WorldWideScience

Sample records for vami sila ili

  1. Spherical sila- and germa-homoaromaticity.

    Science.gov (United States)

    Chen, Zhongfang; Hirsch, Andreas; Nagase, Shigeru; Thiel, Walter; Schleyer, Paul von Ragué

    2003-12-17

    Guided by the 2(N + 1)2 electron-counting rule for spherical aromatic molecules, we have designed various spherical sila- and germa-homoaromatic systems rich in group 14 elements. Their aromaticity is revealed by density-functional computations of their structures and the nucleus-independent chemical shifts (NICS). Besides the formerly used endohedral inclusion strategy, spherical homoaromaticity is another way to stabilize silicon and germanium clusters.

  2. Invariom based electron density studies on the C/Si analogues haloperidol/sila-haloperidol and venlafaxine/sila-venlafaxine.

    Science.gov (United States)

    Luger, Peter; Dittrich, Birger; Tacke, Reinhold

    2015-09-14

    The subjects of this study are the structures and electron densities of the carbon/silicon analogues haloperidol/sila-haloperidol (1a/1b) and venlafaxine/sila-venlafaxine (2a/2b). The parent carbon compounds 1a (an antipsychotic agent) and 2a (an antidepressant) are both in clinical use. For haloperidol/sila-haloperidol, three published structures were studied in more detail: the structures of haloperidol hydrochloride (1a·HCl), haloperidol hydropicrate (1a·HPic) and sila-haloperidol hydrochloride (1b·HCl). For venlafaxine/sila-venlafaxine, the published structures of venlafaxine (2a), venlafaxine hydrochloride (2a·HCl; as orthorhombic (2a·HCl-ortho) and monoclinic polymorph (2a·HCl-mono)) and sila-venlafaxine hydrochloride (2b·HCl) were investigated. Based on these structures, the molecular electron densities were reconstructed by using the invariom formalism. They were further analysed in terms of Bader's quantum theory of atoms in molecules, electrostatic potentials mapped onto electron density isosurfaces and Hirshfeld surfaces. These studies were performed with a special emphasis on the comparison of the corresponding carbon/silicon analogues.

  3. Subliminalne poruke: mit ili stvarnost

    OpenAIRE

    Baj, Igor

    2017-01-01

    Subliminalne poruke dugi su niz godina prisutne u gotovo svim medijima, a u ovom je radu naglasak stavljen na praksu koja se odnosi na vizualnu komunikaciju. Pojašnjeni su osnovni pojmovi kao što su subliminalne poruke i šest temeljnih audiovizualnih tehnika pomoću kojih se prenose subliminalne ili podsvjesne informacije. Pored povijesnog prikaza i navedenih primjera uporabe subliminalnih poruka u medijima analizirana su brojna sekundarna istraživanja koja upućuju da nema znanstvenog istraživ...

  4. Hammam Dalaa, M'Sila-Algérie

    African Journals Online (AJOL)

    PR BOKO

    ... le quotient pluviothermique d'Emberger (Q2) est élevé. La station de. M'Sila appartient à l'étage bioclimatique aride à hiver tempérée et la zone d'étude El Haourane se trouve dans une ambiance bioclimatique semi-aride frais [2]. Figure 1 : Localisation géographique du canton El Haourane (Carte touristique. ONAT).

  5. A Journey, the Pain of Others, and Historical Experience: Susan Silas

    Directory of Open Access Journals (Sweden)

    Sendyka, Roma

    2014-12-01

    Full Text Available The author interprets Susan Silas' Helmbrechts walk (1998-2003, a unique series of forty-five photographs and supplementing visual and textual materials collected during the walk along the route of two hundred and twenty-five miles. The walk repeats the route which in 1945 had to undertake women prisoners from the concentration camp in Helmbrechts near Flossenbürg in their death march to Prachatice in Czech Republic. The pictures Silas takes, the people she meets, and finally the trees, the very materiality of the road become the factors of creating her own, individual memory of the event from the past. Silas selects an object from "the margins of the Holocaust" – a forgotten event that she re-presents by reacting to contemporary objects placed along the route of the event. Silas' work offers an opportunity to critically review the concept of memory landscapes (where is memory located in a landscape? and the phenomenon of dark tourism (is following in the footsteps of the prisoners a kind of pilgrimage, tourism, or therapy?. Silas problematises the question of memory, as well as examines different kinds of non-memory. Her camera is directed at locations that can be termed "the non-sites of memory."

  6. Pipeline integrity: ILI baseline data for QRA

    Energy Technology Data Exchange (ETDEWEB)

    Porter, Todd R. [Tuboscope Pipeline Services, Houston, TX (United States)]. E-mail: tporter@varco.com; Silva, Jose Augusto Pereira da [Pipeway Engenharia, Rio de Janeiro, RJ (Brazil)]. E-mail: guto@pipeway.com; Marr, James [MARR and Associates, Calgary, AB (Canada)]. E-mail: jmarr@marr-associates.com

    2003-07-01

    The initial phase of a pipeline integrity management program (IMP) is conducting a baseline assessment of the pipeline system and segments as part of Quantitative Risk Assessment (QRA). This gives the operator's integrity team the opportunity to identify critical areas and deficiencies in the protection, maintenance, and mitigation strategies. As a part of data gathering and integration of a wide variety of sources, in-line inspection (ILI) data is a key element. In order to move forward in the integrity program development and execution, the baseline geometry of the pipeline must be determined with accuracy and confidence. From this, all subsequent analysis and conclusions will be derived. Tuboscope Pipeline Services (TPS), in conjunction with Pipeway Engenharia of Brazil, operate ILI inertial navigation system (INS) and Caliper geometry tools, to address this integrity requirement. This INS and Caliper ILI tool data provides pipeline trajectory at centimeter level resolution and sub-metre 3D position accuracy along with internal geometry - ovality, dents, misalignment, and wrinkle/buckle characterization. Global strain can be derived from precise INS curvature measurements and departure from the initial pipeline state. Accurate pipeline elevation profile data is essential in the identification of sag/over bend sections for fluid dynamic and hydrostatic calculations. This data, along with pipeline construction, operations, direct assessment and maintenance data is integrated in LinaViewPRO{sup TM}, a pipeline data management system for decision support functions, and subsequent QRA operations. This technology provides the baseline for an informed, accurate and confident integrity management program. This paper/presentation will detail these aspects of an effective IMP, and experience will be presented, showing the benefits for liquid and gas pipeline systems. (author)

  7. Agonum tulliae sp. n. from the Sila National Park (Calabria, southern Italy (Coleoptera: Carabidae: Platynini

    Directory of Open Access Journals (Sweden)

    A. Mazzei

    2017-04-01

    Full Text Available Agonum tulliae sp. n. is described from the Sila Massif upland in Calabria, Italy. This species is similar to Agonum (Olisares sexpunctatum (Linné, 1758 as far as the external morphology is concerned, but it is easy to distinguish by the colour pattern, the shape of pronotum, and at best by the morphology of male genitalia. The study includes some remarks about the habitat and ecology of the new species. It lives only in the eastern part of the Sila massif and occupies the southernmost part of the distribution area of the Agonum sexpunctatum (Linné, 1758 complex in Italy.

  8. Podróż, cudze cierpienie i doświadczenie historyczne: Susan Silas

    Directory of Open Access Journals (Sweden)

    Sendyka, Roma

    2014-12-01

    Full Text Available Autorka interpretuje pracę Susan Silas Helmbrechts walk (1998-2003, szczególny cykl czterdziestu pięciu zdjęć i dołączonych do nich materiałów wizualnych oraz tekstowych zbudowany podczas przejścia trasy dwustu dwudziestu pięciu mil, które w 1945 roku musiały przebyć kobiety pędzone w marszu śmierci z Helmbrecht koło Flossenbürga do czeskich Prachatic. Wykonywane zdjęcia, napotykani ludzie, w końcu – drzewa, sama materialność drogi stają się czynnikami wytwarzania własnej, indywidualnej pamięci wydarzenia sprzed lat. Silas wybiera szczególny obiekt "z marginesów Zagłady" – zapomniane zdarzenie, które przedstawia obserwując współczesne obiekty położone wzdłuż trasy tego zdarzenia. Praca Silas pozwala przyjrzeć się krytycznie koncepcji memory landscapes (gdzie w krajobrazie umiejscawia się pamięć? i zjawisku dark tourism (czy podążanie śladami więźniarek to pielgrzymka, turystyka czy terapia?. Silas problematyzuje nie tylko kwestię pamięci, bada również rodzaje nie-pamiętania. Jej kamera zostaje zwrócona ku lokalizacjom, które można nazwać "nie-miejscami pamięci".

  9. Traditional use of medicinal plants in a city at steppic character (M’sila, Algeria

    Directory of Open Access Journals (Sweden)

    Madani Sarri

    2014-04-01

    Full Text Available Context: M’sila city occupies a privileged position in the central part of northern Algeria. The climate of this area is continental, subject in part to the Saharan influences of which vegetation is steppic. Aims: Highlight traditional usage of plants despite environmental characteristics. Methods: An ethnobotanical survey in the city of M’sila was conducted during the period 2011-2012 in collaboration with traditional practitioners, herbalists and healers. A total of 85 adults were able to determine the species and answer questions about the traditional use of plants in artisanal processing, nutritional and medicinal domains. Results: Medicinal plants recorded in the city of M’sila were 36 divided into 16 families and 31 genera. Lamiaceae family predominates (27.8%, followed by Asteraceae (13.9%. Leaves are the most frequently used (27.4%, the aerial parts (18.5% and thus the seeds (16.3%. It appears that the population is highly dependent on these plants that allow them to treat different pathologies (digestive, stomach, diarrhea, constipation, vomiting with a percentage (18.6%, carminative (5.7% and antidiabetic (12.2%. In general, the remedies are administered orally. Indeed, therapeutic use forms are: the tisane or decoction (44.7%, infusion (27.1% and powder (12.2%. Conclusions: The ethnobotanical survey conducted among traditional healers, herbalists and healers in the M’sila city has created an inventory of 36 species and a database that collected all the information on local and traditional therapeutic applications as well as all the diseases treated.

  10. Linking tephrochronology and soil characteristics in the Sila and Nebrodi Mountains, Italy

    Science.gov (United States)

    Raab, Gerald; Halpern, Dieter; Scarciglia, Fabio; Raimondi, Salvatore; de Castro Portes, Raquel; Norton, Kevin; Egli, Markus

    2017-04-01

    Mediterranean soils are an important key to understanding past volcanic events and landscape evolution. The influence and timing of Quaternary volcanic events on soils, however, remains still poorly understood in southern Italy. We used a multi-method approach to explore the origin and age of volcanic deposits (soils) in Sicily and Calabria. By comparing the geochemical signature of the soils with the chemical fingerprint of magmatic effusive rocks in southern Italy, we tried to identify the source material. It seems that the investigated soils on the Nebrodi (Sicily) and Sila (Calabria) mountains were both influenced by volcanic deposits having a high-K calc-alkaline series volcanic background. The Aeolian islands (Lipari and Vulcano) are the most likely sources of origin. Due to weathering processes of the volcanic sediments and the partial mixing with the underlying non-volcanic parent material, a direct relation with the potential source areas was not always straightforward. Immobile elements and their corresponding ratios (e.g. the Nb/Y vs Zr/Ti plot) or trace elements (Co, Th) and rare earth elements gave better hints of the origin of the deposits. Radiocarbon dating of the stable soil organic fraction (H2O2 resistant) indicated a minimum age of 8 - 10 ka of the Nebrodi and Sila soils. The chemical proxy of alteration (CPA) and weathering index according to Parker (WIP) were tested as proxies for an age estimate of the volcanic deposits and duration of soil formation. The soils and, subsequently, landscape are characterized by multiple volcanic depositional phases for the last 30 - 50 ka in the Sila mountains and about 70 ka in the Nebrodi mountains. We show that a multi-method approach (numerical dating, relative dating using weathering indices and the forensic procedure) enabled the identification of potential source areas, gave tentative age estimates of the ash deposits, duration of soil formation and, therefore, improved our understanding of volcanic

  11. An ethnobotanical survey of galactogenic plants of Berhoum district (M'sila, Algeria

    Directory of Open Access Journals (Sweden)

    Sarri Madani

    2017-09-01

    Full Text Available Background/Aim: This work aimed an ethnobatanical study on the galactogenic plants used in the Berhoum region (East of M’sila, Algeria; as a part of different studies on the medicinal plants related to M’sila region. Methods: The fieldwork was undertaken as an ethnobotanical survey involving 76 informants (mean age: 50; 64% women, 36% men. Used the medicinal plants were identified and the results were analyzed according to literature investigation dealing with ethnobotany. Use value (UV, fidelity level (FL, and informant consensus factor (FIC were used to analyze the obtained data. Results: A total of 29 plant species belonging to 29 genera and 12 families (mainly Apiaceae and Fabaceae has been registered. Fruits and seeds were the most commonly used plant part (80%. The used plants are mainly prepared as an infusion and decoction (69%. Trigonella foenum-graecum L. (UV = 0.58 was the species most commonly used by local healers. The FIC factors ranging from 0.45 to 0.89 for the six uses categories retained for this study. The ICF (0.65 was registered for the use galactogenic category with 29 species. Conclusion: This work showed that the population of Berhoum district uses various medicinal plants for galactogenic purposes. Furthermore, ethnobotanical analysis will provide data on sustainable use and valorization of this plant heritage for ethnopharmacological and phytochemical studies. [J Complement Med Res 2017; 6(3.000: 311-315

  12. Seasonal Web Search Query Selection for Influenza-Like Illness (ILI) Estimation

    DEFF Research Database (Denmark)

    Hansen, Niels Dalum; Mølbak, Kåre; Cox, Ingemar Johansson

    2017-01-01

    Inuenza-like illness (ILI) estimation from web search data is an important web analytics task. The basic idea is to use the frequencies of queries in web search logs that are correlated with past ILI activity as features when estimating current ILI activity. It has been noted that since inuenza...

  13. ANALISIS PERANAN PALANG MERAH INDONESIA (PMI KOTA MADIUN DALAM MENGIMPLEMENTASIKAN NILAI-NILAI PANCASILA SILA KEDUA

    Directory of Open Access Journals (Sweden)

    Alfiantika Febrian Ashari

    2016-04-01

    Hasil penelitian menunjukkan bahwa Palang Merah Indonesia (PMI kota Madiun berperan dalam mengimplementasikan nilai-nilai Pancasila sila kedua. Berdasarkan dengan temuan data, hal ini dapat dilihat dari berbagai kegiatan kemanusiaan yang telah dilakukan oleh PMI sebagai wujud dalam mengembangkan sikap saling mencintai sesama manusia, mengakuinya dan memperlakukan sesuai dengan harkat dan martabatnya sebagai makhluk Tuhan Yang Maha Esa, guna untuk menjunjung tinggi nilai-nilai kemanusiaan. Dari berbagai kegiatan kemanusiaan yang telah dilakukan oleh PMI tersebut tentunya sangatlah bermanfaat untuk masyarakat yang terkena dampak bencana yang memerlukan bantuan secara adil dan sukarela. Serta dapat memberikan pertolongan bagi para pasien atau penderita sakit yang sangat membutuhkan darah melalui kegiatan donor darah yang diadakan PMI.

  14. Role of lichens in weathering of granodiorite in the Sila uplands (Calabria, southern Italy)

    Science.gov (United States)

    Scarciglia, Fabio; Saporito, Natalina; La Russa, Mauro F.; Le Pera, Emilia; Macchione, Maria; Puntillo, Domenico; Crisci, Gino M.; Pezzino, Antonino

    2012-12-01

    This paper explores the role of five recurrent epilithic lichen species (Aspicilia intermutans (Nyl.) Arnold, Xanthoparmelia pulla (Ach.) O. Blanco, A. Crespo, Elix, D. Hawksw. & Lumbsch, Rhizocarpon lecanorinum Anders, Tephromela atra (Huds.) Hafellner and Lecanora bolcana (Pollini) Poelt), which encrust granodiorite spheroidal boulders exposed in the Sila uplands (Calabria, southern Italy), in weathering of plutonic rocks in a typical mountainous Mediterranean environment. A detailed investigation was carried out on the lichen-rock interface of each species, by comparing them mutually and with lichen-free granodiorite samples. For this purpose, the lichen species were sampled together with the encrusted rock surface for detailed mineral-petrographic analyses performed in thin and ultra-thin sections. Optical and scanning electron microscopy of these sections and of bulk samples permitted us to highlight the peculiar modes of physical and chemical attacks of lichen thalli and hyphae on and into the substratum for each species. Crack systems often parallel to the outer rock surface appear often intruded by hyphae, which cause rupture of primary minerals, with detachment and progressive incorporation of their fragments into the thallus. In particular, the species L. bolcana and T. atra revealed an unexpected, partly endolithic behavior, presumably enhanced by the presence of rock fractures earlier generated by other physical breakage processes already affecting the spheroidal boulders in the Sila mountains. Dissolution features often affect primary minerals (even quartz), that may show very peculiar patterns which are suggestive of a biologically-induced control. Various phyllosilicate clay minerals were identified using SEM-EDS microprobe analyses and FT-IR spectroscopy, which also enabled the identification of possible amorphous silica (or quartz micrograins), rhizocarpic acid and carotenoid at the encrusted granodiorite interface. In contrast, neither oxalic

  15. Uboinaja sila

    Index Scriptorium Estoniae

    2006-01-01

    Legendaarne fantastiline seiklusfilm "Superman : The Movie" (1978) on eeskujuks ja aluseks uuele sama koomiksi ainelisele mängufilmile "Superman tuleb tagasi" ("Superman Returns") : režissöör Bryan Singer : nimiosas kunagisele nimiosalisele Christopher Reeve'le sarnanev Brandon Routh : Ameerika Ühendriigid 2006

  16. Mindblindness: metaphor and neuroaesthetics in the works of Silas Weir Mitchell and Simon Baron-Cohen.

    Science.gov (United States)

    Swenson, Kristine

    2013-01-01

    Silas Weir Mitchell's novel, When All the Woods are Green (1894), acknowledges the medical use of mindblindness (agnosia) but also casts it as a developmental disorder, bringing it provocatively close to how current neuropsychologist, Simon Baron-Cohen and his followers use the term in relation to autism. This chapter traces the mindblindess metaphor in the works of Mitchell and Baron-Cohen to show how mindblindness informs the larger paradigms by which they theorize the brain. This analysis suggests that Baron-Cohen, and thus much current thinking about autism spectrum conditions, is influenced by Victorian-era cultural assumptions and neurosexism, a connection that calls for scrutiny of Baron-Cohen's current models of the brain and theories of autism. This chapter also demonstrates the extent to which Mitchell used fiction and advocated writing as neuroaesthetic tools and thus bridged in his work cognitive science and aesthetics--a connection that current scholars of neuroaesthetics are now theorizing. © 2013 Elsevier B.V. All rights reserved.

  17. Statistical implications of adjustments of raw ILI (In-Line Inspection) data

    Energy Technology Data Exchange (ETDEWEB)

    Timashev, Svyatoslav A.; Bushinskaya, Anna V. [Russian Academy of Sciences, Ekaterinburg (Russian Federation). Ural Branch. Sciences and Engineering Center ' Reliability and Safety of Large Systems and Machines'

    2009-07-01

    The paper describes the implications and inferences that inevitably arise when deliberate 'adjustments' of raw MFL ILI data are made when delivering the final report on conducted ILI and/or performing defect sizing and reliability assessments needed for pipeline integrity management plans (IMPs). The root causes of data adjustments are discussed, main types of adjustments are classified and the consequences as related to pipeline residual life, reliability and safety are described. A comparison is performed between adjustment and the full statistical analysis (FSA), as applied to raw ILI and verification data. The consequences of defect data adjustment as related to pipeline reliability and POF and possible litigation issues are discussed. Case studies are presented which demonstrate the application of the FSA method to the results of ILI and verification measurements on pipelines that are located on three continents. Some assessments of the actual reliability of pipelines with defects are given. (author)

  18. A review on pipeline corrosion, in-line inspection (ILI), and corrosion growth rate models

    International Nuclear Information System (INIS)

    Vanaei, H.R.; Eslami, A.; Egbewande, A.

    2017-01-01

    Pipelines are the very important energy transmission systems. Over time, pipelines can corrode. While corrosion could be detected by in-line inspection (ILI) tools, corrosion growth rate prediction in pipelines is usually done through corrosion rate models. For pipeline integrity management and planning selecting the proper corrosion ILI tool and also corrosion growth rate model is important and can lead to significant savings and safer pipe operation. In this paper common forms of pipeline corrosion, state of the art ILI tools, and also corrosion growth rate models are reviewed. The common forms of pipeline corrosion introduced in this paper are Uniform/General Corrosion, Pitting Corrosion, Cavitation and Erosion Corrosion, Stray Current Corrosion, Micro-Bacterial Influenced Corrosion (MIC). The ILI corrosion detection tools assessed in this study are Magnetic Flux Leakage (MFL), Circumferential MFL, Tri-axial MFL, and Ultrasonic Wall Measurement (UT). The corrosion growth rate models considered in this study are single-value corrosion rate model, linear corrosion growth rate model, non-linear corrosion growth rate model, Monte-Carlo method, Markov model, TD-GEVD, TI-GEVD model, Gamma Process, and BMWD model. Strengths and limitations of ILI detection tools, and also corrosion predictive models with some practical examples are discussed. This paper could be useful for those whom are supporting pipeline integrity management and planning. - Highlights: • Different forms of pipeline corrosion are explained. • Common In-Line Inspection (ILI) tools and corrosion growth rate models are introduced. • Strength and limitations of corrosion growth rate models/ILI tools are discussed. • For pipeline integrity management programs using more than one corrosion growth rate model/ILI tool is suggested.

  19. Sila kojom vazduh pritiska pokretnu ploču/Force of the air pressure on a moving plate

    Directory of Open Access Journals (Sweden)

    Leonid Ivanovich Gretchihin

    2014-10-01

    Full Text Available U radu je razrađena matematički model gasodinamičkog opstrujavanja ravne ploče pri njenom kretanju sa pozitivnim i negativnim napadnim uglom. Pokazano je da pri malim brzinama kretanja, silu uzgona i čeoni otpor određuje gasodinamički tok vazduha u izlaznoj oblasti opstrujavanja, a pri brzinama kretanja koje su bliske brzini zvuka odlučujuću ulogu vrši uzajamno udarno dejstvo ploče sa molekulima okružujuće sredine u ulaznoj oblasti opstrujavanja. Otcepljena struja iza ploče se ne pojavljuje pri malim brzinama kretanja. Određeni su uslovi kada čeoni otpor i sila uzgona ploče menjaju znak. / (ruski Razrabotana matematičeskaja model' gazodinamičeskogo obtekanija ploskoj plastiny pri ee dviženii s položitel'nym i otricatel'nym uglom ataki. Pokazano, čto pri malyh skorostjah dviženija plastiny pod''emnaja sila i lobovoe soprotivlenie opredeljajutsja gazodinamikoj tečenija vozduha v tyl'noj oblasti, a pri skorostjah dviženija blizkih k skorosti zvuka rešajuščuju rol' vypolnjaet udarnoe vzaimodejstvie plastiny s molekulami okružajuščej sredy v perednej oblasti. Sryvnoe tečenie za plastinoj pri malyh skorostjah dviženija ne voznikaet. Opredeleny uslovija, kogda lobovoe soprotivlenie i pod''emnaja sila plastiny izmenjaet znak. / This paper developed a mathematical model of gas dynamic fluid flow for a flat plate during its movement with positive and negative angles of attack. It is shown that at low velocities, the lifting force and the frontal resistance are determined by gasdynamic air flow in the fluid flow exit areawhile at velocities close to the speed of sound the decisive role is played by a mutualeffect of the pplate coliding with molecules of the surrounding environment in the fluid flow incidence field. The airflow behind the plate does not appear at low velocities. The conditions when the frontal resistance and the lifting force change the sign are determined.

  20. Action of (R)-sila-venlafaxine and reboxetine to antagonize cisplatin-induced acute and delayed emesis in the ferret

    International Nuclear Information System (INIS)

    Warneck, Julie B.; Cheng, Frankie H.M.; Barnes, Matthew J.; Mills, John S.; Montana, John G.; Naylor, Robert J.; Ngan, Man-P.; Wai, Man-K.; Daiss, Juergen O.; Tacke, Reinhold; Rudd, John A.

    2008-01-01

    The chemotherapeutic drug cisplatin is associated with severe gastrointestinal toxicity that can last for several days. A recent strategy to treat the nausea and emesis includes the combination of a 5-HT 3 receptor antagonist, a glucocorticoid, and an NK 1 receptor antagonist. The present studies explore the use of the selective noradrenaline reuptake inhibitors, (R)-sila-venlafaxine, (R,R)-reboxetine and (S,S)-reboxetine to prevent cisplatin (5 mg/kg, i.p.)-induced acute (0-24 h) and delayed (24-72 h) emesis in ferrets. The positive control regimen of ondansetron and dexamethasone, both at 1 mg/kg/8 h, reduced acute and delayed emesis by 100 (P 0.05). In conclusion, the studies provide the first evidence for an anti-emetic potential of noradrenaline reuptake inhibitors to reduce chemotherapy-induced acute and delayed emesis

  1. Geoethics and pedagogy of mountain and risk: the case of transhumance in Sila (Southern Italy)

    Science.gov (United States)

    Bernardo, Marcello; Muto, Francesco; De Pascale, Francesco

    2015-04-01

    , could bring out the range of perceptions that mountains can arouse in a child or pre-adolescent: from images of sadness and unhappiness to others of joy and elation. Perception is, of course, the first operational level and is essential in the exploration and understanding of space. This exploration and understanding is initially based on sensory perceptions and is then added to by perceptions of the environmental condition of the mountains, the weaknesses and risks, the links to history and to demographic, economic, social and cultural trends. The school, traditionally delegated to the training of the boy, can contribute to the acquisition of a new consciousness that can change the current image that the public has of the mountain and the phenomena connected with it as, indeed, the transhumance. Transhumance is a technical term of the pastoral economy, the "best" that is to point out a typical aspect of life, almost symbiotic, leading, for the whole year, men and flocks, with a double seasonal allocation, in mountain and plain, and a dual path (outward and return), almost always quite long, and for particular routes. In Calabria, the most significant and sustained transhumance settled between Sila plateau and Crotone plains.

  2. Analysis of Pathogenesis of Autoimmune Insulitis in NOD Mice: Adoptive Transfer Experiments of Insulitis in ILI and NOD Nude Mice

    OpenAIRE

    Nakamura, Moritaka; Nishimura, Masahiko; Koide, Yukio; Takato, O.Yoshida

    2003-01-01

    In an effort to study the pathophysiological events in the development of insulitis in NOD mice, we have developed ILI- and NOD-nu/nu mice. ILI mice are a nondiabetic inbred strain but are derived from the same Jcl:ICR mouse as NOD mice and share the same H-2 allotype with NOD mice. Splenocytes and CD4+ cells from diabetic NOD mice appeared to transfer insulitis to ILI-nu/nu mice, suggesting that ILI mice already express autoantigen(s) responsible for insulitis. But reciprocal thymic grafts f...

