju in vodenju uCinkovitega skupinskega dela.

  15. PRETKAZIVANJA BOLESTI I SMRTI, NADNARAVNI NAČINI PREVENTIVE BOLESTI I SMRTI I LIJEČENJA BOLESTI U LOVINAČKOM KRAJU

    OpenAIRE

    Hustić, Karla

    2010-01-01

    U radu autorica donosi prikaz raznolikih praksi povezanih s bolešću i smrti u pojedinim mjestima lovinačkog kraja u Lici. Rad se temelji na vlastitoj prikupljenoj terenskoj građi te dijelom i na građi prikupljenoj na prijašnjim terenskim istraživanjima. Prikazuju se načini pretkazivanja bolesti i smrti i njihova preventiva, liječenje uroka i nameta te uloga zmija u nadnaravnim praksama ljudi ovoga kraja. Sve razmatrane cjeline prožete su vjerovanjem u djelovanje nadnaravnih sila.

  16. UNDER THE SIGN OF SATURN: PLOTS AND MEMORIES OF THE COLONIAL WAR

    Directory of Open Access Journals (Sweden)

    Robson Dutra

    2013-11-01

    Full Text Available From the concepts of trauma and memory on, the objective of this text is to think on some aspect of Portuguese cultural identity in confrontation with Guinean ones presented on the novel A Última tragédia,(The last tra­gedy by Abdulai Sila (1995, reinforcing some discoursive strategies on colonialism and Colonial War. It also focuses on resistency associated to the tragedy brought up by the novel and registered by history as a way of questioning and evaluating the post colonial.

  17. Wikipedia usage estimates prevalence of influenza-like illness in the United States in near real-time.

    Science.gov (United States)

    McIver, David J; Brownstein, John S

    2014-04-01

    Circulating levels of both seasonal and pandemic influenza require constant surveillance to ensure the health and safety of the population. While up-to-date information is critical, traditional surveillance systems can have data availability lags of up to two weeks. We introduce a novel method of estimating, in near-real time, the level of influenza-like illness (ILI) in the United States (US) by monitoring the rate of particular Wikipedia article views on a daily basis. We calculated the number of times certain influenza- or health-related Wikipedia articles were accessed each day between December 2007 and August 2013 and compared these data to official ILI activity levels provided by the Centers for Disease Control and Prevention (CDC). We developed a Poisson model that accurately estimates the level of ILI activity in the American population, up to two weeks ahead of the CDC, with an absolute average difference between the two estimates of just 0.27% over 294 weeks of data. Wikipedia-derived ILI models performed well through both abnormally high media coverage events (such as during the 2009 H1N1 pandemic) as well as unusually severe influenza seasons (such as the 2012-2013 influenza season). Wikipedia usage accurately estimated the week of peak ILI activity 17% more often than Google Flu Trends data and was often more accurate in its measure of ILI intensity. With further study, this method could potentially be implemented for continuous monitoring of ILI activity in the US and to provide support for traditional influenza surveillance tools.

  18. ÖĞRETMEN ADAYLARININ SAHİP OLDUKLARI DEĞERLER İLE KİŞİLİK ÖZELLİKLERİ ARASINDAKİ İLİŞKİNİN İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Münevver YILDIZ

    2012-05-01

    Full Text Available Bu araştırmada, öğretmen adaylarının sahip oldukları değerler ile kişilik özellikleri arasındaki ilişkinin incelenmesi amaçlanmıştır. Bu araştırma genel tarama modelinin bir alt türü olan ilişkisel tarama modelidir. Araştırmanın çalışma grubunu, Selçuk.Üniversitesi . Ahmet Keleşoğlu Eğitim Fakültesinde öğrenim gören 1245 öğretmen adayından oluşmaktadır. Araştırmada veri toplama araçları olarak; Schwartz Değerler Listesi ve Sıfatlara Dayalı Kişilik Testidir. Araştırma sonuçlarına göre;  sırasıyla güç alt boyutu arasında,  öz denetim, evrensellik, yardımseverlik, uyum ve güvenlik puanları arasında bir ilişki olduğu, bu ilişkilerden duygusal dengesizlik ile güç arasındaki ilişki pozitif yönde diğer ilişkilerde negatif yönde bir ilişki olduğu görülmektedir.

  19. The influence of staff and resident immunization rates on influenza-like illness outbreaks in nursing homes.

    Science.gov (United States)

    Shugarman, Lisa R; Hales, Craig; Setodji, Claude Messan; Bardenheier, Barbara; Lynn, Joanne

    2006-11-01

    To evaluate the influence of immunization rates on the likelihood of influenza-like illness (ILI) clusters in nursing facilities. Retrospective cross-sectional study. Nursing facilities in a single for-profit chain (N = 301). Nursing home residents and staff in each facility. Resident and staff influenza immunization rates during the 2004-2005 influenza season, indicator of ILI cluster in facility defined as 3+ ILI cases reported within 72 hours in close proximity within the facility, hospitalization and mortality rates for facilities reporting ILI clusters, indicator of confirmatory laboratory testing for ILI cases in facility. Staff (median = 38%) and resident (median = 85%) rates of immunization did not independently predict the likelihood of an outbreak but jointly were strong predictors. For example, facilities having greater than 55% of staff and greater than 89% of residents immunized were almost 60% less likely to have an ILI cluster (odds ratio [OR]: 0.410; 95% CI: 0.19, 0.89) compared to all others. Facilities with higher proportions of Medicaid-funded residents were less likely to have an outbreak. Each 1% increase in the proportion of residents with Medicaid was associated with a 2.5% decrease in the risk of a cluster (OR: 0.975; 95% CI: 0.956, 0.995). Bed size and staff size did not significantly influence the likelihood of an outbreak. Among facilities with outbreaks, higher vaccination rates did not predict lower rates of hospitalizations or deaths. Approximately two thirds of all ILI clusters had laboratory testing to confirm the diagnosis of influenza. Three quarters of the facilities in which outbreaks occurred and for which confirmatory tests were performed (50/67, 74.6%) had 1+ cases positively identified as influenza. Both staff and residents must have high rates of vaccination to substantially alter the rate and impact of influenza outbreaks in nursing facilities.

  20. Monitoring influenza activity in the United States: a comparison of traditional surveillance systems with Google Flu Trends.

    Directory of Open Access Journals (Sweden)

    Justin R Ortiz

    2011-04-01

    Full Text Available Google Flu Trends was developed to estimate US influenza-like illness (ILI rates from internet searches; however ILI does not necessarily correlate with actual influenza virus infections.Influenza activity data from 2003-04 through 2007-08 were obtained from three US surveillance systems: Google Flu Trends, CDC Outpatient ILI Surveillance Network (CDC ILI Surveillance, and US Influenza Virologic Surveillance System (CDC Virus Surveillance. Pearson's correlation coefficients with 95% confidence intervals (95% CI were calculated to compare surveillance data. An analysis was performed to investigate outlier observations and determine the extent to which they affected the correlations between surveillance data. Pearson's correlation coefficient describing Google Flu Trends and CDC Virus Surveillance over the study period was 0.72 (95% CI: 0.64, 0.79. The correlation between CDC ILI Surveillance and CDC Virus Surveillance over the same period was 0.85 (95% CI: 0.81, 0.89. Most of the outlier observations in both comparisons were from the 2003-04 influenza season. Exclusion of the outlier observations did not substantially improve the correlation between Google Flu Trends and CDC Virus Surveillance (0.82; 95% CI: 0.76, 0.87 or CDC ILI Surveillance and CDC Virus Surveillance (0.86; 95%CI: 0.82, 0.90.This analysis demonstrates that while Google Flu Trends is highly correlated with rates of ILI, it has a lower correlation with surveillance for laboratory-confirmed influenza. Most of the outlier observations occurred during the 2003-04 influenza season that was characterized by early and intense influenza activity, which potentially altered health care seeking behavior, physician testing practices, and internet search behavior.

  1. Monitoring Influenza Activity in the United States: A Comparison of Traditional Surveillance Systems with Google Flu Trends

    Science.gov (United States)

    Ortiz, Justin R.; Zhou, Hong; Shay, David K.; Neuzil, Kathleen M.; Fowlkes, Ashley L.; Goss, Christopher H.

    2011-01-01

    Background Google Flu Trends was developed to estimate US influenza-like illness (ILI) rates from internet searches; however ILI does not necessarily correlate with actual influenza virus infections. Methods and Findings Influenza activity data from 2003–04 through 2007–08 were obtained from three US surveillance systems: Google Flu Trends, CDC Outpatient ILI Surveillance Network (CDC ILI Surveillance), and US Influenza Virologic Surveillance System (CDC Virus Surveillance). Pearson's correlation coefficients with 95% confidence intervals (95% CI) were calculated to compare surveillance data. An analysis was performed to investigate outlier observations and determine the extent to which they affected the correlations between surveillance data. Pearson's correlation coefficient describing Google Flu Trends and CDC Virus Surveillance over the study period was 0.72 (95% CI: 0.64, 0.79). The correlation between CDC ILI Surveillance and CDC Virus Surveillance over the same period was 0.85 (95% CI: 0.81, 0.89). Most of the outlier observations in both comparisons were from the 2003–04 influenza season. Exclusion of the outlier observations did not substantially improve the correlation between Google Flu Trends and CDC Virus Surveillance (0.82; 95% CI: 0.76, 0.87) or CDC ILI Surveillance and CDC Virus Surveillance (0.86; 95%CI: 0.82, 0.90). Conclusions This analysis demonstrates that while Google Flu Trends is highly correlated with rates of ILI, it has a lower correlation with surveillance for laboratory-confirmed influenza. Most of the outlier observations occurred during the 2003–04 influenza season that was characterized by early and intense influenza activity, which potentially altered health care seeking behavior, physician testing practices, and internet search behavior. PMID:21556151

  2. Stabilization of an expansive overconsolidated clay using hydraulic binders

    Directory of Open Access Journals (Sweden)

    Abdelkrim Mahamedi

    2015-04-01

    Full Text Available Urban areas of the wilaya of M’sila in Algeria nowadays experience a considerable development because of an unceasingly increasing demography, from where its extension toward virgin zones is often less favorable than those already urbanized. This wilaya is located in a zone classified as semi-arid, whose geology comprises clayey formations characterized by a high variation of volume when the conditions of their equilibrium are modified (natural climatic phenomena due to a prolonged dryness, human activity by modification of the ground water level because of excessive pumping, configuration of constructions in their environment. This paper presents and analyzes the results of a series of laboratory tests (identification, compaction, penetration and direct shear tests performed on an expansive overconsolidated clay obtained from an urban site situated in Sidi-Hadjrès city (wilaya of M’sila, Algeria, where significant damages frequently appear in the road infrastructures and in the light structures. Test results obtained show that the geotechnical parameteric values deduced from these tests are concordant and confirm the bearing capacity improvement of this natural clay treated with hydraulic binders (composed Portland cement and extinct lime and compacted under the optimum Proctor conditions, which is translated by a significant increase in soil strength and its durability.

  3. A case study of the New York City 2012-2013 influenza season with daily geocoded Twitter data from temporal and spatiotemporal perspectives.

    Science.gov (United States)

    Nagar, Ruchit; Yuan, Qingyu; Freifeld, Clark C; Santillana, Mauricio; Nojima, Aaron; Chunara, Rumi; Brownstein, John S

    2014-10-20

    Twitter has shown some usefulness in predicting influenza cases on a weekly basis in multiple countries and on different geographic scales. Recently, Broniatowski and colleagues suggested Twitter's relevance at the city-level for New York City. Here, we look to dive deeper into the case of New York City by analyzing daily Twitter data from temporal and spatiotemporal perspectives. Also, through manual coding of all tweets, we look to gain qualitative insights that can help direct future automated searches. The intent of the study was first to validate the temporal predictive strength of daily Twitter data for influenza-like illness emergency department (ILI-ED) visits during the New York City 2012-2013 influenza season against other available and established datasets (Google search query, or GSQ), and second, to examine the spatial distribution and the spread of geocoded tweets as proxies for potential cases. From the Twitter Streaming API, 2972 tweets were collected in the New York City region matching the keywords "flu", "influenza", "gripe", and "high fever". The tweets were categorized according to the scheme developed by Lamb et al. A new fourth category was added as an evaluator guess for the probability of the subject(s) being sick to account for strength of confidence in the validity of the statement. Temporal correlations were made for tweets against daily ILI-ED visits and daily GSQ volume. The best models were used for linear regression for forecasting ILI visits. A weighted, retrospective Poisson model with SaTScan software (n=1484), and vector map were used for spatiotemporal analysis. Infection-related tweets (R=.763) correlated better than GSQ time series (R=.683) for the same keywords and had a lower mean average percent error (8.4 vs 11.8) for ILI-ED visit prediction in January, the most volatile month of flu. SaTScan identified primary outbreak cluster of high-probability infection tweets with a 2.74 relative risk ratio compared to medium

  4. Partial meal replacement plan and quality of the diet at one year: Action for Health in Diabetes (Look AHEAD) Trial

    Science.gov (United States)

    Raynor, Hollie A.; Anderson, Andrea M.; Miller, Gary D.; Reeves, Rebecca; Delahanty, Linda M.; Vitolins, Mara Z.; Harper, Patricia; Mobley, Connie; Konersman, Kati; Mayer-Davis, Elizabeth

    2014-01-01

    Background Little is known about diet quality with a reduced-energy, low-fat, partial meal replacement (PMR) plan, especially in individuals with type 2 diabetes. The Action for Health in Diabetes (Look AHEAD) trial implemented a PMR plan in the intensive lifestyle intervention (ILI). Objective Compare dietary intake and percent meeting fat-related and food group dietary recommendations in ILI and diabetes support and education (DSE) groups at 12 months. Design Randomized controlled trial, comparing ILI to DSE, at 0- and 12-months. Participants/setting From 16 United States sites, the first 50% of participants (aged 45 to 76 years, overweight or obese, with type 2 diabetes) were invited to complete dietary assessments. Complete 0- and 12-month dietary assessments (collected between 2001 and 2004) were available on 2,397 participants (46.6% of total participants), with 1,186 randomized to DSE and 1,211 randomized to ILI. Main outcome measures A food frequency questionnaire assessed intake: energy; percent energy from protein, fat, carbohydrate, polyunsaturated fatty acids (PUFA), and saturated fats; trans fatty acids; cholesterol; fiber; weekly meal replacements (MRs); and daily servings from food groups from the Food Guide Pyramid. Statistical analyses performed Mixed-factor analyses of covariance (ANCOVA), using Proc MIXED with a repeated statement, with age, sex, race/ethnicity, education, and income controlled. Unadjusted chi-square tests compared percent meeting fat-related and food group recommendations at 12 months. Results At 12 months, ILI had a significantly lower fat and cholesterol intake and greater fiber intake than DSE. ILI consumed more servings/day of fruits; vegetables; and milk, yogurt & cheese; and fewer servings/day of fats, oils & sweets than DSE. A greater percentage of ILI than DSE participants met fat-related and most food group recommendations. Within ILI, a greater percentage of participants consuming ≥ 2 MRs/day than food group

  5. LANL* V1.0: a radiation belt drift shell model suitable for real-time and reanalysis applications

    Directory of Open Access Journals (Sweden)

    J. Koller

    2009-07-01

    Full Text Available We describe here a new method for calculating the magnetic drift invariant, <i>L*>, that is used for modeling radiation belt dynamics and for other space weather applications. <i>L*> (pronounced L-star is directly proportional to the integral of the magnetic flux contained within the surface defined by a charged particle moving in the Earth's geomagnetic field. Under adiabatic changes to the geomagnetic field <i>L*> is a conserved quantity, while under quasi-adiabatic fluctuations diffusion (with respect to a particle's <i>L*> is the primary term in equations of particle dynamics. In particular the equations of motion for the very energetic particles that populate the Earth's radiation belts are most commonly expressed by diffusion in three dimensions: <i>L*>, energy (or momentum, and pitch angle (the dot product of velocity and the magnetic field vector. Expressing dynamics in these coordinates reduces the dimensionality of the problem by referencing the particle distribution functions to values at the magnetic equatorial point of a magnetic "drift shell" (or L-shell irrespective of local time (or longitude. While the use of <i>L*> aids in simplifying the equations of motion, practical applications such as space weather forecasting using realistic geomagnetic fields require sophisticated magnetic field models that, in turn, require computationally intensive numerical integration. Typically a single <i>L*> calculation can require on the order of 105 calls to a magnetic field model and each point in the simulation domain and each calculated pitch angle has a different value of <i>L*>. We describe here the development and validation of a neural network surrogate model for calculating <i>L*> in sophisticated geomagnetic field models with a high degree of fidelity at computational speeds that are millions of times faster than direct numerical field line mapping and integration. This new surrogate model has

  6. Demonstrating the use of high-volume electronic medical claims data to monitor local and regional influenza activity in the US.

    Directory of Open Access Journals (Sweden)

    Cécile Viboud

    Full Text Available Fine-grained influenza surveillance data are lacking in the US, hampering our ability to monitor disease spread at a local scale. Here we evaluate the performances of high-volume electronic medical claims data to assess local and regional influenza activity.We used electronic medical claims data compiled by IMS Health in 480 US locations to create weekly regional influenza-like-illness (ILI time series during 2003-2010. IMS Health captured 62% of US outpatient visits in 2009. We studied the performances of IMS-ILI indicators against reference influenza surveillance datasets, including CDC-ILI outpatient and laboratory-confirmed influenza data. We estimated correlation in weekly incidences, peak timing and seasonal intensity across datasets, stratified by 10 regions and four age groups (<5, 5-29, 30-59, and 60+ years. To test IMS-Health performances at the city level, we compared IMS-ILI indicators to syndromic surveillance data for New York City. We also used control data on laboratory-confirmed Respiratory Syncytial Virus (RSV activity to test the specificity of IMS-ILI for influenza surveillance.Regional IMS-ILI indicators were highly synchronous with CDC's reference influenza surveillance data (Pearson correlation coefficients rho≥0.89; range across regions, 0.80-0.97, P<0.001. Seasonal intensity estimates were weakly correlated across datasets in all age data (rho≤0.52, moderately correlated among adults (rho≥0.64 and uncorrelated among school-age children. IMS-ILI indicators were more correlated with reference influenza data than control RSV indicators (rho = 0.93 with influenza v. rho = 0.33 with RSV, P<0.05. City-level IMS-ILI indicators were highly consistent with reference syndromic data (rho≥0.86.Medical claims-based ILI indicators accurately capture weekly fluctuations in influenza activity in all US regions during inter-pandemic and pandemic seasons, and can be broken down by age groups and fine geographical areas

  7. Impact of medical and behavioural factors on influenza-like illness, healthcare-seeking, and antiviral treatment during the 2009 H1N1 pandemic: USA, 2009-2010.

    Science.gov (United States)

    Biggerstaff, M; Jhung, M A; Reed, C; Garg, S; Balluz, L; Fry, A M; Finelli, L

    2014-01-01

    We analysed a cross-sectional telephone survey of U.S. adults to assess the impact of selected characteristics on healthcare-seeking behaviours and treatment practices of people with influenza-like illness (ILI) from September 2009 to March 2010. Of 216,431 respondents, 8.1% reported ILI. After adjusting for selected characteristics, respondents aged 18-64 years with the following factors were more likely to report ILI: a diagnosis of asthma [adjusted odds ratio (aOR) 1.88, 95% CI 1.67-2.13] or heart disease (aOR 1.41, 95% CI 1.17-1.70), being disabled (aOR 1.75, 95% CI 1.57-1.96), and reporting financial barriers to healthcare access (aOR 1.63, 95% CI 1.45-1.82). Similar associations were seen in respondents aged ≥ 65 years. Forty percent of respondents with ILI sought healthcare, and 14% who sought healthcare reported receiving influenza antiviral treatment. Treatment was not more frequent in patients with high-risk conditions, except those aged 18-64 years with heart disease (aOR 1.90, 95% CI 1.03-3.51). Of patients at high risk for influenza complications, self-reported ILI was greater but receipt of antiviral treatment was not, despite guidelines recommending their use in this population.

  8. Use of an automated circuit for isolated limb infusion for malignancy.

    Science.gov (United States)

    Grobmyer, S R; Filichia, L; Robinson, A R; Clark, T D; Vaughn, K; Copeland, E M; Hochwald, S N

    2010-12-01

    Isolated limb infusion (ILI) for recurrent or in-transit melanoma is an accepted technique that allows high-dose chemotherapy to be delivered to an extremity with minimal systemic toxicity. Current infusion systems have relied on manual delivery of drugs and circulation of blood during the treatment. Herein, we document our initial results with an automated circuit for ILI as an alternative to the manual technique. Patients undergoing ILI with an automated circuit for recurrent or advanced malignancy were identified. ILI was performed utilizing a Sarns 8000 roller pump attached to a Cobe 4:1 cardioplegia set with heat exchanger with a total priming volume of 80 ml. Melphalan (7.5 mg/L) and Dactinomycin (75 μg/L) doses which were corrected for ideal body weight were delivered via the infusion circuit after limb temperature reached 38 °C. Fourteen lower extremity infusion procedures were performed in 10 patients. Successful infusion procedures were completed in all patients using the automated circuit. Constant flow rates of 50-70 cc/minute were achievable with the automated circuit. Acute toxicity and clinical results were similar to that reported with manual delivery systems. ILI for advanced malignancy utilizing an automated circuit is feasible and safe. This automated system offers a safe and reliable alternative to the manual infusion technique. Copyright © 2010 Elsevier Ltd. All rights reserved.

  9. Adiponectin and the mediation of HDL-cholesterol change with improved lifestyle: the Look AHEAD Study[S

    Science.gov (United States)

    Belalcazar, L. Maria; Lang, Wei; Haffner, Steven M.; Hoogeveen, Ron C.; Pi-Sunyer, F. Xavier; Schwenke, Dawn C.; Balasubramanyam, Ashok; Tracy, Russell P.; Kriska, Andrea P.; Ballantyne, Christie M.

    2012-01-01

    Adipose tissue dysfunction plays a key role in the development of the metabolic abnormalities characteristic of type 2 diabetes (T2DM) and participates actively in lipid metabolism. Adiponectin, found abundantly in circulation and a marker of adipose health, is decreased in obese persons with T2DM. We investigated whether the changes in adiponectin with an intensive lifestyle intervention (ILI) for weight loss could potentially mediate the increase in low HDL-cholesterol (HDL-C) with ILI. Adiponectin and its fractions were determined using an ELISA with selective protease treatment in 1,397 participants from Look AHEAD, a trial examining whether ILI will reduce cardiovascular events in overweight/obese subjects with T2DM when compared with a control arm, diabetes support and education (DSE). Multivariable regression and mediational analyses were performed for adiponectin and its high-molecular-weight (HMW) and non-HMW fractions. ILI increased baseline HDL-C by 9.7% and adiponectin by 11.9%; changes with DSE were 1.3% and 0.2%, respectively (P < 0.0001). In a model including changes in weight, fitness, triglycerides, and glucose control and that adjusted for demographics and medical history, adiponectin changes remained significantly associated with HDL-C change. Data supported the contribution of changes in both HMW- and non-HMW-adiponectin to the improvement in HDL-C with ILI PMID:22956782

  10. Adiponectin and the mediation of HDL-cholesterol change with improved lifestyle: the Look AHEAD Study.

    Science.gov (United States)

    Belalcazar, L Maria; Lang, Wei; Haffner, Steven M; Hoogeveen, Ron C; Pi-Sunyer, F Xavier; Schwenke, Dawn C; Balasubramanyam, Ashok; Tracy, Russell P; Kriska, Andrea P; Ballantyne, Christie M

    2012-12-01

    Adipose tissue dysfunction plays a key role in the development of the metabolic abnormalities characteristic of type 2 diabetes (T2DM) and participates actively in lipid metabolism. Adiponectin, found abundantly in circulation and a marker of adipose health, is decreased in obese persons with T2DM. We investigated whether the changes in adiponectin with an intensive lifestyle intervention (ILI) for weight loss could potentially mediate the increase in low HDL-cholesterol (HDL-C) with ILI. Adiponectin and its fractions were determined using an ELISA with selective protease treatment in 1,397 participants from Look AHEAD, a trial examining whether ILI will reduce cardiovascular events in overweight/obese subjects with T2DM when compared with a control arm, diabetes support and education (DSE). Multivariable regression and mediational analyses were performed for adiponectin and its high-molecular-weight (HMW) and non-HMW fractions. ILI increased baseline HDL-C by 9.7% and adiponectin by 11.9%; changes with DSE were 1.3% and 0.2%, respectively (P < 0.0001). In a model including changes in weight, fitness, triglycerides, and glucose control and that adjusted for demographics and medical history, adiponectin changes remained significantly associated with HDL-C change. Data supported the contribution of changes in both HMW- and non-HMW-adiponectin to the improvement in HDL-C with ILI.