  3. Statistical analysis of real ILI (In-Line Inspection) data: implications, inferences and lessons learned

    Energy Technology Data Exchange (ETDEWEB)

    Timashev, Svyatoslav A.; Bushinskaya, Anna V. [Russian Academy of Sciences, Ekaterinburg (Russian Federation). Ural Branch. Sciences and Engineering Center ' Reliability and Safety of Large Systems and Machines'

    2009-07-01

    The paper discusses current possibilities and drawbacks of in-line inspection (ILI) in sizing defects in oil and gas pipelines. A methodology based on analysis of variances (ANOVA) is presented that extracts maximum possible information from the ILI measurements of defects and subsequent verification results. This full statistical analysis (FSA) methodology was extensively tested by using the Monte Carlo simulation method. It was then applied to analyze the content of sections 7, 9 and appendix E of the API 1163 RP Standard. (author)

  4. Realité urbaine et planification – Cas du P.O.S.(Hammam Dalaa – M Sila – Algérie

    Directory of Open Access Journals (Sweden)

    L. FELOUSSIA

    2013-10-01

    Full Text Available The purpose of this study is to better understand t he incompatibility between the urban phenomenon in Algeria, and the physical and socio-e conomic city as "urban reality" through the case study of land use plan "L.U.P." said " Hammam Dalaa Road " to M'sila. We treat the context of the urban phenomenon locally, taking as an examp le the city of M'sila. The work will therefore, in terms of land use, its contents and the changes it undergoes during its application. After a critical study on the plan of land entitle d "Hammam Dala Road", by observation field, to better understand the urban phenomenon, a nd see the continuing evolution of urban space, we will make Comparison of the first urban project, as a graphic document, and (urban reality. We found that there are changes in use of land which creates a conflict with the recommendations of the "L.U.P.". This has lead to that, specializat ion areas have not been respected at the city of M'sila, and that the areas allocated to activities or habitat no longer play their role. This article presents a first step in the land use plan, and then it will focus on the mismatch between the "L.U.P.", and the urban reality

  5. Analyzing Idioms and Their Frequency in Three Advanced ILI Textbooks: A Corpus-Based Study

    Science.gov (United States)

    Alavi, Sepideh; Rajabpoor, Aboozar

    2015-01-01

    The present study aimed at identifying and quantifying the idioms used in three ILI "Advanced" level textbooks based on three different English corpora; MICASE, BNC and the Brown Corpus, and comparing the frequencies of the idioms across the three corpora. The first step of the study involved searching the books to find multi-word…

  6. Analysis on Cu and Zn Concentrations in Agricultural Soils of Ili District, Xinjiang Autonomous Region, China

    Directory of Open Access Journals (Sweden)

    YANG Jing-na

    2015-02-01

    Full Text Available The aim of this work is mainly to investigate the contents of copper(Cuand zinc(Znin agricultural soils to provide basic infor-mation for the establishment of green and organic production base in Ili District, Xinjiang Autonomous Region. 600 topsoil samples of the a-gricultural land were collected from eight counties of Ili District, and the contents of Cu and Zn were determined by AAS after microwave di-gestion. The statistics analysis showed that the mean contents of Cu and Zn in the agricultural soils of Ili District were 28.68 mg·kg-1 and 83.17 mg·kg-1, respectively. The concentrations of Cu in the agricultural soils of Ili District ranged from 11.07 mg·kg-1 to 59.90 mg·kg-1, 85% of which ranged from 20 mg·kg-1 to 40 mg·kg-1; and the concentrations of Zn in the agricultural soils of Ili District ranged from 39.58 mg·kg-1 to 160.40 mg·kg-1, 90%of which ranged from 60 mg·kg-1 to 110 mg·kg-1. Furthermore, compared the Cu and Zn contents of the tested soils among the eight counties, Cu contents in Tekes County were higher than other counties, while Zn contents showed little difference. The con-tents of Cu and Zn in the tested soils were all below the threshold values that were established in the national environmental quality standard for soils(secondary standards, GB 15618-1995, but about 7% and 21% were higher than the Cu and Zn background values of soil in Ili District, respectively. Furthermore, the concentrations of Cu and Zn in soils of Ili District accord with the environmental requirements for or-ganic and green production base regulated by national standard of organic products(GB/T 19630-2011and industrial standard of green food(NY/T 391-2013.

  7. Probabilistic daily ILI syndromic surveillance with a spatio-temporal Bayesian hierarchical model.

    Directory of Open Access Journals (Sweden)

    Ta-Chien Chan

    Full Text Available BACKGROUND: For daily syndromic surveillance to be effective, an efficient and sensible algorithm would be expected to detect aberrations in influenza illness, and alert public health workers prior to any impending epidemic. This detection or alert surely contains uncertainty, and thus should be evaluated with a proper probabilistic measure. However, traditional monitoring mechanisms simply provide a binary alert, failing to adequately address this uncertainty. METHODS AND FINDINGS: Based on the Bayesian posterior probability of influenza-like illness (ILI visits, the intensity of outbreak can be directly assessed. The numbers of daily emergency room ILI visits at five community hospitals in Taipei City during 2006-2007 were collected and fitted with a Bayesian hierarchical model containing meteorological factors such as temperature and vapor pressure, spatial interaction with conditional autoregressive structure, weekend and holiday effects, seasonality factors, and previous ILI visits. The proposed algorithm recommends an alert for action if the posterior probability is larger than 70%. External data from January to February of 2008 were retained for validation. The decision rule detects successfully the peak in the validation period. When comparing the posterior probability evaluation with the modified Cusum method, results show that the proposed method is able to detect the signals 1-2 days prior to the rise of ILI visits. CONCLUSIONS: This Bayesian hierarchical model not only constitutes a dynamic surveillance system but also constructs a stochastic evaluation of the need to call for alert. The monitoring mechanism provides earlier detection as well as a complementary tool for current surveillance programs.

  8. Reactions of 1,3-dioxacycloalkanes and their 2-arsena, 2-bora, 2-germa, 2-sila, and 2-thia analogs with nitriles

    International Nuclear Information System (INIS)

    Kuznetsov, V.V.

    2005-01-01

    New reactions of five-, six-, and seven-membered 1,3-dioxacycloalkanes and their 2-arsena, 2-bora, 2-germa, 2-sila, and 2-thia analogs with nitriles giving rise to 1,3-oxazacycloalkanes and then to amino alcohols are surveyed. The reactions under consideration, including the reactions of boronic and boric acid esters with nitriles, supplement the known chemical transformations of 1,3-dioxacycloalkanes and their 2-hetero atomic analogs and provide a wide scope for the synthesis of diverse functional derivatives on their basis [ru

  9. Luminescence dating of the Zeketai loess section in the Ili Basin, northwestern China: Methodological considerations

    Science.gov (United States)

    Qin, Jintang; Zhou, Liping

    2018-04-01

    Loess deposits in Xinjiang, northwestern China are ideal archives for past environmental changes in the Westerlies-dominated central Asia. Among previous luminescence dating studies of loess in Xinjiang, few have attempted to systematically investigate the methodological aspects. In this study, we report results of a multiple-procedure luminescence dating of the Zeketai loess section in the Ili Basin, central Xinjiang. Optically stimulated luminescence (OSL) and post-infrared infrared stimulated luminescence (pIRIR) signals were used for quartz and polymineral grains of different sizes. The pIRIR ages obtained with two protocols agree well with each other and constrain the loess deposition between 50 ka and 88 ka. The OSL ages of fine-grained quartz are in stratigraphic order and range from 37 ka to 61 ka, but are ∼30% younger than the pIRIR295 ages of both fine and medium grained polyminerals. Although the causes of the discrepancy between the ages derived from different luminescence dating protocols are still to be understood, we stress that the quartz OSL ages of loess in this region are likely to be underestimated, especially for samples older than 40 ka. The polymineral or potassium feldspar pIRIR signal is recommended for dating loess in the Ili Basin, at least as an internal check.

  10. Weathering profiles in granitoid rocks of the Sila Massif uplands, Calabria, southern Italy: New insights into their formation processes and rates

    Science.gov (United States)

    Scarciglia, Fabio; Critelli, Salvatore; Borrelli, Luigi; Coniglio, Sabrina; Muto, Francesco; Perri, Francesco

    2016-05-01

    In this paper we characterized several weathering profiles developed on granitoid rocks in the Sila Massif upland (Calabria, southern Italy), integrating detailed macro- and micromorphological observations with physico-mechanical field tests and petrographic, mineralogical and geochemical analyses. We focused our attention on the main weathering and pedogenetic processes, trying to understand apparent discrepancies between weathering grade classes based on field description and geomechanical properties, and two common weathering indices, such as the micropetrographic index (Ip) and the chemical index of alteration (CIA). Our results showed that sericite on plagioclase and biotite chloritization, that represent inherited features formed during late-stage hydrothermal alteration of granitoid rocks, may cause an overestimation of the real degree of weathering of primary mineral grains under meteoric conditions, especially in lower weathering grade classes. Moreover, the frequent identification of Fe-Mn oxides and clay coatings of illuvial origin (rather than or in addition to those formed in situ), both at the macro- and microscale, may also explain an overestimation of the weathering degree with respect to field-based classifications. Finally, some apparent inconsistencies between field geomechanical responses and chemical weathering were interpreted as related to physical weathering processes (cryoclastism and thermoclastism), that lead to rock breakdown even when chemical weathering is not well developed. Hence, our study showed that particular caution is needed for evaluating weathering grades, because traditional field and geochemical-petrographic tools may be biased by inherited hydrothermal alteration, physical weathering and illuvial processes. On the basis of chronological constraints to soil formation obtained from a 42 ka-old volcanic input (mixed to granite parent materials) detected in the soil cover of the Sila Massif upland, a first attempt to estimate

  11. Temperature profiles from expendable bathythermograph (XBT) casts from the USNS SILAS BENT in the North Pacific Ocean in support of the Integrated Global Ocean Services System (IGOSS) project from 1977-03-04 to 1977-03-27 (NODC Accession 7700351)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — XBT data were collected from the USNS SILAS BENT in support of the Integrated Global Ocean Services System (IGOSS) project. Data were collected by the US Navy; Naval...

  12. Functional species traits of carabid beetles living in two riparian alder forests of the Sila plateau subject to different disturbance factors (Coleoptera: Carabidae

    Directory of Open Access Journals (Sweden)

    Antonio Mazzei

    2015-06-01

    Full Text Available We studied carabid beetle assemblages found in riparian black alder forests in the Sila plateau (Southern Apennines. These carabid assemblages are characterized by a high incidence of endemic small-sized, low dispersal, highly stenotopic (hygrophilic, and trophycally specialized species. To evaluate the influence of anthropogenic disturbance on these insects, we compared carabid assemblage of an old undisturbed forest (65-170y, wilderness landscape with that of a younger, partly grazed stand (40-60y, cropland landscape. The carabid assemblage of the disturbed stand was characterized by a higher number of species, but showed a lower incidence of zoophagous specialists and brachypterous beetles, with many species probably coming from an adjacent cropland. However, the disturbed stand maintains almost 80% of the core species found in the older forest, which suggests that these insects are not particularly sensitive to disturbance factors represented by periodic wood harvesting and extensive cattle grazing.

  13. A disputa pela laicidade: Uma análise das interações discursivas entre Jean Wyllys e Silas Malafaia

    Directory of Open Access Journals (Sweden)

    Roberta Bivar Carneiro Campos

    2015-12-01

    Full Text Available Resumo Este artigo analisa conflitos envolvendo lideranças laicas e religiosas na esfera pública brasileira entre os anos de 2010 e 2013. O pastor Silas Malafaia protagoniza os confrontos aqui recapitulados, primeiro contra a deputada Iara Bernardi, na ocasião de um debate sobre o PLC 122/2006, passando por sua tão repercutida entrevista no programa de Marília Gabriela e culminando no embate travado contra o deputado Jean Wyllys por ocasião do PDC que ficou conhecido como da “cura gay”. Partindo de um diálogo entre a teoria social contemporânea e a filosofia política, avaliamos os dilemas apresentados a partir dos pontos de vista últimos em disputa, iluminando os sentidos que definem as respectivas concepções do que seja a vida numa sociedade laica e democrática.

  14. Survival and Transcendence of Transnational Indigenous Latina Immigrants (ILIs in the US

    Directory of Open Access Journals (Sweden)

    Margarita Machado-Casas

    2013-12-01

    Full Text Available Transnational indigenous Latino immigrants today seem to live multiple lives across multiple borders. Based on a 3-year Mix methods research study that took place in a new immigrant-receiving community in North Carolina, the manuscript describes the experiences of Indigenous Latina Immigrants (ILIs living in the United States, specifically pedagogies of survival based on fluid social identities. The indigenous women who took part in this study had to adopt fluid unknown identities both in the home for cultural survival, and also outside the home (external identities for physical and social survival, often in hostile environments. In addition, it raises questions about the ways multilingualism affects border mobility and transnationality as well as how indigenous Latina immigrants become Camaleónas guerreras (Chameleon Warriors who use “critical survival tools” as a transnational bridge to facilitate their survival in a hostile US environment, the community, and in schools.

  15. Foreword: Mervyn Silas Paterson

    Science.gov (United States)

    Boland, J. N.

    Born on March 7, 1925 at Booleroo, South Australia, Mervyn Paterson's childhood revolved around life on the family farm. His father was a methodist lay preacher and the local church with its practices was part of his early experiences—it is rare nowadays for people to attend church services four times on Sunday! His early life contrasted markedly with Maginnis Magee of Australian bush fame, whom the namesake poet A. B. Paterson described so colorfully in A Bush Christening: "On the outer Barcoo where the churches are a few, And men of religion are scanty". Mervyn's early sharing of the beauties of nature developed, no doubt, during those peaceful moments as he rode his horse to the local bush school. Such interests continue to this day with his frequent treks from his home in the suburb of Aranda to the lab through the picturesque, relatively unspoilt forest that adorns Black Mountain in Canberra. Mervyn grew up with a respect for nature tempered by an experiential awareness of its hazards as in 1939 he drove with his father through one of those horrendous, nightmarish bushfires that periodically sweep through the Australia bushland, as they transferred the family possessions from one farm to another.

  16. Quality of life for parents of children with influenza-like illness: development and validation of Care-ILI-QoL.

    Science.gov (United States)

    Chow, Maria Yui Kwan; Morrow, Angela; Heron, Leon; Yin, Jiehui Kevin; Booy, Robert; Leask, Julie

    2014-04-01

    Influenza-like illnesses (ILI) cause paediatric morbidity and affect the quality of life (QoL) of children and their parents. We have developed a disease-specific questionnaire (Care-ILI-QoL) to measure the QoL of caregivers of children with ILI. The drafting of the Care-ILI-QoL questionnaire was based on a systematic review, a quantitative survey, qualitative interviews with parents, and meetings with paediatricians. Children aged 6-48 months recruited from childcare centres in Sydney, Australia, were followed up during the 2011 influenza season. Care-ILI-QoL and SF-12v2 Acute Form were administered to the parent of a sick child 2 weeks after the onset of ILI, and again 2 weeks after the child had recovered. Exploratory factor analysis was conducted. Internal consistency, concurrent validity, discriminant validity, homogeneity of items, and responsiveness were tested. Out of the 125 children enrolled from 48 childcare centres, 55 children had ILI (total 75 ILI episodes). Care-ILI-QoL was reduced from 25 to 16 items covering four factors: Daily Activities, Perceived Support, Social Life, and Emotions (Cronbach's alphas 0.90, 0.92, 0.78, and 0.72, respectively). Care-ILI-QoL has satisfactory concurrent and discriminant validity, good internal consistency, and excellent responsiveness. Total QoL and factor scores correlated well with SF-12v2 scores. Total QoL scores were significantly lower in parents who perceived their child as very/extremely sick, sacrificed 10 hours or more in work or recreation in caring for the child, or whose child had two or more general practitioner visits. Total QoL and factor scores were significantly higher after the child had recovered than when the child had ILI. Care-ILI-QoL is the first ILI-specific QoL instrument for parents and is demonstrated to be valid and reliable in a developed country setting where the child is affected by ILI. It has the potential to be applied in clinical and research settings to assist measurement of

  17. Tallinn - eto nash s vami gorod / Leivi Sher

    Index Scriptorium Estoniae

    Šer, Leivi, 1941-

    2007-01-01

    Linnavolikogu valis 5. aprillil Tallinna linnapeaks Keskerakonna esimehe Edgar Savisaare. Rääkides ees ootavatest ülesannetest, loetles E. Savisaar ئ Vabaduse väljaku uuendamine, Kopli liinid, Pae park

  18. [Environmental geochemical baseline of heavy metals in soils of the Ili river basin and pollution evaluation].

    Science.gov (United States)

    Zhao, Xin-Ru; Nasier, Telajin; Cheng, Yong-Yi; Zhan, Jiang-Yu; Yang, Jian-Hong

    2014-06-01

    Environmental geochemical baseline models of Cu, Zn, Pb, As, Hg were established by standardized method in the ehernozem, chestnut soil, sierozem and saline soil from the Ili river valley region. The theoretical baseline values were calculated. Baseline factor pollution index evaluation method, environmental background value evaluation method and heavy metal cleanliness evaluation method were used to compare soil pollution degrees. The baseline factor pollution index evaluation showed that As pollution was the most prominent among the four typical types of soils within the river basin, with 7.14%, 9.76%, 7.50% of sampling points in chernozem, chestnut soil and sierozem reached the heavy pollution, respectively. 7.32% of sampling points of chestnut soil reached the permitted heavy metal Pb pollution index in the chestnut soil. The variation extent of As and Pb was the largest, indicating large human disturbance. Environmental background value evaluation showed that As was the main pollution element, followed by Cu, Zn and Pb. Heavy metal cleanliness evaluation showed that Cu, Zn and Pb were better than cleanliness level 2 and Hg was the of cleanliness level 1 in all four types of soils. As showed moderate pollution in sierozem, and it was of cleanliness level 2 or better in chernozem, chestnut soil and saline-alkali soil. Comparing the three evaluation systems, the baseline factor pollution index evaluation more comprehensively reflected the geochemical migration characteristics of elements and the soil formation processes, and the pollution assessment could be specific to the sampling points. The environmental background value evaluation neglected the natural migration of heavy metals and the deposition process in the soil since it was established on the regional background values. The main purpose of the heavy metal cleanliness evaluation was to evaluate the safety degree of soil environment.

  19. Integrity management and optimization of planning activities from results of the ILI run

    Energy Technology Data Exchange (ETDEWEB)

    Farinas, Jaime [TRANSIERRA S.A., Santa Cruz (Bolivia)

    2009-07-01

    Transierra owns and operates the Yacuiba - Rio Grande pipeline (GASYRG), 432 kilometers in length and 32 inches in diameter, which transports natural gas from the fields of San Alberto and San Antonio (southern Bolivia) to the Rio Grande compression station (Santa Cruz), and is part of the gas export system to Brazil. This pipeline system has a sustained capacity to transport 17,6 million of cubic meter per day. Within the Integrity Management Program (IMP) has been developing and implementing activities and techniques that seeking to ensure the technical integrity of the pipeline, from the good practices of the industry, which also get an optimization for the use of resources for inspection, operation and maintenance activities. In response to that goal at the beginning of 2008, it was concluded the baseline of the GASYRG ILI runs, getting a very good stage of both the internal and external condition of the pipeline, found some stables anomalies (manufacturing and construction) which do not affect the safe operation status of the pipeline, in this way, it was appropriate to re-planning the maintenance programs of all facilities and main elements, in order to achieve a balance between safety operation condition of the pipeline and the resources used for these purposes, which means that there is a 'before' and an 'after' regarding to planning and maintenance activities are concerned. All of this re-planning gives us a cost optimization for the main activities in the order of 30%. Additionally there has been a very particular approach to care for and prevent threats related to corrosion, maintaining a stable cathodic protection system, taking into account the presence of interfering elements (crossing with pipelines, power lines, railroads, etc.). Also important steps have been taken regarding to the changing dynamic to the action of third parties, it is part of a specific program for strengthening contingency plans. Concluding the above, the

  20. Analiza uticaja armiranobetonskog rama od sopstvenog opterećenja i spoljašnjih sila/Structural analysis of a prestressed concrete

    Directory of Open Access Journals (Sweden)

    Miloš Z. Petrović

    2014-10-01

    Full Text Available U radu je prikazano delovanje sile prednaprezanja na armiranobetonski ram (u daljem tekstu AB ram. Posmatrani sistem je statički neodređen sa dva ukleštenja. Na njega deluje opterećenje prednaprezanje kablom silom Nk=600 kN, kao i sopstveno opterećenje. Visina rama je 6.00 m, a osovinski razmak 20.00 m. Opterećenje od sopstvene težine elemenata je od rigle i stuba. Opterećenje konstrukcije usled prednaprezanja spada u unutrašnja opterećenja, koja zamenjujemo ekvivalentnim opterećenjem koje predstavlja spoljašnje opterećenje. Proračun je izvršen metodom sila i metodom deformacija, kao i u softverskom programu 'Tower'. Metodom sila se uklanja ukleštenje i preseku se omogućava obrtanje. Statički neodređena veličina tada je moment ukleštenja. Kod metode deformacije sve statičke i deformacijske veličine izražavaju se putem izvesnog broja međusobno nezavisnih deformacijskih veličina, koje su određene iz uslova ravnoteže sistema. Broj nezavisnih deformacijskih neodređenih veličina predstavlja deformacijsku neodređenost nosača. Sve deformacijski neodređene veličine mogu se svrstati u dve grupe: prvu grupu čine uglovi obrtanja na krajevima kruto vezanih štapova, a drugu grupu komponente pomeranja čvorova. / The effects of prestressing forces on a reinforced concrete frame are shown in the paper. The structure is a statically indeterminate frame with two fixed supports. The load is due to tendon prestressing with Nk = 600 kN and due to self-weight of columns and beam. The columns height is 6.00 m and the beam span is 20.00 m. Effects of prestressing can be replaced by an external equivalent load. Calculations are performed by the force method, by the direct stiffness method and using the 'Tower' software. The rotational restraints are released at fixed supports and the restraint moments are calculated by the force method. The direct stiffness method uses the members' stiffness relations for computing member forces and

  1. Genetic polymorphisms, forensic efficiency and phylogenetic analysis of 15 autosomal STR loci in the Kazak population of Ili Kazak Autonomous Prefecture, northwestern China.

    Science.gov (United States)

    Feng, Chunmei; Wang, Xin; Wang, Xiaolong; Yu, Hao; Zhang, Guohua

    2018-03-01

    We investigated the frequencies of 15 autosomal STR loci in the Kazak population of the Ili Kazak Autonomous Prefecture with the aim of expanding the available population information in human genetic databases and for forensic DNA analysis. Genetic polymorphisms of 15 autosomal short tandem repeat (STR) loci were analysed in 456 individuals of the Kazak population from Ili Kazakh Autonomous Prefecture, northwestern China. A total of 173 alleles at 15 autosomal STR loci were found; the allele frequencies ranged from 0.5022-0.0011. The combined power of discrimination and exclusion statistics for the 15 STR loci were 0.999 999 999 85 and 0.999 998 800 65, respectively. In addition, phylogenetic analysis involving the Ili Uygur population and other relevant populations was carried out. A neighbour-joining tree and multidimensional scaling plot were generated based on Nei's standard genetic distance. Results of the population comparison indicated that the Ili Uygur population was most closely related genetically to the Uygur populations from other regions in China. These findings are consistent with the historical and geographic backgrounds of these populations.

  2. Critical Evaluation of the New Headway Advanced and the ILI Advanced Series: A Comparison of Curricular Components and CLT Objectives Based on ACTFL

    Directory of Open Access Journals (Sweden)

    Esmail Zare-Behtash

    2017-07-01

    Full Text Available The critical evaluation of systematic planning, development and review practices of instructional materials intend to improve the quality of teaching and learning. This study investigates the objectives of communicative language teaching and curricular components of two important textbooks which are widely studied in Iran: the New Headway Advanced Series (2015, the Iran Language Institute (ILI Advanced1 (2008. The evaluation is done in terms of two prospects; firstly, the interpretation of communicative language teaching objectives and secondly, curricular components of the books. To this aim, a checklist of 5 Cs standards and seven curricular components evaluation developed by American Council on the Teaching of Foreign Languages (ACTFL was employed. The evaluation reveals that the New Headway advanced series is more preferable and desirable than the ILI Advanced 1 due to the design and organization, authenticity, attractiveness, functionality, practicality and the other qualities mentioned above regarding communication, cultures, connection, comparison, and community in all aspects. The evaluation based on the seven curricular components- language systems, communication strategies, cultural knowledge, learning strategies, content from other subject areas, critical thinking skills, technology and the other features- indicates that the ILI textbook enjoys low standards and is not well developed in all components. The ILI textbook is highly reading and writing oriented and not appropriate for transactional and interactional learning purposes. This study acquaints language teachers and learners with the more desirable and cogent book.

  3. Financial and tax risks at implementation of ''Chayanda- Lensk'' section of ''Sila Sibiri'' gas transportation system construction project

    International Nuclear Information System (INIS)

    Sharf, I V; Chukhareva, N V; Kuznetsova, L P

    2014-01-01

    High social and economic importance of large-scale projects on gasification of East Siberian regions of Russia and diversifying gas exports poses the problem of complex risk analysis of the project. This article discusses the various types of risks that could significantly affect the timing of the implementation and effectiveness of the project for the construction of the first line of ''Sila Sibiri'', the ''Chayanda-Lensk'' section. Special attention is paid to financial and tax aspects of the project. Graphically presented analysis of the dynamics of financial indicators reflect certain periods of effectiveness in implementing the project. Authors also discuss the possible causes and consequences of risks

  4. Chemical composition and antimicrobial activity of the essential oil from Satureja horvatii Šilić (Lamiaceae

    Directory of Open Access Journals (Sweden)

    BRANISLAVA LAKUSIC

    2008-07-01

    Full Text Available The present paper describes the chemical composition and antimicrobial activity of the essential oil of the endemic species Satureja horvatii Šilić, collected in Montenegro. The essential oil was obtained from the aerial parts of the plant by hydrodistillation and analyzed by GC–MS. From the 34 compounds representing 100 % of the oil, the major compound was the phenolic monoterpene thymol (63.37 %. The oil contained smaller amounts of g-terpinene (7.49 %, carvacrol methyl ether (4.92 %, carvacrol (4.67 %, p-cymene (4.52%, a-terpinene (1.81 %, borneol (1.58 %, a-thujene (1.56 %, b-caryophyllene (1.55 % and b-myrcene (1.44 %. The antimicrobial activity of the essential oil of S. horvatii was evaluated using the agar diffusion and broth microdilution methods. The essential oil exhibited antimicrobial activity to varying degrees against all the tested strains. The maximum activity of S. horvatii oil was observed against Gram-positive bacteria (Micrococcus luteus, Staphylococcus epidermidis, Staphylococcus aureus and Enterococcus faecalis and against the yeast (Candida albicans. The oil exhibited moderate activity against the Gram-negative bacteria Escherichia coli and Klebsiella pneumoniae and weak activity against Pseudomonas aeruginosa. This study confirms that the essential oil of S. horvatii possesses antimicrobial activities in vitro against medically important pathogens.

  5. Morphological characteristics of a rare endemic species, Erysimum croceum M. Pop. (Brassicaceae from Trans-Ili Alatau, Kazakhstan

    Directory of Open Access Journals (Sweden)

    Karime T. Abidkulova

    2017-12-01

    Full Text Available Erysimum croceum is a rare endemic species listed in the Red Book of Kazakhstan. In 2015–2017 we studied three populations of this species on the territory of the Ile-Alatau National Park (Trans-Ili Alatau, Northern Tian-Shan. As a result of the inventory of sampling plots, we estimated the elevation range occupied by the species and identified age structure and population density. Our results confirmed earlier reports of low population counts of E. croceum. We also studied biometric characteristics of virginal and generative individuals of E. croceum from different populations, and measured parameters of their seeds. The morphometric parameters were highly variable across the studied populations. The only exception was the morphometric parameters of the seeds, which had low or very low variability. We conclude that these parameters are the most stable characteristics of the species. The results of the study can contribute to our understanding of population structure and dynamics of E. croceum and assist in developing effective conservation strategies for this species.

  6. Internet-based monitoring of influenza-like illness (ILI in the general population of the Netherlands during the 2003–2004 influenza season

    Directory of Open Access Journals (Sweden)

    Schellevis François G

    2006-10-01

    Full Text Available Abstract Background An internet-based survey of influenza-like illness (ILI – the Great Influenza Survey or GIS – was launched in the Netherlands in the 2003–2004 influenza season. The aim of the present study was to validate the representativeness of the GIS population and to compare the GIS data with the official ILI data obtained by Dutch GPs participating in the Dutch Sentinel Practice Network. Method Direct mailings to schools and universities, and repeated interviews on television and radio, and in newspapers were used to kindle the enthusiasm of a broad section of the public for GIS. Strict symptomatic criteria for ILI were formulated with the assistance of expert institutes and only participants who responded at least five times to weekly e-mails asking them about possible ILI symptoms were included in the survey. Validation of GIS was done at different levels: 1 some key demographic (age distribution and public health statistics (prevalence of asthma and diabetes, and influenza vaccination rates for the Dutch population were compared with corresponding figures calculated from GIS; 2 the ILI rates in GIS were compared with the ILI consultation rates reported by GPs participating in the Dutch Sentinel Practice Network. Results 13,300 persons (53% of total responders, replied at least five times to weekly e-mails and were included in the survey. As expected, there was a marked under-representation of the age groups 0–10 years and 81->90 years in the GIS population, although the similarities were remarkable for most other age groups, albeit that the age groups between 21 and 70 years were slightly overrepresented. There were striking similarities between GIS and the Dutch population with regard to the prevalence of asthma (6.4% vs. 6.9% and the influenza vaccination rates, and to a lesser degree for diabetes (2.4% vs. 3.5%. The vaccination rates in patients with asthma or diabetes, and persons older than 65 years were 68%, 85%, and

  7. Critical Evaluation of the New Headway Advanced and the ILI Advanced Series: A Comparison of Curricular Components and CLT Objectives Based on ACTFL

    OpenAIRE

    Esmail Zare-Behtash; Hassan Banaruee

    2017-01-01

    The critical evaluation of systematic planning, development and review practices of instructional materials intend to improve the quality of teaching and learning. This study investigates the objectives of communicative language teaching and curricular components of two important textbooks which are widely studied in Iran: the New Headway Advanced Series (2015), the Iran Language Institute (ILI) Advanced1 (2008). The evaluation is done in terms of two prospects; firstly, the interpretation of...