  11. Metabolic factors, adipose tissue, and plasminogen activator inhibitor-1 levels in type 2 diabetes: findings from the look AHEAD study.

    Science.gov (United States)

    Belalcazar, L Maria; Ballantyne, Christie M; Lang, Wei; Haffner, Steven M; Rushing, Julia; Schwenke, Dawn C; Pi-Sunyer, F Xavier; Tracy, Russell P

    2011-07-01

    Plasminogen activator inhibitor-1 (PAI-1) production by adipose tissue is increased in obesity, and its circulating levels are high in type 2 diabetes. PAI-1 increases cardiovascular risk by favoring clot stability, interfering with vascular remodeling, or both. We investigated in obese diabetic persons whether an intensive lifestyle intervention for weight loss (ILI) would decrease PAI-1 levels independently of weight loss and whether PAI-1 reduction would be associated with changes in fibrinogen, an acute phase reactant, or fibrin fragment D-dimer (D-dimer), a marker of ambient coagulation balance. We examined 1-year changes in PAI-1, D-dimer, and fibrinogen levels; adiposity; fitness; glucose; and lipid control with ILI in 1817 participants from Look AHEAD, a randomized trial investigating the effects of ILI, compared with usual care, on cardiovascular events in overweight or obese diabetic persons. Median PAI-1 levels decreased 29% with ILI and 2.5% with usual care (P < 0.0001). Improvements in fitness, glucose control, and high-density lipoprotein cholesterol were associated with decreased PAI-1, independently of weight loss (P = 0.03 for fitness, P < 0.0001 for others). Fibrinogen and D-dimer remained unchanged. Reductions in PAI-1 levels with ILI in obese diabetic individuals may reflect an improvement in adipose tissue health that could affect cardiovascular risk without changing fibrinogen or d-dimer levels. Clinical Trial Registration- URL: http://clinicaltrials.gov/ct2/show/NCT00017953. Unique identifier: NCT00017953.

  12. Outbreaks of influenza-like illness in long-term care facilities in Winnipeg, Canada.

    Science.gov (United States)

    Mahmud, Salaheddin M; Thompson, Laura H; Nowicki, Deborah L; Plourde, Pierre J

    2013-11-01

    Outbreaks of influenza-like illness (ILI) are common in long-term care facilities (LTCFs) and result in significant morbidity and mortality among residents. We describe patterns of reported ILI outbreaks in LTCFs in Winnipeg, Canada, and examine LTCF and outbreak characteristics that influence the clinical outcomes of these outbreaks. We analyzed the electronic records of all ILI outbreaks reported by LTCFs in Winnipeg from 2003 to 2011. Outbreak duration, ILI attack rates among staff and residents, and residents' death rates were calculated by presumed viral etiology, staff vaccination rates, type of influenza chemoprophylaxis used, and time to notification to public health. Of a total of 154 reported outbreaks, most (N=80) were attributed to influenza, and these outbreaks tended to have higher attack and death rates among LTCF residents compared with outbreaks caused by other respiratory viruses (12) or those of unknown etiology (62). About 92% of residents and 38% of staff of the average LTCFs were vaccinated. Chemoprophylaxis was used in 57·5% of influenza outbreaks. Regardless of presumed viral etiology, outbreaks reported within 3 days of onset ended sooner and had lower attack and mortality rates among residents. Influenza-like illness outbreaks still occur among highly immunized LTCF residents, so in addition to vaccination of staff and residents, it is important to maintain competent infection control practices. Early identification and notification to public health authorities and possibly early initiation of control measures could improve clinical outcomes of ILI outbreaks. © 2012 John Wiley & Sons Ltd.

  13. Impact of an Intensive Lifestyle Intervention on Use and Cost of Medical Services Among Overweight and Obese Adults With Type 2 Diabetes: The Action for Health in Diabetes

    Science.gov (United States)

    Glick, Henry A.; Bertoni, Alain; Brancati, Frederick L.; Bray, George A.; Clark, Jeanne M.; Curtis, Jeffrey M.; Egan, Caitlin; Evans, Mary; Foreyt, John P.; Ghazarian, Siran; Gregg, Edward W.; Hazuda, Helen P.; Hill, James O.; Hire, Don; Horton, Edward S.; Hubbard, Van S.; Jakicic, John M.; Jeffery, Robert W.; Johnson, Karen C.; Kahn, Steven E.; Killean, Tina; Kitabchi, Abbas E.; Knowler, William C.; Kriska, Andrea; Lewis, Cora E.; Miller, Marsha; Montez, Maria G.; Murillo, Anne; Nathan, David M.; Nyenwe, Ebenezer; Patricio, Jennifer; Peters, Anne L.; Pi-Sunyer, Xavier; Pownall, Henry; Redmon, J. Bruce; Rushing, Julia; Ryan, Donna H.; Safford, Monika; Tsai, Adam G.; Wadden, Thomas A.; Wing, Rena R.; Yanovski, Susan Z.; Zhang, Ping

    2014-01-01

    OBJECTIVE To assess the relative impact of an intensive lifestyle intervention (ILI) on use and costs of health care within the Look AHEAD trial. RESEARCH DESIGN AND METHODS A total of 5,121 overweight or obese adults with type 2 diabetes were randomly assigned to an ILI that promoted weight loss or to a comparison condition of diabetes support and education (DSE). Use and costs of health-care services were recorded across an average of 10 years. RESULTS ILI led to reductions in annual hospitalizations (11%, P = 0.004), hospital days (15%, P = 0.01), and number of medications (6%, P < 0.001), resulting in cost savings for hospitalization (10%, P = 0.04) and medication (7%, P < 0.001). ILI produced a mean relative per-person 10-year cost savings of $5,280 (95% CI 3,385–7,175); however, these were not evident among individuals with a history of cardiovascular disease. CONCLUSIONS Compared with DSE over 10 years, ILI participants had fewer hospitalizations, fewer medications, and lower health-care costs. PMID:25147253

  14. The accuracy and timeliness of neuraminidase inhibitor dispensing data for predicting laboratory-confirmed influenza.

    Science.gov (United States)

    Papenburg, J; Charland, K M; DE Serres, G; Buckeridge, D L

    2016-06-01

    Neuraminidase inhibitor (NI) dispensing has emerged as a possible automated data source for influenza surveillance. We aimed to evaluate its timeliness, correlation, and predictive accuracy in relation to influenza activity in Quebec, Canada, 2010-2013. Our secondary objective was to use the same metrics to compare NI dispensing to visits for influenza-like illness (ILI) in emergency departments (EDs). Provincial weekly counts of positive influenza laboratory tests were used as a reference measure for the level of influenza circulation. We applied ARIMA models to account for serial correlation. We computed cross-correlations to measure the strengths of association and lead-lag relationships between NI dispensing, ILI ED visits, and our reference indicator. Finally, using an ARIMA model, we evaluated the ability of NI dispensing and ILI ED visits to predict laboratory-confirmed influenza. NI dispensing was significantly correlated (R = 0·68) with influenza activity with no lag. The maximal correlation of ILI ED visits was not as strong (R = 0·50). Both NI dispensing and ILI ED visits were significant predictors of laboratory-confirmed influenza in a multivariable model; predictive potential was greatest when NI counts were lagged to precede laboratory surveillance by 2 weeks. We conclude that NI dispensing data provides timely and valuable information for influenza surveillance.

  15. Identifying influenza-like illness presentation from unstructured general practice clinical narrative using a text classifier rule-based expert system versus a clinical expert.

    Science.gov (United States)

    MacRae, Jayden; Love, Tom; Baker, Michael G; Dowell, Anthony; Carnachan, Matthew; Stubbe, Maria; McBain, Lynn

    2015-10-06

    We designed and validated a rule-based expert system to identify influenza like illness (ILI) from routinely recorded general practice clinical narrative to aid a larger retrospective research study into the impact of the 2009 influenza pandemic in New Zealand. Rules were assessed using pattern matching heuristics on routine clinical narrative. The system was trained using data from 623 clinical encounters and validated using a clinical expert as a gold standard against a mutually exclusive set of 901 records. We calculated a 98.2 % specificity and 90.2 % sensitivity across an ILI incidence of 12.4 % measured against clinical expert classification. Peak problem list identification of ILI by clinical coding in any month was 9.2 % of all detected ILI presentations. Our system addressed an unusual problem domain for clinical narrative classification; using notational, unstructured, clinician entered information in a community care setting. It performed well compared with other approaches and domains. It has potential applications in real-time surveillance of disease, and in assisted problem list coding for clinicians. Our system identified ILI presentation with sufficient accuracy for use at a population level in the wider research study. The peak coding of 9.2 % illustrated the need for automated coding of unstructured narrative in our study.

  16. Expectations and Experiences of Information Literacy Instruction

    Directory of Open Access Journals (Sweden)

    Saga Pohjola-Ahlin

    2016-11-01

    Full Text Available In May 2016, 48 third semester undergraduate students enrolled in the physiotherapy program at Karolinska Institutet in Sweden were given three sets of questionnaires; before the information literacy instruction (ILI started, at the end of the first session, and a week after, at the end of the second and last session. The aim of this small-scale pilot study was to shed some light on students’ motivation to attend ILI, how they value the sessions afterwards and how they assess their learning outcome. Furthermore, it was an attempt to do a "students’ user experience study” in a pedagogical setting, with the intention to evaluate and improve teaching in ILI to meet student expectations. The average response rate for the three questionnaires was 92%. The results show that students’ expectations were similar to the actual content of ILI, and that the students were satisfied with their own learning outcome. Both motivation and the sense of relevance got higher scores after students attended ILI. Motivation rose from 7,4 to 8,12 out of 10. This is positive because a high level of motivation often improves the learning outcome (Schunk, 2012. When asked which areas most needed improvement in order to further enhance their learning outcome, the most common responses were “the pedagogy” and “my own achievement”. It would be interesting to start collaborating with a group of students in order to explore new methods and learning activities.

  17. TÜRKİYE’DE PARA ARZI, FAİZ ORANI VE HİSSE SENEDİ FİYATLARI ARASINDAKİ NEDENSEL İLİŞKİLERİN ANALİZİ

    OpenAIRE

    Serpil TÜRKYILMAZ; Özata, Erkan

    2009-01-01

    Bu çalışmada, Türkiye’de 2001:05-2005:12 dönemi için Para Arzı (M1), Faiz Oranları ve Hisse Senedi Fiyatları arasındaki dinamik ilişkiler incelenmiştir. Bu amaçla, bir Standart VAR Modeli altında, Granger Nedensellik Testi ile değişkenler arasındaki nedensellik ilişkilerinin yönü belirlenmeye çalışılmış, Para Arzı’ ndan Hisse Senedi Fiyatları’ na doğru tek yönlü bir nedensellik ilişkisi bulunmuştur. Standart VAR modeli yardımıyla elde edilen Etki- Tepki Analizi ve Varyans Ayrımlaştırma Analiz...

  18. Pravičan i pošten tretman ulaganja u međunarodnom investicijskom pravu

    OpenAIRE

    Babić, Davor

    2012-01-01

    Pošten i pravičan tretman je najvažniji standard zaštite ulaganja u suvremenom međunarodnom pravu . U većini investicijskih arbitraža, na standard se pozivaju tužitelji ili samostalno ili u kombinaciji s drugima standardima zaštite. Istovremeno, pošten i pravičan tretman je najopćenitiji standard zaštite ulaganja. Dok su standardi poput nacionalnog tretmana, tretman najpovlaštenije nacije ili ograničenja od izvlaštenja bar donekle definirani u dosegu, značenja poštenog i pravičnog tretmana je...

  19. Estimating the influenza vaccine effectiveness in elderly on a yearly basis using the Spanish influenza surveillance network--pilot case-control studies using different control groups, 2008-2009 season, Spain.

    Science.gov (United States)

    Savulescu, Camelia; Valenciano, Marta; de Mateo, Salvador; Larrauri, Amparo

    2010-04-01

    We conducted a case-control and screening method studies to estimate influenza vaccine effectiveness (IVE) in the age group >or=65 years, based on the Spanish Influenza Sentinel Surveillance System (SISSS). Cases (influenza laboratory-confirmed) were compared to influenza-negative ILI patients (test-negative) and patients without ILI since the beginning of the season (non-ILI). For the screening method, cases' vaccination coverage was compared to the vaccination coverage of the GPs' catchment population. The results suggested a protective effect of the vaccine against laboratory-confirmed influenza in elderly in 2008-2009. The screening method and the test-negative control designs enable estimating IVE using exclusively SISSS data. (c) 2010 Elsevier Ltd. All rights reserved.

  20. Nutrigenomik Teknolojileri

    Directory of Open Access Journals (Sweden)

    Arzu Kart Gündoğdu

    2015-02-01

    Full Text Available Nutrigenomik (Genetik beslenme bilimi beslenme ve insan genomu arasındaki ilişkileri ele almaktadır. Ayrıca, nutrigenomik teknolojileri (genomik, proteomik, transkriptomik ve biyoinformatik ile bu ilişkilerin temelinde yatan mekanizmaların anlaşılması yönünde çalışmalar yapmaktadır. Bu teknolojiler sayesinde, kişisel diyet reçeteleri hazırlanarak, ileride daha sağlıklı bir yaşam tarzı geliştirmek ve kronik hastalık risklerini azaltmak mümkün olabilecektir. Bu derlemede nutigenomik teknolojileri ve bu teknolojiler ile insan beslenmesi arasındaki ilişki hakkında bilgi verilmesi amaçlanmıştır.

  1. Ocena tveganja vnosa kadmija z vrtninami na lokalno prebivalstvo Mestne občine Celje

    OpenAIRE

    Karo Bešter, Petra

    2014-01-01

    Na onesnaženih območjih so lahko ljudje dodatno izpostavljeni kadmiju preko zaužitja pridelanih vrtnin. Za nekadilce predstavljajo živila glavni vir k celotni izpostavljenosti kadmiju. V raziskavo je bilo vključenih 123 pridelovalcev vrtnin. V vzorcih tal smo določili pH-vrednost, vsebnost organske snovi, teksturo in vsebnost Cd, Cu, Mn, Pb in Zn. Na vrtovih smo vzorčili: bučke, paradižnik, zelje, čebulo, zgodnji krompir, korenček, rdečo peso, endivijo in radič. Na trgu pa smo vzorčili: bučke...

  2. Obstructive sleep apnea after weight loss: a clinical trial comparing gastric bypass and intensive lifestyle intervention.

    Science.gov (United States)

    Fredheim, Jan Magnus; Rollheim, Jan; Sandbu, Rune; Hofsø, Dag; Omland, Torbjørn; Røislien, Jo; Hjelmesæth, Jøran

    2013-05-15

    Few studies have compared the effect of surgical and conservative weight loss strategies on obstructive sleep apnea (OSA). We hypothesized that Roux-en-Y gastric bypass (RYGB) would be more effective than intensive lifestyle intervention (ILI) at reducing the prevalence and severity of OSA (apnea-hypopnea-index [AHI] ≥ 5 events/hour). A total of 133 morbidly obese subjects (93 females) were treated with either a 1-year ILI-program (n = 59) or RYGB (n = 74) and underwent repeated sleep recordings with a portable somnograph (Embletta). Participants had a mean (SD) age of 44.7(10.8) years, BMI 45.1(5.7) kg/m(2), and AHI 17.1(21.4) events/hour. Eighty-four patients (63%) had OSA. The average weight loss was 8% in the ILI-group and 30% in the RYGB-group (p weight loss, rather than the surgical procedure per se, explains the beneficial effects.

  3. Gastronomi ve Turizm İlişkisi Üzerine Bir Değerlendirme

    OpenAIRE

    YILMAZ, Gökhan

    2017-01-01

    Çalışmada Türkiye ve Kapadokya bölgesindeki turizmpaydaşlarının bakış açısıyla gastronomi ve turizm ilişkisinin mevcut durumununtespit edilmesi, gastronomi ve turizm ilişkisinin başlıca karakteristiklerininbelirlenmesi ve turizm potansiyeli içerisinde gastronominin rolünün ne olduğununderinlemesine incelenmesi amaçlanmaktadır. Nitel yaklaşım çerçevesinde veritoplama tekniği olarak doküman incelenmesi; veri analizi olarak da içerikanalizinden yararlanılmıştır. Gastronomi ve turizm ilişkisi üze...

  4. Specifičnosti zdravstvene njege kod autoagresivnih i suicidalnih bolesnika

    OpenAIRE

    Novak, Silvija

    2017-01-01

    Suicid ili samoubojstvo je svjesno ili namjerno oduzimanje života ili pokušaj oduzimanja vlastitog života. Pokušaj suicida, suicid, suicidalne namjere i samoozljeđivanje smatraju se važnim problemom ne samo psihijatrije već i javnog zdravstva i društva općenito. Mišljenja brojnih znanstvenika su da je stopa suicida u posljednjih 50 godina porasla za 60%, najvećim dijelom u zemljama u razvoju. Suicid češće počine muškarci, a žene češće neuspješno pokušavaju suicid. S obzirom da suicid zauzima ...

  5. Düzce İli Atmosferinin Polen ve Spor Dağılımının İncelenmesi

    OpenAIRE

    Serbes, Ayşe Belgin; Kaplan, Ayşe

    2014-01-01

    Bu çalışma 1 Ocak 2006 / 1 Ocak 2007 tarihleri arasında Düzce ili havasında yapılan bir yıllık aeropalinolojik çalışma olup, polen ve sporların neden olduğu alerjik hastalıkların teşhis ve tedavisinde hekimlere yardımcı olmayı amaçlamaktadır. Düzce ili Yimpaş A.Ş binası üzerine yerleştirilen iki farklı Durham cihazı kullanılarak Gravimetrik yöntemle elde edilen preparatlar incelenmiştir. Düzce ili atmosferindeki polen ve sporların hangi taksonlarına ait oldukları saptanmış ve morfolojik tanım...

  6. Rekurirajuće infekcije mokraćnog sustava

    OpenAIRE

    Andrašević, Saša

    2012-01-01

    Rekurirajuće uroinfekcije jesu one koje se javljaju u najmanje dva ili više navrata tijekom šest mjeseci ili u najmanje tri ili više navrata u tijeku godine dana, a etiološki su dokazane. Većina tih epizoda su cistitisi. Rekurirajuće uroinfekcije ozbiljan su javnozdravstveni problem zbog učestalosti javljanja te pobola i troškova koje izazivaju. Rekurirajuće uroinfekcije najčešće su među mlađim ženama te u postmenopauzi. Predisponirajući čimbenici za razvoj ovih infekcija dijele se na genske,...

  7. Gruplar arası temas, kaygı ve yanlılığın sosyal mesafeye etkisi: Türk ve Kürt kökenli gruplar üzerine bir çalışma

    OpenAIRE

    GÜLER, Meltem

    2013-01-01

    Son altmış yıldır gruplar arasındaki ilişkiler incelenmektedir. Allport (1954), Amir (1969), Şerif (1966), LeVine ve Campbell (1972) ve Tajfel ve Turner (1979) gruplararası ilişkilere yoğunlaşan ilk isimler olmuştur. 1980’lerde Tajfel ve Turner (1979) Sosyal Kimlik Kuramını ve izleyen yıllarda Turner ve arkadaşları (1987) Kendini Sınıflandırma Kuramını ortaya koyarak gruplar arasındaki ilişkileri daha geniş bir bakış açısından ele alınmasını sağlamıştır. Sosyal Kimlik Kuramı, sosyal ...

  8. TOPLUMSAL BİÇİMLER OKULUNUN ÖNCÜLERİNDEN

    Directory of Open Access Journals (Sweden)

    Çetin Murat HAZAR

    2017-06-01

    Full Text Available Toplumun ve insan ilişkilerinin sosyal şekiller tarafından biçimlenmesi görüşü özellikle Tönnies ve Simmel Taraından ortaya konulmuştur.Sosyal şekiller zaman ve bölge ayrımı olmadan iletişimin ve ilişkilerin belirlenmesinde önemli bir faktör olarak görülmektedir. hatta bir çok durumda içerikten bağımsız olarak, toplum ve topluluk tipolojisi ile grupların üye sayısının benzer ilişki ve iletişim deneyimlerinin oluşmasında önemli katkıları bulunmaktadır.  

  9. TOPLUM VE SİYASET İLİŞKİSİ BAĞLAMINDA AZERBAYCAN SİNEMA TARİHİ - THE HISTORY OF THE AZERBAIJAN MOVIES IN THE CONTEXT OF THE RELATIONSHIP BETWEEN SOCIETY AND POLITICS

    OpenAIRE

    Ali Murat KIRIK

    2014-01-01

    ÖzetÇağımızda sinema 7.sanat olarak adlandırılmaktadır. Görsel bir sanat dalı olan sinema gerçeğin aynası durumundadır. Bununla birlikte sinema, toplum ve siyaset ile sürekli bir ilişki içerisindedir. Azerbaycan sinemasında bu ilişki derinden hissedilmektedir. Bu çalışmada Azerbaycan Sineması 3 dönem altında incelenmektedir. Propaganda ve siyaset her dönem Azerbaycan Sineması’nda var olmuştur. Günümüzde ise milliyetçiliği ön plana çıkaran filmler üretilmektedir. Çalışmada Azerbaycan Sineması’...

  10. A randomized controlled trial of a 12-week intensive lifestyle intervention program at a primary care obesity clinic for adults in western Saudi Arabia.

    Science.gov (United States)

    Alghamdi, Riyad Q

    2017-08-01

    To assess the ability of a 12-week primary care-based intensive lifestyle intervention (ILI), to facilitate a 5% reduction in baseline weight compared with an education-only active comparator (AC).  Methods: A randomized clinical trial was conducted in a primary health care setting in Jeddah, Saudi Arabia between December 2014 and June 2015. Arab participants with obesity, but who were otherwise healthy (n=140), were randomized to the ILI (n=70) or AC (n=70) group. The ILI group received 8 clinical visits throughout the study. The AC group received only an initial health education session. The primary outcome was the proportion of participants who achieved clinically significant weight loss (≥5% of their baseline weight).  Results: Participants in the ILI group were significantly more likely than those in the AC group to achieve the primary outcome (p=0.008, relative risk: 1.8 [95% confidence interval [CI]: 1.15 to 2.93). At week 12, the ILI group exhibited a mean weight decrease of 5.58 ± 5.60 kg (-5.37 ± 5.31%), significantly greater than that observed in the AC group (-2.8 ± 4.96 kg, -2.62 ± 4.34%, p=0.002), and corresponding to a weight loss advantage of 2.77 kg (95% CI: 1.01 to 4.54 kg) or 2.75% (95% CI: 1.13% to 4.37%).  Conclusion: The 12-week primary care-based ILI program was effective in achieving a clinically meaningful weight reduction (≥5%) among Saudi and Arab patients with obesity.

  11. Influenza and other respiratory viruses detected by influenza-like illness surveillance in Leyte Island, the Philippines, 2010-2013.

    Directory of Open Access Journals (Sweden)

    Hirono Otomaru

    Full Text Available This study aimed to determine the role of influenza-like illness (ILI surveillance conducted on Leyte Island, the Philippines, including involvement of other respiratory viruses, from 2010 to 2013. ILI surveillance was conducted from January 2010 to March 2013 with 3 sentinel sites located in Tacloban city, Palo and Tanauan of Leyte Island. ILI was defined as fever ≥38°C or feverish feeling and either cough or running nose in a patient of any age. Influenza virus and other 5 respiratory viruses were searched. A total of 5,550 ILI cases visited the 3 sites and specimens were collected from 2,031 (36.6% cases. Among the cases sampled, 1,637 (75.6% were children aged <5 years. 874 (43.0% cases were positive for at least one of the respiratory viruses tested. Influenza virus and respiratory syncytial virus (RSV were predominantly detected (both were 25.7% followed by human rhinovirus (HRV (17.5%. The age distributions were significantly different between those who were positive for influenza, HRV, and RSV. ILI cases were reported throughout the year and influenza virus was co-detected with those viruses on approximately half of the weeks of study period (RSV in 60.5% and HRV 47.4%. In terms of clinical manifestations, only the rates of headache and sore throat were significantly higher in influenza positive cases than cases positive to other viruses. In conclusion, syndromic ILI surveillance in this area is difficult to detect the start of influenza epidemic without laboratory confirmation which requires huge resources. Age was an important factor that affected positive rates of influenza and other respiratory viruses. Involvement of older age children may be useful to detect influenza more effectively.

  12. Influenza-like illness-related emergency department visits: Christmas and New Year holiday peaks and relationships with laboratory-confirmed respiratory virus detections, Edmonton, Alberta, 2004-2014.

    Science.gov (United States)

    Martin, Leah J; Im, Cindy; Dong, Huiru; Lee, Bonita E; Talbot, James; Meurer, David P; Mukhi, Shamir N; Drews, Steven J; Yasui, Yutaka

    2017-01-01

    Emergency department (ED) visit volumes can be especially high during the Christmas-New Year holidays, a period occurring during the influenza season in Canada. Using daily data, we examined the relationship between ED visits for the chief complaint "cough" (for Edmonton, Alberta residents) and laboratory detections for influenza A and respiratory syncytial virus (RSV) (for Edmonton and surrounding areas), lagged 0-5 days ahead, for non-pandemic years (2004-2008 and 2010-2014) using multivariable linear regression adjusting for temporal variables. We defined these cough-related visits as influenza-like illness (ILI)-related ED visits and, for 2004-2014, compared Christmas-New Year holiday (December 24-January 3) and non-holiday volumes during the influenza season (October-April). Adjusting for temporal variables, ILI-related ED visits were significantly associated with laboratory detections for influenza A and RSV. During non-pandemic years, the highest peak in ILI-related visit volumes always occurred during the holidays. The median number of holiday ILI-related visits/day (42.5) was almost twice the non-holiday median (24) and was even higher in 2012-2013 (80) and 2013-2014 (86). Holiday ILI-related ED visit volumes/100 000 population ranged from 56.0 (2010-2011) to 117.4 (2012-2013). In contrast, lower visit volumes occurred during the holidays of pandemic-affected years (2008-2010). During non-pandemic years, ILI-related ED visit volumes were associated with variations in detections for influenza A and RSV and always peaked during the Christmas-New Year holidays. This predictability should be used to prepare for, and possibly prevent, this increase in healthcare use; however, interventions beyond disease prevention strategies are likely needed. © 2016 The Authors. Influenza and Other Respiratory Viruses Published by John Wiley & Sons Ltd.

  13. Forecasting influenza in Hong Kong with Google search queries and statistical model fusion.

    Science.gov (United States)

    Xu, Qinneng; Gel, Yulia R; Ramirez Ramirez, L Leticia; Nezafati, Kusha; Zhang, Qingpeng; Tsui, Kwok-Leung

    2017-01-01

    The objective of this study is to investigate predictive utility of online social media and web search queries, particularly, Google search data, to forecast new cases of influenza-like-illness (ILI) in general outpatient clinics (GOPC) in Hong Kong. To mitigate the impact of sensitivity to self-excitement (i.e., fickle media interest) and other artifacts of online social media data, in our approach we fuse multiple offline and online data sources. Four individual models: generalized linear model (GLM), least absolute shrinkage and selection operator (LASSO), autoregressive integrated moving average (ARIMA), and deep learning (DL) with Feedforward Neural Networks (FNN) are employed to forecast ILI-GOPC both one week and two weeks in advance. The covariates include Google search queries, meteorological data, and previously recorded offline ILI. To our knowledge, this is the first study that introduces deep learning methodology into surveillance of infectious diseases and investigates its predictive utility. Furthermore, to exploit the strength from each individual forecasting models, we use statistical model fusion, using Bayesian model averaging (BMA), which allows a systematic integration of multiple forecast scenarios. For each model, an adaptive approach is used to capture the recent relationship between ILI and covariates. DL with FNN appears to deliver the most competitive predictive performance among the four considered individual models. Combing all four models in a comprehensive BMA framework allows to further improve such predictive evaluation metrics as root mean squared error (RMSE) and mean absolute predictive error (MAPE). Nevertheless, DL with FNN remains the preferred method for predicting locations of influenza peaks. The proposed approach can be viewed a feasible alternative to forecast ILI in Hong Kong or other countries where ILI has no constant seasonal trend and influenza data resources are limited. The proposed methodology is easily tractable

  14. Influenza-like illness in residential care homes: a study of the incidence, aetiological agents, natural history and health resource utilisation.

    Science.gov (United States)

    Hui, D S; Woo, J; Hui, E; Foo, A; Ip, M; To, K-W; Cheuk, E S C; Lam, W-Y; Sham, A; Chan, P K S

    2008-08-01

    Influenza-like illness (ILI) among elderly people living in residential care homes (RCHEs) is a common cause for hospitalisation. A study was undertaken to examine the incidence, underlying aetiology, natural history and associated healthcare resource utilisation related to ILI in the RCHE population. A prospective study of ILI in four RCHEs in Shatin, Hong Kong was conducted from April 2006 to March 2007. Each RCHE was monitored daily for the occurrence of ILI and followed up until resolution of illness or death. Clinical features were recorded and sputum, nasopharyngeal aspirate, blood and urine specimens were examined for underlying aetiology. 259 episodes of ILI occurred in 194 subjects, with mild peaks in winter and summer, over a sustained level throughout the year. The infectious agent was identified in 61.4% of all episodes, comprising bacterial infection in 53.3% and viral in 46.7%. Multiple infections occurred in 16.2% of subjects. The most frequent organism was Streptococcus pneumoniae, followed by respiratory syncytial virus, Pseudomonas aeruginosa, metapneumovirus and parainfluenza virus types 1 and 3. Clinical features did not vary according to the underlying aetiology, the common presenting features being a decrease in general condition, cognitive and functional deterioration, and withholding of food in addition to fever and respiratory symptoms. Overall, mortality at 1 month/discharge was 9.7%. Infection with methicillin-resistant Staphylococcus aureus, low body mass index and poor function predisposed to mortality. No association was observed between influenza vaccination status and underlying aetiology, clinical features or outcome. The clinical presentation of ILI is non-specific and is mainly due to bacterial and viral infections other than influenza in the RCHE population.

  15. Influenza-like-illness and clinically diagnosed flu: disease burden, costs and quality of life for patients seeking ambulatory care or no professional care at all.

    Science.gov (United States)

    Bilcke, Joke; Coenen, Samuel; Beutels, Philippe

    2014-01-01

    This is one of the first studies to (1) describe the out-of-hospital burden of influenza-like-illness (ILI) and clinically diagnosed flu, also for patients not seeking professional medical care, (2) assess influential background characteristics, and (3) formally compare the burden of ILI in patients with and without a clinical diagnosis of flu. A general population sample with recent ILI experience was recruited during the 2011-2012 influenza season in Belgium. Half of the 2250 respondents sought professional medical care, reported more symptoms (especially more often fever), a longer duration of illness, more use of medication (especially antibiotics) and a higher direct medical cost than patients not seeking medical care. The disease and economic burden were similar for ambulatory ILI patients, irrespective of whether they received a clinical diagnosis of flu. On average, they experienced 5-6 symptoms over a 6-day period; required 1.6 physician visits and 86-91% took medication. An average episode amounted to €51-€53 in direct medical costs, 4 days of absence from work or school and the loss of 0.005 quality-adjusted life-years. Underlying illness led to greater costs and lower quality-of-life. The costs of ILI patients with clinically diagnosed flu tended to increase, while those of ILI patients without clinically diagnosed flu tended to decrease with age. Recently vaccinated persons experienced lower costs and a higher quality-of-life, but this was only the case for patients not seeking professional medical care. This information can be used directly to evaluate the implementation of cost-effective prevention and control measures for influenza. In particular to inform the evaluation of more widespread seasonal influenza vaccination, including in children, which is currently considered by many countries.

  16. Influenza-like-illness and clinically diagnosed flu: disease burden, costs and quality of life for patients seeking ambulatory care or no professional care at all.

    Directory of Open Access Journals (Sweden)

    Joke Bilcke

    Full Text Available This is one of the first studies to (1 describe the out-of-hospital burden of influenza-like-illness (ILI and clinically diagnosed flu, also for patients not seeking professional medical care, (2 assess influential background characteristics, and (3 formally compare the burden of ILI in patients with and without a clinical diagnosis of flu. A general population sample with recent ILI experience was recruited during the 2011-2012 influenza season in Belgium. Half of the 2250 respondents sought professional medical care, reported more symptoms (especially more often fever, a longer duration of illness, more use of medication (especially antibiotics and a higher direct medical cost than patients not seeking medical care. The disease and economic burden were similar for ambulatory ILI patients, irrespective of whether they received a clinical diagnosis of flu. On average, they experienced 5-6 symptoms over a 6-day period; required 1.6 physician visits and 86-91% took medication. An average episode amounted to €51-€53 in direct medical costs, 4 days of absence from work or school and the loss of 0.005 quality-adjusted life-years. Underlying illness led to greater costs and lower quality-of-life. The costs of ILI patients with clinically diagnosed flu tended to increase, while those of ILI patients without clinically diagnosed flu tended to decrease with age. Recently vaccinated persons experienced lower costs and a higher quality-of-life, but this was only the case for patients not seeking professional medical care. This information can be used directly to evaluate the implementation of cost-effective prevention and control measures for influenza. In particular to inform the evaluation of more widespread seasonal influenza vaccination, including in children, which is currently considered by many countries.

  17. Clinical results of neurotransmission SPECT in extra-pyramidal diseases; Resultats cliniques de la TEMP de la neurotransmission en pathologie extra-pyramidale

    Energy Technology Data Exchange (ETDEWEB)

    Baulieu, J.L.; Prunier, C.; Tranquart, F.; Guilloteau, D. [Centre Hospitalier Universitaire Bretonneau, Service de Medecine Nucleaire in vitro, INSERM U316, 37 - Tours (France)

    1999-12-01

    We present some methodological aspects and clinical applications of dopamine D2 receptor and transporter SPECT using new radiotracers radiolabeled with iodine 123. The gamma camera quality control and standardisation has to be adapted to the small volume and deep location of striata, where receptors and transporters are present. Phantom containing hollow spheres of different diameters which can be filled with different amounts of {sup 99m}Tc or {sup 123}I. The semi quantitation of receptor and transporter molecular concentration is based on an equilibrium binding model. According to this model, the binding potential (Bmax. Ka) is equal to the ratio between specific binding in the striatum and circulating activity in a reference region of interest in the occipital cortex. By comparing ECD and ILIS SPECT, it has been shown that striatal ILIS binding does not depend on the local perfusion. The clinical applications mainly concern the extra-pyramidal pathology: ILIS and IBZM SPECT are able to differentiate pre- and post-synaptic lesions. In Parkinson disease the nigrostriatal pathway is damaged and D2 receptors are normal or increased, as shown by normal or elevated IBZM or ILIS uptake. In other extra pyramidal degenerative diseases as progressive supra nuclear palsy or multiple system atrophy striatal D2 receptors are damaged as shown by decreased IBZM or ILIS uptake. In our experience, 88 per cent of patients are correctly classified by ILIS SPECT and 86 per cent with IBZM SPECT. Dopamine transporter SPECT with {beta}CIT and PE2I provides an evaluation of the presynaptic neuronal density in the striatum. One can expect an help for the early diagnosis and the evaluation of Parkinson disease. Another potential application of dopaminergic neurotransmission SPECT is the evaluation of neuronal loss after hypoxo-ischemia. We conclude that dopaminergic neurotransmission SPECT using specific ligands should become a useful diagnosis tool to study a large number of brain

  18. Mogućnosti uporabe plazma terapije u stomatologiji : teoretske osnove i klinička primjena

    OpenAIRE

    Pavelić, Bernard

    2015-01-01

    Plazma je djelomično ionizirani plin graĎen od iona, slobodnih elektrona, radikala, neutralnih i pobuĎenih atoma i molekula te ostalih čestica. Prema svojim karakteristikama smatra se četvrtim agregatnim stanjem. Nastaje dovoĎenjem energije u obliku topline, električne energije ili elektromagnetskog zračenja plinu ili smjesi plinova. Zbog povećanja energije dolazi do ubrzanog gibanja elektrona i ostalih čestica u plinu te njihovog meĎusobnog sudaranja, posljedično s pokretanjem različitih pro...

  19. Sestrinska skrb za pacijente oboljele od alkoholizma

    OpenAIRE

    Tot, Šimun

    2017-01-01

    Alkoholizam je bolest, a prema definiciji skupine stručnjaka Svjetske zdravstvene organizacije ''Alkoholičarem se može nazvati ona osoba koja je trajnom i prekomjernom potrošnjom alkoholnih pića oštetila svoje zdravlje, socijalno ili ekonomsko stanje, ili u koje postoje bar predznaci takvih oštećenja''. Grana u medicini koja se bavi istraživanjem alkohola i njegovih posljedica zove se alkohologija. Prema raširenosti alkoholizam se kao bolest nalazi u svjetskim statistikama na trećem mjestu, o...

  20. Kontaktna alergija u ustima: raznolike kliničke manifestacije i dijagnostika najčešćih alergena važnih za stomatološku praksu

    OpenAIRE

    Bakula, Andrijana; Lugović-Mihić, Liborija; Šitum, Mirna; Turčin, Juraj; Šinković, Ana

    2011-01-01

    Kasna reakcija preosjetljivosti ili IV. tip alergijske reakcije može izazvati različite oralne manifestacije. One mogu biti lokalizirane ili vidljive difuzno na oralnoj sluznici, a obično se javljaju 24-72 sata nakon unošenja antigena. Pritom najčešće dolazi do reakcija na vanjske antigene kao što su kontaktni alergeni (osobito metali i lijekovi). Pokazalo se da su najčešće oralne manifestacije gingivitis, heilitis, perioralni dermatitis, sindrom pekućih usta, lihenoidna reakcija i orofacijal...

  1. Razvoj dnevnika potovanj s pomočjo AppInventorja in AppInventor Java Bridge-a

    OpenAIRE

    Bezjak, Žan

    2016-01-01

    V diplomski nalogi smo proučili in analizirali orodje AppInventor, predstavili njegove osnove podatke, njegove prednosti in na drugi strani tudi slabosti. Poglobili smo se tudi v knjižnico AppInventor Java Bridge, ki deluje na principu že omenjenega orodja, ter v diplomskem delu izpostavili prednosti in slabosti te knjižnice. Skozi nalogo smo zgradili dve enaki aplikaciji, po eno v vsakem izmed omenjenih orodij, in na ta način preučili podobnosti oziroma razlike med orodjem AppInventor ter kn...

  2. RAZISKAVE AFINITETE ZEOLITOV ZA PARE RAZLIČNIH TOPIL

    OpenAIRE

    Mlakar, Gregor

    2015-01-01

    V sklopu magistrskega dela Raziskave afinitete zeolitov za pare različnih topil smo preučevali adsorpcijo različnih organskih topil na različne tipe zeolitov. Poizkuse smo izvedli tako, da smo zeolit natehtali v petrijevko in ga položili v eksikator, kamor smo na dno nalili izbrano topilo. Tako smo zeolit izpostavili hlapom izbranega topila. Količino adsorbiranega topila smo določali gravimetrično. Določili smo maksimalno količino adsorbiranega topila za posamezen zeolit ter časovni potek ...

  3. Kontejnerizacija in prevoz iz luke Rotterdam

    OpenAIRE

    Klemenčič, Mojca

    2016-01-01

    V diplomskem delu prikažemo pomen kontejnerizacije, kje se uporablja, njene prednosti in slabosti, ki jih imajo uporabniki le-te. Osredotočili smo se na proučevanje kontejnerizacije v pomorskem prometu in predstavili pojem kontejner in kakšne ladje se uporabljajo v pomorskem prometu. Opisali smo vrste pomorskega prometa, kakšne ladje uporabljamo, njegove prednosti in slabosti. V praktičnem delu smo se osredotočili na Luko Rotterdam in opisali njen pomen za Evropo in jo primerjali z Luko Hambu...

  4. Definiranje poslovnih procesa i modeliranje procesa prodaje u poduzeću Mikronis

    OpenAIRE

    Vincek, Ivan

    2017-01-01

    U robnoj proizvodnji proizvodi se za tržište. Roba ili usluga traži kupca kao drugu stranu koja je neophodna za proces razmjene, a prodaja se pojavljuje kao infrastruktura razmjene. Razmjena se mora promatrati više kao proces nego kao događaj. U procesu razmjene prodaja je važna za obavljanje transakcije kao razmjene vrijednosti između dviju ili više strana. O prodaji se može govoriti iz više aspekata. Sukladno zahtjevima međunarodne norme ISO 9001:2000 sustav upravljanja ...

  5. Žene Frankopanke

    OpenAIRE

    Šercer, Marija

    2011-01-01

    Izabravši četrnaest žena koje su rođene kao Frankopanke, ili su udajom dospjele u obitelj Frankopan autorica je ukazala na uvjete u kojima su se ženska djeca udavala. Njihova dob od devet ili dvanaest godina, nedovoljno poznavanje budućega supruga, nepoznavanje sredine u koju su ih udavali, možebitno nepoznavanje jezika, otežavali su život toj nezreloj djeci. Temeljna zadaća ženskoga djeteta bila je rađanje djece i osiguravanje potomstva. Česti porodi su nerijetko dovodili do prerane smrti. T...

  6. Utjecaj različitih sastojaka štakorske hrane na apsorpciju radioaktivnog stroncija u štakora

    OpenAIRE

    Kargačin, B.; Kostial, K.

    1982-01-01

    Proučavali smo apsorpciju stroncija u štakora hranjenih mesom, mesom s dodatkom štakorske hrane ili različitih sastojaka štakorske hrane. životinje su bile na odgovarajućoj prehrani devet dana. Šestog i sedmog dana pokusa primile su radioizotope 85Sr i 47Ca u vodi za piće. Retencija radiostroncija bila je najviša u grupi hranjenoj samo mesom (52% doze). Dodatak štakorske hrane ili bilo kojeg od njezinih sastojaka mesu smanjio je retenciju (do 9 puta). Sastojci štakorske hrane koji su uzrokova...

  7. PROBLEMATIKA IZBORA ODGOVARAJUĆE METODOLOGIJE U PROCJENI VRIJEDNOSTI HOTELSKIH OBJEKATA U HRVATSKOJ

    OpenAIRE

    Pavlović, Damir

    2011-01-01

    Ispravna procjena vrijednosti svake nekretnine poželjan je uvjet za prodaju ili kupnju iste. I ne samo to, već ispunjenje istog uvjeta dokazano dugoročno oživljava i dinamizira tržište nekretnina. Hotelski objekti su u tom pogledu pod posebnim povećalom, budući da su u praksi predmet više tipova transakcija, od onih koje se realiziraju kroz privatizaciju hotelskih poduzeća do kupoprodaje privatnih objekata ili zemljišta namijenjenih izgradnji novih smještajnih je...

  8. VPLIV TELEVIZIJSKIH POROČIL NA UČENCE 5. RAZREDA OSNOVNE ŠOLE

    OpenAIRE

    Dečman, Pia

    2014-01-01

    Pri raziskovanju vpliva televizijskih poročil na učence petega razreda smo na začetku največ pozornosti posvetili raziskovanju televizije. Tako smo v prvem delu teoretičnega dela najprej predstavili televizijo kot množični medij, osredotočili pa smo se tudi na njeno zgodovino. Nato smo pozornost namenili gledanju televizije, kjer smo ugotavljali, kakšne so navade gledanja ljudi različnih starosti in iz kakšnih razlogov najpogosteje gledajo televizijo. V nadaljevanju smo se osredotočili n...

  9. NAKIT OD GAGATA IZ FUNDUSA ARHEOLOŠKOG MUZEJA ZADAR

    OpenAIRE

    Giunio, Kornelija A.

    2010-01-01

    Gagat je vrsta bituminoznog ugljena baršunastocrne ili smeđe boje, voštana ili masna sjaja. U stvari radi se o fosiliziranom drvu iz roda Araucariaceae iz geološkog razdoblja jure, od pred oko 180 milijuna godina. Zbog svog organskog porijekla ne spada u kamenje, ali se zbog svojih svojstava ubraja u plemenite materijale. Odlično se polira i upotrebljava kao uresni kamen. Nalazi se u rudnicima ugljena, u obliku oblutaka različitih dimenzija. Najpoznatija nalazišta gagata u svijetu...

  10. Senzorska procjena meda koji nisu skloni kristalizaciji

    OpenAIRE

    Mikac, Sara

    2016-01-01

    Med je sladak, gust, viskozan, tekuć ili kristaliziran proizvod što ga medonosne pčele proizvode od nektara medonosnih biljaka, sekreta živih dijelova biljaka ili izlučevina kukaca koji sišu na živim dijelovima biljaka, koji pčele sakupljaju, dodaju mu vlastite specifične tvari, izdvajaju vodu i odlažu u stanice saća do sazrijevanja. Senzorska procjena kao znanstvena disciplina bavi se procjenom proizvoda kroz evaluiranje svojstava proizvoda koja se mogu osjetiti jednim od 5 osjetilnih organa...

  11. VPLIV AMBROZIJE NA ZDRAVJE

    OpenAIRE

    Tramšek, Dejan

    2015-01-01

    Izhodišča: V raziskavi smo se osredotočili na opis različnih vrst ambrozije. Opisali smo tudi rastline, ki so v veliki meri podobne ambroziji. Ob vsem tem pa seveda vpliv ambrozije na zdravje ljudi, predvsem alergij. Predstavili smo posamezne alergije, opisali način preprečevanja in zdravljenja le-teh in simptome, ki alergije spremljajo. Za omejitev in zmanjšanje pojava alergij na ambrozijo pa je to rastlino potrebno odstraniti oz. zamejiti. Odločili smo se, da v diplomskem delu predstavimo ...

  12. Using Google Flu Trends data in forecasting influenza-like-illness related ED visits in Omaha, Nebraska.

    Science.gov (United States)

    Araz, Ozgur M; Bentley, Dan; Muelleman, Robert L

    2014-09-01

    Emergency department (ED) visits increase during the influenza seasons. It is essential to identify statistically significant correlates in order to develop an accurate forecasting model for ED visits. Forecasting influenza-like-illness (ILI)-related ED visits can significantly help in developing robust resource management strategies at the EDs. We first performed correlation analyses to understand temporal correlations between several predictors of ILI-related ED visits. We used the data available for Douglas County, the biggest county in Nebraska, for Omaha, the biggest city in the state, and for a major hospital in Omaha. The data set included total and positive influenza test results from the hospital (ie, Antigen rapid (Ag) and Respiratory Syncytial Virus Infection (RSV) tests); an Internet-based influenza surveillance system data, that is, Google Flu Trends, for both Nebraska and Omaha; total ED visits in Douglas County attributable to ILI; and ILI surveillance network data for Douglas County and Nebraska as the predictors and data for the hospital's ILI-related ED visits as the dependent variable. We used Seasonal Autoregressive Integrated Moving Average and Holt Winters methods with3 linear regression models to forecast ILI-related ED visits at the hospital and evaluated model performances by comparing the root means square errors (RMSEs). Because of strong positive correlations with ILI-related ED visits between 2008 and 2012, we validated the use of Google Flu Trends data as a predictor in an ED influenza surveillance tool. Of the 5 forecasting models we have tested, linear regression models performed significantly better when Google Flu Trends data were included as a predictor. Regression models including Google Flu Trends data as a predictor variable have lower RMSE, and the lowest is achieved when all other variables are also included in the model in our forecasting experiments for the first 5 weeks of 2013 (with RMSE = 57.61). Google Flu Trends data

  13. Guillain-Barréov sindrom udružen s infekcijom virusom gripe A: prikaz bolesnice

    OpenAIRE

    Vuković, Berislav; Petković, Dobrinka; Vuković, Ivana

    2015-01-01

    Guillain-Barréov sindrom (GBS) je akutna monofazička imunološki posredovana bolest perifernog živčanog sustava koja se najčešće javlja nakon bolesti probavnog ili dišnog sustava. Može se javiti i nakon gripe ili rjeđe nakon cijepljenja protiv gripe. Prikazat ćemo bolesnicu staru 57 godina s akutnom inflamatornom demijelinziraju}om poliradikuloneuropatijom (AIDP) nakon teške obostrane upale pluća i ARDS uzrokovane virusom gripe. Tijek bolesti je bio kompliciran novonastalom tetraplegijom uzrok...