  8. SPECT and 123I-Iodolisuride (123-I-ILIS) in extra-pyramidal syndromes. The use of different models of γ-cameras

    International Nuclear Information System (INIS)

    Ribeiro, M.J.; Jannuario, C.; Santos, A.C.; Cunha, L.; Pedroso de Lima, J.J.; Prunier-Levilion, C.; Autret, A.; Guilloteau, D.; Besnard, J.C.; Baulieu, J.L.; Chassat, F.; Bekhechi, D.; Marchand, J.; Mauclaire, L.; Catela, L.

    1999-01-01

    The aim of this work was to evaluate 123 I-ILIS as a radioligand of dopamine receptors in patients with extra-pyramidal diseases by using different cameras in two different centers. 45 patients were included and divided in 2 groups: group I (n=28): idiopathic Parkinson disease, group II (n=17): other extra-pyramidal syndrome. 123 I-ILIS, 1.7 to 2.8 MBq/kg, was injected after informed consent. Imaging was performed with a single head camera, a dual head camera, a triple head camera and a brain dedicated annular detector. The pattern of the transverse slices containing the basal ganglia was classified according to 3 types: type 1: visible basal ganglia and invisible cortex, type 2: invisible basal ganglia and visible cortex, type 3: visible basal ganglia and cortex. Striatal/frontal cortex ratio (S/FC) was calculated from standardized, geometrical ROI's. No patient showed any undesirable effect. All SPECT images were interpretable. In group 1, 45/45 scintigraphic pattern were type 1 or 3, in group II 18/23 scintigraphic patterns were type 2 or 3. S/FC was significantly lower in group II than in group I patients. We conclude that 123 I-ILIS SPECT can be performed with any conventional γ-camera. It provides functional informations about the striatal dopaminergic synapse in patients with extra-pyramidal degenerative disease, and could be useful in the differential diagnosis between Parkinson disease and other extra-pyramidal syndromes. (author)

  9. Environmental and seasonal impacts on the chemical composition of Satureja horvatii Šilić (Lamiaceae) essential oils.

    Science.gov (United States)

    Lakušić, Branislava; Ristić, Mihailo; Slavkovska, Violeta; Milenković, Marina; Lakušić, Dmitar

    2011-03-01

    The chemical composition of the essential oils of Satureja horvatii Šilić from two natural habitats (Mt. Orjen and Mt. Lovćen in Montenegro) and from cultivated plants (Belgrade, Serbia) were characterized. For the latter, plants from the locus classicus, i.e., Orjenske Lokve (Mt. Orjen), were transferred to Belgrade and, after three years of cultivation, the chemical composition of their essential oils at different phenological stages was analyzed. The essential oils were obtained from the aerial parts of the plants by hydrodistillation and analyzed by GC and GC/MS. The yields and chemical compositions of the S. horvatii oils showed significant differences between the plants collected in the natural habitats and those from cultivation, as well as between the plants at different phenological stages. In the populations from the natural habitats, growing in Mediterranean conditions, the most abundant oil constituents were the phenols thymol (63.7% in the samples from Mt. Orjen) or carvacrol (68.1% in the samples from Mt. Lovćen), while the oils from the cultivated plants (Belgrade), growing in continental conditions, were dominated by linalool (up to 65.8 and 55.9% in average). The basic characteristics of the essential oil from plants at the early phenological stage (before flowering) were high percentages of linalool (37.4%), thymol (27.3%), and carvacrol (12.2%). At the stage of flowering, the percentage of linalool (56.6-57.5%) increased, while those of thymol (15.5-15.8%) and carvacrol (1.4-1.5%) significantly decreased. The essential oil of plants in the full stage of fruiting was characterized by the domination of linalool (58.4 and 65.8%) and lower percentages of thymol (7.6 and 1.3%) and carvacrol (0.7 and 0.1%). In conclusion, the oil composition of S. horvatii was found to depend on the pedoclimatic conditions of the habitat and the phenological stage of the plants. Copyright © 2011 Verlag Helvetica Chimica Acta AG, Zürich.

  10. Mikrobiološka kvaliteta i biokemijske promjene u svježem, mekanom kiselom siru Xinotyri, pripravljenom od svježeg ili pasteriziranog kozjeg mlijeka

    OpenAIRE

    Pappa, Eleni C.; Bontinis, Thomas G.; Tasioula-Margari, Maria; Samelis, John

    2017-01-01

    U radu su ispitani sljedeći parametri: mikrobiološka kakvoća, promjene u glavnim fizikalno-kemijskim značajkama i tijeku proteolize i lipolize te udjelu hlapljivih sastojaka u mekanom siru Xinotyri, tradicionalnom grčkom kiselom siru (pH vrijednosti od približno 4,4; udjela vlage od 65 % i udjela soli od 1 %), pripravljenom od svježeg ili pasteriziranog kozjeg mlijeka bez dodatka starter-kultura, i to tijekom 60 dana aerobnog skladištenja pri 4 °C. Nisu pronađene statistički bitne razlike u u...

  11. Hemşirelerin problem çözme becerileri ve atılganlıkları arasındaki ilişkinin incelenmesi

    OpenAIRE

    Polat, Hatice

    2014-01-01

    Araştırma, hemşirelerin problem çözme becerileri ile atılganlıkları arasındaki ilişkinin incelenmesi amacıyla analitik- kesitsel olarak planlanmıştır. Araştırmanın evrenini 2011 yılı itibariyle ve araştırma takvimi süresince Muğla ili Muğla Üniversitesi Eğitim ve Araştırma Hastanesi'nde çalışan 300 hemşire oluşturmaktadır. Araştırma verileri, tanımlayıcı özellikleri içeren Kişisel Bilgi Formu, Rathus Atılganlık Envanteri ve Gözden Geçirilmiş Sosyal Sorun Çözme Envanteri (GGSSÇE) ile toplanmış...

  12. A unique mountainous vertical distribution patterns and related environmental interpretation-a case study on the northern slope of the ili river valley

    International Nuclear Information System (INIS)

    Tian, Z.P.; Wang, X.L.; Zhuang, L.

    2016-01-01

    Patterns of plant diversity and soil factors along the altitude gradient on the northern slope of Ili River Valley were examined. Plant and environment characteristics were surveyed from 1000-2200 m. There were a total of 155 vascular plant, 133 herbage, 18 shrub, and 7 tree species in 44 sampled plots. The plant richness of vegetation types generally showed a special pattern along altitude, with a bimodal change of plant species number at 100m intervals of altitude samples. The two belts of higher plant richness were in transient areas between vegetation types, the first in areas from low-mountain desert to forest, and the other from dry grass to coniferous forest. Matching the change of richness of plant species to environmental factors along altitude by GAM model and relation analysis revealed that the environmental factors controlling species richness and their patterns were the combined effects of soil salt and nutrition. Water was more important at lower altitude, and temperature at higher altitude, the role of the inversion layer at high altitude coniferous forest species diversity appearing to rise. Soil nutrition and salt also showed a similar distribution pattern of diversity. Especially, diversity index and soil salinity showed a strong correlation. This study provides insights into plant diversity conservation of ili River Valley in Tianshan Mountain. (author)

  13. Central Asia’s Ili River Ecosystem as a Wicked Problem: Unraveling Complex Interrelationships at the Interface of Water, Energy, and Food

    Directory of Open Access Journals (Sweden)

    Steven G. Pueppke

    2018-04-01

    Full Text Available The Ili River originates in the mountains of Xinjiang, China, and flows across an increasingly arid landscape before terminating in Kazakhstan’s Lake Balkhash, which has no outlet to the ocean. The river has been extensively impounded and diverted over the past half century to produce hydroelectric power and food on irrigated land. Water withdrawals are increasing to the extent that they are beginning to threaten the ecosystem, just as it is becoming stressed by altered inflows as glaciers retreat and disappear. If the Ili River ecosystem is to be preserved, it is crucial that we thoroughly understand the spatial and temporal nuances of the interrelationships between water, energy, and food—and the vulnerability of these components to climate change. The ecosystem has all of the characteristics of a classically-defined “wicked problem”, and so it warrants treatment as a complex and dynamic challenge subject to changing assumptions, unexpected consequences, and strong social and economic overtones. Research should thus focus not just on new knowledge about the water, energy, or food component, but on advancing our understanding of the ecosystem as a whole. This will require the participation of interdisciplinary teams of researchers with both tacit and specialized knowledge.

  14. Siber Kimliklerin Kişiliğe Yansıması: Proteus Etki (Tanımı, Nedenleri Ve Önlenmesi)

    OpenAIRE

    TANHAN, Fuat; ALAV, Özlem

    2015-01-01

    Hayatın vazgeçilmez bir parçası haline gelmiş olan teknoloji ve internet bireyi ve toplumu farklı yönlerden etkisi altına alabilmektedir. Teknoloji ve internet sanal çevre diye bilinen yeni bir sosyal dünyanın oluşmasına neden olmuştur. Sanal dünya, sınırları neredeyse çizilemeyen bir çevre sunmakta ve bu çevre içinde bulunan bireyleri, kurumları etkilemekte ve dönüştürmektedir.  Söz konusu etki, kimi yönlerden olumlu, kimi yönlerden ise olumsuzlaşmaktadır. Sanal dünyadaki ilişkiler, kimlikle...

  15. Performance of the inFLUenza Patient-Reported Outcome (FLU-PRO) diary in patients with influenza-like illness (ILI)

    Science.gov (United States)

    Bacci, Elizabeth D.; Leidy, Nancy K.; Poon, Jiat-Ling; Stringer, Sonja; Memoli, Matthew J.; Han, Alison; Fairchok, Mary P.; Coles, Christian; Owens, Jackie; Chen, Wei-Ju; Arnold, John C.; Danaher, Patrick J.; Lalani, Tahaniyat; Burgess, Timothy H.; Millar, Eugene V.; Ridore, Michelande; Hernández, Andrés; Rodríguez-Zulueta, Patricia; Ortega-Gallegos, Hilda; Galindo-Fraga, Arturo; Ruiz-Palacios, Guillermo M.; Pett, Sarah; Fischer, William; Gillor, Daniel; Moreno Macias, Laura; DuVal, Anna; Rothman, Richard; Dugas, Andrea; Guerrero, M. Lourdes

    2018-01-01

    Background The inFLUenza Patient Reported Outcome (FLU-PRO) measure is a daily diary assessing signs/symptoms of influenza across six body systems: Nose, Throat, Eyes, Chest/Respiratory, Gastrointestinal, Body/Systemic, developed and tested in adults with influenza. Objectives This study tested the reliability, validity, and responsiveness of FLU-PRO scores in adults with influenza-like illness (ILI). Methods Data from the prospective, observational study used to develop and test the FLU-PRO in influenza virus positive patients were analyzed. Adults (≥18 years) presenting with influenza symptoms in outpatient settings in the US, UK, Mexico, and South America were enrolled, tested for influenza virus, and asked to complete the 37-item draft FLU-PRO daily for up to 14-days. Analyses were performed on data from patients testing negative. Reliability of the final, 32-item FLU-PRO was estimated using Cronbach’s alpha (α; Day 1) and intraclass correlation coefficients (ICC; 2-day reproducibility). Convergent and known-groups validity were assessed using patient global assessments of influenza severity (PGA). Patient report of return to usual health was used to assess responsiveness (Day 1–7). Results The analytical sample included 220 ILI patients (mean age = 39.3, 64.1% female, 88.6% white). Sixty-one (28%) were hospitalized at some point in their illness. Internal consistency reliability (α) of FLU-PRO Total score was 0.90 and ranged from 0.72–0.86 for domain scores. Reproducibility (Day 1–2) was 0.64 for Total, ranging from 0.46–0.78 for domain scores. Day 1 FLU-PRO scores correlated (≥0.30) with the PGA (except Gastrointestinal) and were significantly different across PGA severity groups (Total: F = 81.7, pFLU-PRO scores are reliable, valid, and responsive in adults with influenza-like illness. PMID:29566007

  16. Eolian dust dispersal patterns since the last glacial period in eastern Central Asia: insights from a loess-paleosol sequence in the Ili Basin

    Science.gov (United States)

    Li, Yue; Song, Yougui; Fitzsimmons, Kathryn E.; Chang, Hong; Orozbaev, Rustam; Li, Xinxin

    2018-03-01

    The extensive loess deposits of the Eurasian mid-latitudes provide important terrestrial archives of Quaternary climatic change. As yet, however, loess records in Central Asia are poorly understood. Here we investigate the grain size and magnetic characteristics of loess from the Nilka (NLK) section in the Ili Basin of eastern Central Asia. Weak pedogenesis suggested by frequency-dependent magnetic susceptibility (χfd%) and magnetic susceptibility (MS) peaks in primary loess suggest that MS is more strongly influenced by allogenetic magnetic minerals than pedogenesis, and may therefore be used to indicate wind strength. This is supported by the close correlation between variations in MS and proportions of the sand-sized fraction. To further explore the temporal variability in dust transport patterns, we identified three grain size end-members (EM1, mode size 47.5 µm; EM2, 33.6 µm; EM3, 18.9 µm) which represent distinct aerodynamic environments. EM1 and EM2 are inferred to represent grain size fractions transported from proximal sources in short-term, near-surface suspension during dust outbreaks. EM3 appears to represent a continuous background dust fraction under non-dust storm conditions. Of the three end-members, EM1 is most likely the most sensitive recorder of wind strength. We compare our EM1 proportions with mean grain size from the Jingyuan section in the Chinese loess plateau, and assess these in the context of modern and Holocene climate data. Our research suggests that the Siberian High pressure system is the dominant influence on wind dynamics, resulting in loess deposition in the eastern Ili Basin. Six millennial-scale cooling (Heinrich) events can be identified in the NLK loess records. Our grain size data support the hypothesis that the Siberian High acts as teleconnection between the climatic systems of the North Atlantic and East Asia in the high northern latitudes, but not for the mid-latitude westerlies.

  17. 14-18 yaş arası ergenlerin benlik saygısı ve psikolojik dayanıklılık düzeyleri arasındaki ilişki

    OpenAIRE

    Sarıkaya, Açelya

    2015-01-01

    Bu araştırmanın amacı lise çağındaki ergenlerin benlik saygıları ile psikolojik dayanıklılıkları arasındaki ilişkinin incelenmesidir. Bunun yanı sıra teorik anlamda benlik saygısıyla ilişkili olduğu düşünülen; cinsiyet, yaş, doğum sırası, ebeveynlerin eğitim durumu, ebeveynlerin birliktelik durumu, algılanan sosyoekonomik düzey gibi demografik özelliklerin de bu değişkenle ilişkileri araştırılmıştır. Araştırmada ilişkisel tarama modeli kullanılmıştır ve araştırmanın evrenini Yalova ...

  18. Eolian dust dispersal patterns since the last glacial period in eastern Central Asia: insights from a loess-paleosol sequence in the Ili Basin

    Directory of Open Access Journals (Sweden)

    Y. Li

    2018-03-01

    Full Text Available The extensive loess deposits of the Eurasian mid-latitudes provide important terrestrial archives of Quaternary climatic change. As yet, however, loess records in Central Asia are poorly understood. Here we investigate the grain size and magnetic characteristics of loess from the Nilka (NLK section in the Ili Basin of eastern Central Asia. Weak pedogenesis suggested by frequency-dependent magnetic susceptibility (χfd% and magnetic susceptibility (MS peaks in primary loess suggest that MS is more strongly influenced by allogenetic magnetic minerals than pedogenesis, and may therefore be used to indicate wind strength. This is supported by the close correlation between variations in MS and proportions of the sand-sized fraction. To further explore the temporal variability in dust transport patterns, we identified three grain size end-members (EM1, mode size 47.5 µm; EM2, 33.6 µm; EM3, 18.9 µm which represent distinct aerodynamic environments. EM1 and EM2 are inferred to represent grain size fractions transported from proximal sources in short-term, near-surface suspension during dust outbreaks. EM3 appears to represent a continuous background dust fraction under non-dust storm conditions. Of the three end-members, EM1 is most likely the most sensitive recorder of wind strength. We compare our EM1 proportions with mean grain size from the Jingyuan section in the Chinese loess plateau, and assess these in the context of modern and Holocene climate data. Our research suggests that the Siberian High pressure system is the dominant influence on wind dynamics, resulting in loess deposition in the eastern Ili Basin. Six millennial-scale cooling (Heinrich events can be identified in the NLK loess records. Our grain size data support the hypothesis that the Siberian High acts as teleconnection between the climatic systems of the North Atlantic and East Asia in the high northern latitudes, but not for the mid-latitude westerlies.

  19. Lise öğrencisi ergenlerde depresyon, internet bağımlılığı ve ilişkili faktörler

    OpenAIRE

    Öner, Kamile

    2015-01-01

    Bu çalışma, lise öğrencisi ergenlerde depresyon, internet bağımlılığı ve ilişkili faktörleri incelemek amacı ile kesitsel bir araştırma olarak yapılmıştır. Trabzon İl Merkezinde Milli Eğitim Müdürlüğüne bağlı 5 lise de eğitim-öğretim gören 3289 öğrenci üzerinden örneklem büyüklüğü Büyüköztürk ve arkadaşları tarafından önerilen eşitlik ile hesaplanmış olup %95 güven aralığı ile 345 öğrenci olarak bulunmuştur. Araştırmanın desen etkisi 2 kabul edilip 690 öğrenciye ulaşılması hedeflenmiş ancak ö...

  20. The Research on Ili Accordion Music Culture%伊犁手风琴音乐文化发展状况及其特征

    Institute of Scientific and Technical Information of China (English)

    马茜

    2012-01-01

    伊犁多元的文化孕育出多样的音乐艺术,手风琴音乐也同样丰富多彩。本文就伊犁手风琴自20世纪初到新世纪不同阶段的音乐教育情况作了系统的梳理和归纳;指出伊犁手风琴音乐在乐器种类、乐曲体裁风格、演奏形式、存在范围等方面呈现出鲜明的多样性特征,并探讨了音乐文化中“大、小传统”概念在伊犁手风琴音乐文化艺术中的和谐体现。%Ili's multi-cuhure has bred multiple music art, and the accordion is also rich and varied. The thesis has scientific summary music education in different periods from the beginning of 20~ century to the new millennium ; it points out that Ili accordion music culture shows distinct varied features in instrument kinds, musical composition types, playing forms and existing scopes and so on; it probes into the concept of "big and small traditions's" harmonious reflection in Ill accordion music culture.

  1. Üniversite öğrencilerinde ebeveyn kabulü ile psikolojik uyum arasındaki ilişkinin incelenmesi

    OpenAIRE

    KAVAK, Güler

    2013-01-01

    Bu çalışmada, alanyazında yer alan anne-baba kabul/reddi vepsikolojik uyum değişkenleri arasındaki ilişkilerin, kuramsal tartışmalar ve varolan araştırmalar ışığında bir yapısal model bağlamında test edilmesiamaçlanmıştır. Çalışmada ayrıca, anne-baba kabul/reddi ile psikolojik uyumdeğişkenlerinin cinsiyet ve anne-baba eğitim durumuna göre değişipdeğişmediği de incelenmiştir. Bunlara ek olarak, katılımcıların annelerinden vebabalarından algıladıkları kabul/reddin psikolojik uyumu yord...

  2. Abrupt climatic events recorded by the Ili loess during the last glaciation in Central Asia: Evidence from grain-size and minerals

    Science.gov (United States)

    Song, Yougui; Zeng, Mengxiu; Chen, Xiuling; Li, Yue; Chang, Hong; An, Zhisheng; Guo, Xiaohua

    2018-04-01

    The loess record of Central Asia provides an important archive of regional climate and environmental changes. In contrast to the widely investigated loess deposits in the Chinese Loess Plateau, Central Asian loess-paleosol sequences remain poorly understood. Here, we present an aeolian loess section in the southern Ili Basin. Based on granularity and mineralogical analyses, we reconstruct climatic changes during the last glaciation. The results indicated that most of the abrupt climatic events (such as Dansgaard-Oeschger events and Heinrich events) were imprinted in this loess section, although their amplitudes and ages showed some differences. Compared with the millennial oscillations recoded in loess and stalagmites in East Asia, the arid Central Asia responded more sensitively to the warming events than to the cooling events. The shifting trajectory of westerlies across Central Asia played an important role in dust deposition during the stadials. The North Atlantic climatic signals may have been transmitted from Central Asia to the East Asian monsoon regions via the westerlies.

  3. Knjižnična podrška studentskom učenju i istraživanju: ocjena kvalitete hrvatskih visokoškolskih knjižnica u postupku reakreditacije visokih učilišta

    Directory of Open Access Journals (Sweden)

    Aleksandra Pikić

    2016-12-01

    Full Text Available Potpisivanjem Bolonjske deklaracije Republika Hrvatska obavezala se na kontinuirano praćenje kvalitete sustava za visoko obrazovanje, koje se u praksi između ostaloga odvija postupkom reakreditacije. Cilj ovog istraživanja bio je ispitati razinu uspješnosti hrvatskih visokoškolskih knjižnica pomoću analize ocjena knjižničnih resursa koje su dali članovi stručnih povjerenstava prvog ciklusa reakreditacije hrvatskih visokih učilišta. Istraživanje obuhvaća sva hrvatska visoka učilišta koja su prošla postupak reakreditacije od samog početka njezina provođenja (ak. god. 2010./11. pa do kraja 2015. U tom periodu kroz postupak je prošlo ukupno 129 visokih učilišta ili dijelova visokih učilišta. Rezultati su pokazali da su, ukupno gledajući, hrvatske visokoškolske knjižnice u prosjeku dobile ocjenu 3. Također se pokazalo da nema razlike u ocjeni knjižničnih resursa između sveučilišnih sastavnica te veleučilišta i visokih škola, zatim između javnih i privatnih visokih učilišta te na kraju između glavnih sveučilišnih središta: Zagreba, Splita, Rijeke i Osijeka.

  4. Ergenlerde parasosyal etkileşim: İnternette gerçek benlik, kendilik algısı ve sosyal kaygı arasındaki ilişkiler

    OpenAIRE

    AYTULUN, Gözde

    2015-01-01

    Bu çalışmanın temel amacı, ergenlik dönemindeki seyircilerin dizikarakterleriyle geliştirdikleri parasosyal etkileşim ile internette gerçek benlik,kendilik algısı ve sosyal kaygı arasındaki ilişkiyi incelemektir. Bu çalışmada,cinsiyet ve yaşlarına göre sınıflandırılan bireyler, parasosyal etkileşim, internettegerçek benlik, kendilik algısı ve sosyal kaygı değişkenlerinden aldıkları puanlaraçısından da karşılaştırılmışlardır. Son olarak da, parasosyal etkileşimle ilişkili olanve paras...

  5. Plan ili propal / Jekaterina Rodina

    Index Scriptorium Estoniae

    Rodina, Jekaterina

    2007-01-01

    Läbimõtlemata linnaplaneerimisest Tallinnas. "Vaeste-Tiskre" eramajade rajooni elanikud protestivad samasse piirkonda viiekorruseliste korterelamute ehitamise vastu. Elanike protest peatas 24-korruselise elumaja planeeringu kinnitamise Õismäe elurajoonis. Peatati Hiiul Sanatooriumi parki sanatooriumi sildi all valmiva korterelamu ehitustööd

  6. Halkla ilişkiler öğrencilerinin sosyal medyadaki siber zorbalık duyarlılıklarını ölçmeye ilişkin bir araştırma (A research related to the calculation of sensitivity for cyber bullying in social media among the students of public relations)

    OpenAIRE

    AKTAN, Ercan; ÇAKMAK, Veysel

    2015-01-01

    İnternet alt yapısındaki gelişmeye paralel olarak iletişim yöntemlerinde de bazı değişme ve gelişmeler yaşanmıştır. İletişimin sanal ortamlara hızlı biçimde kaydığı da gözlenmektedir. Bu ortamlardan biri de sosyal medyadır. Sosyal medyanın gelişmesi ile siber zorbalık kavramının gelişimi paralellik göstermiştir. Bu çalışma halkla ilişkiler ve tanıtım bölümü ön lisans ve lisans öğrencilerinin siber zorbalık duyarlılıklarını ölçmek amacıyla Aksaray Üniversitesi Sosyal Bilimler Meslek Yüksekokul...

  7. Evli erkeklerde eşlerine yönelik şiddet ve ilişkili etmenler/Spouse violence and related factors in married men

    Directory of Open Access Journals (Sweden)

    Guljan Dönmez

    2012-12-01

    Full Text Available Amaç: Araştırmanın amacı 25-49 yaş arası evli erkeklerde eşlerine yönelik şiddet uygulama durumunun, türlerinin ve etkileyen etmenlerin belirlenmesidir. Yöntem: Kesitsel tipteki çalışmanın evreni, İzmir’in Konak İlçesi’nde bulunan Esentepe Sağlık Ocağı Bölgesi’nde yaşayan 25-49 yaş arası 2615 evli erkektir. Sistematik örnekleme yöntemi ile seçilen 254 kişiye ulaşılmıştır. Bağımlı değişken olan şiddet varlığı “Yeniden Gözden Geçirilen Çatışma Taktikleri Ölçeği” (The Revised Conflict Tactics Scales=CTS 2 ile belirlenmiştir. Bağımsız değişkenler erkeğe ve eşine ilişkin sosyodemografik değişkenler, evliliğe ve aileye, sağlık durumuna, cinsel yaşama ilişkin özelliklerdir. Veri t Testi, Ki-kare, Lojistik Regresyon Analizi ile çözümlenmiştir. Bulgular: Eşe yönelik psikolojik şiddet sıklığı %93, fiziksel şiddet %37.5, ekonomik şiddet %34.4, cinsel şiddet %3.9 olarak saptanmıştır. Psikolojik şiddete maruziyet, ortaokul ve üzeri öğrenimli kadınlarda anlamlı olarak daha fazladır. Erkeklerin işsiz olması ya da düzensiz işlerde çalışması, haftada birkaç kez ya da her gün alkol kullanması, istenmeyen gebelik varlığı, kadının 25-34 yaş grubunda olması fiziksel şiddette belirleyici etmenler olarak saptanmıştır. Sonuç: Eşleri tarafından kadına yönelik olarak uygulanan psikolojik şiddet sıklığı beklenenden çok yüksek bulunmuştur. Üç erkekten biri ekonomik ve fiziksel şiddet uygulamaktadır. Cinsel şiddet düşük saptanmasına karşın sorunun daha büyük boyutlarda olabileceği düşünülmektedir. Anahtar Kelimeler: Aile içi şiddet, toplumsal cinsiyet, kadın sağlığı Spouse violence and related factors in married men Objective:The purpose of this study is to examine the presence, patterns and related factors of spouse violence among 25-49 years old men. Methods: The cross-sectional study was conducted in the

  8. Između progona i prešutne marginalizacije, ili iz povijesti stradanja Roma u nekim srednjoeuropskim državama za vrijeme Drugog svjetskog rata (Mađarska, Hrvatska, Čehoslovačka, Poljska)

    OpenAIRE

    Vojak, Danijel

    2016-01-01

    Većina europskih zemalja prije samog početka Drugoga svjetskog rata nije započela s nasilnijim pokušajima asimilacije, kakav je već bio u tijeku u nacističkoj Njemačkoj. Izbijanjem Drugoga svjetskog rata i širenjem nacističkog utjecaja na mnoge europske zemlje, bilo izravno kao okupirane, ili posredno kao države – saveznice, započeli su se provoditi neki dijelovi nacističkog anticiganističkog modela odnosa prema Romima. Analizom u ovom radu biti će obuhvaćen odnos srednjoeuropskih vlasti, pop...

  9. Povijest kemije i kemijskog inženjerstva Pedeseta obljetnica osnutka poslijediplomskog studija korozije i zaštite materijala na Tehnološkom fakultetu Sveučilišta u Zagrebu

    OpenAIRE

    Esih, I.; Stupnišek-Lisac, E.; Martinez, S.

    2011-01-01

    Prvi poslijediplomski studij na Kemijsko-tehnološkom odjelu Tehnološkog fakulteta (današnjem Fakultetu kemijskog inženjerstva i tehnologije) Sveučilišta u Zagrebu odnosio se na područje "Korozija i zaštita materijala", a osnovan je ak. god. 1960/61. na poticaj akademika Miroslava Karšulina. Studij je obuhvaćao 3 semestra a završavao je izradom i obranom magistarskog rada. Godine 1980. provedena je reorganizacija kojom su svi poslijediplomski studiji ujedinjeni u poslijediplomski studij "Inžen...

  10. Türkiye'nin 7 akarsu havzasında horozbina, Salaria fluviatilis (Asso,1801, balığına ait boy-ağırlık ilişkisi.

    Directory of Open Access Journals (Sweden)

    Ali İlhan

    2015-12-01

    Full Text Available Bu çalışmada Türkiye‟nin 7 akarsu havzasından toplanmış olan Horozbina Balığı (Salaria fluviatilis‟na ait boy-ağırlık ilişkisinin ortaya çıkarılması amaçlanmıştır. Marmara, Küçük Menderes, Batı Karadeniz, Antalya, Doğu Akdeniz, Seyhan ve Ceyhan havzalarına ait akarsulardan toplanmış olan 652 birey incelenmiştir. Tüm bireyler dikkate alındığında türün Türkiye içsularındaki total boy dağılımı 2.0-12.9 cm, total ağırlık dağılımı 0.10-33.82 g, boy-ağırlık ilişkisi parametreleri a= 0.0135, b= 3.004, r2= 0.986 olarak hesaplanmıştır. Ayrıca, büyüme tipi havzaların 5‟inde izometrik, 1 havzada pozitif allometrik ve 1 havzada da negatif allometrik olarak belirlenmiştir

  11. Türkiye’de denetleme, cezalar ve trafik güvenliği göstergeleri arasındaki ilişkiler: 2008-2012 yılları analizi

    Directory of Open Access Journals (Sweden)

    Nebi Sümer

    2015-12-01

    Full Text Available Amaç: Trafik denetiminin amacı, psikolojik caydırma ve öğrenme kuramı ilkelerine dayalı olarak yollarda trafik kurallarına ve düzenlemelerine tam uyumu sağlamaktır. Bu çalışmanın amacı Türkiye’de trafik denetimlerinin ve cezaların trafik kazaları, yaralanmaları ve ölümleri ile ilişkisini incelenmektir. Yöntem: Çalışmada 2008-2012 dönemine ait 81 ilin trafik denetleme, ceza ve kaza verileri kullanılmıştır. Bu amaçla, 81 ilde söz konusu dönemde araç başına düşen denetleme, ceza, kaza, yaralı ve ölümlere ilişkin trafik güvenliği göstergeleri hesaplanmış ve ilgili değişkenler arasındaki korelasyonlar incelenmiştir. Bulgular: Kaza, yaralanma ve ölüm oranın azaltılmasında, ceza sayısının denetim sayısından daha etkili olduğu gözlenmiştir. Denetim türleri arasında en yüksek düzeyde negatif anlamlı ilişki alkol denetimleri ile kaza riskine ilişkin çeşitli değişkenler arasında bulunmuştur. Emniyet kemeri ve aşırı hız denetimleri de trafikteki ölüm, yaralanma ve kazaları azaltmada anlamlı etkiye sahiptir. Genel olarak denetim/ceza ile trafik kazaları, ölümleri ve yaralanmaları arasındaki korelasyonlar -0,30 civarındadır. Bu da denetleme ve/veya ceza sayısının Türkiye’de kazaları %10 düzeyinde azalttığına işaret etmektedir. Sonuç: Hem beş yıllık toplamda, hem de yıllar bazında, trafik denetimlerinin ve cezalarının başta ölü, yaralı ve kaza sayısı olmak üzere, farklı trafik güvenliği göstergeleriyle negatif yönde ilişkili olduğu bulunmuştur.Anahtar Kelimeler: Trafik kazası, trafik güvenliği, trafik denetimi etkinliği, trafik cezası.

  12. Mersin ilinde görev yapan hekimlerin meslek örgütüyle ilişkileri ve beklentileri

    Directory of Open Access Journals (Sweden)

    Ahmet Öner Kurt

    2011-12-01

    Full Text Available Amaç: Bu çalışmada; Mersin İlinde görev yapan hekimlerin meslek örgütü olan tabip odası ile ilişkilerinin boyutu ve odadan beklentilerinin değerlendirilmesi amaçlanmıştır. Yöntem: Kesitsel tipteki bu çalışmada Mersin İlinde görev yapan toplam 1875 hekim evren olarak kabul edildi, örnek olarak 550 hekimin çalışmaya alınması hedeflendi. Çalışmaya alınacak hekimler; görev yeri, kurum, unvan ve cinsiyet oranına göre ağırlıklandırılarak tabakalı sistematik örnekleme yöntemi ile belirlendi. Veriler Kasım-Aralık 2009 tarihlerinde anket formu kullanılarak toplandı. Verilerin özetlenmesinde tanımlayıcı istatistikler ve değişkenlerin karşılaştırılmasında Ki-kare testi kullanıldı. Bulgular: Hekimlerin %69.1’i erkek, %82.5’i evli, %80.9’u kamu sağlık kurumlarında çalışıyor, %37.6’sı pratisyen hekim olarak görev yapıyordu. Hekimlerin ortalama görev süresi 17.4±9.6 (1–52 yıldı. Hekimlerin %77.1’i tabip odasına üye, %31.5’i son bir yılda tabip odası çalışmalarına katılmış ve %26.7’si bugünden sonraki süreçte tabip odası çalışmalarında görev almak istiyordu. Erkek, evli, özel sektörde çalışan, uzman olan, görev süresi 30 yıldan fazla olan ve çalışma koşullarının iyileştirilmesini bekleyen hekimlerin diğer gruplara göre tabip odasına daha fazla üye oldukları saptandı. Son bir yılda araştırma görevlileri tabip odası çalışmalarına daha az katılmıştı. Hekimlerin tabip odasından ilk sıradaki beklentisi; çalışma koşullarının iyileştirilmesiydi. Sonuç: Mersin’de dört hekimden birisinin tabip odasına üye olmaması, üçte ikisinin oda çalışmalarına katılmaması ve bugünden sonra da katılmayı düşünmemesi, hekimlerin örgütlü yaşamın gereklerini yeterince yerine getirmediğini ve meslek örgütlerine çok fazla sahip çıkmadığını düşündürmektedir. Tabip odaları üyelerinin odaya yakla

  13. Kadın öğretmenlerin kariyer engelleri ile iş doyum düzeyleri arasındaki ilişki / Effect of career barriers facing women teachers on their level of job satisfaction

    Directory of Open Access Journals (Sweden)

    Yusuf İNANDI

    2012-12-01

    Full Text Available ÖZETBu çalışmada, kadın öğretmenlerin kariyer engellerinin, onların iş doyum düzeyleriyle ilişkisini ve yordama düzeyini belirlemek amaçlanmaktadır. Araştırmanın çalışma grubunu Türkiye’deki 21 ilin kent merkezlerindeki ilköğretim okullarında görev yapan 1.070 kadın öğretmen oluşturmaktadır. Betimsel nitelikte olan araştırmada, veriler ‘Kadınların Kariyer Engelleri Ölçeği’ (KKEÖ ve ‘İş Doyum Ölçeği’ (İDÖ ile toplanmıştır. Araştırma sonuçları, kadınların kariyer engelleri ile iş doyum düzeyleri arasında güçlü bir ilişki ortaya koymamaktadır. Yine araştırma sonuçlarına göre kadınların kariyer engelleri, iş doyumunun alt boyutları üzerinde sınırlı etkiye sahiptir. Kadın öğretmenlerin kariyer engelleri, iş doyumunun, sırasıyla, ‘iletişim’, ‘sosyal haklar’, ‘işin yapılma şekli’, ‘çalışma koşulları’, ‘maaş’, ‘işin yapısı’, ‘ilk amirle ilişkiler’, ‘yönetim’ ve ‘çalışma arkadaşları’ alt boyutlarını etkilemektedir. Kadın öğretmenlerin iş doyumları, en fazla, ‘toplumdaki cinsiyete ilişkin kalıp yargıları, ailevi durumlar ve kadınların kendi bakış açıları’ kaynaklı engellerden etkilenmektedir. Kadın öğretmenlerin kariyer engellerinin, onların iş doyumlarını düşük düzeyde yordaması, kadınların ve erkeklerin, kadınların yönetim süreçlerinde az olma durumlarını içselleştirmelerinden kaynaklanmış olabilir.

  14. Öğretmen, yönetici ve anne-babaların kaynaştırma uygulamalarına ilişkin görüşlerinin belirlenmesi

    Directory of Open Access Journals (Sweden)

    Tevhide Kargın

    2003-07-01

    Full Text Available Bu araştırma ülkemizde 1986 yılından beri uygulanmakta olan kaynaştırma uygulamalarına ilişkin mevcut durumu saptamak amacıyla 2566 kişiden veri toplanarak gerçekleştirilmiştir. Bu kişilerin 907’si sınıf öğretmeni, 519’u okul yöneticisi ve 1140’ı ise engelli çocukları normal sınıflara devam eden anne babalardır. Veriler, katılımcıların demografik özellikleri, kaynaştırma uygulamaları, problemler ve ileride yapılması gerekenlerle ilgili sorulardan oluşan “Kaynaştırma Uygulamalarına ilişkin Durum Saptama Anketi” aracılığı ile toplanmıştır. Verilerin analizi sonucunda, Türkiye’de kaynaştırmaya ilişkin birçok problem olduğu; öğretmenler, anne-babalar ve okul yöneticilerinin kaynaştırma uygulamalarına ilişkin bilgi ve becerileri ile okulların sınıf büyüklüğü, öğretim materyalleri ve destek servislerinin sınırlı olduğu görülmüştür. Ayrıca, sınıf öğretmenlerinin engelli çocuklara öğretim yapmak ve sınıfta bu çocukları desteklemek konusunda yeterli eğitim almadıkları bildirilmiştir. The research reported in this article investigated the current situation of the mainstreaming programs implemenred since 1986 in Turkey. Participants of the study were 907 elementary school teahers, 519 school administrators and 1140 parents of children with disabilities placed in regular schools. Data was collected by using “Mainstreaming Programs Situation Survey” consisted of questions related to the demographic characteristics of the respondents, ongoing mainstreaming applications, and problems. The frequency analysis of the responses of the subjects revealed that many problems existed in Turkey in terms of the information and the skills of the teachers, the parents and the administrators about the mainstreaming programs, physical conditions of the schools such as class size, amount of instructional materials, lack of support services. Morover all the

  15. Prikaz knjige: Budislav Vukas, ml., Hrvatska državnost – pravnopovijesne prosudbe: uz 25. godišnjicu prijama Republike Hrvatske u Ujedinjene narode, Pravni fakultet Sveučilišta u Rijeci, Rijeka, 2017.

    Directory of Open Access Journals (Sweden)

    Mirela Krešić

    2018-01-01

    Full Text Available Godina 2017. u svjetskim je razmjerima bila iznimno dinamična godina. Obilježila su je različita zbivanja koja u našem globalnom selu imaju posvemašnji utjecaj bilo da je riječ o prirodnim katastrofama (uragani, požari, poplave i potresi ili onima na koje je znatno više utjecaja imala ljudska ruka, od terorističkih samoubilačkih napada, nuklearnog mahnitanja sjevernokorejskog vođe Kim Jong Una, neobičnog predsjednikovanja Donalda Trumpa ili, ako pogledamo bliže našem dvorištu, migrantskih valova, pokretanja postupka britanskog izlaska iz Europske unije te pokušaja katalonske vlade da izbori neovisnost od Španjolske. Istodobno tu su godinu u Hrvatskoj obilježile duboke društvene podjele, ideološke svađe te iseljavanje znatnog broja građana. Nezadovoljstvo koje hrvatski građani osjećaju i izražavaju prema stanju u državi, funkcioniranju njezinih institucija i pravcu u kojem zemlja ide daje nam pravo, ali nas i obvezuje, svakog pojedinačno i društvo u cjelini, upitati se što smo učinili u proteklih nemalih dva i pol desetljeća, odnosno jesmo li učinili dovoljno kako bismo opravdali stečenu neovisnost o kojoj su brojne generacije prije nas sanjale. Upravo je protek čak četvrt stoljeća od stjecanja neovisnosti bio poticaj prof. Budislavu Vukasu, mlađem da se u godini obilježavanja 25. godišnjice prijama Republike Hrvatske u Ujedinjene narode (22. svibnja, ali i obljetnice njezina međunarodnog priznanja (15. siječnja, pozabavi pitanjem hrvatske državnosti u prošlosti i njezinu kontinuitetu/diskontinuitetu kroz stoljeća. Rezultat njegova istraživanja je monografija Hrvatska državnost – pravnopovijesne prosudbe u izdanju Pravnog fakulteta Sveučilišta u Rijeci. Na 240 stranica teksta monografija daje autorovo viđenje “fenomena kontinuiteta hrvatske državnosti” (str. 9, pri čemu se na događanja s početka devedesetih godina prošlog stoljeća može gledati kao na svojevrsnu kulminaciju spomenutog

  16. Emeklilik Fonları ve Finansal İstikrar: Şili ve Türkiye Örneklerinden Dersler(Pension Funds and Financial Stability: Lessons from Chile and Turkey

    Directory of Open Access Journals (Sweden)

    Vedat Akgiray

    2016-03-01

    Full Text Available Emeklilik fonları, i uzun vadeli yatırım perspektifine sahip olması, ii finansal piyasalardaki oynaklığı uzun vadeye yayarak absorbe edebilmesi, ve iii yatırımlarını hisse senedi ve altyapı fonları ile reel ekonomiye aktarmaları sayesinde; finansal piyasalardaki oynaklığın azalmasına katkıda bulunmaktadır. Bu çalışma, gelişmekte olan ülkelerde (GOÜ,  emeklilik fonlarının ekonomideki payının en düşük olduğu ülkelerden Türkiye'de (%2 ve en yüksek olduğu ülkelerden Şili'de (%66 emeklilik sistemlerinin karşılaştırmalı analizini sunarak, emeklilik fonlarının finansal piyasalardaki oynaklığa olan etkisini 2004-2014 dönemi için incelemektedir. Çalışma aynı zamanda, Türkiye’de uygulanması planlanan ‘otomatik katılım sistemi’ ve bu sistemi tamamlayıcı ‘fon ürünleri’ üzerine politika önerilerini de kapsamaktadır.

  17. Ortaöğretim dokuzuncu sınıf matematik ders kitabına ilişkin öğretmen ve öğrenci görüşleri

    OpenAIRE

    Karaca Gün, Canan

    2009-01-01

    Bu araştırmanın amacı, ortaöğretim okullarının 9. sınıflarında okutulan matematik ders kitabına ilişkin öğretmen ve öğrenci görüşlerini belirlemektir. Araştırmanın çalışma evrenini, Aydın il merkezindeki toplam 19 ortaöğretim okulunda görev yapan matematik öğretmenleri ve bu okullarda öğrenim gören 9. sınıf öğrencileri oluşturmaktadır. Araştırmada nicel araştırma ve nitel araştırma yöntemleri birlikte kullanılarak, sayısal veriler sözel veriler ile desteklenmiştir. Örneklem seçimi iki farklı ...

  18. Kontrol odağı ve örgütsel muhalefet arasındaki ilişki üzerine bir araştırma

    OpenAIRE

    KAYA, Çiğdem

    2017-01-01

    Bu çalışmada çalışanların iş çevrelerindeki kontrol algılarının (kontrol odağının), örgütle ilgili anlaşmazlıklarını ve karşıt fikirlerini sözlü olarak ifade etme stratejileri (örgütsel muhalefet) ile ilişkisinin incelenmesi amaçlanmıştır. Bu amaçla, İstanbul’da çeşitli sektörlerde faaliyet gösteren firmalarda çalışan 180 beyaz yakalı çalışandan toplanan veri analiz edilmiştir. Elde edilen sonuçlar, çalışanların kontrol odaklarının yapıcı açık muhalefet, dışsal muhalefet ve sorgulayıcı açık m...

  19. Kiberataki - ugroza realnaja ili virtualnaja? / Jevgenija Garanzha

    Index Scriptorium Estoniae

    Garanža, Jevgenija, 1979-

    2008-01-01

    Autor arutleb koos kaitseministeeriumi side- ja infotehnoloogia osakonna juhataja Mihkel Tammetiga, milline on küberrünnakutest tulenev reaalne ja virtuaalne oht. Vt. samas: Ajalehe märkus NATO juures tegutseva küberkaitse keskuse kohta; Mõistest "botnet"

  20. Made in Narva ili nashi v Seule

    Index Scriptorium Estoniae

    2008-01-01

    Hiigelsuure titaanskulptuuri "Post-Mapping" valmistamisest saksa firma Trinon Titanium Narva tehases ja selle paigaldamisest tehnoloogiainstituudi hoone fuajeesse Soulis. Skulptuuri autor on arhitekt Lawrence Wallen

  1. STANDARDIZACIJA MARKETINGA: BITI ILI NE BITI

    OpenAIRE

    Šuštar, Rozana

    2007-01-01

    The article discusses the possibilities for standardizing the marketing programs of Slovenian firms which can open a door to more intensive process of internationalization of firms. The study found that environmental factors, such as political and economic stability, significantly affected the possibilities for standardization enabling firms to improve sales margins. The strategic elements for standardization of the marketing mix, consisting of price, distribution, and promotion, are also sub...

  2. PC-3 Prostat Kanser Hücreleri Üzerinde İndosyanin Yeşili Kullanarak Yapılan Fotodinamik Terapinin AO/PI Boyama Testi Sonuçları

    Directory of Open Access Journals (Sweden)

    Mustafa Kemal RUHİ

    2017-06-01

    Full Text Available Fotodinamik terapi (FDT prostat kanseri tedavisinde henüz araştırma aşamasında olan sağaltıcı bir alternatiftir. FDT, ışığa duyarlı bir kimyasal maddenin (fotosensitizan ışık ile aktive edilmesi ve aktive olan kimyasalın kanserli bölgedeki hücre canlılığını baskılayıcı etkiye neden olması prensibine dayanmaktadır. Bu yeni tedavi yöntemi hem seçiciliği hem de yan etkilerinin azlığı nedeniyle alternatifler arasında ön plana çıkmaktadır. FDT’de kullanılan fotosensitizanın ışıksız ortamda sitotoksik olmaması ve vücuttan kolay atılabilmesi istenmektedir. Ayrıca herhangi bir fotosensitizanın yakın kızılaltı ışık ile aktive olması, bu dalgaboyunun deriye ve diğer dokulara daha fazla nüfuz etmesinden dolayı tercih sebebidir. Bu özelliklere sahip olan İndosiyanin Yeşili (ISY daha çok floresans özelliği ile ön plana çıkmış ve görüntüleme amaçlı olarak kullanılmıştır. Bu in vitro çalışmada ISY-FDT’nin farklı inkübasyon süreleri sonundaki etkisi AO/PI boyama yöntemi kullanarak ortaya konmuştur. Elde edilen sonuçlar ISY-FDT’nin hücre canlılığını baskıladığını göstermektedir.

  3. Sporazumi o razgraničenju epikontinentskih pojaseva između država čije obale leže sučelice ili međusobno graniče u Sredozemlju

    Directory of Open Access Journals (Sweden)

    Marina Vokić Žužul

    2012-12-01

    Full Text Available Dvostranim sporazumima između država čije obale leže sučelice ili međusobno graniče do danas je u Sredozemnome moru konačno definirano samo deset crta razgraničenja epikontinentskih pojaseva. U ovome radu analizira se sadržaj svakog od tih ugovora i ukazuje na potrebu utvrđivanja brojnih novih granica sredozemnoga morskoga dna i podzemlja, posebice s obzirom na sve veću gospodarsku važnost njegovih prirodnih bogatstava. Toj analizi prethodi istraživanje primjene konvencijskih pravila o vanjskim granicama epikontinentskog pojasa u nacionalnim propisima obalnih država. Kao najaktivnija sredozemna zemlja u određivanju granica podmorja ističe se Republika Italija. Uz usvajanje detaljnih propisa o vanjskim granicama epikontinentskog pojasa, Italija je zaključila i pet sporazuma o njegovom razgraničenju sa susjednim državama - s bivšom Jugoslavijom, Tunisom, Španjolskom, Grčkom i Albanijom. Uz te ugovore razmatraju se i temeljne značajke dvaju sporazuma koji provode presude Međunarodnog suda pravde (Libija - Tunis i Libija - Malta te kriteriji razgraničenja epikontinentskog pojasa primijenjeni u ugovorima o jedinstvenoj morskoj granici između Bugarske i Turske te Francuske i Monaka. Predmet analize je i crta razgraničenja epikontinentskih pojaseva utvrđena sporazumom između Turske i bivšega Sovjetskog Saveza 1978., koja je devet godina kasnije postala granicom i njihovih gospodarskih pojaseva. Cilj ovoga izlaganja nije samo dati pregled svih dosada sporazumno utvrđenih granica epikontinentskih pojaseva u Sredozemlju, nego i pokušati odgovoriti na pitanje - trebaju li već postojeće granice koje su bile dogovorene za morsko dno, postati i granice voda nad morskim dnom. To je pitanje od posebne važnosti za buduće razgraničenje gospodarskog pojasa odnosno zaštićenoga ekološko-ribolovnog pojasa Republike Hrvatske sa sličnim zonama susjednih država u Jadranu. S obzirom na nedavno započeta istra

  4. Kozak Yöresi Fıstıkçamı (Pinus pinea L. ormanlarında fıstık verimi ile artım ve bazı meteorolojik olaylar arasındaki ilişkiler

    Directory of Open Access Journals (Sweden)

    Dr. Mustafa BATUR

    2016-01-01

    Full Text Available Bu çalışmada, Kozak yöresindeki fıstıkçamı ormanlarında fıstık veriminin çap artımı ve meteorolojik olaylarla ilişkileri araştırılmıştır.İlişkilerin ortaya konması için 2006-2011 yılları arasındaki yıllık çap artım verileri, meteorolojik veriler ve örnek ağaçlara ait fıstık verimleri kullanılmıştır.Yapılan değerlendirmede; çap artımı ile fıstık verimi arasında önemli bir bulunamamıştır. Ancak, bazı meteorolojik olaylar ile fıstık verimi arasında ilişkilerin olduğu saptanmıştır. Özellikle, kabuklu fıstık verimi ile bir önceki yılın vejetasyon dönemindeki toplam yağış miktarı arasında R2=0,81, iki yıl önceki vejetasyon dönemindeki toplam yağış miktarı arasında R2=0,79 seviyesinde ilişki saptanmıştır. Fıstık veriminin kozalakların olgunlaştığı yıldaki meteorolojik olaylardan daha çok tozlaşma ve kozalakların büyüme dönemlerindeki meteorolojik verilerle ilişkili olduğu tahmin edilmektedir.

  5. Genel Bilişsel Yetenek Ölçümlerinde Süre ve Performans İlişkisinde A Tipi Kişiliğin Rolü(The Role of Type A Personality on the Relationship between Time and Performance in Measurement of General Cognitive Ability

    Directory of Open Access Journals (Sweden)

    Murat GÜLER

    2016-04-01

    Full Text Available Organizasyonların personel seçiminde kullanılan bilişsel yetenek ölçümlerinin, objektif ve yansız olarak yapılması, ihtiyaç duyulan uygun nitelikteki insan kaynağının temin edilmesi için önemli bir husustur. Ancak, bilişsel yetenek testlerinin kişilik özelliklerinden etkilendiğine dair bazı bulgular öne sürülmektedir. Mevcut araştırmada, genel bilişsel yetenek (GBY ölçümlerinde süre ve performans ilişkisinde A Tipi kişiliğin rolü 271 üniversite öğrencisinden elde edilen verilerle incelenmiştir. Veriler, A Tipi Kişilik Ölçeği ve Raven Standart Progresif Matrisler Testi ile toplanmıştır. Genel örneklemde ve A Tiplerinde GBY test performansı ve süresi ile A Tipi kişilik arasında anlamlı bir ilişki gözlenmezken, B Tiplerinde test süresinin ve yaşın GBY test performansının yordayıcısı olduğuna ilişkin bulgulara ulaşılmıştır. Objectively and impartially application of cognitive ability measurements that used in personnel selection of organizations, is a vital issue for providing needed appropriate human resources. But, some findings have been suggested that personality traits influence the measurement of cognitive abilities. In the current study the relationship between general cognitive ability (GCA and Type A personality (TAP was investigated with the data collected from 271 university students. The assessment instruments used were: Type-A Behavior Scale and Raven Standard Progressive Matrices Test. The findings revealed that, while there was no relationship between GCA, testing time and TAP in the general sample and Type A group, testing time and age were predictors of the GCA test performance in the Type B group

  6. Temel eğitimden ortaöğretime geçiş sınavlarına ilişkin 9. sınıf öğrencilerinin görüşleri

    OpenAIRE

    Akman, Ozan

    2017-01-01

    Araştırmanın amacı, temel eğitimden ortaöğretime geçişte yapılmakta olan Temel Eğitimden Ortaöğretime Geçiş (TEOG) Sınavlarına ilişkin dokuzuncu sınıf öğrencilerinin görüşlerinin incelenmesidir. Araştırmada betimsel araştırma yöntemlerinden tarama modeli çerçevesinde nicel yöntem kullanılmıştır. Araştırmanın evrenini 2015-2016 eğitim öğretim yılında Zonguldak ili Ereğli ilçesinde devlet okullarında öğrenim gören 2715 dokuzuncu sınıf öğrencisi oluşturmaktadır. Araştırmanın örneklemini 1022 öğr...

  7. Algılanan ekonomik güçlük ve eşler arasındaki çatışma ile problem davranışlar arasındaki bağlantıda, ebeveyn-ergen ilişkilerinin aracı rolü

    OpenAIRE

    KORFAL, Ahu

    2016-01-01

    Araştırmanın temel amacı, algılanan ekonomik güçlük ve eşler arasındaki çatışma ile ergen problem davranışları arasındaki bağlantıda ebeveyn-ergen ilişkilerinin aracı rolünü incelemektir. Bu amaç çerçevesinde, anılan ilişkiler kız ve erkek ergenlerde Aile Stres Modeli çerçevesinde sınanmıştır. Araştırmanın örneklemini Ankara kent merkezinde bulunan ilköğretim 6. ve 7. Sınıflar ile ortaöğretim 9. ve 10. Sınıflara devam eden ergenler oluşturmaktadır. Çalışmamıza, 518 (%48.5...

  8. 5 February 2010: Romanian Former Minister of Justice V. Stoica (4th from left) visiting SM18 with, from left to right, University of Bucharest Faculty of Physics A. Costescu, DESY Hamburg C. Diaconu; Mrs Valeriu Stoica; Université de Montpellier II S. Ciulli; Technology Department Vacuum, Surfaces and Coatings group S. Ilie; Technology Department Head F. Bordry and Adviser for Russian Federation, Central and Eastern Europe T. Kurtyka.

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    5 February 2010: Romanian Former Minister of Justice V. Stoica (4th from left) visiting SM18 with, from left to right, University of Bucharest Faculty of Physics A. Costescu, DESY Hamburg C. Diaconu; Mrs Valeriu Stoica; Université de Montpellier II S. Ciulli; Technology Department Vacuum, Surfaces and Coatings group S. Ilie; Technology Department Head F. Bordry and Adviser for Russian Federation, Central and Eastern Europe T. Kurtyka.

  9. Toros sediri (Cedrus libani A. Rich. ağaçlandırmalarının gelişimi ile yetişme ortamı özellikleri arasındaki ilişkiler

    Directory of Open Access Journals (Sweden)

    Rıza KARATAŞ

    2017-07-01

    Full Text Available Bu çalışma, Eskişehir, Afyonkarahisar ve Ankara illerindeki toros sediri (Cedrus libani A. Rich. ağaçlandırmalarının boy gelişimi ile bazı yetişme ortamı özellikleri arasındaki ilişkileri belirlemek amacıyla yapılmıştır. Örneklemeler bakı, yükselti, eğim, yamaç konumu ve meşcere gelişimi bakımından farklılık gösteren 55 alanda yürütülmüştür. Her örnek alanda meşcere üst boyunda bulunan bir ağaç kesilmiş ve toprak çukuru açılarak belirlenen horizonlardan toprak örnekleri alınmıştır. Laboratuvarda toprak örneklerinin bazı fiziksel ve kimyasal özellikleri belirlenmiştir. Toros sediri ağaçlandırmalarının gelişimi ile iklim özellikleri arasındaki ilişkileri belirlemek amacıyla örnek alanlara en yakın mesafede bulunan meteoroloji istasyonu verileri kullanılmıştır. Örnek alanlardaki ağaçların üst boy değerleri ile edafik, klimatik ve fizyografik faktörler arasındaki ilişkiler korelasyon, aşamalı regresyon ve regresyon ağacı yöntemleri ile değerlendirilmiştir.Örnek alanlardaki ağaçların üst boy değerleri ile fizyografik yetişme ortamı faktörlerinden enlem ve yamaç konumu; iklim özelliklerinden ortalama yüksek sıcaklık, potansiyel evapotranspirasyon, su fazlası, en soğuk ayın ortalama sıcaklığı, en sıcak ayın ortalama sıcaklığı ve dört yaz ayının ortalama sıcaklığı; toprak özelliklerinden toz miktarı arasında istatistiksel bakımdan önemli ilişkiler bulunmuştur.Sedir ağaçlandırmalarının boy büyümesi aşamalı regresyon analizi ve regresyon ağacı tekniği kullanılarak modellenmiştir. Uygulanan bu analizler sonucunda, boy gelişimini en iyi açıklayan kestirim modeli %65,6 ile regresyon ağacı tekniği kullanılarak elde edilmiştir.