  14. Prognostička svojstva instrumenta W-PTSD za utvrđivanje posttraumatskog stresnog poremećaja kod osoba oštećena vida

    OpenAIRE

    Runjić, Tina; Nikolić, Branko; Bilić-Prcić, Ante

    2006-01-01

    Posttraumatski stresni poremecaj je u novijoj literaturi definiran kao skup specificnih simptoma koji se javljaju u nekih osoba, nakon što su izravno ili kao svjedoci bile izložene nekom traumaticnom iskustvu koje bi za vecinu ljudi bilo jako traumaticno, i na to iskustvo su reagirale snažnim strahom, osjecajem bespomocnosti ili užasnutosti. Razvoj simptoma ovog poremecaja odreen je karakteristikama licnosti izložene osobe, vrstom i jacinom traume, ulogom koju je osoba imala tijekom...

  15. Space Handbook,

    Science.gov (United States)

    1985-01-01

    further increasing the expansion ratio), the exhaust gas exit pressure will be less than ambient (P, < P.), and the nozzle will overexpand . Net thrust...decreasing P., until P, is essentially zero. Large booster engines use nozzles that overexpand at launch, achieve optimum expansion at 40,000 to 50,000 feet...tises 37 1 inhtdl ii il11 1 Il~ tilt Il Illnium-235 tttimatelv mixed with ili oniunl hvdridle. Which sct~vC as Ih ili% 011 415 h i i the nectitrons

  16. Isolated limb infusion chemotherapy for melanoma: an overview of early experience at the Adelaide Melanoma Unit

    Directory of Open Access Journals (Sweden)

    Giles MH

    2013-08-01

    Full Text Available Mitchell H Giles,1 Brendon J Coventry2 1Adelaide Melanoma Unit, 2Discipline of Surgery, The University of Adelaide, Royal Adelaide Hospital Adelaide, SA, Australia Background: Isolated limb infusion (ILI using cytotoxic agents has been demonstrated to be an effective and less invasive alternative modality than isolated limb perfusion for the treatment of melanoma localized to a limb. Percutaneous catheters were inserted into the axial artery and vein of the affected limb while using a pneumatic cuff to restrict limb vascular flow proximally to "isolate" the limb from the body and enable delivery of high-dose intra-arterial chemotherapy selectively to the limb. The ILI technique was developed at the Sydney Melanoma Unit (now renamed the Melanoma Institute Australia, and only a few other centers have reported separate results. We report our early results using the ILI technique for management of locally recurrent surgically nonresectable melanoma. Methods and results: Twenty-eight ILI procedures were performed in 20 patients treated with one or more procedures between 1997 and 2007. Patient parameters and clinical responses were evaluated. The median follow-up duration was 15.9 months after the first ILI, with an overall response rate after one or more infusions of 70%, of which 35% were complete responders and 35% were partial responders, with a further 20% showing stable disease, giving a "clinically significant" response rate of 90%. After one ILI (n = 20, the overall response rate was 70%, with 20% complete responders and 50% partial responders, and 20% with stable disease. Low limb toxicities were generally observed, and no amputations were required. Conclusion: ILI chemotherapy is a useful technique, which can be readily repeated for control of melanoma in the limb. It is generally well tolerated, and is capable of achieving a cure, delayed progression, or effective palliation in selected cases. The longest survivors in this series were 8

  17. PRIMERJALNA ANALIZA MOBILNIH REŠITEV CRM NA PRIMERU INTRIX CRM IN MICROSOFT DYNAMICS CRM

    OpenAIRE

    Tetičkovič, Rebeka

    2016-01-01

    Če želijo podjetja biti uspešna in biti konkurenca drugim podjetjem morajo uvesti v svoje podjetje rešitev za upravljanje odnosov s strankami, saj le tako lahko imajo celovit pogled na stranko in vidijo, kakšne so njihove potrebe in želje ter jih poskušajo zadvoljiti. Mobilne rešitve CRM podjetjem pomagajo, da lažje upravljajo odnose s strankami ne glede na to kje so. V uvodnem poglavju bomo opisali področje in opredelili problem, določili namen, cilje in hipoteze raziskave, določili predp...

  18. Teleološke i metodičke pretpostavke i specifičnosti glazbene terapije za djecu s autizmom u odnosu prema glazbenoj kulturi u redovitoj školi

    OpenAIRE

    Kardum, Aleksandra

    2009-01-01

    Autizam još nije dovoljno razjašnjen. Ipak, njegove bitne značajke koje utječu na odgojno obrazovni rad su: nerazvijena intersubjektivnost kao mogućnost tumačenja tuđih emocija ili namjera, nemogućnost komunikacije ustaljenim verbalnim ili neverbalnim obrascima, otežano iskazivanje emocija, nerazumijevanje simbola, nepostojanje »teorija uma«, ustaljeni raspored rituala ponašanja, neočekivane i neprimjerene reakcije itd. Jasno je da se i glazbena terapija svojim metodičkim pristupom mora prila...

  19. The Development and Application of Two-Chamber Reactors and Carbon Monoxide Precursors for Safe Carbonylation Reactions.

    Science.gov (United States)

    Friis, Stig D; Lindhardt, Anders T; Skrydstrup, Troels

    2016-04-19

    Low molecular weight gases (e.g., carbon monoxide, hydrogen, and ethylene) represent vital building blocks for the construction of a wide array of organic molecules. Whereas experimental organic chemists routinely handle solid and liquid reagents, the same is not the case for gaseous reagents. Synthetic transformations employing such reagents are commonly conducted under pressure in autoclaves or under atmospheric pressure with a balloon setup, which necessitates either specialized equipment or potentially hazardous and nonrecommended installations. Other safety concerns associated with gaseous reagents may include their toxicity and flammability and, with certain gases, their inability to be detected by human senses. Despite these significant drawbacks, industrial processes apply gaseous building blocks regularly due to their low cost and ready availability but nevertheless under a strictly controlled manner. Carbon monoxide (CO) fits with all the parameters for being a gas of immense industrial importance but with severe handling restrictions due to its inherent toxicity and flammability. In academia, as well as research and development laboratories, CO is often avoided because of these safety issues, which is a limitation for the development of new carbonylation reactions. With our desire to address the handling of CO in a laboratory setting, we designed and developed a two-chamber reactor (COware) for the controlled delivery and utilization of stoichiometric amounts of CO for Pd-catalyzed carbonylation reactions. In addition to COware, two stable and solid CO-releasing molecules (COgen and SilaCOgen) were developed, both of which release CO upon activation by either Pd catalysis or fluoride addition, respectively. The unique combination of COware with either COgen or SilaCOgen provides a simple reactor setup enabling synthetic chemists to easily perform safe carbonylation chemistry without the need for directly handling the gaseous reagent. With this technology

  20. The Crati River Basin: geomorphological and stratigraphical data for the Plio–Quaternary evolution of northern Calabria, South Apennines, Italy

    Directory of Open Access Journals (Sweden)

    Robustelli Gaetano

    2017-02-01

    Full Text Available In this paper, we present the results of an integrated geomorphological and stratigraphical study carried out in the eastern side of the Crati River valley (northern Calabria, South Italy. This area is characterized by the occurrence of three order palaeosurfaces that, along with low-sloping palaeovalleys and structural landforms, are striking features of the landscape. The relationships between morpho-tectonic and sedimentary evolution of the Crati Basin has been assessed through sandstone detrital modes, morphostratigraphy and geomorphological correlation with adjacent areas. The two main unconformity surfaces that typify the Quaternary fill were correlated to different steps of landscape evolution. The presence of both erosional and depositional palaeosurfaces has been a useful marker for reconstructing sedimentary and morphogenetic events, and hence to detect drainage network evolution and changes in source sediment area. In particular, we recognized that the study area experienced, during the late Pliocene–Early Pleistocene a period of sub-aerial landscape modelling as suggested by low-sloping palaeovalleys and related fluvial deposits (1st Order Palaeosurface. At that time, the source of the detrital constituents of the PPS Unit sandstones was mainly from the Sila Massif. The onset of Coastal Range identification and uplift (Early Pleistocene marks a change in the geomorphic scenario with tectonic driven stream incision and valley development along the eastern side of Coastal Range, along with the occurrence of depositional and erosional landsurfaces (2nd Order Palaeosurface at footslopes. During this period, the Coastal Range and Sila Massif were the sources for the detrital constituents of the PlS Unit sandstones. The progressive uplift of Coastal Range during late Early Pleistocene and the marked backstepping of the depositional systems along the Sila footslope was accompanied by alternating phases of down-cutting and base

  1. Prototype of a multi-user chaos-based system with correlator and support vector machine receivers / Прототип многопользовательской системы, основанной на корелляционных приемниках или опорных векторах / Prototip višeučesničkog sistema baziranog na prijemnicima sa korelatorima ili mašinom podržavajućih vektora

    Directory of Open Access Journals (Sweden)

    Stevan M. Berber

    2016-04-01

    Full Text Available Multiuser communication techniques are used in modern wireless networks like cellular and wireless sensor networks. The design of the physical layer for these networks was based on the application of binary spreading sequences and a correlation receiver. This paper presents a design of a multiuser code division transceiver using a new method of communication based on the application of chaotic spreading sequences that can increase security of the system, and on a new technique of detecting the received signal using a support vector machine and a traditional correlation receiver. The two receivers are theoretically analyzed, including the derivation of the probability of error expression in a closed form for the fading channel, and then implemented in DSP technology on a 32-bit floating-point TigerSHARC DSP platform. The comparison of two implemented systems showed that the support vector machine solution improves the robustness of the system, sacrificing the speed of processing. The achievable bit rate for the correlator receiver was up to two times higher than for the support vector machine receiver. / Технология многопользовательской системы коммуникации с кодовым распределением каналов (CDMA используется в современных беспроводных сетях, таких как сотовые, радиотелефонные сети и беспроводные сенсорные сети. Развитие передачи сигнала на физическом уровне в сети, основано на применении двоичных последовательностей в расширении зоны сигнала и применении корреляционных приемников. В данной работе описана разработка приемопередатчика CDMA сигналов, при применении новых коммуникационных методов, основанных на хаотической последовательности в расширении зоны сигналов, обеспечивая тем самым защиту передачи сообщений в системе, применяя методы новых технологиях обнаружения сигналов при использовании машины опорных векторов в приемнике (SVM – приемник и традиционного применения корреляционных приемников. Проведен теоретический анализ обеих моделей приемников, включая вывод вычисления вероятности битовых ошибок в каналах с замираниями (федингом сигналов, затем произведено внедрение в цифровые технологии (DSP на 32-битовую процессорную платформу TigerSHARC. Сопоставление этих систем показало, что решение применения машины опорных векторов (SVM – приемник улучшает робастность системы за счет снижения скорости потока. В то время как осуществленный поток битов корреляционного приемника в два раза превышает поток битов приемника машины опорных векторов. / Tehnike višeučesničkih komunikacija sa kodnom raspodelom kanala (CDMA koriste se u modernim bežičnim mrežama kao što su mobilne radio-telefonske mreže i bežične senzorske mreže. Razvoj prenosa signala na fizičkom nivou u ovim mrežama zasnovan je na primeni binarnih sekvenci za proširenje signala i primeni korelatorskih prijemnika. U ovom radu prikazan je razvoj primopredajnika za prenos CDMA signala korišćenjem nove komunikacione metode zasnovane na primeni haotičnih sekvenci za proširenje signala, čime se može povećati zaštita u prenosu poruka u sistemu, i razvojem nove tehnike detekcije signala korišćenjem mašina sa podržavajućim vektorima u prijemniku (SVM prijemnik i tradicinalno korišćenog korelatorskog prijemnika. Oba razvijena prijemnika su teorijski analizirana, uključujući izvode izraza za verovatnoću greške bita u zatvorenom obliku u slučaju kanala sa fedingom, a zatim je izvršena njihova implementacja u digitalnoj tehnologiji (DSP na 32-bitnoj procesorskoj platformi TigerSHARC. Poređenje ova dva sistema pokazalo je da rešenje sa mašinom sa podržavajućim vektorima (SVM prijemnik poboljšava robustnost sistema po cenu smanjenja brzine procesiranja. Međutim, ostvarljivi protok bita kod prijemnika sa korelatorom bio je dva puta veći nego kod prijemnika koji koristi mašinu sa podržavajućim vektorima.

  2. Six- and Seven-Membered 1-Oxa-4-Aza-2-Silacyclanes as Possible Correctors of Adaptational Mechanisms

    Science.gov (United States)

    Kurochka, Andrey V.; Agafonova, Ol'ga V.; Losev, Aleksandr S.; Mamaeva, Elizaveta A.; Bylikin, Sergey Yu.; Negrebetsky, Vadim V.; Kramarova, Evgeniya P.; Shipov, Aleksandr G.

    1998-01-01

    The biological activity of eight 1-oxa-4-aza-2-silacyclanes with the OSiCH2N fragment including 6-membered 2-sila-5-morpholinones (1–3) and 4-acyl-2-silamorpholines (4–6)and previously unknown 7-membered derivatives of salicylic acid (7, 8) was studied. Compounds 1 and 3–6 show the certain antihypoxic action. Compounds 2 (40 mg/kg), 4 (20 mg/kg), 6 (40 mg/kg), 7 (20 mg/kg) and 8 (40 mg/kg) reduce the physical serviceability of intact animals. Compound 1 (20 mg/kg) influences the physical serviceability in a moderate-positive way on the background of chlorophos-poisoning. Compounds 5–8 displayed protective properties against chlorophos-poisoning at the LD50 dose and compounds 2, 4, 5, 7 at the LD100 dose. Influence of compounds 1 and 2 on the emotional-research behavior of mice was studied. PMID:18475821

  3. Vacuum technologies developed for at-400A Type B transportation and storage package

    Energy Technology Data Exchange (ETDEWEB)

    Franklin, K.W.; Cockrell, G.D. [Mason and Hanger-Silas Mason Co., Inc., Amarillo, TX (United States)

    1995-11-01

    The AT-400A TYPE B transportation and storage container will be used at Pantex Plant for the transportation and interim storage of plutonium pits. The AT-400A was designed by a joint effort between Sandia National Labs, Los Alamos National Labs, Lawrence Livermore National Laboratory, and Mason and Hanger-Silas Mason Co., Inc. In order to meet the requirements for transportation and storage, five different vacuum technologies had to be developed. The goals of the various vacuum technologies were to verify the plutonium pit was sealed, perform the assembly verification leak check in accordance with ANSI N-14.5 and to provide a final inert gas backfill in the containment vessel. This paper will discuss the following five vacuum technologies: (1) Pit Leak Testing, (2) Containment Vessel Purge and Backfill with tracer gas, (3) Containment Vessel Leak Testing, (4) Containment Vessel Purge and Final Backfill, and (5) Leak Testing of the Containment Vessel Gas Transfer tube.

  4. Observations of Mutual Eclipses by the Binary Kuiper Belt Object Manwe-Thorondor

    Science.gov (United States)

    Rabinowitz, David L.; Benecchi, Susan D.; Grundy, William M.; Thirouin, Audrey; Verbiscer, Anne J.

    2016-10-01

    The binary Kuiper Belt Object (385446) Manwe-Thorondor (aka 2003 QW111) is currently undergoing mutual events whereby the two ~100-km bodies alternately eclipse and occult each other as seen from Earth [1]. Such events are extremely rare among KBOs (Pluto-Charon and Sila-Nunam being notable exceptions). For Manwe-Thorondor, the events occur over ~0.5-d periods 4 to 5 times per year until the end of 2019. Here we report the results of observations to be made with the Soar 4m telescope at Cerro Pachon, Chile on 2016 Aug 25 and 26 UT, covering one of the deepest predicted eclipses. We use these observations to constrain the rotational variability of the two bodies, determine their physical properties (size, shape, albedo, density), and set limits on the presence of any prominent surface features.[1] Grundy, W. et al. 2012, Icarus, 220, 74

  5. A perícia e o perito-contador nos processos judiciais

    OpenAIRE

    Almeida, Ari Guilherme Ferreira de

    2008-01-01

    Artigo apresentado à Fundação Universidade Federal de Rondônia, Campus de Cacoal, como requisito parcial para obtenção do Título de Bacharel em Ciências Contábeis. Orientador: Prof. Esp. Silas Neiva de Carvalho A perícia contábil surgiu no início da civilização, sendo praticada por pessoas escolhidas pelo povo. Somente a partir do século XVII, o perito tornou-se auxiliar da justiça. No Brasil a perícia contábil foi legalizada pelo Decreto-lei nº 5.268/46, que criou o Cons...

  6. Donor/Acceptor-Stabilized 1-Silaketene: Reversible [2+2] Cycloaddition with Pyridine and Evolution by an Olefin Metathesis Reaction.

    Science.gov (United States)

    Reyes, Morelia Lopez; Troadec, Thibault; Rodriguez, Ricardo; Baceiredo, Antoine; Saffon-Merceron, Nathalie; Branchadell, Vicenç; Kato, Tsuyoshi

    2016-07-11

    The reaction of silacyclopropylidene 1 with benzaldehyde generates a 1-silaketene complex 2 by a formal atomic silicon insertion into the C=O bond of the aldehyde. The highly reactive 1-silaketene 2 undergoes a reversible [2+2] cycloaddition with pyridine to give sila-β-lactam 3. Of particular interest, in the presence of 4-dimethylaminopyridine (DMAP), 1-silaketene complex 2 evolves through an intramolecular olefin metathesis reaction, generating a new 1-silaketene complex 8 and cis-stilbene. Theoretical studies suggest that the reaction proceeds through the formation of a transient silacyclobutanone, a four-membered-ring intermediate, similar to that proposed by Chauvin and co-workers for the transition-metal-based olefin metathesis. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. PENINGKATAN HASIL BELAJAR SEPAK TAKRAW MELALUI COOPERATIVE LEARNING PADA SISWA KELAS IV SD N 1 TEMULUS KECAMATAN MEJOBO KABUPATEN KUDUS

    Directory of Open Access Journals (Sweden)

    Bagas Aulia

    2015-07-01

    Full Text Available This research is a classroom action research that executed in two cycles that consisting of planning, performing, observation, and reflection. Observational subject are fourth grade students of elementary school that totally 21 students. The variables in this research are student study result in sepak takraw at matter sepak sila and sepak kura. Data collecting in this classroom action research contain of practice method, observation, and documentation. Analysis tech that utilized is description analysis that using exhaustive classical presentation that compared by success indicator. Result of this research show the increasing of average value and exhaustive classical presentation. At first cycle student’s average value is 73,04 increasing to 83,05 at second cycle. Whereas exhaustive classical presentation at first cycle is 57,14% with proper category increasing to 80,95% with very good category at second cycle.

  8. Prilog optimalnom projektovanju aktivnog sistema za oslanjanje vozila / A contribution to optimal design of vehicle active suspension system

    Directory of Open Access Journals (Sweden)

    Miroslav Demić

    2005-05-01

    Full Text Available U ovom radu prikazanje sistem za aktivno oslanjanje vozila, uz korišćenje ravanskog modela vozila, bez filtera u povratnim spregama sistema za regulaciju. Za optimizaciju parametara PI kontrolera korišćena je metoda stohastičke parametarske optimizacije. Cilj optimizacije bio je istovremeno minimiziranje vibracijskih ubrzanja oslonjene mase i standardnog odstupanja sila u kontaktima točkova i tla, što poboljšava udobnost i ponašanje vozila na putu. / In this paper, an active suspension system is developed by use of a vehicle plane model without feedback filters in control system. A method of stochastic parameters optimization has been utilized in order to optimize PI controller parameters. The basic optimization goal was a simultaneous minimization of sprung mass acceleration and standard deviation of forces in tire-to-ground contact area, so as to improve vehicle comfort and handling performances.

  9. Pareuchiloglanis hupingshanensis, a new species of the glyptosternine catfish (Siluriformes: Sisoridae) from the middle Yangtze River, China.

    Science.gov (United States)

    Kang, Zujie; Chen, Yongxia; He, Dekui

    2016-02-18

    A new glyptosterniod catfish, Pareuchiloglanis hupingshanensis, is described on the basis of 29 specimens, which were collected from Hunan Hupingshan National Nature Reserve (HHNNR) in the Yangtze River basin, China. It can be distinguished from all congeners by morphology and sequences of the cytochrome b gene. Morphometric and molecular data show that the new species is closely related to P. sinensis Hora et Silas but differs from it in possessing a premaxillary tooth band with a deeper median indentation; a dentary tooth band which consists of two shorter and wider patches; a lower angle of gill opening, opposite to the base of the 4th or 5th (vs. second or third) branched pectoral-fin ray; an upper lip edged with dense papillae; the posterior end of the ventral fin falling distinctly short of (vs. almost reaching ) anus; a shorter dorsal fin; and a greater caudal-fin base depth.

  10. The sil Locus in Streptococcus Anginosus Group: Interspecies Competition and a Hotspot of Genetic Diversity.

    Science.gov (United States)

    Mendonca, Michelle L; Szamosi, Jake C; Lacroix, Anne-Marie; Fontes, Michelle E; Bowdish, Dawn M; Surette, Michael G

    2016-01-01

    The Streptococcus Invasion Locus (Sil) was first described in Streptococcus pyogenes and Streptococcus pneumoniae, where it has been implicated in virulence. The two-component peptide signaling system consists of the SilA response regulator and SilB histidine kinase along with the SilCR signaling peptide and SilD/E export/processing proteins. The presence of an associated bacteriocin region suggests this system may play a role in competitive interactions with other microbes. Comparative analysis of 42 Streptococcus Anginosus/Milleri Group (SAG) genomes reveals this to be a hot spot for genomic variability. A cluster of bacteriocin/immunity genes is found adjacent to the sil system in most SAG isolates (typically 6-10 per strain). In addition, there were two distinct SilCR peptides identified in this group, denoted here as SilCRSAG-A and SilCRSAG-B, with corresponding alleles in silB. Our analysis of the 42 sil loci showed that SilCRSAG-A is only found in Streptococcus intermedius while all three species can carry SilCRSAG-B. In S. intermedius B196, a putative SilA operator is located upstream of bacteriocin gene clusters, implicating the sil system in regulation of microbe-microbe interactions at mucosal surfaces where the group resides. We demonstrate that S. intermedius B196 responds to its cognate SilCRSAG-A, and, less effectively, to SilCRSAG-B released by other Anginosus group members, to produce putative bacteriocins and inhibit the growth of a sensitive strain of S. constellatus.

  11. Persistence of historical population structure in an endangered species despite near-complete biome conversion in California's San Joaquin Desert

    Science.gov (United States)

    Richmond, Jonathan Q.; Wood, Dustin A.; Westphal, Michael F.; Vandergast, Amy; Leache, Adam D.; Saslaw, Lawrence; Butterfield, H. Scott; Fisher, Robert N.

    2017-01-01

    Genomic responses to habitat conversion can be rapid, providing wildlife managers with time-limited opportunities to enact recovery efforts that use population connectivity information that reflects predisturbance landscapes. Despite near-complete biome conversion, such opportunities may still exist for the endemic fauna and flora of California's San Joaquin Desert, but comprehensive genetic data sets are lacking for nearly all species in the region. To fill this knowledge gap, we studied the rangewide population structure of the endangered blunt-nosed leopard lizard Gambelia sila, a San Joaquin Desert endemic, using restriction site-associated DNA (RAD), microsatellite and mtDNA data to test whether admixture patterns and estimates of effective migration surfaces (EEMS) can identify land areas with high population connectivity prior to the conversion of native xeric habitats. Clustering and phylogenetic analyses indicate a recent shared history between numerous isolated populations and EEMS reveals latent signals of corridors and barriers to gene flow over areas now replaced by agriculture and urbanization. Conflicting histories between the mtDNA and nuclear genomes are consistent with hybridization with the sister species G. wislizenii, raising important questions about where legal protection should end at the southern range limit of G. sila. Comparative analysis of different data sets also adds to a growing list of advantages in using RAD loci for genetic studies of rare species. We demonstrate how the results of this work can serve as an evolutionary guidance tool for managing endemic, arid-adapted taxa in one of the world's most compromised landscapes.

  12. Antioxidant activity and total phenolic and flavonoids content variations of leaves extracts of white Horehound (Marrubium vulgare Linné) from three geographical origins.