  10. Sağlık yüksekokulu öğrencilerinin evlilik dışı cinsel ilişki, istemli düşükler ve kontraseptif kullanımı konusundaki görüşleri

    Directory of Open Access Journals (Sweden)

    Burcu Tokuç

    2011-12-01

    Full Text Available Amaç: Bu çalışmanın amacı; sağlık yüksekokulu öğrencilerinin evlilik öncesi cinsel ilişki, istemli düşükler ve kontraseptif yöntem kullanımı konusunda görüşlerini belirlemek ve toplumsal değer yargılarını mesleki yaşantılarına yansıtmamaları konusunda farkındalık yaratmaktır. Yöntem: Kesitsel olarak planlanan araştırmaya, Mayıs-2008’de Trakya ve Namık Kemal Üniversitesi sağlık yüksek okullarında öğrenim gören toplam 338 ebelik ve hemşirelik öğrencisinin katılmıştır. Veriler araştırmacılar tarafından hazırlanan 25 maddelik bir soru formu ile toplanmıştır. Bulgular: Araştırmaya katılanların yaş ortalaması 20.9±1.6’dır ve %97’si kadındır. Öğrencilerin %66.9’u “evlenmeden önce cinsel ilişkiye girmek yanlıştır”; %63.6’sı “evlilik dışı ilişkiler bizim ahlaki ve kültürel değerlerimizi tahrip ediyor”; %52.1’i “istemli düşük ahlaksal olarak yanlıştır”; yalnızca %2.1’i ise “kontraseptif yöntemler ile ilgili bilgi yalnızca evli çiftlere verilmelidir” önermesine katıldıklarını belirtmişlerdir. Sonuç: Geleceğin sağlık çalışanları evlilik dışı cinsel ilişki, istemli düşükler ve kontraseptif kullanımı ile ilgili konularda toplumsal değer yargıları ve mesleki yaklaşımları arasında ikilem yaşamaktadırlar. Evlilik dışı cinsel ilişki ve istemli düşükler ahlaksal olarak yanlış bulunurken; planlanmamış bir gebelik durumunda istemli düşüğün kabul edilebileceğini ve evli olmayan genç kadınların istemli düşük hizmetlerinin, kürtajın fiziksel ve psikolojik sonuçlarını da kapsayacak şekilde verilmesi bu ikilemi açıkça göstermektedir. Sağlık alanında toplumsal değer yargılarının mesleki bağımsızlığı ve tıbbi etik yaklaşımları etkilemesi olasılığını en aza indirmek amacıyla müfredat gözden geçirilmelidir. Anahtar Kelimeler: Üreme sağlığı hizmetleri

  11. Eğitim yöneticilerinin hizmetkâr liderlik yeterlikleri ile farklılıkları yönetme becerileri arasındaki ilişki [The relationship between servant leadership competences and diversity management skills among education managers

    Directory of Open Access Journals (Sweden)

    Refik BALAY

    2014-04-01

    Full Text Available Bu çalışmanın amacı, öğretmen ve yönetici görüşlerine göre eğitim kurumlarında görev yapan yöneticilerin hizmetkâr liderlik yeterlikleri ile farklılıkları yönetme becerileri arasındaki ilişkiyi belirlemektir. Araştırma, tarama modelinde desenlenmiştir. Çalışmada veriler, Hizmetkâr Liderlik Ölçeği (HLÖ ve Farklılıkların Yönetimi Ölçeği (FYÖ ile toplanmıştır. Araştırmanın örneklemi 90 yönetici ve 172 öğretmen olmak üzere 262 kişiden oluşmaktadır. Araştırmada, yöneticilerin hizmetkâr liderlik yeterlikleri ile farklılıkları yönetme becerilerinin orta düzeyde olduğu belirlenmiştir. Araştırma sonucunda katılımcı algılarına göre, eğitim yöneticilerinin hizmetkâr liderlik yeterliklerinin, görev türü ve yaş değişkenlerine göre anlamlı düzeyde farklılık gösterdiği; farklılıkları yönetme becerilerinin ise cinsiyet, görev türü, yaş, mesleki hizmet yılı ve kurumda bulunan çalışan sayısı değişkenlerine göre anlamlı düzeyde farklılık gösterdiği tespit edilmiştir. Son olarak, yöneticilerin hizmetkâr liderlik yeterlikleri ile farklılıkları yönetme becerileri arasında ortanın üstünde, yüksek düzeye yakın pozitif yönde bir ilişkinin olduğu belirlenmiştir.

  12. Kendini değerlendirme ve sınav performansı arasındaki ilişki ile sınav kaygısının sınav performansını yordama etkisinin incelenmesi

    OpenAIRE

    Dalkıran, Esra

    2015-01-01

    Bu araştırma, kendini değerlendirme yöntemini kullanarak öz yeterlik düzeyleri gözlemi yapmak ve sınav kaygısının kendini değerlendirme performansı üzerine etkisini tespit etmek amacıyla yapılmıştır. Bu araştırma, çalgı eğitiminde performansın değerlendirilmesi ile öğrencinin kendini değerlendirmesi arasındaki ilişkiyi ve sınav kaygısının sınav performansını yordama etkisini belirlemeyi amaçlamaktadır. Çalışmanın araştırma grubunu 2014-2015 güz yarıyılında Müzik Öğretmenliği Bölümünde öğrenim...

  13. Mersin-Kadıncık Havzası’ndaki Sedir (Cedrus libani A. Rich. ve Karaçam (Pinus nigra Arnold. ağaçlandırmalarının boy gelişimi ile bazı yetişme ortamı özellikleri arasındaki ilişkiler

    Directory of Open Access Journals (Sweden)

    Dr. Sevda POLAT

    2014-12-01

    Full Text Available Mersin Orman Başmüdürlüğü Toprak Muhafaza ve Mera Islâhı Tatbikat Grup Müdürlüğü’nce hazırlanan Kadıncık Su Toplama Havzası Ön Etüt Raporu ve Tatbikat Raporu (OGM, 1968 uyarınca Kuzboğazı Dere Havzası ağaçlandırmıştır. Bu çalışma, Türkiye’nin en eski, Mersin ilinin ilk ağaçlandırmalarından biridir. Havzada sedir ve karaçam türlerinin farklı yükselti/iklim kuşağı, bakı, anakaya ve farklı meşcere kuruluşlarındaki boy gelişmeleri değerlendirilerek yetişme ortamı özellikleri ile ilişkileri araştırılmıştır. Kuzboğazı Dere Havzası’nda sedir ve karaçamların üst boyu ile bakı, toprakların bir m³ hacimdeki değerlerinden kum miktarı, ince toprak miktarı, iskelet hacmi, organik karbon ve tüm azot miktarları arasında önemli ilişkiler bulunmuştur. Havzada güney bakı grubundaki sedir ve karaçamların üst boyları kuzey bakı grubundaki sedir ve karaçamlara göre daha fazladır. Kuzboğazı Dere Havzası’nda 38 yaşındaki meşcerelerde sedirin ulaştığı en yüksek üst boy; orta sedir kuşağında, dolomitik kireç taşlarından oluşmuş topraklarda, güney bakı grubundaki karaçam ile karışık meşcerede 15,10 m’dir. Karaçamda ise; orta sedir kuşağında, kalkşist anakayasından oluşmuş topraklarda, güney bakı grubunda ve sedir ile karışık meşcerede 14,45 m’dir. Kuzboğazı Dere Havzası ağaçlandırmasında 38. yılın sonunda ortalama hacim 197,11 m³/ha olarak hesaplanmıştır. Yıllık hacim artımı 5,19 m³/ha’dır. Araştırmaya göre; Doğu Akdeniz Bölgesi’nde deniz etkisine açık, 1500-2000 m yükseltide, eğimin > % 40 olduğu, dolomitik kireç taşı ve kalkşist anakayalarından oluşmuş topraklarda yapılacak ağaçlandırma çalışmalarında, kuzey bakılarda karaçam, güney bakılarda sedirin tercih edilmesi önerilmektedir.

  14. Portret : dotsh ili mat? / Valeria Bobõleva

    Index Scriptorium Estoniae

    Bobõljova, Valeria, 1945-

    2003-01-01

    Moskvas Pushkini-nimelises Kujutava Kunsti Muuseumis oleva Henry Francois Viollier (1750-1829) miniatuurmaalist tundmatu autori poolt maalitud koopia atributsioon. Autor jõuab järeldusele, et maalil on Natalja Ivanovna Gontsharova asemel kujutatud Euphrosine Ulrika von Liphart-Posset

  15. Dálník čili ekomobil

    Czech Academy of Sciences Publication Activity Database

    Ireinová, Martina

    2003-01-01

    Roč. 86, č. 4 (2003), s. 222-223 ISSN 0027-8203 Institutional research plan: CEZ:AV0Z9061902 Keywords : Czech denomination of cab- motorcycle * spoken language * linguistics Subject RIV: AI - Linguistics

  16. Bright environments vision of the Intelligent Lighting Institute (ILI)

    NARCIS (Netherlands)

    Özçelebi, T.

    2014-01-01

    The Bright Environments research program of the Eindhoven University of Technology Intelligent Lighting Institute aims to find new methods of intelligent lighting control and human interaction. We present a summary of the institute’s work on this research field and the research vision of the Bright

  17. Povorot ljubimoi mõsli, ili Zhenshtshina na trone

    Index Scriptorium Estoniae

    2003-01-01

    Moskva Noorsooteatri lavastused : A. Thehhovi "Ivanov ja teised", lavastaja H. Janovskaja ; show-paroodia "Good-bye, America!" S. Marshaki luuletuse "Mister Twister" ainetel, lavastaja H. Janovskaja ; K. Ginkase Tshehhovi tõlgendus "Must munk". Venemaa ajakirjanduse põhjal

  18. Zamok krassotõ ili tsarstvo duhha / Tamara Unanova

    Index Scriptorium Estoniae

    Unanova, Tamara

    2005-01-01

    14. veebr. andsid Maria Teatri balletisolistid Tallinna Linnahallis galakontserdi. Esinesid teatri solistid Natalja Sologub, Darja Pavlenkova, Igor Kolb, Anton Korsakov ja tõmbenumbrina reklaamitud Farukh Ruzimatov

  19. Akademie čili nevěstinec

    Czech Academy of Sciences Publication Activity Database

    Cidlinská, Kateřina

    (2015) ISSN 0862-5921 Institutional support: RVO:68378025 Keywords : Library of the Czech Academy of Sciences * exhibition * nudes Subject RIV: AO - Sociology, Demography http://www.lidovky.cz/akademie-cili-nevestinec-08h-/kultura.aspx?c=A151106_165942_ln_kultura_ELE

  20. Ironija sudbõ, ili S ljogkim piarom! / Julia Larina

    Index Scriptorium Estoniae

    Larina, Julia

    2007-01-01

    Eldar Rjazanovi menufilmi "Saatuse iroonia ehk Hüva leili!" (1975) järjefilm "Saatuse iroonia: lugu läheb edasi" ("Ironija sudbõ. Prodolzhenije") : režissöör Timur Bekmambetov : Venemaa 2007. Arvamust avaldavad ka filmi produtsent ja stsenaariumi kaasautormAnatoli Maksimov ja stsenarist Aleksei Slapovski

  1. Pobjeda ratom ili pobjeda pravdom? Vijaya i dhammavijaya

    OpenAIRE

    Ježić, Mislav

    2016-01-01

    Indijski vladar Aśoka (273/269.–232. pr. Khr.) ostavio je znatan korpus natpisa na širokome prostoru svojega carstva o načelima svoje vladavine. Njegovi su pretci osvojili gotovo čitavu Indiju i područja današnjega Afghanistana i dijela Irana. On je vodio samo jedan rat u Kaliṅgi za istočnu obalu Indije. Strašne posljedice toga rata jasno je opisao na vlastitim natpisima. Potom je obustavio ratovanje i odlučio osvajati svijet načelima (buddhističke) pravednosti. Održavao je diplomatske odnose...

  2. Romantitsheskaja utopia, ili Progulka s fotokameroi / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2007-01-01

    Fotonäitus "The Belarusian Identity cArt" Tallinna Kunstihoone galeriis. Eksponeeritud on Artur Klinovi (Klinau) fotoseeria "Minsk - unenägude päikeselinn", Igor Savtshenko fotoseeria "Kommenteeritav maastik" ja Andrei Liankevitshi fotod

  3. Industrialnõi mir sadov : utopija ili realnost? / Jevgeni Kapov

    Index Scriptorium Estoniae

    Kapov, Jevgeni

    2002-01-01

    Kohtla-Järve põlevkivimuuseumis avatud näitusest "Aedade industriaalmaailm": organiseerisid Bauhaus Dessau (saksa arhitektuuri- ja disainikool) töötajad. Esitatud on tööstuskeskkonna ümberkujundamise projekte

  4. Roskosh ili sredstvo dlja võzhivanija / Andrei Sokolov

    Index Scriptorium Estoniae

    Sokolov, Andrei

    2004-01-01

    Maailmas kasutusel olevatele standarditele MRP II/ERP vastavad ettevõtte juhtimissüsteemid on jõudnud Eesti ettevõtete juhtide ja omanike huviorbiiti. Tabel: ERP-süsteemi maksumus sõltuvalt ettevõtte aastakäibele

  5. Imperatritsa ili sovetskaja zhenshtshina? / Aleksandr Vassiljev ; interv. N. Rumjantseva

    Index Scriptorium Estoniae

    Vassiljev, Aleksandr

    2002-01-01

    Kunstnik ja moeajaloolane oma intervjuust kuulsa baleriini Maia Plissetskajaga (1925), mille ta tegi detsembris Monte-Carlos esilinastuva baleriini portreefilmi jaoks. Telekanali "Arte" filmi stsenarist on Kristian Lvovski ja stsenarist krahvinna Jelizaveta Kapnist

  6. CREDERE I KREDIT: DVA SRODNA ILI SUPROTSTAVLJENA POJMA?

    Directory of Open Access Journals (Sweden)

    Gabrijela Mihelčić

    2016-01-01

    Full Text Available Proučavajući ugovore o kreditu osigurane stvarnopravnim osiguranjima, a koji se u praksi većinom sklapaju u potrošačkim odnosno B2C odnosima, autorice u radu dolaze do spoznaja o mnogobrojnim problemima u hrvatskoj sudskoj praksi, ali i zakonodavstvu. Isti su primarno posljedica kompleksnog procesa usklađivanja izvornih nacionalnih odredaba s europskim acquisom u tom području, a koji pored ispravnog preuzimanja EU propisa u nacionalno zakonodavstvo zahtijeva i ispravnu primjenu i ujednačeno tumačenje harmo- niziranog nacionalnog prava sukladno istima. U tom smislu, poteškoće nastu- paju već samim određenjem ugovornih strana, odnosno glede pitanja tko je potrošač, a tko trgovac odnosno vjerovnik u B2C ugovorima o kreditu. Isti se nastavljaju u određenju predmeta ugovora, odnosno pronalaženju odgovora na pitanje, što je potrošački kredit te na kreditiranje čega se on točno odnosi. Nejasnoće postoje i o pitanju određenja bitnih sastojaka ugovora o potrošačkom kreditu, glede kojih jasne odgovore ne daje ni praksa Suda EU-a, niti domaća sudska praksa. Problemi postoje i u razumijevanju same dužnosti sudova i drugih primjenjivača prava o tumačenju i primjeni pozitivnoga nacionalnog prava sukladno acquisu odnosno u načinu provedbe iste dužnosti u praksi. Sva navedena pitanja dodatno se usložnjavaju kada su tražbine takvih kredita stvarnopravno osigurane. Imajući u vidu osobite poteškoće u tumačenju i praktičnoj primjeni harmoniziranih nacionalnih odredaba koje se odnose na potrošačko kreditiranje i pravo potrošača općenito, autorice u radu nastoje dati jasne i koncizne odgovore na brojna ključna pitanja o kojima ovisi ispravna primjena spomenutog zakonodavstva.

  7. Evaluating ILI Advanced Series through Bloom's Revised Taxonomy

    OpenAIRE

    MAHDIPOUR, Nasim; SADEGHI, Bahador

    2015-01-01

    Abstract. This study investigated Iran Language Institute Advanced Series in terms of learning objectives based on Bloom's Revised Taxonomy. It examined the cognitive, affective and psychomotor domains to see how the critical thinking skills are used and to what extent these books are different from each other. For these purposes, the frequencies, percentages and Standard Residual were analyzed. Results revealed that the lower-order cognitive skills (i.e. remembering, understanding and applyi...

  8. Hedzh-fondõ : istotshnik riska ili likvidnosti / Fuad Rasulov

    Index Scriptorium Estoniae

    Rasulov, Fuad

    2007-01-01

    Järg 14. märts lk. 37. G7 riikide rahandusministrid tegid FSF-ile (Financial Stability Forum) ülesandeks teha ettekanne ohtudest, mis tulenevad hedge-fondidest, et selle põhjal võtta vastu fondide tegevust reguleerivate seadusandlike dokumentide pakett. Vt. samas: Mis on hedge-fond?

  9. Bogi i monstrõ, ili biografija Supermena / Olga Marsheva

    Index Scriptorium Estoniae

    Marsheva, Olga

    2007-01-01

    Ameerika tuntuimad koomiksikunstnikud Larry Hama, Stan Lee, Jerry Seagel, Bob Kain, Frank Miller ja nende loodud tegelaskujud. Ka briti kirjanik Alan Moore, kellele ei meeldi oma kangelastest tehtud ekraniseeringuid vaadata

  10. Svjaz : s obshtshestvennostju ili s korruptsijei? / Virkko Lepassalu

    Index Scriptorium Estoniae

    Lepassalu, Virkko, 1971-

    2008-01-01

    Randvere tee detailplaneeringu lugu ja selle võimalik seos Tallinna abilinnapea nõuniku Ivo Parbuse korruptsioonisüüdistusega. Piir korruptsiooni ja seadusliku tegevuse vahel võib olla eristamatu. Lisa: Spravka "DD"

  11. Narnija, ili V platjanoi shkaf i obratno / Nikolai Karajev

    Index Scriptorium Estoniae

    Karajev, Nikolai, 1978-

    2005-01-01

    Ekraniseering C.S. Lewise 1950.a. ilmunud romaanist "Narnia lood : Lõvi, nõid ja riidekapp" ("Chronicles of Narnia : The Lion, the Witch and the Wardrobe") : režissöör Andrew Adamson : Ameerika Ühendriigid 2005

  12. Võsokaja moda : v muzei ili na prodazhu? / Marina Radina

    Index Scriptorium Estoniae

    Radina, Marina

    2006-01-01

    Kõrgmoenädalast kevad/suvi 2006 Pariisis. Tuntud disainerite ja moemajade Jean Paul Gaultier', John Galliano (Christian Diori moemaja), Chaneli, Valentino, Christian Lacroix', Elie Saab'i kollektsioonidest. Chaneli moemaja demonstratsioonil osales ka Carmen Kass

  13. Liberalnõi imperializm, ili Missija Rossii v XXI veke

    Index Scriptorium Estoniae

    2003-01-01

    Venemaa valmistub parlamendi- ja presidendivalimisteks. Tuntud poliitik Anatoli Tshubais esines hiljuti Peterburis, põhiteemaks Venemaa ajalooline missioon XXI sajandil, poliitiline know-how - liberaalne imperialism

  14. Integrating ILI data with publicly available mapping solutions

    Energy Technology Data Exchange (ETDEWEB)

    Coleman, Grant A.; Miller, Scott J. [BJ Pipeline Inspection Services, Calgary, AB (Canada)], email: gcoleman@bjservices.ca, email: smiller@bjservices.ca

    2010-07-01

    With the improvement of the technology, in line inspection tools now incorporate accurate Inertial Mapping Units (IMU) which provide spatial coordinates for the features comprised within a pipeline. Geographic information systems (GIS) can be used to display the data, however some companies do not have such systems and novices cannot navigate easily within the application. The aim of this paper is to present the use of universally available packages to display GIS style data. Case studies are presented in which Google Earth imagery is used to display IMU data. This study showed that universally available packages such as Google Earth do not match the accuracy and functionality of GIS systems but they can be a convenient and easy to use way to display data in a portable format. Organizations that do not have a GIS system could thus benefit from the use of those packages.

  15. Teatr v kino ili kino v teatre? / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2008-01-01

    Võimalusest jälgida Metropolitan Opera lavastusi kinolavalt Tallinna kobarkinos ja Tartu kinos Ekraan. The Metropolitan Operas 26. IX etendunud R. Straussi ooperist "Salome", lavastaja J. Flimm, dirigent P. Summers, peaosas K. Mattila.

  16. Psihushka, ili Poljot nad Berlinale? / Lauri Kärk

    Index Scriptorium Estoniae

    Kärk, Lauri, 1954-

    2007-01-01

    57. Berlinalelt avamise järel : Eldar Rjazanovi "Andersen. Elu ilma armastuseta", korealase Park Chan-wooki "Olen küborg, aga muidu OK", festivali avafilm - Olivier Dahani "La Mõme" prantsuse lauljast Edith Piafist. Rain Tolk esindab Eestit Euroopa noorte näitlejate tutvustuspromotsioonis Shooting Star

  17. Shagrenevaja kozha pjatogo elementa, ili Klassika kak zrelishtshe / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2001-01-01

    Klassikalavastused - Mati Undi "Graal" (lav. Peeter Jalakas), Mihhail Bulgakovi "Meister ja Margarita" (lav. Mati Unt), W. Shakespeare'i "Kuningas Lear" (lav. Priit Pedajas), Pedro Calderoni "Elu on unenägu" (lav. Ingo Normet)

  18. Benzin iz rapsa : utopija ili realnaja perspektiva? / Oleg Samorodni

    Index Scriptorium Estoniae

    Samorodni, Oleg, 1961-

    2006-01-01

    Suurärimees Rein Kilgi eesmärgiks on viia Lõuna Toiduainetööstus Lõuna-Eesti juhtivaks ettevõtteks, seepärast käib ka võitlus rapsitööstuse Werol Tehased ostmise ümber ärimeeste Oliver Kruuda ja Urmas Sõõrumaaga

  19. Glaz da glaz ili gaz da gaz? / Jevgenija Garanzha

    Index Scriptorium Estoniae

    Garanža, Jevgenija, 1979-

    2005-01-01

    Euroopa Liidu ja Venemaa tippkohtumisest Londonis, kõnealusteks teemadeks lihtsustatud viisarežiim, piirilepingud Eesti ja Lätiga, vähemusrahvuste olukord nendes riikides, põhiteemaks kujuneb Euroopa sõltuvus Venemaa gaasist ja naftast

  20. Two New Types of Detector for X- or Gamma-Ray Cameras; Deux Nouveaux Types de Detecteurs pour Camera a Rayons X ou {gamma}; O dvukh novykh tipov detektorov dlya rentgenovskikh ili gamma-kamer; Dos Nuevos Tipos de Detector para Camaras de Rayos X o Gamma

    Energy Technology Data Exchange (ETDEWEB)

    Kellershohn, C.; Desgrez, A. [Departement de Biologie, Service Hospitalier Frederic Joliot (France); Lansiart, A. [Departement d' Electronique, Centre d' Etudes Nucleaires de Saclay (France)

    1964-10-15

    Electric Valve, que actua como obturador. Una parte de la luz que penetra en el dispositivo optico es recibida por un fotomultiplicador que rige la apertura del tubo obturador por mediacion de un selector de amplitudes. Este artificio permite efectuar la seleccion entre la luz debida a la senal y la debida al ruido del tubo de Thomson. Solo la primera ocasiona La apertura del tubo obturador. Como la duracion de dicha apertura es sumamente corta, el cociente senal/ruido de este conjunto detector es suficientemente alto para obtener una imagen de la pantalla terminal del tubo obturador por medio de un aparato fotografico abierto constantemente. En la memoria se discuten las caracteristicas de esos dos tipos de detector y los primeros resultados obtenidos. (author) [Russian] Kamery dlja ren t genovskih ili gamma-luchejsozd aju t sja glavnym o br a zom na osnove sovmeshhennogo s detektorom stenopirovannogo ili s etch atogo opticheskogo ustrojstv a. Avtory predlagajut dva tipa detektorov, polnost'ju otlichajushhihsja ot pribora A n g era, kotoryj do p o sl edn e go vremeni byl edinstvennym priborom tak o goroda. Pervyj p redstavlja et soboj kameru s samovoznikajushhej scintilljaciej. Jeta kamera, 2 0 sm v diametre i zapolnennaja redkim g a zom (argonom ili ksenonom), predstavljaet soboj katod i dve s etk i . Katod i vtoraja s etk a nahodjatsja pod raznost'ju potenciala v neskol'ko kilovol't, nemnogo nizhe probojnogo naprjazhenija. Pervoe prostranstvo mezh du k atodom i s etk oj sluzhit istochnikom jel ek tr on ov , p oluchaemyh pod vozdejs tv i em ren t genovskih ili gamma-fotono v slaboj jen er gi i . Mozhno takzhe ispol'zovat' naklejku na katodizmetalla s povyshennym chislom Z, libo kristallicheskij scintilljator, sovmeshhennyj s fotokatodom. Rezk i j vybros zarjadov v rezul' tat e razmnozhenija jelektronov v lavine Taunsenda privodit posle sootvetstvujushhego usilenija k chetko lokalizovannoj scintilljacii s opozdaniem v kak ujuto doljumksek. Izobrazhenie p oluchaet sja s

  1. A nnals of the Academ y of Romanian Scientists Series on History and Arch a eology ISSN 2067 - 5682 Volume 9 , Number 1 / 201 7 79 OF THE AUST RIA - HUNGARIAN SAFETY STRUCTURES IN THOSE OF THE GREAT ROMANIA. CASE OF THE ARAD OFFICER ILIE MIŞCUŢIA (1913 - 1924

    Directory of Open Access Journals (Sweden)

    Mihai D. Drecin

    2018-05-01

    Full Text Available Ilie Miscutia (1893 -? was born in the city of Jula (Bichisghiula, Gyula -today in Hungary, at the border with Romania considered until today “the great city of the Romanians” a Romanian-Serbia family. A graduate of the trade Hungarian School in Lipova; in 1913, he is recruited by the Austria-Hungary army where he attends a Special Course of information. During the Austro -Hungarian-Serbia war (1914-1915, he will be infiltrated as a spy within the Serbia geographical territory. In 1918, along with the decomposition of the Austria- Hungary he joins the political forces in Transylvania that will prepare the Unification from Alba Iulia. We find him, as an officer in the Romanian military units in Prague, then in Budapest in close to the Romanian Central National Council, and in Arad becomes “the guard body” for Stefan Cicio-Pop. He accompanies the delegation of the Transylvanian Romanians that shall submit to the King Ferdinand, in Bucharest, the act of Unification of Transylvania with the Romanian Kingdom. Within theframework of the Diligent Council in Sibiu, the secretary dr.Eugen Bianu is appointed as the head of the Safety Service in Transylvania and Banat. Since 1 January 1919, he is incorporated in the Romanian Army in the framework of the Organizational Section of the Body VII Sibiu Army, named with the rank of sub -lieutenant in the Intelligence Service of the same Army Body. Between 1918-1920 he takes part to the defense of the city and the Committee of Arad and the Committee Bichis (Bekes today in Hungary, against the Hungarian nationalist guards and of the French army of occupation which were playing the game of the governments in Budapest, watching even keeping the Romanian west in the Hungarian state. In the period March 1920 -September 1924 he is part, as officer, of the Police Prefecture in Arad. He withdraws by his resignation, remaining as civil, a known personality in Arad, in dealing with the management of his own

  2. Sağlık politikaları ile meslek ahlakı arasında ilişki var mı? Bursa Tabip Odası’na yapılan başvurular örneğinde bir değerlendirme

    Directory of Open Access Journals (Sweden)

    Kayıhan Pala

    2016-12-01

    Full Text Available Amaç:Hekimlik pratiğine dair meslek örgütüne yansıyan ihlal iddialarını ve belirleyenlerini incelemektir. Yöntem:Araştırma, Bursa Tabip Odası (BTO Yönetim Kurulu’nun 1991-2014 yılları arasındaki tüm kayıtlarının, Onur Kurulu dosyalarının ve bilgisayar kayıtlarının taranmasıyla gerçekleştirilmiştir.Bulgular:İncelenen dönemde BTO’ya yapılan 593 başvuruda toplam 623 ihlal iddiası bulunmaktadır. İhlal iddialarının %46.2’si Onur Kurulu’na iletilmiş ve %29.5’ine yaptırım uygulanmasına karar verilmiştir. Başvurular en çok hasta, hasta yakını ya da hastanın vekili tarafından yapılmıştır (%34.1. Hakkında başvuru yapılan hekimlerin %75.7’si uzman,  %23.3’ü pratisyen, %1.0’i asistan hekimdir. En sık üç ihlal iddiası sırasıyla; tanıtım kurallarının ihlali, haksız kazanç/rekabete aykırılık (%24.8, tıbbi uygulama hatası (%21.4 ve gerçek dışı belge/rapor düzenlemektir (%18.2. ‘Gerçek dışı belge/rapor düzenlemek’, ‘Hasta haklarına saygısızlık’ ve ‘Aracılık, yönlendirme, çıkar ilişkisi’ eylemlerinin Sağlıkta Dönüşüm Programı (SDP sonrasında anlamlı derecede arttığı saptanmıştır. Zorunlu Mesleki Sorumluluk Sigortası sonrasında tıbbi uygulama hatası iddialarının sayısında ve bu iddia sonucunda yaptırıma uğratılan hekim sayısında anlamlı bir artış saptanmamıştır. Sonuç:Bu çalışma ile hekimlik uygulamalarına dair meslek ahlakı ihlallerini anlayabilmek ve sorunları saptayabilmek açısından önemli çıkarımlar elde edilmiş, bulgular SDP ile uygulamaya konulan politikaların mesleki yükümlülüklerin yaşama geçirilmesini güçleştirebileceği yönünde yorumlanmıştır.Anahtar kelimeler:Hekim, meslek ahlakı, etik, tabip odası, onur kurulu

  3. Rabotshaja sila, gossudarstvennõi sektor i programma promõshlennogo razvitija / Eteri Kekelidze

    Index Scriptorium Estoniae

    Kekelidze, Eteri, 1944-

    2007-01-01

    Tööandjate Keskliidu juhatuse esimehe Enn Veskimägi arvamusi tööjõust, riiklikust sektorist ja tööstuse arenguprogrammist. Tööandjate keskliidu pöördumisest vabariigi valitsuse poole, milles juhitakse tähelepanu riigi majanduse ees seisvatele probleemidele. Vt. samas: Eesti eksport 2005-2007 esimene pool

  4. USPOREDBA POTRESNOG ODZIVA ARMIRANOBETONSKIH ZGRADA OD NEKONVENCIONALNIH BETONA

    OpenAIRE

    Kraus, Ivan; Netinger, Ivanka; Morić, Dragan

    2011-01-01

    Članak istražuje ponašanje numeričkih modela armiranobetonskih zgrada sa zgurom u sastavu betona, podvrgnutih seizmičkoj proračunskoj kombinaciji djelovanja. Provedena su preliminarna numerička istraživanja te je utvrđeno da uporaba betona sa zgurom vodi ka smanjenju seizmičkih sila, te posljedično ka smanjenju dimenzija konstrukcijskih elemenata i/ili smanjenju potrebne količine armature. Rezultati ovih preliminarnih istraživanja govore u prilog mogućnosti uporabe zgure kao a...