    Science.gov (United States)

    Bouterfas, K; Mehdadi, Z; Elaoufi, M M; Latreche, A; Benchiha, W

    2016-11-01

    To elucidate the effect of the sampling location of Marrubium vulgare L. leaves on phenolic contents and antioxidant proprieties of flavonoids extracts. M. vulgare L. leaves were collected from three different geographical locations belonging to northwest Algeria: Tessala (mountain region), M'sila forest (coastal region), and Ain Skhouna (steppe region). The flavonoid extraction was achieved using organic solvents with different polarities (methanol, chloroform, ethyl acetate, and hexane). Folin-Ciocalteu colorimetric method was used for quantification of total phenolic contents, and aluminum chloride assay for quantification of total flavonoid contents. The antioxidant properties of flavonoids extract were studied by free l,l-diphenyl-2-picrylhydrazyl radical-scavenging technique. Total phenolic and flavonoids concentrations varied respectively between 40.7 and 160mg gallic acid equivalents/g and 27.4 and 66.3mg catechin equivalents/g. The DPPH free radical-scavenging activity shows that the antioxidant activity of the flavonoid extracts varied significantly (Pextracts exhibited the highest percentages of inhibition unlike to the aqueous and hexane extracts. These percentages are ranged from 54.8 to 98.8% at 1000μg/mL. In general, M'sila forest flavonoids extracts showed the highest free radical inhibition capacity; followed by those of Ain Skhouna and Tessala Mountain. The inhibitory concentration 50 (IC 50 ) ranged from 33.7 to 774μg/mL and often exceeded those recorded by phenolic standards (ascorbic acid, gallic acid, caffeic acid, tannic acid and catechin). The phytochemical screening revealed the presence of some flavonoid classes, such as flavans and flavanols. The results suggested a potent antioxidant activity of M. vulgare flavonoids extracts, which may find its application in feature research for the food and the pharmacological industries. Copyright © 2016 Académie Nationale de Pharmacie. Published by Elsevier Masson SAS. All rights reserved.

  13. Effectiveness of silica-lasing method on the bond strength of composite resin repair to Ni-Cr alloy.

    Science.gov (United States)

    Madani, Azam S; Astaneh, Pedram Ansari; Nakhaei, Mohammadreza; Bagheri, Hossein G; Moosavi, Horieh; Alavi, Samin; Najjaran, Niloufar Tayarani

    2015-04-01

    The aim of this study was to evaluate the effectiveness of silica-lasing method for improving the composite resin repair of metal ceramic restorations. Sixty Ni-Cr cylindrical specimens were fabricated. The bonding surface of all specimens was airborne-particle abraded using 50 μm aluminum oxide particles. Specimens were divided into six groups that received the following surface treatments: group 1-airborne-particle abrasion alone (AA); group 2-Nd:YAG laser irradiation (LA); group 3-silica coating (Si-CO); group 4-silica-lasing (metal surface was coated with slurry of opaque porcelain and irradiated by Nd:YAG laser) (Si-LA); group 5-silica-lasing plus etching with HF acid (Si-LA-HF); group 6-CoJet sand lased (CJ-LA). Composite resin was applied on metal surfaces. Specimens were thermocycled and tested in shear mode in a universal testing machine. The shear bond strength values were analyzed using ANOVA and Tukey's tests (α = 0.05). The mode of failure was determined, and two specimens in each group were examined by scanning electron microscopy and wavelength dispersive X-ray spectroscopy. Si-CO showed significantly higher shear bond strength in comparison to other groups (p 0.05). The failure mode was 100% adhesive for AA, Si-LA, Si-LA-HF, and CJ-LA. LA and Si-CO groups showed 37.5% and 87.5% cohesive failure, respectively. Silica coating of Ni-Cr alloy resulted in higher shear bond strength than those of other surface treatments. © 2014 by the American College of Prosthodontists.

  14. Marker-assisted pyramiding of Thinopyrum-derived leaf rust ...

    Indian Academy of Sciences (India)

    Mona Singh

    2017-12-08

    Dec 8, 2017 ... ilies carrying both Lr19 and Lr24 in homozygous state were developed. The details of gene pyramiding scheme are given in figure 1. Apart from the use of molecular markers, shuttle breed- ing was used to accelerate the development of NILs. Two generations in a year were raised; one at IARI, New Delhi,.

  15. EuroWordNet : a multilingual database of autonomous and language-specific wordnets connected via Inter-Lingual-Index

    NARCIS (Netherlands)

    Vossen, P.T.J.M.

    2004-01-01

    This paper describes the multilingual design of the EuroWordNet database. The EuroWordNet database stores wordnets as autonomous language -specific structures that are interconnected via an Inter-Lingual-Index (ILI). In this paper, we discuss the possibilities to create mappings from each wordnet

  16. extraction of high quality dna from polysaccharides-secreting ...

    African Journals Online (AJOL)

    cistvr

    ily and was well digested by restriction enzymes. All of the other methods tested resulted in the ... that was not contaminated with inhibitors of DNA modifying enzymes and poly- merases. Both pathogens secrete excessive .... De gomziekte van het suikerret. hare oorzaak in hare bestrijding. Archief voor de Suikerindustrie ...

  17. First report of a novel LMNA mutation in a Chinese family with limb ...

    Indian Academy of Sciences (India)

    2014-12-12

    Dec 12, 2014 ... was performed using Wizard Genomic DNA Purification Kit ... Clinical features. The pedigree of the family is shown in figure 1. This fam- ily shows inheritance as an autosomal dominant model. The proband (III 5), a 46-year-old man who suffered .... nuclear shape and structure, as well as functional roles in.

  18. Heterogeneity in both cytokine production and responsiveness of a panel of monoclonal human Epstein-Barr virus-transformed B-cell lines

    NARCIS (Netherlands)

    Jochems, G. J.; Klein, M. R.; Jordens, R.; Pascual-Salcedo, D.; van Boxtel-Oosterhof, F.; van Lier, R. A.; Zeijlemaker, W. P.

    1991-01-01

    To optimize growth and Ig production of in vitro-cultured Epstein-Barr virus (EBV)-transformed B cells, a panel of six monoclonal EBV B-cell lines was analyzed for autocrine growth factor production and responsiveness to various cytokines. Three cell lines produced Il-I and four produced Il-6,

  19. Page 1 Synthesis of Citreorosein and Alº-Emodin 421 The mixture ...

    Indian Academy of Sciences (India)

    distilled, When an orange-red solid was left behind, which crystallised from glacial acetic acid as orange-yellow rectangular plates melting at 206–07°. Yield, 0.5 g. It was insoluble in aqueous sodium carbonate (5%) but dissolved. *ily in sodium hydroxide and potassium hydroxide producing purple red solutions from which ...

  20. Radial variation of whistler-mode chorus: first results from the STAFF/DWP instrument on board the Double Star TC-1 spacecraft

    Directory of Open Access Journals (Sweden)

    O. Santolík

    2005-11-01

    Full Text Available We use the first measurements of the STAFF/DWP instrument on the Double Star TC-1 spacecraft to investigate whistler-mode chorus. We present initial results of a systematic study on radial variation of dawn chorus. The chorus events show an increased intensity at <i>L> parameter above 6. This is important for the possible explanation of intensifications of chorus, which were previously observed closer to the Earth at higher latitudes. Our results also indicate that the upper band of chorus at frequencies above one-half of the electron cyclotron frequency disappears for <i>L> above 8. The lower band of chorus is observed at frequencies below 0.4 of the electron cyclotron frequency up to <i>L> of 11-12. The maxima of the chorus power spectra are found at slightly lower frequencies compared to previous studies. We do not observe any distinct evolution of the position of the chorus frequency band as a function of <i>L>. More data of the TC-1 spacecraft are needed to verify these initial results and to increase the MLT coverage.

  1. Buii.Chern.Soc.Ethiop., 1992,6(2) 119422.

    African Journals Online (AJOL)

    FLAVONOIDS OF POLYGONUM SENEGALENSE (MEISN) PART II1 : MOFIE. SURFACE AND INTERNAL TISSUE FLAVONOID AGLYCONES. J. Ogweno MidiWOa. N.K. Gikonyoa, D.O. Wanjaua, J.J. ili'iatasia and PG. Waterman“. aDepartment of Chemistry, College of Biological and Physical Sciences, University of Nairobi ...

  2. Ufundishaji wa Kusoma na Kuandika Kiswahili: Uzoefu wa Idara ya ...

    African Journals Online (AJOL)

    Makala haya yanahusu shughuli za kufundisha Kiswahili kama lugha ya kigeni katika Chuo Kikuu cha Sebha nchini Libya. Kwanza inaeleza historia ya Kiswahili – yaani kilianza lini kufundishwa kwa madhumuni gani na nani walikuwa wanzilishi. Halikadhalika makala ya naeleza utaratibu uliowekwa na idara ili kuweza ...

  3. Riwaya ya Kiswahili katika ufundishaji wa historia | Mlaga | Kiswahili

    African Journals Online (AJOL)

    Makala haya yanachunguza uwezekano wa riwaya ya Kiswahili kutumika katika ufundishaji wa historia. Makala yamejiegemeza katika kuonesha namna ambavyo riwaya kama utanzu mmojawapo wa fasihi unafaa kufundishia historia. Hivyo basi, hoja mbalimbali zinabainishwa ili kuonesha namna ambavyo riwaya ya ...

  4. Utafiti Wa Lahaja Za Kiswahili: Uzoefu Wa Uwandani | Ismail ...

    African Journals Online (AJOL)

    Katika ujumla wake, historia ya utafiti, na hasa utafiti wa uwandani, ni historia ya jitihada za binadamu katika kujishughulisha kwake ili ayaelewe masuala mengi mtambuka katika mazingira fungamanishi. Hakuna mtafiti yeyote anayeweza kudai kuwa utafiti wa mada fulani katika eneo fulani umekamilika na ...

  5. Combining Search, Social Media, and Traditional Data Sources to Improve Influenza Surveillance.

    Science.gov (United States)

    Santillana, Mauricio; Nguyen, André T; Dredze, Mark; Paul, Michael J; Nsoesie, Elaine O; Brownstein, John S

    2015-10-01

    We present a machine learning-based methodology capable of providing real-time ("nowcast") and forecast estimates of influenza activity in the US by leveraging data from multiple data sources including: Google searches, Twitter microblogs, nearly real-time hospital visit records, and data from a participatory surveillance system. Our main contribution consists of combining multiple influenza-like illnesses (ILI) activity estimates, generated independently with each data source, into a single prediction of ILI utilizing machine learning ensemble approaches. Our methodology exploits the information in each data source and produces accurate weekly ILI predictions for up to four weeks ahead of the release of CDC's ILI reports. We evaluate the predictive ability of our ensemble approach during the 2013-2014 (retrospective) and 2014-2015 (live) flu seasons for each of the four weekly time horizons. Our ensemble approach demonstrates several advantages: (1) our ensemble method's predictions outperform every prediction using each data source independently, (2) our methodology can produce predictions one week ahead of GFT's real-time estimates with comparable accuracy, and (3) our two and three week forecast estimates have comparable accuracy to real-time predictions using an autoregressive model. Moreover, our results show that considerable insight is gained from incorporating disparate data streams, in the form of social media and crowd sourced data, into influenza predictions in all time horizons.

  6. Integrated Care for Multisensory Injury

    Science.gov (United States)

    2013-07-01

    eas- ily replicated in civilian care networks, but they can nonetheless provide experience and modeling informative to sports medi- cine , first...responders, homeland security and other law enforcement, anti- terror , anti-narcotic, and public safety sectors of care where individuals encounter

  7. presumptive diagnosis of schistosoma haematobium and ...

    African Journals Online (AJOL)

    boaz

    ABSTRACT. A cross-sectional study was carried out in Ilie community of Olorunda Local Government Area in Osun state, southwestern. Nigeria to comparatively evaluate the presumptive diagnosis of schistosoma infections using microscopy as gold standard. One hundred and thirty seven consented primary school ...

  8. Hiinlased tahavad ehitada Ringtee silda

    Index Scriptorium Estoniae

    2007-01-01

    2007. a. suvel kohtusid Tartu linnajuhtidega Shangai projekteerimisfirma Lin Tung-Yen & Li Guo-Hao Consultants Ltd ja Jiangsu provintsist pärit ehitusfirma Jiangyn Bridge Engineering Ltd esindajad, et esitada oma nägemus Tartusse planeeritavast Ringtee sillast. Anto Ili kommentaar

  9. FAIR-TRADE INDIGO IN EL SALVADOR INDIGO ÉQUITABLE AU ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    of her three children head over to the indigo planta- tion, where they clean and fertilize the crops. Jose and Santos Inocente are among the 18 fam- ilies of the San Lucas community—which is located about an hour's drive northwest of El Salvador's capital—who celebrated their first harvest of true in- digo leaves under fair ...

  10. mined from prescribed relations of the points with given points, and ...

    Indian Academy of Sciences (India)

    Loci of points in the Euclidean plane are deter- mined from prescribed relations of the points with given points, and/or, lines. The depen- dence of these relations on parameters lead to the differential equations representing the fam- ily of loci under concern. Incidentally most of the differential equations thus obtained are non ...

  11. Arabidopsis CDS blastp result: AK063170 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK063170 001-110-G09 At4g25110.1 latex-abundant family protein (AMC2) / caspase fam...ily protein contains similarity to latex-abundant protein [Hevea brasiliensis] gb:AAD13216; contains Pfam profile PF00656: ICE-like protease (caspase) p20 domain 2e-65 ...

  12. An Infection Control Program for a 2009 Influenza A H1N1 Outbreak in a University-Based Summer Camp

    Science.gov (United States)

    Tsalik, Ephraim L.; Cunningham, Coleen K.; Cunningham, Hannah M.; Lopez-Marti, Maria G.; Sangvai, Devdutta G.; Purdy, William K.; Anderson, Deverick J.; Thompson, Jessica R.; Brown, Monte; Woods, Christopher W.; Jaggers, L. Brett; Hendershot, Edward F.

    2011-01-01

    Objectives: Describe two 2009-H1N1 influenza outbreaks in university-based summer camps and the implementation of an infection control program. Participants: 7,906 campers across 73 residential camps from May 21-August 2, 2009. Methods: Influenza-like-illness (ILI) was defined as fever with cough and/or sore throat. Influenza A was identified…

  13. An Evaluation of the Intensity of Mentoring: Child Outcomes

    Science.gov (United States)

    Lambert, Richard; Gallagher, Peggy A.; Abbott-Shim, Martha

    2015-01-01

    This study examines the intensity effect of a mentoring intervention for Head Start teachers, the Individualised Learning Intervention (ILI), as it impacts child social emotional outcomes. Pairs of Mentor and Protégé teachers across three sites in two states were randomly assigned to intervention and control groups. Mentors in the intervention…

  14. FİNANSAL VEKTÖREL ZAMAN DİZİLERİNDE ÖZDEĞER-ÖZVEKTÖR ANALİZİYLE EŞZAMANLI VE GECİKMELİ DOĞRUSAL İLİŞKİLERİN TESBİTİ

    Directory of Open Access Journals (Sweden)

    REŞAT KASAP

    2013-05-01

    Full Text Available Bu çalışmada, vektörel zaman dizilerinde modelleme aşamasında, dizilerin birbirleriyle ilişkilerini ortaya koyan eşzamanlı ve gecikmeli doğrusal ilişkilerin tesbiti, iki farklı gerçek veri grubu üzerinde gösterilmiştir. Bunlardan birincisi, üç diziden oluşan Ziraat Bankası(TCZB’nın verdiği kredi dizileridir. Diğeri ise, ABD Doları’nın BP(İngiliz Sterlini, DM(Alman Markı, SF(İsviçre Frangı, ve YEN(Japon Yeni’e göre değişimlerini veren dört dizidir. Analizler sonucunda vektör AR(1 ile modellenen her iki grupdan; birincisinde doğrusal ilişkilerin her ikisinin de olmadığı, diğer veri grubunda ise her iki ilişkinin de var olduğu görülmüştür.

  15. Profiling the Youth Leader: Personality and Emotional Intelligence Trends and Their Relationship to Leadership Skills

    Science.gov (United States)

    McElravy, L. J.; Hastings, Lindsay J.

    2014-01-01

    The transfer of leadership to younger generations is an important factor in agricultural communities and is likely one reason developing leaders is a central mission of many youth organizations, including 4-H and FFA. In adults, researchers have extensively explored the relationship between personality traits and leadership (Judge, Bono, Ilies,…

  16. The Fifth Annual Navy Workforce Research and Analysis Conference: Building on the Pillars of the Navy’s Human Capital Strategy

    Science.gov (United States)

    2005-08-01

    IlI List of tables ......... ............................ 115 Introduction As the Chief of Naval Operations (CNO) announced...R. Wesley Nimon (NPRST) presented a three-step assignment auction process that leverages the power of optimization to generate recommended matches...considerably, or will it 88 remain largely unchanged? Dr. Nimon presented a decision support tool that quickly displays the tradeoffs associated with

  17. Deepening Democracy: Explaining Variations in the Levels of Democracy

    Science.gov (United States)

    2010-06-01

    neighbors adopted increased levels of democracy. Level of: M ex ic o Ph ili pp in es Se ne ga l Income High Medium Low Industrialization High Low...Informacion Estadistica Sector Salud y Seguridad Social, Cauderno No. 4, Mexico City: INEGI, 1985. 276 THIS PAGE INTENTIONALLY LEFT BLANK

  18. Anaesthetic efficacy of intraligamentary injection techniques on mandibular molars diagnosed with asymptomatic irreversible pulpitis: A retrospective study.

    Science.gov (United States)

    Lin, Shaul; Wigler, Ronald; Huber, Ronen; Kaufman, Arieh Y

    2017-04-01

    The objective of this study was to evaluate the success rate of intraligamentary injections (ILI) using a two- or four-site injection technique. One hundred and fifty-one mandibular molars diagnosed with asymptomatic irreversible pulpitis received ILI at the mesiobuccal and distobuccal aspects of the roots. Patients who experienced pain when the access cavity was performed received additional supplemental ILI in the mesiolingual and distolingual aspects. Pulpal anaesthesia was considered successful when complete analgesia was achieved. The data were analysed by means of the Fisher's exact and Pearson's chi-square tests. IL anaesthesia was successful for 92.1% of the teeth. Forty-eight teeth (31.8%) were sufficiently anaesthetised using the two-site ILI and 91 teeth (60.3%) following supplemental IL anaesthesia in two more sites. The results of this study indicate that the use of four-site IL injections as a primary anaesthetic technique may be considered a favourable alternative to the common IANB. © 2016 Australian Society of Endodontology Inc.

  19. The Interdictor’s Lot: A Dynamic Model of the Market for Drug Smuggling Services

    Science.gov (United States)

    1988-02-01

    8217 market (pure competition, Cournot -Nash noncooperative behavior, or collusive cartel), * the rationale for entry decisions (current price, current... Cournot , or Collusive Behavior"--leads to submenu IliA, and allows the user to select pure competition (each smuggler takes price as given

  20. "Pedagogias Del Camaleon"/Pedagogies of the Chameleon: Identity and Strategies of Survival for Transnational Indigenous Latino Immigrants in the US South

    Science.gov (United States)

    Machado-Casas, Margarita

    2012-01-01

    Based on a 3-year qualitative research study that took place in a new immigrant-receiving community in North Carolina, the manuscript examines the implications of transnational cultural and sociolinguistic patterns of multilingual indigenous Latino immigrants (ILIs), and its effects on their survival in the US. Utilizing narrative analysis, it…

  1. Patient-reported Measurements of Oral Mucositis in Head and Neck Cancer Patients Treated With Radiotherapy With or Without Chemotherapy Demonstration of Increased Frequency, Severity, Resistance to Palliation, and Impact on Quality of Life

    NARCIS (Netherlands)

    Elting, Linda S.; Keefe, Dorothy M.; Sonis, Stephen T.; Garden, Adam S.; Spijkervet, F. K. L.; Barasch, Andrei; Tishler, Roy B.; Canty, Thomas P.; Kudrimoti, Mahesh K.; Vera-Lionch, Montserrat

    2008-01-01

    BACKGROUND. I-lie risk, severity, and patient-reported outcomes of radiation-induced mucositis among head and neck cancer patients were prospectively estimated. METHODS. A validated, patient-reported questionnaire (OMDQ), the FACT quality of life (QOL), and the Functional Assessment of Chronic

  2. Range extension of the White-headed Buffalo Weaver Dinemellia ...

    African Journals Online (AJOL)

    40°49'E; elevation 625 m) at a site dominated by dry bush habitats, and fairly heav- ily grazed by livestock. Five birds, all in adult plumage, were seen well and photo- graphed at 16:00 on 20 January 2015. They were feeding on the ground and perching briefly; no breeding-related behaviours were noted, and the birds were ...

  3. NCBI nr-aa BLAST: CBRC-GGOR-01-1322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-1322 gb|AAP44475.1| transient receptor potential cation channel subfam...ily M member 4 splice variant C [Homo sapiens] gb|EAW52460.1| transient receptor potential cation channel, subfamily M, member 4, isoform CRA_a [Homo sapiens] AAP44475.1 3e-28 87% ...

  4. Pathways of Expansion and Multiple Introductions Illustrated by Large Genetic Differentiation Among Worldwide Populations of the Southern House Mosquito

    Science.gov (United States)

    2006-01-01

    Uc;,,~ ’I It-. ":1" ..":lk:tlbh..t’ ,)"’ll’H~1I hIli .,um I’",d. \\\\h~ll·,t D 1t1l’ nuru~, til imJi" UJu ...t... s.. ;, Ih\\. numtTt.:1 ..I \\"~IIIK𔃻

  5. NCBI nr-aa BLAST: CBRC-DDIS-05-0125 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-05-0125 ref|YP_628541.1| putative cation transporter/universal stress fam...ily protein [Myxococcus xanthus DK 1622] gb|ABF92456.1| putative cation transporter/universal stress family protein [Myxococcus xanthus DK 1622] YP_628541.1 3e-90 34% ...

  6. AcEST: DK960785 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ily A member 2 OS=Rattus norvegicus GN=Dnaja2 PE=2 SV=1 Length = 412 Score = 44.7 bits (104), Expect = 4e-04... homolog subfamily A member 2 OS=Mus musculus GN=Dnaja2 PE=2 SV=1 Length = 412 Sc

  7. AcEST: DK957996 [AcEST

    Lifescience Database Archive (English)

    Full Text Available A member 2 OS=Rattus norvegicus GN=Dnaja2 PE=2 SV=1 Length = 412 Score = 119 bits (299), Expect = 9e-27 Ide...ily A member 2 OS=Mus musculus GN=Dnaja2 PE=2 SV=1 Length = 412 Score = 118 bits (296), Expect = 2e-26 Ident

  8. A study of the health and economic effects of influenza-like illness on the working population under different working environments of a large corporation in Hong Kong.

    Science.gov (United States)

    Lee, Kenneth K C; Li, Shu Chuen; Kwong, Kai Sun; Chan, Thomas Y K; Lee, Vivian W Y; Lau, Joseph T F

    2008-01-01

    The incidence, health and economic impacts of influenza-like illness (ILI) among the working population in Hong Kong had never been studied. Due to the nature of the disease, ILIs can have a significant impact on the operation of a corporation in terms of loss of productivity and reduced work performance. The present study was undertaken to determine the health and economic impacts of ILIs under different environmental conditions on the working population of a large corporation. Over 2,000 employees of a large corporation in the travelling and tourism industry were studied with three different types of working environment (confined, typical office and well ventilated) by two structured questionnaires. The most affected group in terms of productivity and health was the group working in a confined area, whilst those working in a well-ventilated area were least affected. However, symptoms of the confined area group seemed to disappear faster. The infection rate appeared to vary according to work environment for the studied population. Policies on preventive measures and early treatment are important for a corporation to reduce loss in productivity due to ILIs.

  9. The look AHEAD trial: bone loss at four-year follow-up in type 2 diabetes

    Science.gov (United States)

    OBJECTIVE: To determine whether an intensive lifestyle intervention (ILI) designed to sustain weight loss and improve physical fitness in overweight or obese persons with type 2 diabetes was associated with bone loss after 4 years of follow-up. RESEARCH DESIGN AND METHODS: This randomized controlled...