  5. Remedies to Fraud in Documentary Letters of Credit: A Comparative Perspective / Opravné Opatrenia Pri Podvodoch S Dokumentárnymi Akreditívami: Komparatívna Perspektíva

    Directory of Open Access Journals (Sweden)

    Alavi Hamed

    2016-06-01

    Full Text Available Article 4 of the Unified Customs and Practices of Documentary Letters of Credit establishes the notion of autonomy principle by separating credit from underlying contract between account party and beneficiary. Article 5 by recognizing the autonomy principle confirms that effectuate the payment under credit, banks only deal with documents and not with goods. As a result, while documentary letters of credit are meant to facilitate the process of international trade, their sole dependency on compliance of presented documents to bank by beneficiary to actualize the payment will increase the risk of fraud and forgery in the course of their operation. Interestingly, UCP (currently UCP600 takes a silent status regarding the problem of fraud in international LC operation and leaves the ground open for national laws to provide remedies to affected parties by fraudulent beneficiary. National Laws have different approaches to the problem of fraud in general and fraud in international LC operation in particular which makes the access of affected parties to possible remedies complicated and difficult. Current paper tries to find answer to the questions of (i what available remedies are provided to affected parties in international LC fraud by different legal systems? (ii And what are conditions for benefiting from such remedies under different legal systems? In achieving its objective, paper will be divided in two main parts to study remedies provided by intentional legal frameworks as well as the ones offered by national laws. Part one will study the position of UCP and UNCITRAL Convention on Independent Guarantees and Standby Letters of Credit (UNCITRAL Convention and remedies, which they provide to LC fraud in international trade. Part two in contrary will study available remedies to LC fraud and condition for access them under English and American legal system.

  6. Health-promoting lifestyles and related factors among pregnant women/Gebelerde sağlıklı yaşam biçimi davranışları ve ilişkili faktörler

    Directory of Open Access Journals (Sweden)

    Güliz Onat

    2014-08-01

    açısından özellikle gebelik sürecinde oldukça önemlidir. Bu çalışmada gebe kadınlaın sağlıklı yaşam biçimi davranışları ve ilişkili faktörlerinin araştırılması amaçlanmıştır. Yöntem: Tanımlayıcı nitelikte olan bu çalışma, Uşak’ta 255 gebe kadın üzerinde gerçekleşmiştir. Çalışmada Sağlıklı Yaşam Biçimi Davranışları Ölçeği-II (SYBDÖ-II kullanılmıştır. İstatistiksel değerlendirmede sıklık ve yüzdelik dağılım, t test, Mann Whitney U test and ANOVA kullanılmıştır. Bulgular:Kadınların yaş ortalaması 26.7±5.1 ve gestasyonel yaşı 25.2±10.9 haftadır. Toplam SYBDÖ-II puanı 130.7.±20.0 idi. Ölçeğe ait en düşük puan “fiziksel aktivite” alt grubuna, (14.4±5.0 en yüksek puan ise “manevi gelişim” e aittir (26.1±4.2. Gebelik öncesi sigara içme sıklığı %16.9 iken, gebelikte bu oran %3.9’dur (ortalama 4 sigara/gün. Kadınların gebelikte beslenme alışkanlıkları iyileşmiştir; öte yandan halen sigara içen gebeler bulunmaktadır ve fiziksel aktivitelerindeki değişimler yetersizdir. Ayrıca kadınlar gebelik ve doğum hakkında bilgi alma gereksinimindedir. Sonuç: Gebe kadınlarda SYBDÖ-II puanı üst-orta seviyededir. Eğitim seviyesi düşük, işsiz ve gebeliğini sonlandırmak isteyen kadınların, sağlıksız davranışlar açısından risk grubunda olduğu belirlenmiştir. Bu bulgular, doğum öncesi kliniklerde çalışan sağlık personeline riskli grubu belirleme açısından ipuçları sunar. Sağlık bakımı sunanların, sağlıklı yaşam biçimi davranışları açısından belirlenen riskli grubu daha dikkatli değerlendirilmesi önerilmektedir.Anahtar Kelimeler: Sağlıklı Yaşam Biçimi Davranışları; gebe kadınlar; Sağlıklı Yaşam Biçimi Davranışları Ölçeği-II

  7. Coincidence scanning with positron-emitting arsenic or copper in the diagnosis of focal intracranial disease; Exploration par coincidences avec l'Arsenic ou le Cuivre Emetteurs de Positrons dans le Diagnostic des Maladies intracraniennes localisees; Raspoznavanie ochagovykh vnutricherepnykh zabolevanij putem podscheta (skanirovaniya) sovpralenij s primeneniem mysh'yaka ili medi, vydelyayushchikh pozitrony; Exploracion por coincidencia con arsenico o cobre emisores de positrones en el diagnostico de enfermedades intracraneanas localizadas

    Energy Technology Data Exchange (ETDEWEB)

    Sweet, William H; Mealey, John Jr; Brownell, Gordon L; Aronow, Saul [Departments of Surgery and Medicine, Harvard Medical School, and Neurosurgical Service and Physics Research Laboratory of Massachusetts General Hospital, Boston, MA (United States)

    1959-07-01

    suficiente para proceder a la reseccion quirurgica, quizas sea esta la contribucion mas importante del metodo hasta la fecha. En cambio, los resultados con tumores subtentoriales fueron menos satisfactorios, pues se fracaso en 23 de 39 casos, es decir en el 59 por ciento. En el grupo de enfermedades benignas, el arsenico permitid localizar 7 de 8 hematomas subdurales, mientras que la exploracion mediante cobre no dio ningun resultado positivo en tres casos. En cuatro casos sobre cinco el empleo del arsenico permitio localizar coagulos intracerebrales diagnosticados. La totalidad de los 10 abscesos estudiados fue diagnosticada mediante el arsenico, y 3 de cada 4 mediante el cobre. En los tres pacientes que sufrian de leucoencefalopatia, la exploracion mediante arsenico indico las zonas principales de desmielinizacion. De 10 pacientes que hablan sido sometidos a un total de 16 exploraciones, y a los que posteriormente se efectuo una craneotomia exploratoria con resultado negative, no hubo mas que dos en los cuales la exploracion (mediante arsenico y cobre respectivamente) habia permitido diagnosticar una anormalidad localizada y bien definida. (author) [Russian] Nastoyashchij doklad posvyashchen podschetu metodom sovpadenij v chelovecheskom organizme parnykh annigilyatsonny kh gamma-luchej, vydelyaemykh pri pozitroniem raspade izotopov medi i mysh'yaka. V nem rassmatrivaets ya biologicheskoe pove denie neorganicheskoj soli mysh'yakovoj i mysh'yakovistoj kisloty ili mednogo versenata, a takzhe rezul'taty ispol'zovaniya veshchestv pri provedenii issledovanij s pomoshch'yu avtomaticheski rabotayushchej apparatury v tselyakh lokalizatsii vnutricherepnykh mass. Radioaktivnost' glavnykh normal'nykh golovnykh tkanej, a takzhe razlichnykh novoobrazovanij , krovyanykh opukholej (gematom), gnojnikov (abstsessov) i zon razrusheniya mielina byla analizirovana metodom biopsii. Pri primenenii mysh'yaka koehffitsient sootnosheniya mezhdu zakhvatom izotopa v mozgovoj opukholi i ego

  8. Tarihi Yeniden Kurma Kuramı: Kılıç Dede Bağlamında Kılıçlar Köyünün Kuruluşu ve Kılıç Dede’nin Efsanevi Kişiliği Historic Restoration Theory: In the Context of Establisment of Kılıçlar Villages and Legendary Personality of Kılıç Dede

    Directory of Open Access Journals (Sweden)

    Gülperi MEZKİT

    2013-03-01

    onlarla mukayese edildiğinde dahaaz tesirli olaylar sözlü tarihin hafızaya dayalı belleğinde muhafazaedilmiştir. Yerel tarih bilgisinin büyük çoğunluğu yazıyageçmemiş/geçememiş ve halkın hafızasına emanet edilmiştir. Bubağlamda, Ankara Çubuk ovasında vuku bulan Ankara Savaşı(1402sırasında Çubuk’a bağlı olan(daha sonra ayrılıp Kazan ilçesinebağlanan Çelençler Köyü’nde(daha sonra adı Kılıçlar olarakdeğiştirilmiştir yaşanan, Yıldırım Bayezid’in esir edilmesinin, halküzerinde yarattığı derin teessürün etkisiyle gölgelenen bir hadiseninyöre halkı tarafından sözlü hafızada saklanarak ve dilden dileaktarılarak korunmuş hikâyesi üzerinde durulacaktır. YıldırımBayezid’in ordusunda yer alan ve şehit düşen Kılıç Dede’nin köykuruculuğu ve etrafında gelişen anlatmaların köyün tarihini yenidenkurmasındaki rolü tartışılacaktır. Gerçekten yaşayan sıradan biraskerin kahramanı olduğu hadisenin ve bu hadise içinde şehitdüşmesinin köylü üzerinde yarattığı etkiler neticesinde efsaneleşmesi,kişiliği etrafında oluşan anlatmalarla bir köyün tarihinin yeniden nasılinşa edildiği mütalaa edilecektir.

  9. A population-based case-cohort study of the risk of myocardial infarction following radiation therapy for breast cancer

    International Nuclear Information System (INIS)

    Paszat, Lawrence F.; Vallis, Katherine A.; Benk, Veronique M.A.; Groome, Patti A.; Mackillop, William J.; Wielgosz, Andreas

    2007-01-01

    Objective: To describe the risk of acute myocardial infarction (AMI) after radiation therapy (RT) for breast cancer (BrCa) in an exposed population. Methods: We identified and validated cases of AMI (vAMI), by electrocardiographic or enzyme criteria, among all 6680 women who received post-operative RT following lumpectomy or mastectomy, within 12 months following diagnosis of BrCa between 1982 and 1988 in Ontario, Canada. We identified women without vAMI whose death certification was ascribed to AMI (dAMI). We abstracted risk factors and treatment exposures for a random sample of women from the 6680, and for all with vAMI or dAMI. The hazards of vAMI and of dAMI were estimated using multivariate Cox proportional hazards models, corrected for study design. Results: We validated 121 cases of vAMI and identified 92 cases of dAMI. The risk of vAMI associated with RT to the left breast HR = 1.96 (1.09, 3.54) among women at age ≥ 60 at time of RT, adjusted for history of smoking and prior MI. The adjusted HR dAMI = 1.90 (1.08, 3.35) for exposure to anterior internal mammary node (IMC) RT. Among women who received anterior left breast boost RT, increasing area of the boost is associated with adjusted HR vAMI = 1.02 (1.00, 1.03)/cm 2 , and adjusted HR dAMI = 1.02 (1.01, 1.03)/cm 2 . Conclusion: The risks of vAMI and dAMI following RT for BrCa are related to anatomic sites of RT (left breast, area of anterior left breast boost field, and anterior IMC field)

  10. Maternal ve fetal MBL2 genotiplerinin preterm doğumlarla ilişkisi

    OpenAIRE

    Taneri, Ayşe

    2009-01-01

    Yenidoğan döneminde, immün sistemin tam olarak gelismemesine bağlı karsılasılan komplikasyonlara ek olarak, yenidoğanın “prematüre” olması prenatal mortalite ve morbidite hızını arttıran baslıca faktördür. Görülme sıklığının %9 olması nedeni ile, günümüz perinatal tıbbının çözmeye çalıstığı ve çevresel, tıbbi ve kalıtsal faktörlerin rol oynadığı çoklu değisimlere bağlı bir yenidoğan sorunudur. Patogenezi aydınlatmaya yönelik yapılan çalısmalarda inflamasyonun gestasyonel sür...

  11. Vizantiiskoje zerkalo. Novõi rossiiski agitprop ili otsherednaja strashilka? / Pavel Kuzenkov ; interv. Sergei Bõtshkov

    Index Scriptorium Estoniae

    Kuzenkov, Pavel

    2008-01-01

    Isa Tihhoni autorlusena valminud Venemaa dokumentaalfilm "Impeeriumi hukk. Bütsantsi õppetunnid" ("Gibel imperii. Uroki Vizantii"). Filmi ideestikust, mis suunatud tänase Venemaa suunas, räägib filmi teaduslik konsultant

  12. Industrija 4.0 - sadašnjost ili budućnost u Hrvatskoj

    OpenAIRE

    Matejak, Nedeljko

    2017-01-01

    Tehnološki razvoj generator je dinamičnih promjena gotovo u svim područjima koje dotiče. Jedno od područja koje prolazi kroz intenzivnu tranziciju je industrijska proizvodnja. U prilog tome govori transformacija iz treće industrijske revolucije u četvrtu, dok zapravo dio globalne ekonomije nije napravio potpunu transformaciju u treću industrijsku revoluciju. Pojam Industrija 4.0 opisuje što se nalazi na putu transformacije postojeće industrijske proizvodnje u novu, primarn...

  13. Planeta Zemlja - matritsa ili nash metafizitsheski dom? / Peeter Liiv ; tõlk. Marina Tervonen

    Index Scriptorium Estoniae

    Liiv, Peeter, 1953-

    2005-01-01

    Metafüüsika nõrkusest Eesti kultuuris. Kannatuse ja rõõmu religioonidest, valgustumisest, "Brahma ööst" ja "Brahma päevast", miks ja kuidas on Jumal maailma loonud. Osho, Ken Wilberi, Maharishi Mahesh Yogi jt. mõtteid

  14. Za vsjo horosheje - finansovaja udavka ili Aleksandr Kaljagin protiv Marinõ Dmitrijevskoi / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2007-01-01

    Vastasseisust Venemaa Teatritegelaste Liidu esimehe Aleksandr Kaljagini ja Peterburi teatriajakirja "Peterburgski teatralnõi zhurnal" peatoimetaja Marina Dmitrijevskaja vahel. Aleksandr Kaljagin ähvardab lõpetada ajakirja finantseerimise

  15. Kak eto nam poljubitsa, ili Ljubov i nenavist Timofeja Sopoleva / Timofei Sopoljov ; interv. Boris Tuch

    Index Scriptorium Estoniae

    Sopoljov, Timofei

    2006-01-01

    William Shakespeare'i "Kuidas teile meeldib", lavastaja Timofei Sopoljov, muusika autor helilooja Aleksei Shelõgin. Lavastaja meenutab ka oma teatriõpinguid lavastaja ja teatripedagoogi Andrei Gontsharovi käe all

  16. Žalovanje ili melankolija?: psihoanaliza i ekonomski problem Derridina marksizma

    OpenAIRE

    Jukić, Tatjana

    2011-01-01

    Autorica predlaže kritičko čitanje studije Sablasti Marxa: stanje duga, rad žalovanja i nova Internacionala Jacquesa Derride s pozicije s koje Derridino dovođenje u vezu žalovanja i Marxove političke ekonomije evidentno računa na spregu žalovanja i ekonomije kod Freuda, posebno u “Trauer und Melancholie”. Kod Freuda se žalovanje i ekonomija sprežu tek nakon što se žalovanje stavi u relaciju prema melankoliji, pri čemu melankolija dovodi u pitanje upravo ono što psihoanaliza ...

  17. Zametjat li v Pekine estonskii flag ili jego otsutstvije? / Viktoria Savtshuk, Susanna Berezina

    Index Scriptorium Estoniae

    Savtshuk, Viktoria

    2008-01-01

    Euroopa Liidu infokeskuses toimunud debatist, kus teemaks oli Pekingi olümpiamängude võimalik boikoteerimine seoses hiljutiste sündmustega Tiibetis. Debatis osalesid Riigikogu Tiibeti toetusrühma liige Silver Meikar ja parlamendiliige ning Eesti Olümpiakomitee asepresident Jüri Tamm

  18. Kventin Tarantino + Robert Rodriges = Grainhaus, ili Kinonostalgija po-amerikanski / Andrei Sozinov

    Index Scriptorium Estoniae

    Sozinov, Andrei

    2007-01-01

    Filmiprojekt "Grindhouse" koosneb Robert Rodrigueze retroõudukast "Grindhouse : Õuduste planeet" ("Planet Terror") ja Quentin Tarantino 70-ndatest inspireeritud õudusfilmist "Surmakindel" ("Death Proof") : Ameerika Ühendriigid 2007

  19. Pipeline mapping and strain assessment using ILI (In-line Inspection) tolls

    Energy Technology Data Exchange (ETDEWEB)

    Purvis, Brian [GE PII Pipeline Solutions, Rio de Janeiro, RJ (Brazil); Huewener, Thomas [E.ON Ruhrgas AG, Essen (Germany)

    2009-07-01

    GE PII IMU Mapping inspection system measures pipeline location coordinates (x, y, z) and provides data for determining pipeline curvature and consequential pipeline bending strain. The changes in strain can be used in the application of structural analyses and integrity evaluation of pipeline systems. This paper reviews the Inertia Measuring Unit (IMU) system and field investigation works performed on a high-pressure gas pipeline for E.ON Ruhrgas AG. The Inertial Measuring Unit of the pipeline inspection tool provides continuous measurement of the pipeline centreline coordinates. More than one inspection run was performed which allowed a more accurate strain comparison to be made. Repeatability is important to establish the reasons for increasing strain values detected at specific pipeline sections through in-line inspection surveys conducted in regular intervals over many years. Moreover, the flexibility resulting from a combination of different sensor technologies, makes it possible to provide a more complete picture of the overall situation. This paper reviews the work involved in detecting, locating and determining the magnitude and type of strain corresponding to the pipeline movement in field. (author)

  20. Negociace čili vyjednávání

    Czech Academy of Sciences Publication Activity Database

    Krausová, Alena

    2001-01-01

    Roč. 38, č. 4 (2001), s. 45-51 ISSN 1212-5326. [Jazyk jako fenomén na přelomu tisíciletí. Setkání mladých jazykovědců /2./. Olomouc, 15.05.2001-16.05.2001] R&D Projects: GA MŠk LN00A023 Institutional research plan: CEZ:AV0Z9061902 Keywords : pragmatics * semantics * neology Subject RIV: AI - Linguistics

  1. Takova zhizn, ili nash tshelovek v Pompidu / Ene Rämmeld ; interv. Boris Tuch

    Index Scriptorium Estoniae

    Rämmeld, Ene, 1947-

    2004-01-01

    Pariisis elav näitlejanna esitles oma autobiograafilist raamatut "C'est la vie. Elu on selline", milles juttu kolmest kunstnikust : L. Laiusest, E. Hermakülast ja V.G. Karassev-Orgussaarest - kuidas nad kõik mõjutasid näitlejanna arengut. Ka oma elust ja elufilosoofiast praegu

  2. Letnii otpusk Barrossu, ili Uravnenije s 25 neizvestnõmi / Marko Saaret

    Index Scriptorium Estoniae

    Saaret, Marko

    2004-01-01

    Euroopa Komisjoni juht Jose Manuel Durao Barroso seisab raske valiku ees - kuidas jagada 25 portfelli 25 esitatud kandidaadi vahel. Liikmesriikide poolt Euroopa Komisjoni voliniku kohale esitatud kandidaadid

  3. Uroki mastera, ili Fantazii na temõ Andersena / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2007-01-01

    Eldar Rjazanovi eluloofilm muinasjutuvestja Hans Christian Anderseni elust "Andersen. Elu ilma armastuseta" ("Andersen. Zhizn bez ljubvi"): stsenarist Irakli Kvirikadze : nimiosas Vanja Haratjan, Stanislav Rjadinski, Sergei Migitsko : Venemaa, 2006

  4. 3D molecular cartography using LC-MS facilitated by Optimus and 'ili software.

    Science.gov (United States)

    Protsyuk, Ivan; Melnik, Alexey V; Nothias, Louis-Felix; Rappez, Luca; Phapale, Prasad; Aksenov, Alexander A; Bouslimani, Amina; Ryazanov, Sergey; Dorrestein, Pieter C; Alexandrov, Theodore

    2018-01-01

    Our skin, our belongings, the world surrounding us, and the environment we live in are covered with molecular traces. Detecting and characterizing these molecular traces is necessary to understand the environmental impact on human health and disease, and to decipher complex molecular interactions between humans and other species, particularly microbiota. We recently introduced 3D molecular cartography for mapping small organic molecules (including metabolites, lipids, and environmental molecules) found on various surfaces, including the human body. Here, we provide a protocol and open-source software for 3D molecular cartography. The protocol includes step-by-step procedures for sample collection and processing, liquid chromatography-mass spectrometry (LC-MS)-based metabolomics, quality control (QC), molecular identification using MS/MS, data processing, and visualization with 3D models of the sampled environment. The LC-MS method was optimized for a broad range of small organic molecules. We enable scientists to reproduce our previously obtained results, and illustrate the broad utility of our approach with molecular maps of a rosemary plant and an ATM keypad after a PIN code was entered. To promote reproducibility, we introduce cartographical snapshots: files that describe a particular map and visualization settings, and that can be shared and loaded to reproduce the visualization. The protocol enables molecular cartography to be performed in any mass spectrometry laboratory and, in principle, for any spatially mapped data. We anticipate applications, in particular, in medicine, ecology, agriculture, biotechnology, and forensics. The protocol takes 78 h for a molecular map of 100 spots, excluding the reagent setup.

  5. Radiation-pulse transmission via a long cable without a preamplifier and/or a pulse transformer; Transmission d'impulsions de rayonnement par cable long sans l'adjonction d'un preamplificateur ou d'un transformateur d'impulsions; Peredacha impul'snykh izluchenij no kabelyu na dal'nie rasstoyaniya bez predvaritel'nogo usileniya i/ili bez preobrazovaniya impul'sov; Transmision de impulsos por cables de gran longitud sin preamplificador y/o transformador de impulsos

    Energy Technology Data Exchange (ETDEWEB)

    Miwa, H; Tohyama, T [Kobe Kogyo Corporation, Okubo, Akashi, Hyogo (Japan)

    1962-04-15

    kompleksnoe soprotivlenie usilitelya No. 2 budet sootvetstvovat' kharakteristike kabelya pri pomoshchi vklyuchennogo kompleksnogo i menyayushchegosya soprotivleniya. Takim obrazom, ustrojstvo vida No. 2 bylo v shirokoj mere prisposobleno k nashemu yadernomu pribornomu oborudovaniyu, kak naprimer k nejtronnomu izmeritelyu vlazhnosti pochvy (schetchik BF{sub 3}) analizatoru sostava pochvy (stsintillyatsionnyj spektrometr), tolshchinomeru snega (schetchik Gejgera-Myullera) i distantsionnym kontrol'nym dozimetricheskim priboram. Otsutstvie predvaritel'nykh usilitelej i preobrazovatelej impul'sov delaet vozmozhnym primenenie ehtikh detektorov na mestnosti v osobykh usloviyakh, kak naprimer, pri vysokikh ili nizkikh temperaturakh, bystrom potoke nejtronov (gamma-izluchenij) i t.d. Nalichie tol'ko odnogo koaksial'nogo kabelya uproshchaet rabotu detektorov na dal'nem rasstoyanii. Peredacha impul'sov po kabelyu na dal'nie rasstoyaniya svyshe 500 metrov ne povliyala na stsintillyatsionnuyu spektroskopiyu gamma-izluchenij. (author)

  6. A Study to Develop a Case Mix Model for the Allocation of Impatient Workload for Silas B. Hays Army Community Hospital Fort Ord, California

    Science.gov (United States)

    1987-06-26

    Development Research Department, World Bank, Washington, D.C. Evans, R.G. and H.D. Walker (1972). Information theory and the analysis of hospital cost...system. Medical Care 14: 185-201. Horn, S.D. and D.N. Schumacher (1979). An analysis of case mix complexity using information theory and diagnosis...REL UGT 459 HA 1 1.0 RETINAL PROCEDURES 0.7101 460 HA 3 1.0 OTHER DISORDERS OF JHE EYE AGE 0-17 0.4018 460 HB 7 2.4 T & A PROC EXCEPT TONSILLECTOMY

  7. Using climate-soil-socioeconomic parameters for a drought vulnerability assessment in a semi-arid region: Application at the region of El Hodna, (M’sila, Algeria

    Directory of Open Access Journals (Sweden)

    Boultif Meriem

    2017-01-01

    Full Text Available The objective of this study is to contribute in assessing and monitoring drought’s vulnerability by developing a GIS-based model to determine vulnerable areas to this natural hazard; the model utilizes a series of agricultural, statistical, meteorological and remotely sensed data, using GIS weighed ponderation and multicriteria analysis decision making, with the integration of three components: climatic sensibility, soil sensibility and socioeconomic sensibility. The result is a vulnerability map classified into five classes according to pixel values. Very Vulnerable class forms 19.46% of the study area, vulnerable class forms 32.81% and 21.37% of the area is not vulnerable, the study presents a modeling procedure of which the final results provide to researchers, users and decision makers important information on the environmental situation of the study area, for better prediction, and risk management.

  8. "Oceživat' komara" ili "proglatyvat' verbljada"?  Biblejskie frazeologizmy v russkom i datskom jazykach

    DEFF Research Database (Denmark)

    Steen, Oxana

    2007-01-01

    I artiklen præsenteres en model for en kontrastiv analyse af fraseologiske udtryk i to forskellige sprog (russisk og dansk). Modellen indeholder 8 niveauer og starter med niveau 0 (fuldstændig isomorfi; fuldstændig ækvivalens) og slutter med niveau 7 (ækvivalentsløse idiomer). De mellemste niveauer...... udgør russiske og danske idiomer, som udviser forskellige grader afvigelser af strukturel og/eller semantisk karakter....