  10. A System Dynamic Model of Leader Emergence

    Science.gov (United States)

    2008-03-01

    Judge, 2004; Judge, Bono, Ilies, & Gerhardt, 2002; Eagly, Johanneses-Schmidt, & Van Engen , 2003; Taggar, Hackett, & Saha, 1999; Stogdill, 1948...System dynamics emerged from the study of electrical control systems, and when generalized found many useful applications in natural systems outside...of the electrical world (Forrester, 1992). Whereas correlations describe cause and effect relationships in a linear equation, system dynamics

  11. Visual Propaganda and Extremism in the Online Environment

    Science.gov (United States)

    2014-07-01

    depicting a group’s violent acts as legitimate, for reaching sympathetic target audiences, and for in- timidating opponents.6 THE RISE OF... grade , poor quality, gray scale footage may have the most credibility; however, it does not necessar- ily stand out with the groups’ target audience

  12. Dicty_cDB: SLF353 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-56 EU999182_1( EU999182 |pid:none) Artemia franciscana ribosomal prot... 218 8e-56 AM048985_1( AM048985 |pid:none) Micromalthus deb...ilis partial mRNA ... 218 8e-56 EF070522_1( EF070522 |pid:none) Maconellicoccus hir

  13. (Pax7) on growth traits

    Indian Academy of Sciences (India)

    2Institute of Cellular and Molecular Biology, Xuzhou Normal University, Xuzhou, Jiangsu 221116, ... ily, is the identification gene of myogenic satellite cells and ..... Asymmetric self-renewal and commitment of satellite stem cells in muscle. Cell 129, 999–1010. Le Grand F. and Rudnicki M. A. 2007 Skeletal muscle satellite.

  14. The Effect of Educational Computerized Games on Learning English Spelling among Iranian Children

    Science.gov (United States)

    Mehrpour, Saeed; Ghayour, Maaedeh

    2017-01-01

    The present study investigated the effects of educational computerized games on learning English spelling among Iranian children. In doing so, 66 young Iranian English learners with the average age of 9.5, attending the children's branch of Iran Language Institute (ILI), the most well-established state-run language teaching institute in Iran,…

  15. US EPA, Pesticide Product Label, CONCENTRATED BOWL ...

    Science.gov (United States)

    2011-04-19

    ... Iud i !I~_~ ,llll i -:, j III i " Il"\\\\IL'lll '1ubL'l"llL' ILiLilli. l',"'\\ II:! ;ill '.'.Ik~~ ,q" s111·f~tl'l~s ijllltldi;~:' fllllll-S, \\.J,11ls, l.:JbillL'LS, fi:-:ldl"L.'S, l-,I)iJcr gUIld . ...; ...

  16. YÖNETİCİNİN ALGILANAN LİDERLİK TARZI İLE YÖNETİCİYE DUYULAN GÜVEN ARASINDAKİ İLİŞKİDE LİDER ÜYE ETKİLEŞİMİNİN ROLÜ - THE ROLE OF THE LEADER– MEMBER INTERACTION IN THE RELATIONSHIP BETWEEN THE PERCEIVED LEADERSHIP STYLE AND THE TRUST IN MANAGER

    OpenAIRE

    YOLAÇ, Sema

    2011-01-01

    Özet:Çalışanlar, algıladıkları liderlik tarzına göreyöneticilerine güven duymaktadır. Güven kavramı da hemizleyicilerin, hem de örgütün verimliliğini etkilemektedir.Liderler her bir çalışanıyla aynı düzeyde ilişki geliştirmezler.Lider ve izleyicileri arasındaki farklı ilişki düzeyi, lider-üyeetkileşim teorisiyle açıklanmaktadır. Bu çalışmada, lider-üyeetkileşim ilişkisi içinde, liderlik tarzı ve yöneticiye duyulangüven arasındaki ilişki ele alınmaktadır. Bu amaçla anketçalışması yapılmıştır. ...

  17. Abstract Introduction

    African Journals Online (AJOL)

    powdery' m~ldew disease (Oidium anacardii. ,. I. Noack) was controlled using wettable sulphur at. 14daY:ini~r.~als.~ '\\ " , " . .' , , .: i PanIcles of the selected female. parents were. ,. ' I bagged using locally ·made paper bags to exclude potehtial pollinating ihsects;, 'Each bagged pani- cle was ciiecked' d~ily 'between 07.

  18. Molecular and Biological Properties of an Immunopotentiating Complex Polysaccharide Adjuvant Produced by a Gliding Bacterium.

    Science.gov (United States)

    1985-12-13

    supernatants wre tested for IL-i in the thymocyte camitogen assay. Results are CPM.- - 77.... DISTRIBUTION LIST Imunological Defense Program Annual. Final and...Matthew J. Kiuger Dr. Barnet M. Sultzer Department of Physiology Department of Microbiology University of Michigan Med. School and Imunology 7620

  19. Original Paper Intestinal Helminthiasis among School Children in ...

    African Journals Online (AJOL)

    There is a big dam which serves as a source of water for bathing and other ... Data Analysis. The data obtained were analysed using Duncan multiple range test and Chi-square statistical package. The differences were considered to be statistically .... Table 5: Socio-Demographic Data of School Children in ilie. Parameter.

  20. TÜRKİYE'DEKİ BAZI PEATLERİN AYRIŞMA DERECESİ, KATYON DEĞİŞİM KAPASİTESİ VE ORGANİK MADDESİ ARASINDAKİ İLİŞKİLER

    Directory of Open Access Journals (Sweden)

    Abdullah BARAN

    1996-02-01

    Full Text Available Bu araştırmada, Türkiye'nin 14 ayrı bölgesinden 0-20 cm, 20-40 cm ve 40-60 cm derinliklerden alınan peat örneklerinin ayrışma dereceleri, katyon değişim kapasiteleri (KDK ve organik madde miktarları arasındaki ilişkiler incelenmiştir. Peat örneklerinin ayrışma derecesi ile KDK ve organik madde arasındaki ilişkilerin yanısıra, organik madde ile KDK arasındaki ilişki de belirlenmiştir. KDK ve organik madde miktarlarının artması ile ayrışmanın azaldığı, organik madde ile KDK arasında da pozitif bir ilişki olduğu yapılan istatistiksel analizlerle belirlenmiştir.

  1. Yeast Interacting Proteins Database: YDL239C, YKL103C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available that belongs to the peptidase family M18; often used as a marker protein in studies of autophagy and cytosol...ily M18; often used as a marker protein in studies of autophagy and cytosol to vacuole targeting (CVT) pathw

  2. Effectiveness of 2010/2011 seasonal influenza vaccine in Ireland.

    LENUS (Irish Health Repository)

    Barret, A S

    2012-02-01

    We conducted a case-control study to estimate the 2010\\/2011 trivalent influenza vaccine effectiveness (TIVE) using the Irish general practitioners\\' influenza sentinel surveillance scheme. Cases were influenza-like illness (ILI) patients with laboratory-confirmed influenza. Controls were ILI patients who tested negative for influenza. Participating sentinel general practitioners (GP) collected swabs from patients presenting with ILI along with their vaccination history and other individual characteristics. The TIVE was computed as (1 - odds ratiofor vaccination) x100%. Of 60 sentinel GP practices, 22 expressed interest in participating in the study and 17 (28%) recruited at least one ILI patient. In the analysis, we included 106 cases and 85 controls. Seven controls (8.2%) and one influenza case (0.9%) had been vaccinated in 2010\\/2011. The estimated TIVE against any influenza subtype was 89.4% [95% CI: 13.8; 99.8%], suggesting a protective effect against GP-attended laboratory confirmed influenza. This study design could be used to monitor influenza vaccine effectiveness annually but sample size and vaccination coverage should be increased to obtain precise and adjusted estimates.

  3. Kiswahili kama Nyenzo ya Maendeleo Nchini Kenya | Mukuthuria ...

    African Journals Online (AJOL)

    Nia ya makala haya ni kubainisha mchango huu katika kufanikisha malengo ya kitaifa katika sehemu za mashambani. Ili kufanikisha lengo la makala haya, kielelezo cha nadharia ya mawasiliano kinachotilia maanani hali halisi ya sehemu za mashambani Kenya kitatumika. Lengo kuu ni kuthibitisha jinsi ambavyo mikakati ...

  4. Studying employee well-being : Moving forward

    NARCIS (Netherlands)

    Ilies, R.; Pluut, Helen; Aw, S.S.Y.

    2015-01-01

    In this article, we attempt to integrate the commentaries to our position paper on intra-individual models of employee well-being (EWB; Ilies, R., Aw, S. S. Y., & Pluut, H. (2015). Intraindividual models of employee well-being: What have we learned and where do we go from here? European Journal of

  5. Evaluation of an influenza-like illness case definition in the diagnosis of influenza among patients with acute febrile illness in cambodia

    Directory of Open Access Journals (Sweden)

    Sovann Ly

    2010-11-01

    Full Text Available Abstract Background Influenza-like illness (ILI is often defined as fever (>38.0°C with cough or sore throat. In this study, we tested the sensitivity, specificity, and positive and negative predictive values of this case definition in a Cambodia patient population. Methods Passive clinic-based surveillance was established at nine healthcare centers to identify the causes of acute undifferentiated fever in patients aged two years and older seeking treatment. Fever was defined as tympanic membrane temperature >38°C lasting more than 24 hours and less than 10 days. Influenza virus infections were identified by polymerase chain reaction. Results From July 2008 to December 2008, 2,639 patients were enrolled. From 884 (33% patients positive for influenza, 652 presented with ILI and 232 acute fever patients presented without ILI. Analysis by age group identified no significant differences between influenza positive patients from the two groups. Positive predictive values (PPVs varied during the course of the influenza season and among age groups. Conclusion The ILI case definition can be used to identify a significant percentage of patients with influenza infection during the influenza season in Cambodia, assisting healthcare providers in its diagnosis and treatment. However, testing samples based on the criteria of fever alone increased our case detection by 34%.

  6. Investigation of Factors Affecting Information Literacy Student Learning Outcomes Fails to Undercover Significant Findings. A Review of: Detlor, B., Julien, H., Willson, R., Serenko, A., & Lavallee, M. (2011. Learning outcomes of information literacy instruction at business schools. Journal of the American Society for Information Science and Technology, 62(3, 572-585.

    Directory of Open Access Journals (Sweden)

    Jason Martin

    2011-06-01

    Full Text Available Objective – To ascertain the factors influencing student learning during information literacy instruction (ILI and create a theoretical model based on those factors.Design – Mixed methodology consisting of interviews and an assessment test.Setting – Three Canadian business schools.Subjects – Seven librarians, 4 library administrators, 16 business faculty, and 52 undergraduate business students were interviewed, and the Standardized Assessment of Information Literacy Skills (SAILS test was administered to 1,087 undergraduate business students across three different business schools.Methods – The authors used an interview script to conduct interviews with librarians, library administrators, business school faculty, and undergraduate business school students at three business schools in Canada. The authors also administered the SAILS test to undergraduate business students at the same three Canadian business schools.Main Results – ILI works best when it is related to an assignment, part of the curriculum, periodically evaluated, adequatelyfunded, timely, mandatory, interactive, uses handouts, provides the proper amount of information, and favourably viewed within the school. ILI student learning outcomes are affected by whether the students find the ILI beneficial and relevant, their year in the program, gender, status as international or domestic student, and overall academic achievement.Conclusion – Creation of theoretical model consisting of the three main factors influencing student learning outcomes in information literacy instruction: learning environment, information literacy components, and student demographics.

  7. Dicty_cDB: AFM237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pmfrc*iwqtys cvtn**yhrrsqwqsl*slpqtilfrslpssp*g*lifstwwyesrri*scrnrpr*ily rctrdiytl*r*gsqerg*rpsr*gwlr*--- ---mcfvl**vg*xctxxrf...itr*cwwcw**syqsnfn*ngwyerqexrfhhwcyq*try hrssyppsrsfrsthlhsitr...ftiscchxqglxq*ixsrqgcrfxifgskxsrfxwxrfn *nlstcl*isys*ih*kgy*ixqspsxiw*xqxgx*lcrsxtrnys*slpxsheicssfx ir**y*k

  8. Developing the bundled glass column

    NARCIS (Netherlands)

    Oikonomopoulou, F.; Bristogianni, T; Veer, F.A.; Nijsse, R.; da Sousa Cruz, Paulo J.

    In this paper a bundled glass column is presented as a promising solution for a completely transparent, almost dematerialized structural compressive element. The aim is to ob-tain a glass column that can safely carry loads, achieve a high visual result and be relatively eas-ily manufactured.

  9. A new starting point for powerful lignin promotion : Eurolignin and linked activities

    NARCIS (Netherlands)

    Abaecherli, A.; Gosselink, R.J.A.; Jong, de E.; Guran, B.

    2004-01-01

    The International Lignin Institute (ILI) was created in 1991 as a new platform for promotion of lignin utilisations. For a few years, the activity was based on informal information exchange, such as Newsletters, international conferences (Forums) and Workshops, as well as in the proceedings of these

  10. NCBI nr-aa BLAST: CBRC-OLAT-26-0221 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-26-0221 ref|NP_504494.2| Prion-like-(Q/N-rich)-domain-bearing protein fam...ily member (pqn-13) [Caenorhabditis elegans] gb|AAA96110.3| Prion-like-(q/n-rich)-domain-bearing protein protein 13 [Caenorhabditis elegans] NP_504494.2 3e-23 25% ...

  11. NCBI nr-aa BLAST: CBRC-BTAU-01-2227 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2227 ref|NP_504494.2| Prion-like-(Q/N-rich)-domain-bearing protein fam...ily member (pqn-13) [Caenorhabditis elegans] gb|AAA96110.3| Prion-like-(q/n-rich)-domain-bearing protein protein 13 [Caenorhabditis elegans] NP_504494.2 2e-08 25% ...

  12. Effectiveness of lifestyle interventions for individuals with severe obesity and type 2 diabetes

    Science.gov (United States)

    Rates of severe obesity (BMI greater than or equal to 40 kg/m(2)) are on the rise, and effective treatment options are needed. We examined the effect of an intensive lifestyle intervention (ILI) on weight loss, cardiovascular disease (CVD) risk, and program adherence in participants with type 2 diab...

  13. bovine

    African Journals Online (AJOL)

    of various breeds under local conditions of management. (Hale, 1974b). AdditionaIly, this procedure has been used to assess the production of LH by the bovine anterior pituitary in vitro and to study the relationships between this production and the activity of the pineal- hypothalamic axis (Hayes, Knight & Symington, 1974;.

  14. Usmirenije Severnoi Korei / Joseph S. Nye ; tõlk. Nikolai Zhdanovitsh

    Index Scriptorium Estoniae

    Nye, Joseph S.

    2006-01-01

    USA president George Bush lootis, et tal õnnestub Põhja-Korea tuumaprobleemi lahendada režiimi vahetamisega. Arvestati, et isolatsioon ja sanktsioonid viivad Kim Jong Il'i diktatuuri kukutamiseni. Kuna režiim osutus vastupidavaks, nõustuti kuuepoolsete läbirääkimistega Hiina, Venemaa, Jaapani ja mõlema Koreaga

  15. Book 1

    African Journals Online (AJOL)

    Background: Tissue sections of dystrophic muscle demonstrate apoptotic myonuclei in degenerating muscle fibers of Duchene ... to the tumor necrosis factor superfam- ily and induces apoptosis through cog- nate interaction with .... muscle damage sites in order to facili- tate muscle repair through removal of tissue debris as ...

  16. Marine Science

    African Journals Online (AJOL)

    alike (Thresher, 1982; Nelson, 2006). The emperor angelfish, P. imperator Bloch, 1787, is among the most spectacularly colored and broadly recognized spe- cies of coral reef-associated fishes. Globally, the fam- ily comprises about 25% in volume of the estimated. 1472 aquarium species traded annually (Sadovy, 1992;.

  17. Glutathione S-transferase P1 gene polymorphisms and susceptibility ...

    Indian Academy of Sciences (India)

    M. A. Bhat

    2017-11-28

    Nov 28, 2017 ... diographic evidence of myocardial infarction, positive treadmill test were enrolled from A.P. Heart-Care Hos- pital, Amritsar, and 200 age-matched, sex-matched and ethnicity-matched controls with no present or past fam- ily history of CAD or any other disease participated voluntarily after written informed ...

  18. Tshastnaja zhizn angela / Andrei Ossipov ; interv. Nikolai Hrustaljov

    Index Scriptorium Estoniae

    Ossipov, Andrei

    2002-01-01

    Režissöör oma portreefilmist "Ohhota na angela ili Tshetõre ljubvi poeta i proritsatelja", mis jutustab tummfilmi näitleja Andrei Belovi elust ja armastusest tema elus. Film võitis festivalil "Kirjandus ja kino" kokku 4 auhinda, sealhulgas ka peaauhinna

  19. Lifestyle intervention improves heart rate recovery from exercise in adults with type 2 diabetes: Results from the Look AHEAD study

    Science.gov (United States)

    The primary aims of this paper were (1) to evaluate the influence of intensive lifestyle weight loss and exercise intervention (ILI) compared with diabetes support and education (DSE) upon Heart Rate Recovery (HRR) from graded exercise testing (GXT), and (2) to determine the independent and combined...

  20. 76 FR 49486 - Notification of Single Source Cooperative Agreement Award for the Pasteur Foundation

    Science.gov (United States)

    2011-08-10

    ... (ILI) and Severe Acute Respiratory Infections (SARI) surveillance. In Sub-Saharan Africa, Cameroon has... with applicability to other emerging respiratory infections and public health threats in general. The... regional CDC's Field Epidemiology Training Program, could become an important leader with regard to IHR...

  1. NJP VOLUME 42 NO 2

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2015-02-17

    Feb 17, 2015 ... Abstract: Sydenham chorea is a major manifestation of Rheumatic fever (RF). Chorea occurs primar- ily in children and is rare after the age of 20 years. Females are more often affected and it almost never occurs in post-pubertal males. Sydenham's chorea is character- ized by emotional lability, unco-.

  2. Forecasting influenza epidemics from multi-stream surveillance data in a subtropical city of China.

    Directory of Open Access Journals (Sweden)

    Pei-Hua Cao

    Full Text Available Influenza has been associated with heavy burden of mortality and morbidity in subtropical regions. However, timely forecast of influenza epidemic in these regions has been hindered by unclear seasonality of influenza viruses. In this study, we developed a forecasting model by integrating multiple sentinel surveillance data to predict influenza epidemics in a subtropical city Shenzhen, China.Dynamic linear models with the predictors of single or multiple surveillance data for influenza-like illness (ILI were adopted to forecast influenza epidemics from 2006 to 2012 in Shenzhen. Temporal coherence of these surveillance data with laboratory-confirmed influenza cases was evaluated by wavelet analysis and only the coherent data streams were entered into the model. Timeliness, sensitivity and specificity of these models were also evaluated to compare their performance.Both influenza virology data and ILI consultation rates in Shenzhen demonstrated a significant annual seasonal cycle (p<0.05 during the entire study period, with occasional deviations observed in some data streams. The forecasting models that combined multi-stream ILI surveillance data generally outperformed the models with single-stream ILI data, by providing more timely, sensitive and specific alerts.Forecasting models that combine multiple sentinel surveillance data can be considered to generate timely alerts for influenza epidemics in subtropical regions like Shenzhen.

  3. Viral respiratory infections among Hajj pilgrims in 2013.

    Science.gov (United States)

    Barasheed, Osamah; Rashid, Harunor; Alfelali, Mohammad; Tashani, Mohamed; Azeem, Mohammad; Bokhary, Hamid; Kalantan, Nadeen; Samkari, Jamil; Heron, Leon; Kok, Jen; Taylor, Janette; El Bashir, Haitham; Memish, Ziad A; Haworth, Elizabeth; Holmes, Edward C; Dwyer, Dominic E; Asghar, Atif; Booy, Robert

    2014-12-01

    Middle East respiratory syndrome coronavirus (MERS-CoV) has emerged in the Arabian Gulf region, with its epicentre in Saudi Arabia, the host of the 'Hajj' which is the world's the largest mass gathering. Transmission of MERS-CoV at such an event could lead to its rapid worldwide dissemination. Therefore, we studied the frequency of viruses causing influenza-like illnesses (ILI) among participants in a randomised controlled trial at the Hajj 2013. We recruited 1038 pilgrims from Saudi Arabia, Australia and Qatar during the first day of Hajj and followed them closely for four days. A nasal swab was collected from each pilgrim who developed ILI. Respiratory viruses were detected using multiplex RT-PCR. ILI occurred in 112/1038 (11%) pilgrims. Their mean age was 35 years, 49 (44%) were male and 35 (31%) had received the influenza vaccine pre-Hajj. Forty two (38%) pilgrims had laboratory-confirmed viral infections; 28 (25%) rhinovirus, 5 (4%) influenza A, 2 (2%) adenovirus, 2 (2%) human coronavirus OC43/229E, 2 (2%) parainfluenza virus 3, 1 (1%) parainfluenza virus 1, and 2 (2%) dual infections. No MERS-CoV was detected in any sample. Rhinovirus was the commonest cause of ILI among Hajj pilgrims in 2013. Infection control and appropriate vaccination are necessary to prevent transmission of respiratory viruses at Hajj and other mass gatherings.

  4. Therapeutic groin dissection for melanoma : Risk factors for short term morbidity

    NARCIS (Netherlands)

    Poos, H. P. A. M.; Kruijff, S.; Bastiaannet, E.; van Ginkel, R. J.; Hoekstra, H. J.

    Aims: Ilio-inguinal lymph node dissection for stage III melanoma is often complicated by wound healing disturbances. A retrospective study was performed to investigate the wound healing disturbances after therapeutic ili-inguinal lymphj node dissection. Patients and methods: Between 1989 and 2007,

  5. Futbol Şirketlerinin Halka Açılması

    OpenAIRE

    Esq., Dr. Necip Kağan KOCAOĞLU,

    2011-01-01

    Türkiye’de futbol şirketlerinin halka açılması ve bu finansmanın denetimi ve regü- lasyonu iflas etmiştir. Futbol şirketlerinin finansmanı, bahis ve talih oyunlarına ilişkin mevzuata bağlı tutulmalıdır.

  6. PRIMERJAVA RAZVOJA APLIKACIJ ZA WINDOWS PHONE 7 S SILVERLEIGHT IN Z XNA GAME STUDIO

    OpenAIRE

    Cešek, Andrej

    2011-01-01

    V diplomskem delu smo preučili in predstavili platformo Windows Phone 7 in tehnologiji za razvoj Windows Phone 7 aplikacij. Ti tehnologiji sta Silverlight in XNA Game Studio. V vsaki izmed njiju smo razvili eno aplikacijo na koncu podali primerjalno tabelo tehnologij.