  9. Biti ili ne biti žena? Percepcija visokoobrazovanih žena o rodnoj jednakosti na radnom mjestu

    OpenAIRE

    Pološki Vokić, Nina; Sinčić Ćorić, Dubravka; Obadić, Alka

    2017-01-01

    Polazišna točka rada je da visokoobrazovane žene trpe manje nejednakosti na radnom mjestu. Kako bismo to testirali, provedena su primarna i sekundarna istraživanja. Sekundarni podatci odnose se na područje obrazovanja, sudjelovanje u aktivnostima koje se temelje na znanju, statusu u hijerarhiji i razlici u plaćama visokoobrazovanih žena u odnosu na plaće muškaraca u odabranim europskim zemljama, dok primarni podatci prikazuju percepcije visokoobrazovanih žena o kontekstualnim čimbenicima koji...

  10. Leadership as social identity management: Introducing the Identity Leadership Inventory (ILI) to assess and validate a four-dimensional model

    OpenAIRE

    Steffens, Niklas K.; Haslam, S. Alexander; Reicher, Stephen D.; Platow, Michael J.; Fransen, Katrien; Yang, Jie; Ryan, Michelle K.; Jetten, Jolanda; Peters, Kim O.; Boen, Filip

    2014-01-01

    Although nearly two decades of research has provided support for the social identity approach to leadership, most previous work has focused on leaders’ identity prototypicality while neglecting the assessment of other equally important dimensions of social identity management. However, recent theoretical developments have argued that in order to mobilize and direct followers’ energies, leaders need not only to ‘be one of us’ (identity prototypicality), but also to ‘do it for us’ (identity adv...

  11. Influenza in outpatient ILI case-patients in national hospital-based surveillance, Bangladesh, 2007-2008.

    Directory of Open Access Journals (Sweden)

    Rashid Uz Zaman

    2009-12-01

    Full Text Available Recent population-based estimates in a Dhaka low-income community suggest that influenza was prevalent among children. To explore the epidemiology and seasonality of influenza throughout the country and among all age groups, we established nationally representative hospital-based surveillance necessary to guide influenza prevention and control efforts.We conducted influenza-like illness and severe acute respiratory illness sentinel surveillance in 12 hospitals across Bangladesh during May 2007-December 2008. We collected specimens from 3,699 patients, 385 (10% which were influenza positive by real time RT-PCR. Among the sample-positive patients, 192 (51% were type A and 188 (49% were type B. Hemagglutinin subtyping of type A viruses detected 137 (71% A/H1 and 55 (29% A/H3, but no A/H5 or other novel influenza strains. The frequency of influenza cases was highest among children aged under 5 years (44%, while the proportions of laboratory confirmed cases was highest among participants aged 11-15 (18%. We applied kriging, a geo-statistical technique, to explore the spatial and temporal spread of influenza and found that, during 2008, influenza was first identified in large port cities and then gradually spread to other parts of the country. We identified a distinct influenza peak during the rainy season (May-September.Our surveillance data confirms that influenza is prevalent throughout Bangladesh, affecting a wide range of ages and causing considerable morbidity and hospital care. A unimodal influenza seasonality may allow Bangladesh to time annual influenza prevention messages and vaccination campaigns to reduce the national influenza burden. To scale-up such national interventions, we need to quantify the national rates of influenza and the economic burden associated with this disease through further studies.

  12. Türkiye’de Enflasyon nisbi Fiyat Değişkenliği ilişkisi

    OpenAIRE

    YAMAK, Prof. Dr. Nebiye; TANRIÖVER, Arş. Gör. Banu

    2013-01-01

    In the literature of economics the hypothesis which implies the positive relationship between inflation rate and relative price variability is called the variability hypothesis The purpose of this study is to investigate the validity of the variability hypothesis separately for each one of the expenditure groups and cities in Turkey Relative price variability for each of the expenditure groups and cities is constructed by using the consumer price index of ten expenditure groups in nineteen...

  13. Delo o 15 millionah dollarov, ili Istorija s kontrabandoi, krazhami, obmanom i podozrenijem v ubiistve / Tatjana Jurassova

    Index Scriptorium Estoniae

    Jurassova, Tatjana

    1998-01-01

    Nikolai Hardzhijevi (1903-1996) arhiivi saatusest. Arhiivi kunsti-osa moodustasid Malevitshi, Larionovi, Tatlini, Gontsharovi, Lissitski jt. (1355 eks.) tööd. N. Hardzhijev oli teadlane, vene avangardi (kunstnikud, poeedid) parim tundja

  14. OBRTNIČKE ILI UMJETNIČKE DEKORACIJE ANTIČKIH JAVNIH SPOMENIKA GRADA PULE? SLAVOLUK SERGIJEVACA

    OpenAIRE

    DŽIN, Kristina

    2010-01-01

    U izboru antičkih javnih spomenika Pule (Colonia Iulia Pola) iz carskog Augustovog vremena, posebna pozornost se u članku daje slavoluku obitelji Sergijevaca, jednom od najljepših djela antičkog kamenoklesarstva i dometa dekorativnih elemenata izrađenih izuzetnim obrtničkim umijećem pod utjecajem helenističke umjetnosti.

  15. Relationships between vertical and horizontal individualism/collectivism self construal’s and autonomous, relatedness, autonomous-related self at university studentÜniversite öğrencilerinde benlik kurguları, yatay ve dikey bireycilik/toplulukçuluk ile ilişkisel, özerk, özerk-ilişkisel benlik arasındaki ilişkiler

    OpenAIRE

    Uçar, Mehmet Ertuğrul

    2017-01-01

    Most of the relevant research and conceptualization has occurred within individualism-collectivism. Kagitcibasi suggests that self can be defined as autonomous, relatedness, and autonomous-related self in Turkish cultural contexts. Triandis make the distinction between vertical and horizontal individualism/collectivism.  Vertical collectivism includes perceiving the self as a part of a collective and accepting inequality. Horizontal collectivism includes perceiving the self as a part of the c...

  16. Asia Beyond the Border: Physical Geography - Central and Northeastern Asia -

    Science.gov (United States)

    1961-03-21

    Shan: the kiang species ( Equus hemionus kiang). Forest hoofed animals are characteristic only for the western and northern mountain groups which are...severe winter olinate or its hot suremers» ’ „ ,, . •The Hwang Ho has a bread a»4>in S»*** a low vamy «»«»S tee sand and alluvial desert

  17. Etičeskaja «dyra» v centre naučnoj paradigmy «publikujsja ili umri»

    Czech Academy of Sciences Publication Activity Database

    Kravjar, J.; Hladík, Marek

    2016-01-01

    Roč. 2016, č. 1 (2016), s. 29-31 ISSN 1994-2443 Institutional support: RVO:68081758 Keywords : academic publishing * publishing ethics * predatory publishing * scientists * publishers * open access * evaluation of science Subject RIV: AF - Documentation, Librarianship, Information Studies OBOR OECD: Information science (social aspects)

  18. Energy efficiency: Reality or just the wish? What should Croatia do?; Energetska efikasnost: Stvarnost ili samo zelja? Sto Hrvatska treba uciniti?

    Energy Technology Data Exchange (ETDEWEB)

    Granic, G [Energetski institut Hrvoje Pozar, Zagreb (Croatia)

    1997-12-31

    During work the problem of efficiency has been analysed as a part of sustainable development and environment protection strategy. Interrelations within the complex procedure of setting an organised energy sector in which the energy efficiency will be one of the fundamental tasks, have been worked out. Based on the experience of European Union countries the model for Croatia has been made. The activities, institution and steps necessary to be taken in order to start the process of efficient energy management as permanent care of all those who are in any way included in energy sector, have been recognised. (author). 2 tabs., 4 figs., 5 refs.

  19. Tko su za nas Turci / Osmanlije? Ili kako su predstavljeni u hrvatskim udžbenicima povijesti i sintezama / pregledima hrvatske povijesti

    Directory of Open Access Journals (Sweden)

    Damir Agičić

    2015-08-01

    Turcy osmańscy w późnym średniowieczu i wczesnej epoce nowożytnej mieli istotny wpływ na historię Europy, w tym także na historię Chorwacji. Zarówno w podręcznikach, jak w poddanych analizie syntezach historii Chorwacji widoczne są dwie przeciwstawne wizje stosunków turecko-chorwackich, jak zresztą i innych momentów narodowej historii: pierwsza, etnocentryczna, wyolbrzymia własną przeszłość i charakteryzuje się w wielu miejscach nietolerancją w stosunku do innych, szczególnie sąsiadów, druga natomiast jest bardziej nowoczesna, otwarta i wyważona. W artykule wymienione są przykłady, które wizje te potwierdzają.

  20. Litva na puti k jenergeticheskoj samostojatel'nosti: opyt ili uroki? [Lithuania on the way to energy independence: an experience or a lesson?

    Directory of Open Access Journals (Sweden)

    Kretinin Gannady

    2010-01-01

    Full Text Available The article considers the steps taken by Lithuania towards gaining energy independence in the interbellum and the Soviet periods. The author analyses the peculiarities of the republic's energy policy after achieving independence in the early 1990s and estimates the methods of diversifying energy supply in Lithuania.

  1. Medyanın profesyonellik ideolojisi ve toplumsal çevresi ile olan ilişkisi üzerine sosyolojik bir değerlendirme

    OpenAIRE

    Ali Arslan

    2006-01-01

    Media Professional Ethics & A Sociological Evaluation on the Relationship Between the Media and Its SocialEnvironmentThere are two opposing ideas about the influence of media: media are “passive transmitters” or “activeinterveners” in the shaping of messages. According to pluralist approach, media professionals behave in accordancewith their ideology. Pluralists also presume that ultimate control of the production process in the media is on the handsof the media pr...

  2. Yeni bir TSH reseptör aktive edici mutasyon ile ilişkili ailevi hipertiroidi: Beş vaka takdimi

    NARCIS (Netherlands)

    K. Demir (Korcan); Tunç, S. (Selma); A.A.A. van Mullem (Alies); T.J. Visser (Theo)

    2015-01-01

    textabstractFamilial non-autoimmune hyperthyroidism, a rare disorder that results from activating germline mutations in the TSH receptor gene, is inherited in an autosomal dominant fashion and has a variable age at onset. Here, we present a family, five members of which were determined to have

  3. Türkiye’deki iç Denetim Profilinin Belirlenmesine ilişkin Bir Araştırma

    OpenAIRE

    MEMİŞ, Arş. Gör. Dr. Mehmet Ünsal

    2013-01-01

    In recent year internal auditing has been taken into account more importantantly because of some company failures and bankrupcies such as seen in giant firms Enron Worldcom and Parmalat Accordingly by the help of efficient working internal auditing system the flaws of the firms may be predetermined and necessary precuations may be held to prevent the failures Owing to the vital importance of internal auditing for the firms the internal auditing profile in Turkey has been evaluated Key...

  4. Sakyamuni Buda'nın Tarihsel Kişiliği Ve Öğretisinin Yeni Bir Din Haline Geliş Süreci

    Directory of Open Access Journals (Sweden)

    Hüsamettin Karataş

    2013-06-01

    Full Text Available Sakyamuni Buda, Hindu kast sistemindeki yönetici sınıfa mensup bir prenstir. O, yaşadığı bir takım hayat tecrübelerinden hareketle, var olan anlayışların yetersiz olduğunu düşünerek kendi gerçeğinin peşine düşmüş tarihsel bir şahsiyettir. Sakyamuni Buda, çeşitli yollar deneyerek sonunda mutlak kurtuluşa erdiğini, yani aydınlandığını iddia eden bir din kurucusudur. Onun kurduğu dinî ve felsefi sistemin adı Budizm'dir. Budizm, ortaya çıktığı dönemdeki politeist yapıya, aşırı çileci veya hazcı ahlak ilkelerine, kurtuluş yolunun formalitelerine ve kast sistemine tepki göstermiştir. Bunun yanı sıra var olmaya çalıştığı bölgedeki dinlerin en belirgin özelliklerini de bünyesinde barındırmış, bazı öğreti ve uygulamaları aynen sürdürmüş, kültürel ve toplumsal hayata dair konularda ise devamlı surette esnek bir yol takip etmiştir. Budizm uzun tarihsel süreç içerisinde dünyanın çok farklı bölgelerine yayılmış ve günümüzün en çok taraftara sahip dinlerden biri haline gelmiştir

  5. Maliyet liderliği stratejisi, toplam kalite yönetimi uygulamaları ve finansal performans ilişkisi

    OpenAIRE

    Kurt, Ali; Zehir, Cemal

    2016-01-01

    Firms need to implement some competition strategies and total quality management applications to overcome the fierce competition among others. The purpose of this study is to show the relationship between cost leadership strategy, total quality management applications and firms’ financial performance with literature review and empirical analysis. 449 questionnaires were conducted to the managers of 142 big firms. The data gathered was assessed with AMOS. As a result, the relationship between ...

  6. Çocuklarda görülen ayak deformitelerinin hérédité ile ilişkisi

    OpenAIRE

    SARI, Fzt.Zübeyir; OTMAN, Fzt.A. Saadet; AKMAN, Dr.M.Nafİz

    2015-01-01

    Ayak deformiteleri, çocukluk çağında en sık görülen kas-iskelet patolojilerinden birisidir. Erken tam ve tedavi, gelişebilecek daha ciddi problemleri önlemek için büyük önem taşır. Çalışmamız, basit tesadüfi örnekleme yöntemi ile seçilen 221 öğrenci ve bunların yakın akrabalarından oluşan toplam 1105 olgu üzerinde gerçekleştirilmiştir. Çalışmamıza Nörolojik kökenli ve kas kuvvet dengesizliğinden kaynaklanan ayak deformitelerine sahip olgular dahil edilmemiştir. Yapılan istatistiksel incelemel...

  7. The biggest stone anchors (Indo-Arab type) from Mithi Virdi, Bhavnagar, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Gaur, A.S.; Sundaresh; Kumar, B.

    of Oceanography, Goa on the Saurashtra coast have been undertaken at Dwarka (Gaur et al. 2000), Bet Dwarka (Sundaresh et al. 2002) and Somnath {Gaur et al. 2002). The prospections *National Institute of Oceanography, Dona Paula, Goa **Devli, Talaza, Bhavnagar... of stone anchors at Dwarka, Bet Dwarka, Aramda (Gaur et al. 2003), Somnath (Gaur ef al. 2002), Vijayadurg (Sila ef al. 1998), Sindhudurg (Sila and Gaur 1997), Goa waters (Sila et al. 2003) and Tamilnadu coast (Athiyaman 2001). These anchors...

  8. A Study to Determine the Ambulatory Quality Assurance Impact of a Computer-Stored Medical Records System Upon the Family Practice Clinic, Silas B. Hays Army Community Hospital, Fort Ord, California

    Science.gov (United States)

    1982-08-01

    clinical outcome measures will be required. h. Data should be available only to those having a legal right of access. The entire information system must...TOTAL DKN5NAME 22 QHA2NANE 22 PHAlNAME 22 PALPITATIONS 21 IRRIT BOWEL SYNDR OR INTE 21 HX OF ALLERGY TO MEDICINA 20 MALIG NEOPL OASTROrNTESTI 20 ACNE

  9. Commande floue adaptative directe stable étendue appliquée à la ...

    African Journals Online (AJOL)

    Administrateur

    Commande floue adaptative directe stable étendue appliquée à la machine asynchrone. Stable direct adaptive fuzzy control extended applied to the asynchronous machine. Malika Fodil. 1. , Said Barkat. 1 et Djamel Boukhetala. 2. 1Université de M'sila, BP 166, rue Ichbillia, M'sila, Algérie. 2Laboratoire de Commande des ...

  10. Single-incision laparoscopic appendectomy using homemade glove port at low cost

    Directory of Open Access Journals (Sweden)

    Sang Myoung Lee

    2016-01-01

    Full Text Available Purpose: The aim of this study was to report homemade glove port technique for single-incision laparoscopic appendectomy (SILA. Materials and Methods: Our homemade glove port was composed of a size 6 latex sterile surgical glove, a sterilized plastic bangle, and three pieces of silicon tube (5 cm in length that were used as the suction tube. Clinical data were retrospectively collected from those patients who underwent SILA at Bucheon St. Mary's Hospital, Bucheon, Gyeonggi-do, South Korea between February 2014 and June 2014, including patient demographics, and operative and postoperative outcomes. To compare the outcomes, a retrospective review was performed for those patients who underwent conventional laparoscopic appendectomy (CLA between October 2013 and January 2014. Both SILA and CLA were performed by the same surgical team. Results: The SILA and CLA groups included 37 and 57 patients, respectively. The mean age, weight, body mass index (BMI, operation time, and pathologic diagnosis of gangrenous appendicitis were not significantly different between the two groups. However, the mean hospital stay in the CLA group was significantly (P = 0.018 longer than that in the SILA group (4.2 days vs 3.5 days. There was no conversion to open surgery in both the groups. Of the cases who underwent SILA, 10 (27.0% needed insertion of additional port and drain. There was one (3.2% complication of umbilical surgical site infection. Conclusion: In this study, SILA, with homemade glove port, was technically feasible and safe at low cost.

  11. Examining Secondary School Students' Safe Computer and Internet Usage Awareness: An Example from Bartin Province=Lise Ögrencilerinin Güvenli Bilgisayar ve Internet Kullanim Farkindaliklarinin Incelenmesi: Bartin Ili Örnegi

    Science.gov (United States)

    Yilmaz, Ramazan; Karaoglan Yilmaz, F. Gizem; Özturk, H. Tugba; Karademir, Tugra

    2017-01-01

    Information and Communication Technologies (ICT) have been rapidly prevailed among the children and youths. Personal technologies facilitating the students to gain some learning experiences both in and out of the schools also include many threats. It is important for students to have high awareness of safe internet and computer use to overcome…

  12. Sosyal Ağlarda Eğlence Faktörü Kullanımının Marka Kişiliğine Etkisi: Starbucks Türkiye Örneği

    OpenAIRE

    Kale, Gözde Öymen

    2016-01-01

    Teknolojik alanda yaşanan gelişmeler her alanda olduğu gibi eğlence endüstrisinde de çok çeşitli değişimlere yol açmaktadır. Bu çalışmada geniş bir uygulama alanına sahip eğlence endüstrisi, sosyal medyada kullanımı itibarıyla ele alınmaktadır. Bu bağlamda, yaratıcı görseller kullanarak kendini ifade etme ve iletişim kurmaya yardımcı olmaya yarayan bir sosyal medya aracı olan Instagram, Starbucks Türkiye hesabında bulunan fotoğraflar aracılığıyla analiz edilmiştir. Öncelikle fotoğraflar Ginsb...

  13. Yenilikçiliğe Yönelik Devlet Uygulamaları ve AB Karşılaştırması(Government Applications Towards Innovation and Comparison with European Union

    Directory of Open Access Journals (Sweden)

    Bernur AÇIKGÖZ ERSOY

    2008-01-01

    Full Text Available Innovation which includes all processes activating new or improved products, services, systems or programs is considered a fundamental component of entrepreneurship and business success. Innovation has been widely recognized as the key driver of economic growth and sustainable development. So, in many countries, firstly the developed ones, innovation became a focus element to governmental policies. Enabling the appropriate conditions needed for innovation In line of these policies became one of the most important missions of the governments. This paper aims to show the innovation profile of Turkey, basing on EU countries’ progresses and to bring up a road map to make a progress.

  14. Historizace devadesátých let. Když je v dokumentech něco jiného, než jsme zažili

    Czech Academy of Sciences Publication Activity Database

    Gjuričová, Adéla

    2018-01-01

    Roč. 34, č. 2 (2018), s. 25-28 ISSN 1211-9938 Institutional support: RVO:68378114 Keywords : Czech poiltics in the 1990s * history and memory Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  15. Servikal nöral foraminal bölge ve uncinate çıkıntının embriolojik gelişimi ve anatomisinin klinikle ilişkilendirilmesi

    OpenAIRE

    BROHİ, Recep Ali

    2012-01-01

    Servikal bölge ile ilgili yapılan anatomik ve morfometrik çalışmaların büyük çoğunluğunda erişkin kadavra ve kemikleri kullanılmıştır. Servikal bölgenin ve bu bölge ile patolojilerde önemli rol oynayan uncinate proses ve servikal nöral foramen ile ilgili çalışmalar literatürde bulunsa da bu iki yapının embriolojik gelişimi yeterin...

  16. Al-Isyârât al-Kauniyyah fi al-Hurûf al-Muqatha’ah Awâili al-Suwar ‘Inda Thanthawi Jauhari

    Directory of Open Access Journals (Sweden)

    Ilham Habibullah

    2017-07-01

    Full Text Available Muslim scholars have different views about the meaning and interpretation of the letters of Muqatha'ah in the Qur'an. This issue also received special attention from the orientalists, as they saw that the letters of Muqatha'ah belonged to the deficiency of the Qur'an. According to Thanthawi Jauhari the different views among Muslim scholars includes three points: first, the letters need not be interpreted because the real meaning of Muqotha’ah is only Allah knows (Mutasyâbihât; second, the letters have related meaning to Asma Allah SWT or related to the names of surah in al- Qur'an; third, the letters are codes containing messages to read the Greatness of Allah SWT in this universe. That is the reason why according to Thanthawi "alif lâm mîm" has a close correlation with "alam taro", that alif lâm and mîm lead to verses that read "alam" which are both derived from the lâm and mîm alif letters. This paper discusses about the third point, which is exploring the meanings of the letters of Muqhata'ah that related to this universe according to Thanthawi Jauhari. Namely all the verses that discuss about alam (nature, such as geography and astrology referring to "alif lâm mîm". Thanthawi tries to bring his interpretation to the current reality, that the letters of muqhata'ah are symbols of all modern science, such as psychology, military, organization and political science. But of course Thanthawi is very observant and careful in relating the verse that according to the Muslim scholars are included in the mutasyâbihât discussion, so Thantawi always tries to provide clear evidence. But Thanthawi insists that the verses in the Qur'an have a very dominant scientific message or Isyârât.

  17. Phylogenetic Analysis of C Type Lectin from Toxocara canis Infective Larvae and Comparison with the C Type Lectin Fam-ily in the Immune System of Mouse and Human

    Directory of Open Access Journals (Sweden)

    Fazeleh ETEBAR

    2018-03-01

    Full Text Available Background: C type lectin (CTL family is a type of calcium-dependent proteins found in vertebrates and invertebrates. The objective of this study was to perform a comparative analysis and phylogenetic inferring for understanding the similarities and differences of carbohydrate recognition domain (CRD domain of Toxocara canis CTL and other nematodes, and similar C type lectin involved in the immune system of mouse and human as their host.Methods: The female T. canis was retrieved from the 2-6 months puppies (Department of Parasitology, Faculty of Veterinary Medicine, University of Tehran, 2015. To collect T. canis eggs, the worms were cultured for 5 d until they were embryonated. The hatching process was accelerated for collecting the stage 2 larvae, and the larvae were cultured for a week. A cDNA library was made from the total mRNA of T. canis infective larvae. The PCR amplification for C type lectin gene was performed and the amino acids were analyzed using the alignment method and the construction of phylogenetic tree.Results: The suspension sample maintained at 30 ºC for four weeks could embryonate 90%-100% of eggs. T. canis CTL gene was 657 bp in length and encoded a protein with 219 amino acids. The CTL of species of Strongylida order were closely placed in the tree, whereas the members of Ascaridida orders were located in a separate branch. High levels of similarity (36%-44% and conservation of C type lectin from T. canis with mouse and human C type lectins. Its C type lectin showed a higher similarity with asialoglycoprotein receptor (ASGPR, macrophage lectin, dendritic cell-specific intercellular adhesion molecule 3-grabbing nonintegrin (DC-SIGN, MINCLE receptor of mouse and human.Conclusion: Analysis of CRD domain of C type lectin protein could make a better understanding of their role in the interaction of nematode parasite with their hosts.

  18. Transobturator tape operasyonu sonrası ağrılı ilişki, benzer semptomları ancak farklı yönetimleri olan iki vakanın sunumu

    OpenAIRE

    Selçuk, İlker; Boyraz, Gökhan; Tuncer, Selçuk

    2014-01-01

    The risk of stress urinary incontinence (SUI) is tremendously increasing in adult females. Midurethral slings (MUS) are the preferred way of treatment for SUI. Transobturator tape (TOT) and transvaginal tape (TVT) operations are the types of MUS procedures and they can be performed with high success rates. Dyspareunia, pain, mesh exposure and vaginal erosion, infection and voiding dysfunction are all possible complications of synthetic slings. Mesh exposure and erosion is the greatest reason ...

  19. Seyahat acentelerinde örgüt kültürü ve liderlik arasındaki ilişki: Kuşadası bölgesinde bir araştırma

    OpenAIRE

    TÜTÜNCÜ, Özkan; AKGÜNDÜZ, Yılmaz

    2012-01-01

    The purpose of this study is to reveal the relationship between the organizational culture and leadership in travel agencies. In order to achieve this goal, a survey that contains the measure of organizational culture adapted from that of Deshpande et al. by Ogbonna and Harris and the measure of perceived leadership style adapted from that of House and House and Dessler by Ogbonna and Harris. The organization culture of each travel agency and leadership styles of managers were measured by thi...

  20. "Od toho dne, kdy jsme ruku v ruce vykročili do zasněžených ulic Leningradu". Dopisy Magdy N. Ivanu Málkovi z let 1951-1970

    Czech Academy of Sciences Publication Activity Database

    Franc, Martin

    2009-01-01

    Roč. 2, č. 2 (2009), s. 125-140 ISSN 1803-411X R&D Projects: GA AV ČR KJB800770701 Institutional research plan: CEZ:AV0Z80770509 Keywords : Málek, Ivan * history of science Subject RIV: AB - History

    1. Journal of Agriculture, Science and Technology - Vol 16, No 2 (2014)

      African Journals Online (AJOL)

      Production and characterization of wine from mango fruit (Mangifera indica) varieties in Kenya · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. SM Musyimi, DN Sila, EM Okoth, CA Onyango, FM Mathooko, 3-19 ...

    2. Uporaba službenih psov za različne namene delovnih procesov

      OpenAIRE

      Rejc, Sara

      2017-01-01

      Pred vami se nahaja diplomsko delo z naslovom Uporaba službenih psov za različne namene delovnih procesov. Glavni namen in cilj diplomskega dela je proučiti in opisati uporabo službenega psa, predvsem v policiji, vojski in zaporih, kar predstavlja jedro tega diplomskega dela. Želeli smo prikazati vsestransko uporabnost psov v svetu ljudi. Ugotovili smo, da je enota reševalnih psov pomemben del ekipe pri iskanju pogrešanih in poškodovanih oseb. Na tem mestu je podrobneje opisano šolanje psa in...

    3. È realmente esistita una polemica tra Arcesilao e la scuola epicurea? A-t-il vraiment existé une polémique entre Arcésilas et l'école épicurienne ? Did really exist any controversy between Arcesilaus and the Epicurean school?

      Directory of Open Access Journals (Sweden)

      Aurora Corti

      2013-05-01

      Full Text Available The purpose of this work is to attempt a reconstruction of the debate that existed between the Epicurean school and the Sceptic Academy in the 3rd century BC. At issue is a consideration of a section of Plutarch’s Against Colotes (1121E-1122F, which is a particularly important witness in favor of the actual existence of such a debate. The paper focuses not so much on the questions relevant such a debate – which are touched on here, but which themselves have an ample bibliography – but rather on the properly historiographical aspects, such as the identification of the beginner of the polemic or the reasons that brought it about. In reply to these inquiries it is possible to show that the originality of Colotes’ thought deserves much more serious consideration, also because Colotes played an important role within Epicureanism precisely as the originator of anti-Sceptic polemic.L’objet de cette étude est de chercher à reconstruire le débat entre l’école épicurienne et l’Académie sceptique au IIIe siècle avant J.-C. On examinera une section de l’Adversus Colotem de Plutarque (1121E-1122F, qui se présente comme un témoignage particulièrement significatif en faveur de l’existence effective d’un tel débat. On se concentrera non pas tant sur les questions qui sont en jeu – questions auxquelles on fera quelques allusions, mais sur lesquelles il existe déjà une vaste littérature –, que sur des aspects proprement historiographiques : de l’identification du promoteur de cette polémique aux raisons qui l’ont fait naître. En répondant à ces questions, on sera en mesure de montrer que l’originalité de la pensée de Colotès mérite d’être mieux mise en valeur, car Colotès a joué un rôle particulier au sein de l’épicurisme comme initiateur de la polémique anti-sceptique.Lo scopo del presente lavoro è cercare di ricostruire il dibattito intercorso tra la scuola epicurea e l’Accademia scettica nel III secolo a.C. Si prenderà in esame una sezione dell’Adversus Colotem plutarcheo (1121E-1122F, che si presenta come una testimonianza particolarmente significativa a favore dell’effettiva esistenza di tale dibattito. Si concentrerà l’attenzione non tanto sulle questioni in gioco in tale dibattito – alle quali si faranno alcuni accenni, ma su cui esiste un’ampia letteratura – quanto piuttosto su aspetti propriamente storiografici: dall’individuare il promotore di tale polemica alle ragioni che la fecero nascere. Rispondendo a questi quesiti sarà possibile mostrare che l’originalità del pensiero di Colote merita di essere maggiormente valorizzata, anche perché Colote svolse all’interno dell’Epicureismo un ruolo importante proprio come iniziatore della polemica antiscettica.