  7. Kadrioru pargi kanalid / Ain Järve, Kersti Lootus ; kommenteerinud Silja Konsa

    Index Scriptorium Estoniae

    Järve, Ain

    2013-01-01

    Pargi esialgne plaanilahendus säilis 19. sajandi lõpuni. 1897. aastal koostas Riia aedade ja parkide direktor G. Kuphaldt pargi uuendamiseks projekti, mis eelistas inglise pargistiili kohaselt vabakujunduslikku lähenemist. Veekanalid raamisid aeda kuni 1938. aastani. Kanalite taastamisega alustati 2011. 2012. aastal said Kadrioru veekanalid sadametevee kollektori lahtiseks osaks. Lisatud Muinsuskaitseameti Harjumaa vaneminspektori Silja Konsa kommentaar

  8. Estimating the disease burden of 2009 pandemic influenza A(H1N1 from surveillance and household surveys in Greece.

    Directory of Open Access Journals (Sweden)

    Vana Sypsa

    Full Text Available BACKGROUND: The aim of this study was to assess the disease burden of the 2009 pandemic influenza A(H1N1 in Greece. METHODOLOGY/PRINCIPAL FINDINGS: Data on influenza-like illness (ILI, collected through cross-sectional nationwide telephone surveys of 1,000 households in Greece repeated for 25 consecutive weeks, were combined with data from H1N1 virologic surveillance to estimate the incidence and the clinical attack rate (CAR of influenza A(H1N1. Alternative definitions of ILI (cough or sore throat and fever>38°C [ILI-38] or fever 37.1-38°C [ILI-37] were used to estimate the number of symptomatic infections. The infection attack rate (IAR was approximated using estimates from published studies on the frequency of fever in infected individuals. Data on H1N1 morbidity and mortality were used to estimate ICU admission and case fatality (CFR rates. The epidemic peaked on week 48/2009 with approximately 750-1,500 new cases/100,000 population per week, depending on ILI-38 or ILI-37 case definition, respectively. By week 6/2010, 7.1%-15.6% of the population in Greece was estimated to be symptomatically infected with H1N1. Children 5-19 years represented the most affected population group (CAR:27%-54%, whereas individuals older than 64 years were the least affected (CAR:0.6%-2.2%. The IAR (95% CI of influenza A(H1N1 was estimated to be 19.7% (13.3%, 26.1%. Per 1,000 symptomatic cases, based on ILI-38 case definition, 416 attended health services, 108 visited hospital emergency departments and 15 were admitted to hospitals. ICU admission rate and CFR were 37 and 17.5 per 100,000 symptomatic cases or 13.4 and 6.3 per 100,000 infections, respectively. CONCLUSIONS/SIGNIFICANCE: Influenza A(H1N1 infected one fifth and caused symptomatic infection in up to 15% of the Greek population. Although individuals older than 65 years were the least affected age group in terms of attack rate, they had 55 and 185 times higher risk of ICU admission and CFR

  9. The Na conductance in the sarcolemma and the transverse tubular system membranes of mammalian skeletal muscle fibers

    Science.gov (United States)

    DiFranco, Marino

    2011-01-01

    Na (and Li) currents and fluorescence transients were recorded simultaneously under voltage-clamp conditions from mouse flexor digitorum brevis fibers stained with the potentiometric dye di-8-ANEPPS to investigate the distribution of Na channels between the surface and transverse tubular system (TTS) membranes. In fibers rendered electrically passive, voltage pulses resulted in step-like fluorescence changes that were used to calibrate the dye response. The effects of Na channel activation on the TTS voltage were investigated using Li, instead of Na, because di-8-ANEPPS transients show anomalies in the presence of the latter. Na and Li inward currents (INa, ILi; using half of the physiological ion concentration) showed very steep voltage dependences, with no reversal for depolarizations beyond the calculated equilibrium potential, suggesting that most of the current originates from a noncontrolled membrane compartment. Maximum peak ILi was ∼30% smaller than for INa, suggesting a Li-blocking effect. ILi activation resulted in the appearance of overshoots in otherwise step-like di-8-ANEPPS transients. Overshoots had comparable durations and voltage dependence as those of ILi. Simultaneously measured maximal overshoot and peak ILi were 54 ± 5% and 773 ± 53 µA/cm2, respectively. Radial cable model simulations predicted the properties of ILi and di-8-ANEPPS transients when TTS access resistances of 10–20 Ωcm2, and TTS-to-surface Na permeability density ratios in the range of 40:60 to 70:30, were used. Formamide-based osmotic shock resulted in incomplete detubulation. However, results from a subpopulation of treated fibers (low capacitance) provide confirmatory evidence that a significant proportion of ILi, and the overshoot in the optical signals, arises from the TTS in normal fibers. The quantitative evaluation of the distribution of Na channels between the sarcolemma and the TTS membranes, as provided here, is crucial for the understanding of the radial and

  10. Internet-based surveillance of Influenza-like-illness in the UK during the 2009 H1N1 influenza pandemic.

    Science.gov (United States)

    Tilston, Natasha L; Eames, Ken T D; Paolotti, Daniela; Ealden, Toby; Edmunds, W John

    2010-10-27

    Internet-based surveillance systems to monitor influenza-like illness (ILI) have advantages over traditional (physician-based) reporting systems, as they can potentially monitor a wider range of cases (i.e. including those that do not seek care). However, the requirement for participants to have internet access and to actively participate calls into question the representativeness of the data. Such systems have been in place in a number of European countries over the last few years, and in July 2009 this was extended to the UK. Here we present results of this survey with the aim of assessing the reliability of the data, and to evaluate methods to correct for possible biases. Internet-based monitoring of ILI was launched near the peak of the first wave of the UK H1N1v influenza pandemic. We compared the recorded ILI incidence with physician-recorded incidence and an estimate of the true number of cases over the course of the epidemic. We also compared overall attack rates. The effect of using different ILI definitions and alternative denominator assumptions on incidence estimates was explored. The crude incidence measured by the internet-based system appears to be influenced by individuals who participated only once in the survey and who appeared more likely to be ill. This distorted the overall incidence trend. Concentrating on individuals who reported more than once results in a time series of ILI incidence that matches the trend of case estimates reasonably closely, with a correlation of 0.713 (P-value: 0.0001, 95% CI: 0.435, 0.867). Indeed, the internet-based system appears to give a better estimate of the relative height of the two waves of the UK pandemic than the physician-recorded incidence. The overall attack rate is, however, higher than other estimates, at about 16% when compared with a model-based estimate of 6%. Internet-based monitoring of ILI can capture the trends in case numbers if appropriate weighting is used to correct for differential response

  11. Fiber intake and plasminogen activator inhibitor-1 in type 2 diabetes: Look AHEAD (Action for Health in Diabetes) trial findings at baseline and year 1.

    Science.gov (United States)

    Belalcazar, L Maria; Anderson, Andrea M; Lang, Wei; Schwenke, Dawn C; Haffner, Steven M; Yatsuya, Hiroshi; Rushing, Julia; Vitolins, Mara Z; Reeves, Rebecca; Pi-Sunyer, F Xavier; Tracy, Russell P; Ballantyne, Christie M

    2014-11-01

    Plasminogen activator inhibitor 1 (PAI-1) is elevated in obese individuals with type 2 diabetes and may contribute, independently of traditional factors, to increased cardiovascular disease risk. Fiber intake may decrease PAI-1 levels. We examined the associations of fiber intake and its changes with PAI-1 before and during an intensive lifestyle intervention (ILI) for weight loss in 1,701 Look AHEAD (Action for Health in Diabetes) participants with dietary, fitness, and PAI-1 data at baseline and 1 year. Look AHEAD was a randomized cardiovascular disease trial in 5,145 overweight/obese patients with type 2 diabetes, comparing ILI (goal of ≥7% reduction in baseline weight) with a control arm of diabetes support and education. ILI participants were encouraged to consume vegetables, fruits, and grain products low in sugar and fat. At baseline, median fiber intake was 17.9 g/day. Each 8.3 g/day higher fiber intake was associated with a 9.2% lower PAI-1 level (P=0.008); this association persisted after weight and fitness adjustments (P=0.03). Higher baseline intake of fruit (P=0.019) and high-fiber grain and cereal (P=0.029) were related to lower PAI-1 levels. Although successful in improving weight and physical fitness at 1 year, the ILI in Look AHEAD resulted in small increases in fiber intake (4.1 g/day, compared with -2.35 g/day with diabetes support and education) that were not related to PAI-1 change (P=0.34). Only 31.3% of ILI participants (39.8% of women, 19.1% of men) met daily fiber intake recommendations. Increasing fiber intake in overweight/obese individuals with diabetes interested in weight loss is challenging. Future studies evaluating changes in fiber consumption during weight loss interventions are warranted. Copyright © 2014 Academy of Nutrition and Dietetics. Published by Elsevier Inc. All rights reserved.

  12. Lifestyle Intervention for Weight Loss and Cardiometabolic Changes in the Setting of Glucokinase Regulatory Protein (GCKR) Inhibition: GCKR-Leu446Pro Variant in Look AHEAD

    Science.gov (United States)

    Belalcazar, L. Maria; Papandonatos, George D.; Erar, Bahar; Peter, Inga; Alkofide, Hadeel; Balasubramanyam, Ashok; Brautbar, Ariel; Kahn, Steven E.; Knowler, William C.; Ballantyne, Christie M.; McCaffery, Jeanne M.; Huggins, Gordon S.

    2015-01-01

    Background Glucokinase regulatory protein (GCKR) inhibitors offer a novel treatment approach for glucose control in diabetes; however their cardiometabolic effects, particularly in relation to increased triglycerides and C-reactive protein (CRP) levels are of concern. GCKR Leu446Pro is a common variant associated with reduced GCKR function, increased triglycerides and CRP. Methods and Results We investigated whether a 1-year intensive lifestyle intervention for weight loss (ILI) would avert the unfavorable cardiometabolic effects associated with GCKR Leu446Pro when compared to a diabetes support and education arm (DSE) in overweight/obese individuals with type 2 diabetes with triglyceride (n=3,214) and CRP (n=1,411) data participating in a randomized lifestyle intervention study for weight loss, Look AHEAD (Action for Health in Diabetes). Once demographics, medication use and baseline adiposity and fitness were accounted for, ILI did not modify the baseline association of GCKR-Leu446Pro with elevated triglycerides (β± SE= 0.067 ± 0.013, p= 1.5×10−7 and β± SE= 0.052 ± 0.015, p=5×10−4) or with elevated CRP (β± SE= 0.136 ± 0.034, p=5.1×10−5and β± SE= 0.903 ± 0.038, p=0.015) in the overall sample and Non-Hispanic Whites, respectively. The lack of a protective effect from ILI at 1-year when compared to DSE (ILI versus DSE interaction for triglyceride and CRP change, respectively: p= 0.64 and 0.37 in the overall sample; p= 0.27 and 0.05 in Non-Hispanic Whites) persisted after additional adjustment for changes in adiposity and fitness. Conclusions Moderate improvements in adiposity and fitness with ILI did not mitigate the adverse cardiometabolic effects of GCKR inhibition in overweight/obese individuals with diabetes. PMID:26578543

  13. Fiber Intake and PAI-1 in type 2 diabetes: Look AHEAD Trial Findings at Baseline and Year 1

    Science.gov (United States)

    Belalcazar, L. Maria; Anderson, Andrea M.; Lang, Wei; Schwenke, Dawn C.; Haffner, Steven M.; Yatsuya, Hiroshi; Rushing, Julia; Vitolins, Mara Z.; Reeves, Rebecca; Pi-Sunyer, F. Xavier; Tracy, Russell P.; Ballantyne, Christie M.

    2014-01-01

    Plasminogen Activator Inhibitor 1 (PAI-1) is elevated in obese individuals with type 2 diabetes (T2DM) and may contribute, independently of traditional factors, to increased cardiovascular disease (CVD) risk. Fiber intake may decrease PAI-1 levels. We examined the associations of fiber intake and its changes with PAI-1, before and during an intensive lifestyle intervention for weight loss (ILI) in 1,701 Look AHEAD participants with dietary, fitness and PAI-1 data at baseline and 1-year. Look AHEAD was a randomized CVD trial in 5,145 overweight/obese subjects with T2DM, comparing ILI (goal of ≥7% reduction in baseline weight) with a control arm of diabetes support and education (DSE). ILI participants were encouraged to consume vegetables, fruits and grain products low in sugar and fat. At baseline, median fiber intake was 17.9 g/d. Each 8.3 g/day higher fiber intake was associated with a 9.2% lower PAI-1 level (p=0.008); this association persisted after weight and fitness adjustments (p=0.03). Higher baseline intake of fruit (p=0.019) and high-fiber grain and cereal (p=0.029) were related to lower PAI-1 levels. Although successful in improving weight and physical fitness at 1-year, ILI in Look AHEAD resulted in small increases in fiber intake (4.1g/day, compared with -2.35 g/day with DSE), which were not related to PAI-1 change (p=0.34). Only 31.3% of ILI participants (39.8% of women; 19.1% of men) met daily fiber intake recommendations. Increasing fiber intake in overweight/obese individuals with diabetes interested in weight loss is challenging. Future studies evaluating changes in fiber consumption during weight loss interventions are warranted. PMID:25131348

  14. Impact of intensive lifestyle intervention on preference-based quality of life in type 2 diabetes: Results from the Look AHEAD trial.

    Science.gov (United States)

    Zhang, Ping; Hire, Don; Espeland, Mark A; Knowler, William C; Thomas, Sheikilya; Tsai, Adam G; Glick, Henry A

    2016-04-01

    To assess the effect of an intensive lifestyle intervention (ILI) compared with standard diabetes support and education (DSE) on preference-based health-related quality of life (HRQOL) in persons with overweight or obesity and type 2 diabetes. Look AHEAD was a multisite, randomized trial of 5,145 participants assigned to ILI or DSE. Four instruments were administered during the trial: Feeling Thermometer (FT), Health Utilities Index Mark 2 (HUI2), Health Utilities Index Mark 3 (HUI3), and Short Form 6D (SF-6D). Linear mixed effect models were used to estimate the mean difference in preference scores by treatment group for 9 years. The ILI had higher mean FT (0.019, 95% CI, 0.015-0.024, P < 0.001) and SF-6D (0.011, 95% CI, 0.006-0.014, P < 0.001) scores than the DSE. No significant group differences were observed for the HUI2 (0.004, 95% CI, -0.003 to 0.010, P = 0.23) and HUI3 (0.004, -0.004 to 0.012, P = 0.36). In year 1, the ILI had higher mean preference scores for all instruments. Thereafter, the increases remained significant only for FT and SF-6D, and the effects also become smaller. ILI aimed at reducing body weight among persons with overweight or obesity and type 2 diabetes improves preference-based HRQOL in the short term, but its long-term effect is unclear. © 2016 The Obesity Society.

  15. Laboratory surveillance of influenza-like illness in seven teaching hospitals, South Korea: 2011-2012 season.

    Directory of Open Access Journals (Sweden)

    Ji Yun Noh

    Full Text Available BACKGROUND: A well-constructed and properly operating influenza surveillance scheme is essential for public health. This study was conducted to evaluate the distribution of respiratory viruses in patients with influenza-like illness (ILI through the first teaching hospital-based surveillance scheme for ILI in South Korea. METHODS: Respiratory specimens were obtained from adult patients (≥18 years who visited the emergency department (ED with ILI from week 40, 2011 to week 22, 2012. Multiplex PCR was performed to detect respiratory viruses: influenza virus, adenovirus, coronavirus, respiratory syncytial virus, rhinovirus, human metapneumovirus, parainfluenza virus, bocavirus, and enterovirus. RESULTS: Among 1,983 patients who visited the ED with ILI, 811 (40.9% were male. The median age of patients was 43 years. Influenza vaccination rate was 21.7% (430/1,983 during the 2011-2012 season. At least one comorbidity was found in 18% of patients. The positive rate of respiratory viruses was 52.1% (1,033/1,983 and the total number of detected viruses was 1,100. Influenza A virus was the dominant agent (677, 61.5% in all age groups. The prevalence of human metapneumovirus was higher in patients more than 50 years old, while adenovirus was detected only in younger adults. In 58 (5.6% cases, two or more respiratory viruses were detected. The co-incidence case was identified more frequently in patients with hematologic malignancy or organ transplantation recipients, however it was not related to clinical outcomes. CONCLUSION: This study is valuable as the first extensive laboratory surveillance of the epidemiology of respiratory viruses in ILI patients through a teaching hospital-based influenza surveillance system in South Korea.

  16. Risk factors of respiratory syncytial virus infection among pediatric influenza-like illness and severe acute respiratory infections in Suzhou, China.

    Science.gov (United States)

    Huang, Yukai; Hua, Jun; Wang, Dan; Chen, Liling; Zhang, Jun; Zhu, Hong; Tian, Jianmei; Zhang, Tao; Zhao, Genming

    2018-03-01

    The characteristics and risk factors of respiratory syncytial virus (RSV) infection among children has not yet been fully understood. To address the characteristics of RSV-associated illness and risk factors of RSV infection among children under 5 years of age in Suzhou, China. From April 2011 to March 2014, we conducted a prospective surveillance among children in Suzhou, China. Nasal or throat swabs were collected from outpatients with influenza-like illness (ILI) and inpatients with severe acute respiratory infections (SARI). RSV was detected by reverse-transcriptase polymerase chain reaction and direct fluorescent antibody assay for children with ILI and SARI, respectively. Multivariable logistic-regression models were constructed to explore risk factors and symptoms of RSV infection. Of 3267 ILI and 1838 SARI children enrolled in the study, 192 (5.9%) and 287 (15.6%) tested positive for RSV, respectively. Among ILI patients, children with RSV infections visited clinics more often (P = 0.005) and had longer duration of fever (P = 0.032) than those without RSV infection. All RSV-positive children had an increased risk of having cough (OR = 2.9), rhinorrhea (OR = 1.6), breathing difficulty (OR = 3.4), wheezing (OR = 3.3), and irritability (OR = 2.7). Children aged respiratory infections (OR = 1.3) were more likely to get infected by RSV. Children with SARI had higher positive rate of RSV than those with ILI. Cough, rhinorrhea, and wheezing were the most common symptoms in RSV infection. Children aged respiratory infections were the potential risk factors for RSV infection. © 2017 Wiley Periodicals, Inc.

  17. Surveillance and clinical characterization of influenza in a university cohort in Singapore.

    Directory of Open Access Journals (Sweden)

    Aidan Lyanzhiang Tan

    Full Text Available Southeast Asia is a potential locus for the emergence of novel influenza strains. However, information on influenza within the region is limited.This study was to determine the proportion of influenza-like illness (ILI caused by influenza A and B viruses in a university cohort in Singapore, identify important distinctive clinical features of influenza infection and potential factors associated with influenza infection compared with other causes of ILI.A surveillance study was conducted from 2007 to 2009, at the University Health and Wellness Centre, National University of Singapore (NUS. Basic demographic information and nasopharyngeal swabs were collected from consenting students and staff with ILI, with Influenza A and B identified by both culture and molecular methods.Proportions of influenza A and B virus infections in subjects with ILI were 153/500 (30.6% and 11/500 (2.2% respectively. The predominant subtype was A/H1N1, including both the seasonal strain (20/153 and the pandemic strain (72/153. The clinical symptom of fever was more common in subjects with laboratory confirmed influenza than other ILIs. On-campus hostel residence and being a student (compared with staff were associated with increased risk of laboratory confirmed influenza A/H1N1 2009 infection.This study provides a baseline prevalence of influenza infection within young adults in Singapore in a university setting. Potential risk factors, such as hostel residence, were identified, allowing for more targeted infection control measures in the event of a future influenza pandemic.

  18. Surveillance and clinical characterization of influenza in a university cohort in Singapore.

    Science.gov (United States)

    Tan, Aidan Lyanzhiang; Virk, Ramandeep Kaur; Tambyah, Paul Anantharajah; Inoue, Masafumi; Lim, Elizabeth Ai-Sim; Chan, Ka-Wei; Chelvi, C Senthamarai; Ooi, Say-Tat; Chua, Catherine; Tan, Boon-Huan

    2015-01-01

    Southeast Asia is a potential locus for the emergence of novel influenza strains. However, information on influenza within the region is limited. This study was to determine the proportion of influenza-like illness (ILI) caused by influenza A and B viruses in a university cohort in Singapore, identify important distinctive clinical features of influenza infection and potential factors associated with influenza infection compared with other causes of ILI. A surveillance study was conducted from 2007 to 2009, at the University Health and Wellness Centre, National University of Singapore (NUS). Basic demographic information and nasopharyngeal swabs were collected from consenting students and staff with ILI, with Influenza A and B identified by both culture and molecular methods. Proportions of influenza A and B virus infections in subjects with ILI were 153/500 (30.6%) and 11/500 (2.2%) respectively. The predominant subtype was A/H1N1, including both the seasonal strain (20/153) and the pandemic strain (72/153). The clinical symptom of fever was more common in subjects with laboratory confirmed influenza than other ILIs. On-campus hostel residence and being a student (compared with staff) were associated with increased risk of laboratory confirmed influenza A/H1N1 2009 infection. This study provides a baseline prevalence of influenza infection within young adults in Singapore in a university setting. Potential risk factors, such as hostel residence, were identified, allowing for more targeted infection control measures in the event of a future influenza pandemic.

  19. Social and economic burden of patients with influenza-like illness and clinically diagnosed flu treated at various health facilities in Vietnam

    Directory of Open Access Journals (Sweden)

    Quang Vo T

    2017-07-01

    Full Text Available Trung Quang Vo,1,2 Usa Chaikledkaew,1,3 Minh Van Hoang,4 Arthorn Riewpaiboon1 1Department of Pharmacy, Division of Social and Administrative Pharmacy, Faculty of Pharmacy, Mahidol University, Bangkok, Thailand; 2Department of Pharmacy Administration, Faculty of Pharmacy, University of Medicine and Pharmacy, Ho Chi Minh City, Vietnam; 3Health Intervention and Technology Assessment Program (HITAP, Ministry of Public Health, Nonthaburi, Thailand; 4Hanoi School of Public Health, Hanoi, Vietnam Abstract: Influenza is a malady related to the human respiratory system, and its influenza-like illness (ILI can cause an economic and social burden, especially among children and the elderly. This study was conducted to estimate the cost of illness based on a social perspective of ILI cases. A prospective study was conducted between February and March of 2016 in pharmacies, private clinics at Khanh Hoa, Lam Dong, Tay Ninh, Dong Nai Province, and Ho Chi Minh City, and Hospital of Tropical Diseases. Demographic and clinical information were collected by face-to-face interview. Direct costs (e.g., diagnosis and therapeutics and indirect costs (e.g., cost of day loss are included as treatment costs. The average cost of treatment associated with ILI was US$ 88.09 per case for all age groups; direct non-medical cost was higher compared to direct medical cost: 39.5% in pharmacies, 71.1% in clinics, and 64.2% in hospital. The indirect cost was US$27.49 per episode. The average total cost for children below 14 years old was much higher than that for the other age groups. The cost of illness of ILI was, therefore, the reason for the economic burden of influenza patients and their families. This study provides a database for future research and programs, and policies that can be adopted for influenza or ILI in Vietnam. Keywords: influenza, influenza-like illness, economic burden, cost of illness, pharmacy, clinic, hospital, Vietnam

  20. Changes in the prevalence of influenza-like illness and influenza vaccine uptake among Hajj pilgrims: A 10-year retrospective analysis of data.

    Science.gov (United States)

    Alfelali, Mohammad; Barasheed, Osamah; Tashani, Mohamed; Azeem, Mohammad Irfan; El Bashir, Haitham; Memish, Ziad A; Heron, Leon; Khandaker, Gulam; Booy, Robert; Rashid, Harunor

    2015-05-21

    Influenza is an important health hazard among Hajj pilgrims. For the last ten years, pilgrims are being recommended to take influenza vaccine before attending Hajj. Vaccination coverage has increased in recent years, but whether there has been any change in the prevalence of influenza-like illness (ILI) is not known. In this analysis, we examined the changes in the rate of ILI against seasonal influenza vaccine uptake among Hajj pilgrims over the last decade. Data for this analysis is a synthesis of raw and published data from eleven Hajj seasons between 2005 and 214. For seven Hajj seasons the data were obtained from studies involving pilgrims of UK, Saudi Arabia and Australia; and for the remaining four Hajj seasons data were abstracted from published studies involving pilgrims from multiple countries. The data from both sources were synthesised to estimate the relative risk (RR) of acquisition of ILI in vaccinated versus unvaccinated pilgrims. The pooled sample size of the included studies was 33,213 with most pilgrims being in the age band of 40-60 years (range: 0.5 to 95 years) and a male to female ratio of 1.6. The pilgrims originated, in order of frequency, from Iran, Australia, France, UK, Saudi Arabia, Indonesia, India, Algeria, Ivory Coast, Nigeria, Somalia, Turkey, Syria, Sierra Leone and USA. Except for one year (2008), data from individual years did not demonstrate a noticeable change in the rate of ILI against influenza vaccine coverage, however the combined data from all studies suggest that the prevalence of ILI decreased among Hajj pilgrims as the vaccine coverage increased over the last decade (RR 0.2, Ppilgrims. However, controlled trials aided by molecular diagnostic tools could confirm whether such an effect is real or ostensible. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Lifestyle Intervention Improves Heart Rate Recovery from Exercise in Adults with Type 2 Diabetes: Results from the Look AHEAD Study

    Directory of Open Access Journals (Sweden)

    Paul M. Ribisl

    2012-01-01

    Full Text Available The primary aims of this paper were (1 to evaluate the influence of intensive lifestyle weight loss and exercise intervention (ILI compared with diabetes support and education (DSE upon Heart Rate Recovery (HRR from graded exercise testing (GXT and (2 to determine the independent and combined effects of weight loss and fitness changes upon HRR. In 4503 participants (45–76 years who completed 1 year of intervention, HRR was measured after a submaximal GXT to compare the influence of (ILI with (DSE upon HRR. Participants assigned to ILI lost an average 8.6% of their initial weight versus 0.7% in DSE group (P<0.001 while mean fitness increased in ILI by 20.9% versus 5.8% in DSE (P<0.001. At Year 1, all exercise and HRR variables in ILI improved (P<0.0001 versus DSE: heart rate (HR at rest was lower (72.8±11.4 versus 77.7±11.7 b/min, HR range was greater (57.7±12.1 versus 53.1±12.4 b/min, HR at 2 minutes was lower (89.3±21.8 versus 93.0±12.1 b/min, and HRR was greater (41.25±22.0 versus 37.8±12.5 b/min. Weight loss and fitness gain produced significant separate and independent improvements in HRR.

  2. Colds and influenza-like illnesses in university students: impact on health, academic and work performance, and health care use.

    Science.gov (United States)

    Nichol, Kristin L; D'Heilly, Sarah; Ehlinger, Edward

    2005-05-01

    Upper respiratory tract illnesses (URIs) are a major cause of morbidity among adults, with substantial direct and indirect costs to society, but their impact among university students has not been well described. We sought to assess the impact of URIs (colds and influenza-like illnesses [ILIs]) on the health, academic and work performance, and health care use of university students. This was a cohort study of college students at the University of Minnesota, Twin Cities campus (Minneapolis-St. Paul), who were recruited during October 2002 and followed up from November 2002 through April 2003. All 42,000 registered students were invited via e-mail to participate. Baseline information was obtained in October 2002. Monthly follow-up information about colds or ILIs was obtained for the period of November 2002 through April 2003. Data were collected by use of Internet-based questionnaires. Of 4919 volunteers, 3249 completed all follow-up surveys. The mean age was 22.7 years; 68% of the volunteers were female. Ninety-one percent had > or = 1 URI (83% had > or = 1 cold, and 36.7% had > or = 1 ILI). These URIs caused 6023 bed-days, 4263 missed school days, 3175 missed work days, and 45,219 days of illness. Of the cohort, 22.2% had > or = 1 health care visit, and 15.8% used antibiotics to treat a URI; 27.8% did poorly on a test and 46.3% did poorly on a class assignment. ILIs versus colds had a much greater impact on all parameters (e.g., general health level was 55%-60% lower with ILI vs. no URI and 33%-39% lower for colds vs. no URI; P students. Enhanced efforts to prevent and control URIs, especially influenza vaccination, could improve the health and well-being of the 17 million college and university students in this country.

  3. Secondary household transmission of 2009 pandemic influenza A (H1N1 virus among an urban and rural population in Kenya, 2009-2010.

    Directory of Open Access Journals (Sweden)

    Clara Y Kim

    Full Text Available BACKGROUND: In Kenya, >1,200 laboratory-confirmed 2009 pandemic influenza A (H1N1 (pH1N1 cases occurred since June 2009. We used population-based infectious disease surveillance (PBIDS data to assess household transmission of pH1N1 in urban Nairobi (Kibera and rural Lwak. METHODS: We defined a pH1N1 patient as laboratory-confirmed pH1N1 infection among PBIDS participants during August 1, 2009-February 5, 2010, in Kibera, or August 1, 2009-January 20, 2010, in Lwak, and a case household as a household with a laboratory-confirmed pH1N1 patient. Community interviewers visited PBIDS-participating households to inquire about illnesses among household members. We randomly selected 4 comparison households per case household matched by number of children aged <5. Comparison households had a household visit 10 days before or after the matched patient symptom onset date. We defined influenza-like illnesses (ILI as self-reported cough or sore throat, and a self-reported fever ≤8 days after the pH1N1 patient's symptom onset in case households and ≤8 days before selected household visit in comparison households. We used the Cochran-Mantel-Haenszel test to compare proportions of ILIs among case and comparison households, and log binomial-model to compare that of Kibera and Lwak. RESULTS: Among household contacts of patients with confirmed pH1N1 in Kibera, 4.6% had ILI compared with 8.2% in Lwak (risk ratio [RR], 0.5; 95% confidence interval [CI], 0.3-0.9. Household contacts of patients were more likely to have ILIs than comparison-household members in both Kibera (RR, 1.8; 95% CI, 1.1-2.8 and Lwak (RR, 2.6; 95% CI, 1.6-4.3. Overall, ILI was not associated with patient age. However, ILI rates among household contacts were higher among children aged <5 years than persons aged ≥5 years in Lwak, but not Kibera. CONCLUSIONS: Substantial pH1N1 household transmission occurred in urban and rural Kenya. Household transmission rates were higher in the rural area.

  4. Secondary Household Transmission of 2009 Pandemic Influenza A (H1N1) Virus among an Urban and Rural Population in Kenya, 2009–2010

    Science.gov (United States)

    Kim, Clara Y.; Breiman, Robert F.; Cosmas, Leonard; Audi, Allan; Aura, Barrack; Bigogo, Godfrey; Njuguna, Henry; Lebo, Emmaculate; Waiboci, Lilian; Njenga, M. Kariuki; Feikin, Daniel R.; Katz, Mark A.

    2012-01-01

    Background In Kenya, >1,200 laboratory-confirmed 2009 pandemic influenza A (H1N1) (pH1N1) cases occurred since June 2009. We used population-based infectious disease surveillance (PBIDS) data to assess household transmission of pH1N1 in urban Nairobi (Kibera) and rural Lwak. Methods We defined a pH1N1 patient as laboratory-confirmed pH1N1 infection among PBIDS participants during August 1, 2009–February 5, 2010, in Kibera, or August 1, 2009–January 20, 2010, in Lwak, and a case household as a household with a laboratory-confirmed pH1N1 patient. Community interviewers visited PBIDS-participating households to inquire about illnesses among household members. We randomly selected 4 comparison households per case household matched by number of children aged <5. Comparison households had a household visit 10 days before or after the matched patient symptom onset date. We defined influenza-like illnesses (ILI) as self-reported cough or sore throat, and a self-reported fever ≤8 days after the pH1N1 patient's symptom onset in case households and ≤8 days before selected household visit in comparison households. We used the Cochran-Mantel-Haenszel test to compare proportions of ILIs among case and comparison households, and log binomial-model to compare that of Kibera and Lwak. Results Among household contacts of patients with confirmed pH1N1 in Kibera, 4.6% had ILI compared with 8.2% in Lwak (risk ratio [RR], 0.5; 95% confidence interval [CI], 0.3–0.9). Household contacts of patients were more likely to have ILIs than comparison-household members in both Kibera (RR, 1.8; 95% CI, 1.1–2.8) and Lwak (RR, 2.6; 95% CI, 1.6–4.3). Overall, ILI was not associated with patient age. However, ILI rates among household contacts were higher among children aged <5 years than persons aged ≥5 years in Lwak, but not Kibera. Conclusions Substantial pH1N1 household transmission occurred in urban and rural Kenya. Household transmission rates were higher in the rural area. PMID

  5. Obesity as a risk factor for severe influenza-like illness.

    Science.gov (United States)

    Cocoros, Noelle M; Lash, Timothy L; DeMaria, Alfred; Klompas, Michael

    2014-01-01

    Obesity was recognized as in independent risk factor for influenza during the 2009 H1N1 influenza pandemic. We evaluated the association between body mass index (BMI) and influenza-like illness (ILI) during two non-pandemic influenza seasons (2003-2004 and 2004-2005) and during the spring and fall waves of the 2009 H1N1 pandemic. Adults with severe (inpatient) and mild (outpatient) ILI were compared to those without ILI using a case-cohort design. The study was nested among those insured by a single health insurance company, receiving care from a large multispecialty practice. Data were collected from insurance claims and the electronic health record. The primary exposure was obesity (BMI ≥ 30·0 kg/m(2) ). Across three seasons, the crude and adjusted ORs for obesity and severe ILI were 1·65 (95% CI 1·31, 2·08) and 1·23 (95% CI 0·97, 1·57), respectively. An association was observed for those aged 20-59 years (adjusted OR 1·92, 95% CI 1·26, 2·90), but not for those 60 and older (adjusted OR 1·08, 95% CI 0·80, 1·46). The adjusted ORs for obesity and severe ILI in 2003-2004, 2004-2005, and during H1N1 were 1·14 (95% CI 0·80, 1·64), 1·24 (95% CI 0·86, 1·79), and 1·76 (95% CI 0·91, 3·42), respectively. Among those with a Charlson Comorbidity Index score of zero, the adjusted ORs for 2003-2004, 2004-2005, and H1N1 were 1·60 (95% CI 0·93, 2·76), 1·43 (95% CI 0·80, 2·56), and 1·90 (95% CI 0·68, 5·27), respectively. Our results suggest a small to moderate association between obesity and hospitalized ILI among adults. © 2013 The Authors. Influenza and Other Respiratory Viruses Published by John Wiley & Sons Ltd.

  6. Clinical characteristics and outcome of respiratory syncytial virus infection among adults hospitalized with influenza-like illness in France.

    Science.gov (United States)

    Loubet, P; Lenzi, N; Valette, M; Foulongne, V; Krivine, A; Houhou, N; Lagathu, G; Rogez, S; Alain, S; Duval, X; Galtier, F; Postil, D; Tattevin, P; Vanhems, P; Carrat, F; Lina, B; Launay, O

    2017-04-01

    The aim of this study was to analyse characteristics and outcome of respiratory syncytial virus (RSV) infection in adults hospitalized with influenza-like illness (ILI). Patients hospitalized with ILI were included in this prospective, multicentre study carried out in six French hospitals during three consecutive influenza seasons (2012-2015). RSV and other respiratory viruses were detected by multiplex PCR in nasopharyngeal swabs. Risk factors for RSV infection were identified by backward stepwise logistic regression analysis. A total of 1452 patients hospitalized with ILI were included, of whom 59% (861/1452) were >65 years and 83% (1211/1452) had underlying chronic illnesses. RSV was detected in 4% (59/1452), and influenza virus in 39% (566/1452). Risk factors for RSV infection were cancer (adjusted OR 2.1, 95% CI 1.1-4.1, p 0.04), and immunosuppressive treatment (adjusted OR 2.0, 95% CI 1.1-3.8, p 0.03). Patients with RSV had a median length of stay of 9 days (6-25), and 57% of them (30/53) had complications, including pneumonia (23/53, 44%) and respiratory failure (15/53, 28%). Fifteen per cent (8/53) were admitted to an intensive care unit, and the in-hospital mortality rate was 8% (4/53). Pneumonia was more likely to occur in patients with RSV than in patients with RSV-negative ILI (44% (23/53) versus 26% (362/1393), p 0.006) or with influenza virus infection (44% versus 28% (157/560), p 0.02). RSV is an infrequent cause of ILI during periods of influenza virus circulation but can cause severe complications in hospitalized adults. Risk factors for RSV detection in adults hospitalized with ILI include cancer and immunosuppressive treatment. Specific immunization and antiviral therapy might benefit patients at risk. Copyright © 2016 European Society of Clinical Microbiology and Infectious Diseases. Published by Elsevier Ltd. All rights reserved.

  7. Farmakoekologija – okolišna sudbina lijekova

    Directory of Open Access Journals (Sweden)

    Valerije Vrček

    2017-03-01

    Full Text Available Lijekovi koji se upotrebljavaju za preventivu ili terapiju završavaju u otpadnim vodama, rijekama, jezerima i morima, ali također u vodi za piće. U posljednjih je dvadesetak godina objavljeno na stotine analitičkih studija koje pokazuju prisutnost gotovo svih terapijskih skupina u okolišu. Koncentracije lijekova u okolišu su niske, ali to ne znači da rizik za ljude ili okoliš ne postoji, jer lijekovi su kemikalije dizajnirane da izazivaju biološke učinke upravo pri vrlo niskim dozama. Pojavnost svakog lijeka u okolišu izravno je povezana s intenzitetom njegove primjene. Stoga su psihoaktivni lijekovi, poput karbamazepina, najčešća farmaceutska zagađivala okoliša. Detekcija sve viših koncentracija lijekova u okolišu nije rezultat razvoja analitičke kemije i preciznosti instrumenata, već je posljedica porasta uporabe lijekova. Poseban problem lijekova u okolišu predstavljaju njihovi razgradni produkti ili metaboliti. Pod utjecajem svjetla ili prilikom kemijske obrade otpadnih voda mnogi se lijekovi transformiraju u nove strukture o kojima znanost vrlo malo zna. Neki metaboliti mogu biti toksičniji od ishodnih spojeva. Također, metaboliti mogu biti otporniji prema biorazgradnji, pa se dulje vremena zadržavaju u okolišu. Metaboliti se najčešće ne razmatraju prilikom službenih procjena okolišnog rizika lijekova. Konačne potvrde da lijekovi zaista dovode do ekoloških katastrofa nalaze se u objavljenim znanstvenim studijama koje prikazuju kolaps riblje populacije u Sjevernoj Americi, zbog djelovanja sintetskih estrogena ili nestanak ptica na indijskom potkontinentu uslijed veterinarske uporabe Voltarena. Budući da je ekološka cijena uporabe lijekova mjerljiva, rasprave o niskim ili (nedovoljnim dozama lijekova u okolišu zapravo su – zakašnjele. Lijekovi i njihovi razgradni produkti već djeluju na žive organizme, a pitanje je vremena kad će slični učinci biti uočeni i u ljudskoj populaciji.

  8. MEHKE VEŠČINE Z VIDIKA OSNOVNOŠOLSKIH UČITELJEV

    OpenAIRE

    Krajnc, Kaja

    2016-01-01

    V diplomski nalogi smo raziskovali mehke veščine z vidika osnovnošolskih učiteljev. V teoretičnem delu smo najprej opredelili kompetence in veščine, nato pa smo se podrobneje osredotočili na mehke veščine. Pojasnili smo razliko med mehkimi in trdimi veščinami, ugotavljali zakaj in katere mehke veščine so pomembne ter kje jih je mogoče pridobiti. Proučili smo učiteljevo vlogo v sodobni šoli in kompetence, ki so pomembne v pedagoškem poklicu, ter predstavili nekaj mehkih veščin, ki jih učitelji...

  9. Eleusina - Lesina - Hvar

    OpenAIRE

    Tomasović, Nives

    2014-01-01

    U članku se iznosi hipoteza o porijeklu i značenju povijesnog imena otoka i grada Hvara, Lesine. Zasnovana na grčkom obliku Bogorodičinog epiteta „od Milosti“, to jest „Eleusa“ (Ἐλεούσα), hipoteza konstatira kontinuitet kultova božanskih zaštitnica pomorstva na Hvaru, budući da je epitet grčke božice Demetre, koja je u antici štovana na području cijelog Mediterana, „Eleusis“ (Ἐλευσίς) ili „Eleusina“ (Elefsina ili Lefsina). Ikonografske analogije između antičkih božica, kršćanskih svetica i nj...

  10. Raziskava različnih vrst prevozov do letališč v Benetkah, na Dunaju, v Münchnu in v Trstu

    OpenAIRE

    Repanšek, Boštjan

    2015-01-01

    Letalski promet postaja vse bolj del vsakdanjika vedno večjega števila državljanov Republike Slovenije. Večina tistih, ki potujejo z letali, je že letela z enega od bližnjih letališč v tujini. Glede na to, da je možnih izbir prevoza do teh letališč več, smo se jih odločili raziskati. Raziskovali smo prevoze iz Ljubljane do letališč v Benetkah, na Dunaju, v Münchnu in Trstu. Naš glavni problem, ki smo ga rešili, je bil poiskati najboljši možni prevoz do vsakega od teh letališč, upoštevajoč šti...

  11. Affetme, Dindarlık ve Hayat Memnuniyeti İlişkisi: Türk ve Ürdünlü Üniversite Öğrencileri Üzerine Bir Araştırma

    OpenAIRE

    Ayten, Ali; Ferhan, Hamza

    2016-01-01

    Affetme; sağlık, kişilik, bağlanma ve dindarlıkla ilişkilendirilerek başta din psikolojisi olmak üzere psikolojinin farklı alt dallarında incelenmiştir. Bu makalede affetme, dindarlık ve hayat memnuniyetiyle (yaşam doyumu) ilişkisi bağlamında araştırılmaktadır. Araştırmanın temel amacı dindarlığın hem affetme hem de hayat memnuniyeti üzerindeki rolünün belirlenmesi, aynı zamanda affetmenin hayat memnuniyeti üzerindeki rolünün tespitidir. Ayrıca araştırmada cinsiyet ve yaşın affetme eğ...

  12. Üniversite gençliği “sosyal adalet”ten ne anlıyor? sosyal adalet ilkeleri bağlamında bir eğilim belirleme araştırması

    OpenAIRE

    Yildirim, Filiz

    2011-01-01

       Bu araştırma; sosyal minimum, eşit vatandaşlık, fırsat eşitliği ve adil dağıtım olarak Miller tarafından belirlenen dört önemli sosyal adalet ilkesinden hareketle üniversite eğitimine devam eden gençlerin (i) sosyal adalet/sizlik/e ilişkin eğilimlerinin, (ii) sözü edilen dört ilke bağlamında gençlerin bilişsel, duygusal tepkilerinin; kişisel ve aile özellikleri, eğitim ve sosyal minimumlara ilişkin değişkenler ile sosyal adalet algısı ve sosyal adalet ilkeleri ar...

  13. [EFFICACY AND SECURITY OF A CONVENTIONAL PROCEDURE OF PLASMAPHERESIS IN COMPLEX OF TREATMENT OF NONBILIARY ACUTE PANCREATITIS IN EARLY PHASE OF THE DISEASE].

    Science.gov (United States)

    Mishalov, V G; Markulan, L Yu; Matveyev, R M

    2016-02-01

    Abstract Efficacy and security of a plasmapheresis procedure in complex of treatment of nonbiliary acute pancreatitis in early phase of the disease were established, basing on the treatment results analysis in 48 patients. The plasmapheresis results were estimated in accordance to changes revealed in the intoxication leukocytic index (ILI), a general protein (GP) content, general calcium (GC) in the blood plasm and of the activated partial thrombin time (APTHT). Application of plasmapheresis in patients, suffering purulent pancreatitis in the enzymal phase, have guaranteed a staged reduction of ILI by (34.86 ± 1.27)%, the APTHT enhancement from (35.15 ± 0.37) to (52.01 ± 0.62) sec, a trustworthy lowering of the GP by (4.35 ± 0.02) g/L at average and of GC in a blood plasmby (10.45 ± 0.38)%.

  14. 2015 HAZİRAN VE KASIM SEÇİMLERİNDE SİYASAL EĞİLİM: YENİ BİR KAMUOYU ÖLÇÜMLEME ARACI OLARAK TWİTTER

    OpenAIRE

    TOKER, Huriye; Erdem, Sabri; ÖZŞARLAK, Pınar

    2017-01-01

    Günümüzde yeni neslin, düşünce ve fikirlerini ifade etme, siyasal alanda görüşlerini beyanetme, çevresindekileri politik hareketlere teşvik etme, seçilmiş siyasi liderleri sosyal medya üzerindentakip etme konularında inisiyatif alabildiğine ilişkin bulgular elde edilmektedir. Bu kapsamda2015 Haziran seçimlerine ilişkin 1011 Twitter kullanıcısının mesajları incelenerek siyasal eğilimibelirlenmeye çalışılmış ve seçilen örneklem üzerinden 364 kullanıcın Twitter mesajları 2015 Kasımseçimleri çerç...

  15. Precision Timing and Measurement for Inference with Laser and Vision

    Science.gov (United States)

    2010-01-01

    techniques may be broadly split into three areas. In the first, the 3D 66 points are used to estimate a signed distance function and then iso ...conservative 174 0.8 0.85 0.9 0.95 1 1.05 1.1 1.15 1.2 0 2000 4000 6000 8000 10000 12000 14000 16000 18000 Delay (ms) P ro b a b ili ty D e n s it y (a...4000 6000 8000 10000 12000 14000 16000 18000 Delay (ms) P ro b a b ili ty D e n s it y (c) 0.8 0.85 0.9 0.95 1 1.05 1.1 1.15 1.2 0 0.2 0.4 0.6 0.8 1

  16. Razvitak elektroenergetike u Hrvatskoj - rad i postignuća akademika Bože Udovičića

    OpenAIRE

    Galić, Radoslav; Kalea, Marijan

    2014-01-01

    Povodom obilježavanja 150 godina djelovanja HAZU-a (1861. – 2011.), Zavod za znanstveni i umjetnički rad Osijek Hrvatske akademije znanosti i umjetnosti organizirao je 21. listopada 2011. svečanu akademiju posvećenu djelu akademika Bože Udovičića, a Elektrotehnički fakultet Osijek održao je znanstvenostručni skup na temu Razvitak elektroenergetike u Hrvatskoj. Akademiji su nazočili brojni gosti, među kojima su bili akademici Božo Udovičić i Hrvoje Babić, rektorica Sveučilišta Josipa Jurja Str...

  17. Bir Sentez Girişimi Olarak Gerçekliğin Sosyal İnşâsı / The Social Construction of Reality as an Attempt to Synthesize

    OpenAIRE

    İbrahim YÜCEDAĞ

    2013-01-01

    Öz: Sosyolojinin teorik temellerine ilişkin tartışmaların odağını oluşturan ‘toplumnasıl anlaşılabilir’ sorusu çeşitli açıklama çabalarını da beraberinde getirmiştir. Metateorikdüzeyde gerçekleştirilen tartışmalarda, toplumun durağan ve değişen yanlarıyla,makro ve mikro boyuttaki gerçekliği arasındaki ilişkinin niteliği toplumu anlamada izlenecekyolu belirlemiştir. Toplumun anlaşılması sorunu, sosyolo...

  18. Povijest kemije i kemijskog inženjerstva Povijesni osvrt na popularizaciju kemije u Hrvatskoj

    OpenAIRE

    Raos, N.

    2012-01-01

    Od Šulekove knjige Lučba za svakoga ili popularna kemija (1881.) do naših dana mogu se u nas uočiti tri osnovna tipa popularizacije kemije: (1) praktični savjeti nestručnjaku - poljoprivredniku i domaćici, (2) udžbenik ili monografija za nestručnjake i (3) kemija kao motiv za priču. Prvi je tip prevladavao početkom 20. stoljeća, za vrijeme industrijalizacije bio je dominantan drugi tip, dok je treći tip popularizacije došao s potrošačkim društvom. U članku se analizira djelo najplodnijih hrva...

  19. Volition and Motivation's Influence on Weight Loss Maintenance in the Period Following an Intensive Lifestyle Intervention

    DEFF Research Database (Denmark)

    Elsborg, Peter

    Questionnaire was validated in a sample of 836 university students. Six volitional factors based on 18 items of relevance to exercise participation were identified. The questionnaire showed acceptable model fit, internal consistency, convergent validity, and the ability to explain differences in exercise...... or counterproductive depending on the level of selfdetermination, as identified regulation showed a positive effect 12 months after the intervention, whereas internal regulation showed a negative effect on weight loss. In Study 3 – an interview based qualitative study of 11 successful and 4 unsuccessful ILI weight...... maintainers – it was shown that important challenges in the period that follows the ILI were adjusting to life after the intervention, controlling ‘unhealthy’ food intake, and avoiding being controlled by specific situations. Clear differences were seen between successful and unsuccessful weight maintainers...

  20. An under-recognized influenza epidemic identified by rapid influenza testing, southern Sri Lanka, 2013.

    Science.gov (United States)

    Tillekeratne, L Gayani; Bodinayake, Champica K; Nagahawatte, Ajith; Vidanagama, Dhammika; Devasiri, Vasantha; Arachchi, Wasantha Kodikara; Kurukulasooriya, Ruvini; De Silva, Aruna Dharshan; Østybe, Truls; Reller, Megan E; Woods, Christopher W

    2015-05-01

    Influenza accounts for a large burden of acute respiratory tract infections in high-income countries; data from lower-income settings are limited due to lack of confirmatory testing. Consecutive outpatients presenting to the largest tertiary care hospital in southern Sri Lanka were surveyed for influenza-like illness (ILI), defined as acute onset of fever ≥ 38.0°C and cough. Patients were administered a questionnaire and nasal/nasopharyngeal sampling for rapid influenza A/B testing. We enrolled 311 patients with ILI from March to November 2013: 170 (54.7%) children and 172 (55.3%) males. Approximately half (147, 47.3%) tested positive for influenza, but 253 (81.4%) were prescribed antibiotics. On bivariable analysis, symptoms associated with influenza included pain with breathing (P testing to identify an influenza epidemic in a setting in which testing is not routinely available. © The American Society of Tropical Medicine and Hygiene.