    4. Single-Incision Versus Three-Port Laparoscopic Appendectomy: Short- and Long-Term Outcomes.

      Science.gov (United States)

      Vellei, Samatha; Borri, Alessandro

      2017-08-01

      To compare the outcome of patients who had undergone single-incision laparoscopic appendectomy (SILA) with others who had undergone three-port laparoscopic appendectomy (3-PORT). Data from all adults with uncomplicated appendicitis treated by laparoscopic appendectomy between June 2012 and December 2015 were prospectively collected. Patients with chronic pain, appendix malignancy, at least two previous laparotomies, and those undergoing concomitant surgery for different condition were excluded from analysis. Postoperative pain was assessed by a visual analog scale (VAS). Patients were reviewed postoperatively at 7 days and 1 month in the outpatient clinic. Late complications were assessed with a telephonic interview. A total of 91 patients were included (46 SILA; 45 3-PORT). There were 16 males and 30 females in the SILA group (mean age = 26.76 ± 10.58 years) and 18 males and 27 females in the 3-PORT group (mean age = 26.84 ± 10.79 years). The mean operative time for SILA was 48.54 ± 12.80 min, for the 3-PORT group the mean operative time was 46.33 ± 15.54 min (P = 0.46). No case required conversion. Mean postoperative hospital length of stay was 1.87 ± 0.69 days for SILA and 2.38 ± 1.11 days for 3-PORT (P = 0.01). VAS value of 3.91 ± 1.96 and mean ketorolac usage of 0.38 ± 0.65 in 3-PORT group and SILA patients reported 3.70 ± 1.58 and 0.39 ± 0.58, respectively (P = 0.91). Our mean follow-up in SILA group was 25.75 ± 10.82 months, for 3-PORT group the mean follow-up was 26.9 ± 11.8 months. Eleven patients missed long-term follow-up. No incisional hernia was found. There is a statistically significant difference in cosmetic evaluation in favor of SILA (P PORT laparoscopic appendectomy, but after SILA procedure discharge was quicker and long-term cosmetic satisfaction was superior.

    5. Basic performance metrics of in-line inspection tools

      Energy Technology Data Exchange (ETDEWEB)

      Timashev, Sviatoslav A. [Russian Academy of Sciences (Russian Federation). Ural Branch. Science and Engineering Center

      2003-07-01

      The paper discusses current possibilities and drawbacks of in-line inspection (ILI) in detecting, identifying, locating and sizing of all types of defects in oil and gas pipelines. A full set of consistent and universal ILI tool performance metrics is constructed. A holistic methodology that extracts maximum value from the ILI measurements in defect detecting, locating, identifying, sizing and verifying the results of ILI is presented. The outlined approach is being implemented as a software component of a multi-purpose HR MFL ILI tool and is proposed for the new API 1163 ILI Qualification Standard. (author)

    6. Electronic Sentinel Surveillance of Influenza-like Illness. Experience from a pilot study in New Zealand.

      Science.gov (United States)

      Adnan, Mehnaz; Peterkin, Donald; Lopez, Liza; Mackereth, Graham

      2017-02-01

      Electronic reporting of Influenza-like illness (eILI) from primary care was implemented and evaluated in three general medical practices in New Zealand during May to September 2015. To measure the uptake of eILI and to identify the system's strength and limitations. Analysis of transactional data from the eILI system; comparative study of influenza-like illness cases reported using manual methods and eILI; questionnaire administered to clinical and operational stakeholders. Over the study period 66% of total ILI cases were reported using eILI. Reporting timeliness improved significantly compared to manual reporting with an average of 24 minutes from submission by the clinician to processing in the national database. Users found the system to be user-friendly. eILI assists clinicians to report ILI cases to public health authorities within a stipulated time period and is associated with faster, more reliable and improved information transfer.

    7. OTROCI KOT POTROŠNIKI

      OpenAIRE

      Prosen, Nina

      2010-01-01

      Diplomsko delo, ki je pred Vami, obravnava vprašanje, če so otroci, ko so postavljeni v vlogo potrošnika, resnično tako zavarovani, kot to določa Ustava Republike Slovenije v 56. členu. Otrokove želje in mnenja so postali pomemben dejavnik pri sooblikovanju potrošniških odločitev v družinah. Otroci postanejo potrošniki že v rosni mladosti. Zato je neprecenljivega pomena, kakšne vzgoje so otroci in mladostniki deležni v okviru družine in kasneje v šoli. Na otrokove želje vplivajo potrošniška s...

    8. Türk Yazınından Seçili İki Romanda Göç ve Göçmen Olgusunun Paydaşlık Bağlamında Yansımaları

      Directory of Open Access Journals (Sweden)

      Birkan KARGI

      2017-09-01

      Full Text Available Nazan Bekiroğlu’nun 2012 yılında yayınlanan Nar Ağacı romanı ve Ali Arslan’ın 2003 yılında yayınlanan Ama Sevgi Kalmalı adlı romanda, anlatıcılar kendi köklerini ve kendilerinden önceki kuşakların göç yazgılarının izlerini sürerler. Bu yapıtlarda biri batıdan doğuya, diğeri ise doğudan batıya evlerinden ayrılarak göç etmek zorunda kalan protogonistlerin yaşam öyküleri ele alınmıştır. Nar Ağacı romanında protogonistin göç serüveni İran’ın Tebriz kentinden başlayıp Tiflis, Bakü, Batum ve Trabzon zincirinde gelişirken, Ama Sevgi Kalmalı adlı roman da protogonistin göç serüveni Hannover’in Linden bölgesinden Filistin’e oradan da Anadolu’ya, Egenin Seki köyüne kadar devam eder. Yapıtların arka dokusunu Rus işgali, Birinci Dünya Savaşı, Milli Mücadele ve sonrası oluşturur. Göç serüveninde, göçmenlerin kimlikleri bölünür, parçalanır ve kendilerini yeniden gerçekleştirmek zorunda hissederler. Bu bağlamda Hans’ın Sofiya’ya, Settarhan’ın Zehra’ya olan aşkları protogonistler için varoluşsal bir işlev görür. Aslında her iki yapıttaki protogonistlerin göç nedenlerini, kurulu düzene ‘karşı olma’ ve kendi farklılıklarını ortaya koyma üzerine kuruludur. Derrida’nın da vurguladığı gibi, kimlikler ancak kendi farklılıklarıyla var olabilir ve bir anlamda her kimlik ötekidir. Benzer şekilde Laclau’ya göre de tüm kimliklerin temelinde antagonizma ve dışlanma bulunur. Hans, savaş karşıtı duruşuyla Almanya’da ötekidir. Settarhan ise gelenek ve törelere karşı duruşuyla öteki olmak durumuna düşmüştür. Her ikisi de göç nedeniyle yeniden varlık sorunlarını biçimlendirmeye çalışırlar. Her iki yapıtta da göç, benzer nedenlere dayanmaktadır. Bu benzerlik, batı ve doğu dünyasının karşıtlığında ortaya çıkar. Avrupa’da Aydınlanma anlayışının gelişim sürecinde egemen olan modernite, bir yandan insanlara özgürlük sağlarken öte yandan insanın varlığını derin bir baskı altına almıştır. Adorno da, Batılı anlayışın, ahlâkî ve insanî sorumluluktan yoksun olduğunu vurgular. Hans da işte bu nedenden ötürü savaş karşıtı olarak göçe zorlanır. Öte yandan gelenek ve göreneklerin hâkim olduğu doğu dünyasında Settarhan öç ve intikam duygusuna direndiği için yollara düşer. Karşıtlıklar ‘ insanı her şey için ölçü alan’ hümanizmde birleşir.

    9. Investigation of the relationship between high school students’ academic procrastination behaviors and their use of social media

      Lise öğrencilerinin akademik erteleme davranışları ve sosyal medya kullanımları arasındaki ilişkilerin incelenmesi

      OpenAIRE

      Ercan Gürültü; Levent Deniz

      2017-01-01

      The main aim of this study is to investigate the relationship between high school students’ academic procrastination and their use of social media. The sample of this study consisted of 473 students From 6 different schools of Eyüp district in İstanbul in 2014-2015 academic year. To indentify students’ academic procrastination behaviors, ‘Academic Procrastination Scale’, developed by Çakıcı (2003), was applied. A twelve item questionnare, which was developed by researchers, was used in order ...

    10. A case study on the vicarious epitomes of the lifecycles in poems and folk songsYaşam dönemlerinin şiir ve türkülerle eşleştirilerek incelenmesine ilişkin örnek bir çalışma

      OpenAIRE

      Kılıç, Ilgım; Kılıç, Mustafa

      2016-01-01

      Each individual is both influenced by and has an impact on his/her culture of birth. Consequently, culture describes life to a certain extent and can penetrate almost all spheresof life. In this study, poems and folks songs related to life periods and development psychology sub-branches such as childhood, adolescence, adulthood and old age and concept of death are examined connectively. In this regard, this study is first and only in its field. “Factual qualitative” data has been used in ...

    11. Výzkum hodnotové orientace u studentů středních škol a odborných učilišť a navržení intervenčního programu.

      OpenAIRE

      JANDOVÁ, Romana

      2013-01-01

      Thesis deals with the value orientation of students in secondary schools and secondary vocational schools. The aim is to map their value system and then based on the results of research to design an intervention program to promote internalization of values desired. The theoretical part includes a systematic search of the available literature values and their hierarchy, the age period of adolescence, the ways and possibilities of educating students given age period and the role of schools in s...

    12. Současný krizový management středních odborných škol - vliv poklesu stavu žáků na středních odborných školách a odborných učilištích v Praze

      OpenAIRE

      Tuška, Pavel

      2012-01-01

      TITLE: The current risk management at secondary vocational schools - effect of the decline of students in secondary vocational schools and vocational schools in Prague. AUTHOR: Bc. Pavel Tuška DEPARTMENT: The Centre of the educational management SUPERVISOR: RNDr. Jana Marková ABSTRACT: The prosperity of every secondary vocational school and vocational school is primarily based on the demand for their service which also depends on the behaviour of the school in times of crisis. The rapid demog...

    13. Programlamaya ilişkin Öz Yeterlilik Algısı Ölçeğinin Türkçe Formunun Güvenirlik ve Geçerlik Çalışması

      Directory of Open Access Journals (Sweden)

      Arif ALTUN

      2012-12-01

      Full Text Available The purpose of this study is to adapt “Computer Programming Self-Efficacy Scale”, developed by Ramalingam and Wiedenbeck (1998, to Turkish and to examine individuals’ programming self-efficacy scores across demographic variables. The study group is consisted of 152 undergraduate students from different academic departments who have taken at least one programming course earlier. The original scale was a 7-likert type with 32 items in 4 factors (independence and persistence, ability to perform simple programming tasks, ability to perform complex programming tasks, self-regulation. In the adapted version, the scale was finalized with 9 items in 2 factors (ability to perform simple programming tasks and ability to perform complex programming tasks in Turkish form. Cronbach alpha coefficient was found to be .928 and McDonald’s  (omega, which is proposed as being more appropriate for congeneric measurement, was found to be .956. As a result of explanatory factor analysis, two factors have explained 80,814 % of the variance together and this factor structure has been confirmed with confirmatory factor analysis, which showed a valid and reliable scale to measure programming self efficacy.

    14. Güney-Batı Anadolu Bölgesindeki kızılçam (Pinus brutia Ten. kültür ormanlarında değişik silvikültürel uygulamalara göre artım ve büyüme ilişkileri

      Directory of Open Access Journals (Sweden)

      Dr. Neşat Erkan

      2017-11-01

      Full Text Available Bu çalışma ile sıklık çağına gelmiş kızılçam ağaçlandırma alanlarında yapılacak değişik dozdaki ayıklamaların ve aralamaların, meşcere artım ve büyümesi üzerine olan etkilerinin incelenmesi amaçlanmıştır. Araştırma, 1982-2016 yılları arasında Kaş-Tekircik ve Eğirdir-Aşağı Narlı kızılçam ağaçlandırma alanı olmak üzere iki yerde yürütülmüştür. Rastlantı blokları deneme deseni kullanılmış; Kaş ve Eğirdir deneme alanlarında toplam 5 blok ve 35 parselden elde edilen veriler değerlendirilmiştir. Araştırmada aralama şiddeti işlem olarak; 1 kontrol, 2 mutedil aralama ve 3 şiddetli aralama şeklinde üç işlemli bir uygulama yapılmıştır. Deneme parsellerinde, kontrol parselleri hariç olmak üzere, 1990 ve 2004 yıllarında, meşcerenin ihtiyaç gösterdiği parsellerde ve düzeyde aralamalara devam edilmiştir. Araştırma sonucu; Meşcereye müdahale edilen parsellerde, 1985, 1990 ve 2004 yıllarında yapılan ölçme sonuçlarına göre Ortalama çapın, belirgin bir şekilde arttığını göstermiştir. Yine her iki yerde, toplam 5 blok üzerinden yapılan varyans analiz sonucunda, aralamaların göğüs yüzeyi ve kalan meşcere hacmi üzerinde p<0,05 anlamlılık düzeyinde etkili olduğu anlaşılmıştır. Parsellerde 44. yaşında, kalan meşcere hacmi için yapılan varyans analizi sonuçlarına göre, aralama şiddetinin kalan meşcere hacmi üzerinde etkili olduğu gözlenmiştir. Genel meşcere hacminin ise, yapılan istatistik analizler sonucunda p<0,05 anlamlılık düzeyinde, aralamalardan etkilenmediği sonucuna ulaşılmıştır. Sonuç olarak, kızılçam ormanlarında, işletme amaçları çerçevesinde, büyümeyi kaliteli gövdeler üzerinde toplamaya yönelik olarak, büyümenin hızlı olduğu genç yaşlarda, ekonomik açıdan da uygun olacağı düşüncesi ile müdahale sıklığını azaltmak ve bunun için de şiddetli aralama ile göğüs yüzeyinin %35-40’ının alınması şeklinde aralamanın yapılabileceği önerilebilir.

    15. Kamu personelinde algılanan örgütsel desteğin örgütsel bağlılık ve örgütsel özdeşleşme düzeyleri ile ilişkisini belirlemeye yönelik bir araştırma

      OpenAIRE

      Barutcu, Kürşad

      2015-01-01

      Algılanan örgütsel destek (AÖD) bireylerin örgüte olan katkılarının ne derece önemsendiği, refahlarının ne derece dikkate alındığı ve üyesi oldukları örgütlerinin kedilerini ne derece destekleyip güvende hissetmelerini sağladıklarına olan inançlarıdır. Bireylerin örgütsel destek algılarının olumlu olduğu ortamlarda bireylerin karşılık olarak bir takım olumlu tepkilerde bulunacakları literatürde yer alan birçok araştırmada ifade edilmiştir. Bu kapsamda değerlendirildiğinde örgüt...

    16. The relation between the level of professional guidance of national education inspectors given to class teachers and the teacher motivationsMaarif müfettişlerinin sınıf öğretmenlerine mesleki rehberlik yapma düzeyleri ile öğretmen motivasyonu arasındaki ilişki

      OpenAIRE

      Çiçek Sağlam, Aycan; Demir, Murat

      2015-01-01

      The aim of is this research is to determine both the views of teachers on the guiding level of inspectors to class teachers, how their approaches motivate them and the relationship between the behaviours of inspectors considering their vocational guidance and the level of their motivational effect. The center of this research is constituted by the primary school teachers who have been working at 31 different primary schools that located in center of Uşak during 2014-2015 educational year. In ...

    17. Yeni Çevresel Paradigma Ölçeği ile organik gıda tüketicilerinin çevreye yönelik tutumlarının değerlendirilmesi: Ankara ili örneği

      OpenAIRE

      ATALAY, Ceyda

      2016-01-01

      Bu tezin temel amacı, araştırma kapsamındaki tüketicilerin organik gıda tüketirken çevreye yöneliktutumlarının “Yeni Çevresel Paradigma Ölçeği” ile incelenmesidir. Ayrıca, tüketicilerin organik gıdatüketimleri konusunda bilgileri, bu ürünleri tüketip tüketmeme nedenleri, organik gıda satın alırken tercihettikleri yerlerin seçimi ve bu gıdaları tüketirken çevreye duyarlı olup olmadıkları da araştırılmıştır.Araştırma Ankara’nın Çankaya ve Yenimahalle ilçelerindeki organik gıda satan 3 ...

    18. 11. sınıf öğrencilerinin düşünme stilleri, öğrenme stratejileri ve düşünme stilleri ile öğrenme stratejileri arasındaki ilişki

      OpenAIRE

      Çelik, Diren

      2016-01-01

      Toplumların geleceği, düşünebilen, yaratıcı ve muhakeme gücü yüksek bireyler yetiştirilmesiyle yön bulacaktır. Değişime uğrayan yaşam koşulları eğitim sistemine farklı bir bakış açısı kazandırmıştır. Günümüzde eğitimin amacı sadece bilginin kazandırılması, bilginin sorgulanmadan kabul edilip, davranışların bu doğrultuda sergileyen bireylerin yetiştirilmesi olmaktan çıkmıştır. Bunun yerine edinilen bilgiyi özümseyen, kendi tarzına uygun bir şekilde biçimlendiren, bağımsız düşünme becerilerine ...

    19. Manisa İli'nde özkıyım girişimlerine ilişkin özellikler: Beş yıllık verinin değerlendirilmesi/Retrospective evaluation of attempted suicides based on a register in the province of Manisa: Age and gender based variations of methods and reasons

      Directory of Open Access Journals (Sweden)

      Hatice Şimşek

      2014-04-01

      Full Text Available ÖzetAmaç: Manisa’da 2007-2011 yılları arasındaki özkıyım girişiminde bulunan olguların özelliklerinin cinsiyete göre incelenmesidir. Yöntem: Tanımlayıcı tipteki araştırma, Manisa Halk Sağlığı Müdürlüğü’nün intihar girişimleri kayıt formlarının incelemesiyle yapılmıştır.  Bulgular: Toplam 6827 olgunun 5311’i (%77.8 kadındır. Özkıyım girişiminde bulunan olguların %57.3’ü 15-24 yaş grubunda, %51.6’sı bekar, %62.2’si ilköğretim mezunudur. Olguların %95.8’inin özkıyım girişimi yöntemi zehirleyici maddedir. En yaygın özkıyım nedeni genel toplamda ve kadınlarda aile geçimsizliği-evlilik-çocuklarken, erkeklerde ruhsal hastalıktır. Özkıyım nedeni en sık, 15 yaş altında ve 15-24 yaş grubunda ebeveyn çatışmaları, 25-64 yaş grubunda aile geçimsizliği-evlilik-çocuklar, 65 yaş ve üzerinde ruhsal ve bedensel hastalıktır. Sonuç: Özkıyım girişiminde bulunan olguların çoğunluğu kadın, ergen/genç yaş grubu, ilköğretim mezunu olanlar, çalışmayanlardır. Başlıca özkıyım girişimi yöntemi ilaç ve zehirleyici madde kullanımıdır. Nedenler de yaş grubu ve cinsiyete göre değişmektedir.Anahtar Kelimeler: Özkıyım,  özkıyım girişimi, epidemiyoloji, risk etmeniAbstractObjective: The study determined, by gender and age group, the characteristics of individuals who had attempted suicide in Manisa between the years 2007-2011.Method: This was a descriptive study conducted by retrospective research of "suicide attempt entry forms". Results:A total of 6827 suicides were evaluated. 5311 (77.8% were women, 57.3% were aged 15-24 years, 51.6% were single, 62.2% had graduated from primary schools. In 95.8% of the suicides the method of suicide was self-poisoning with drugs. The most common reasons for the suicide attempts in total and among women were family problems, marriage and children; mental illness among men. The most frequent reasons for the suicide attempts among those who were 15-24 years of age were conflicts with parents; among the age group of 25-64 the reasons were family problems, marriage or children, and among those who were 65 years and over the reasons were mental or physical illnesses.Conclusion: The main determinants of suicide attempts were female gender, adolescents and/or young adults, primary school as an educational level, unemployed individuals. The most frequent suicide method was self-poisoning. Reasons of attempts displayed variation based on age group and gender.Key words:  suicide, suicide attempt, epidemiology, risk factor  

    20. Nacrt geneze pojma stila u starijoj teorijsko-umetničkoj misli ili, prilog oblikovanju povesnog prostora umetnosti / The Scheme of Genesis of the Concept of Style in Older Theoretical and Artistic Thought or Addition to the Forming of Historical Space of Art

      Directory of Open Access Journals (Sweden)

      Radovan Popović

      2012-12-01

      Full Text Available During the course of its historical-intellectual shaping, the style, gradually but obviously and positively shifting from one framework of onto-logical deliberation – within which it was being constituted on the margin of what Plato determined to be the essence of mind as the essence in mind or, in other words, idea – to another, assuming the form of probable knowledge or the knowledge of things presumed, being the ability of creative imagination which reveals but does not make evident (ars inveniendi, the importance of which is pointed out in man’s practical self-accomplishment as a community-being, which disposes not only of the truth of apodictic reasoning but also of convictions and truisms (loci communes which, transposed into the canons of rhetoric, represent since Hellenism and the period of Roman domination (Cicero, Seneca, etc. not only a stronghold of variability and expressive abundance of dialectical argumentation but also a generic basis which gives to understand originality and irreducibility to normativity (Quintillian as motivators of the overall progress of civilization. Having considered that, and also reaching anew for the sources of antiquity, the uomini universali from the period of European history which we traditionally name the Renaissance assuming to their spiritual sensibility founded upon the religious experience of Christian subjectivity the heritage of logical and axiological structure of hellenico-roman pattern of thinking, form a notion or at least an idea of style which is then, probably for the first time, beginning to be brought in relation to literature and pictorial art as their differentia specifica, in opposition to philosophy, theology and jurisprudence. Until the end of the eighteenth century however, the style remains more or less firmly attached to purely contemplative aesthetic deliberations which tend to draw from the inexhaustible wealth of concretizations of style in the artistic creation examples to illustrate their proposed theses. The consideration of style outside aesthetics as a philosophical discipline emerges about the mid-nineteenth century and especially at the end of the nineteenth and the beginning of the twentieth century when, in the works of theorists such as Heinrich Wölfflin and Max Dvořák, the style assumes its role of analytical and critical category on the one hand, and the frameworks in which art acquires its own worth and importance on the other.

    1. Interstitial lung involvement in rheumatoid arthritis

      Directory of Open Access Journals (Sweden)

      David Vladimirovich Bestaev

      2014-01-01

      Full Text Available Rheumatoid arthritis (RA is a systemic autoimmune rheumatic disease of unknown etiology, characterized by chronic erosive arthritis and extraarticular manifestations. Pulmonary involvement is one of the common extraarticular manifestations of RA and may show itself as bronchial tree lesions, rheumatoid nodules, Caplan's syndrome, and lesions in the pleura or pulmonary interstitium (interstitial lung involvement (ILI. High-resolution computed tomography allows the diagnosis of ILI in RA in nearly 70% of cases although the incidence of ILI may be lower (4 to 30% depending on diagnostic methods and patient selection criteria. There are several histopathological types of ILI, the differential diagnosis of which can be troublesome. Usual interstitial pneumonia (UIP and nonspecific interstitial pneumonia are major types of RA-associated ILI. UIP-pattern ILI has a more severe course than ILI with other histological patterns. The clinical presentation of ILI may be complicated by the likely toxic effect of a number of disease-modifying antirheumatic drugs (DMARDs used to treat RA, such as methotrexate and leflunomide, and biological agents (BAs, tumor necrosis factor-α (TNF-α inhibitors. The pathogenesis of pulmonary involvement in RA and the role of synthetic DMARDs and BAs in the development of ILI call for further investigations.An extraarticular manifestation, such as ILI, affects the choice of treatment policy in patients with RA.The relevance of a study of ILI is beyond question. The paper discusses the state-of-the-art of investigations in this area.

    2. Emergency department and 'Google flu trends' data as syndromic surveillance indicators for seasonal influenza.

      Science.gov (United States)

      Thompson, L H; Malik, M T; Gumel, A; Strome, T; Mahmud, S M

      2014-11-01

      We evaluated syndromic indicators of influenza disease activity developed using emergency department (ED) data - total ED visits attributed to influenza-like illness (ILI) ('ED ILI volume') and percentage of visits attributed to ILI ('ED ILI percent') - and Google flu trends (GFT) data (ILI cases/100 000 physician visits). Congruity and correlation among these indicators and between these indicators and weekly count of laboratory-confirmed influenza in Manitoba was assessed graphically using linear regression models. Both ED and GFT data performed well as syndromic indicators of influenza activity, and were highly correlated with each other in real time. The strongest correlations between virological data and ED ILI volume and ED ILI percent, respectively, were 0·77 and 0·71. The strongest correlation of GFT was 0·74. Seasonal influenza activity may be effectively monitored using ED and GFT data.

    3. Láska není antipolitická síla

      Czech Academy of Sciences Publication Activity Database

      Bierhanzl, Jan

      -, č. 10 (2017), s. 1-3 ISSN 1210-4361 Institutional support: RVO:67985955 Keywords : láska * politika * tělesnost * veřejný prostor * citové menšiny Subject RIV: AA - Philosophy ; Religion http://protestant.evangnet.cz/laska-neni-antipoliticka-sila

    4. Assessment of four different methods for selecting biosurfactant ...

      African Journals Online (AJOL)

      ... and ease of use to screen biosurfactant producing six extremely halophilic bacteria isolated from saline soil of Chott El Hodna-M'sila (Algeria), which is considered as a thalassohaline environment. Results from screening methods revealed that, CH2 and CH5 strains are potential candidates for biosurfactant production.

    5. Download this PDF file

      African Journals Online (AJOL)

      Owner

      2010-02-08

      Feb 8, 2010 ... which means that they have been born on the same day. Highlighting ... count in favour of one of them is the weight of argument he presents in court. As the ... These include umSila weNgwe(a leopard's tail); isiGqeba(inner.

    6. Moodne aeg : Moeuudised

      Index Scriptorium Estoniae

      2000-01-01

      Moes on puhvseelik, mis moekriitik Amanda Harlech'i arvates teeb naise keha inetuks. Londonis elava prantslanna Emma Cassid'i cool'id ridikülid. Sian Evansi toidukäruga sõrmused. Graafik James Jarvise disainitud Briti firma Silas'i Evil Martini nimeline kummilelu ning tema sõber kummikass Bubba the Car.

    7. Isomerization of 2-phospha-4-silabicyclo[1.10]butane

      NARCIS (Netherlands)

      Slootweg, J.C.; Ehlers, A.W.; Lammertsma, K.

      2004-01-01

      In analogy with the valence isomerism of the hydrocarbons bicyclobutane, 1,3-butadiene and cyclobutene, the rearrangements for 2-phospha-4-sila- bicyclo[1.1.0]butane were studied at the B3LYP/6-311+G** level of theory. The monocyclic 1,2-dihydro-1,2-phosphasilete is shown to be the thermodynamically

    8. Whale Heart

      DEFF Research Database (Denmark)

      2017-01-01

      Student bachelor film. Synopsis:Silas lives in an isolated whaling town, toiling for months in the harsh and bloody trade on which he and his community depend. However, in order to be capable of killing the creatures whose bone and blubber pay his wage, he has developed an ungodly method for extr...

    9. Influenza-like illness in a Vietnamese province: epidemiology in correlation with weather factors and determinants from the surveillance system.

      Science.gov (United States)

      Minh An, Dao Thi; Ngoc, Nguyen Thi Bich; Nilsson, Maria

      2014-01-01

      Seasonal influenza affects from 5 to 15% of the world's population annually and causes an estimated 250,000-500,000 deaths worldwide. The World Health Organization (WHO) recommends 'sentinel surveillance' for influenza-like illness (ILI) because it is simple and calls for standardized methods at a relatively low cost that can be implemented throughout the world. In Vietnam, ILI is a key priority for public health also because of its annually recurring temporal pattern. Two major factors, on which the spread of influenza depends, are the strain of the virus and its rate of mutation, since flu strains constantly mutate as they compete with host immune systems. In the context of global climate change, the role of climatic factors has been discussed, as they may significantly contribute to the cause of large outbreaks of ILI. 1) To describe the epidemiology of ILI in Ha Nam province, Vietnam; 2) to seek scientific evidence on the association of ILI occurrence with weather factors in Ha Nam province; and 3) to analyze factors from the Ha Nam ILI surveillance system that contribute to explaining the correlation between the ILI and the weather factors. A data set of 89,270 monthly reported ILI cases from 2008 to 2012 in Ha Nam was used to describe ILI epidemiological characteristics. Spearman correlation analyses between ILI cases and weather factors were conducted to identify which preceding period of months and weather patterns influenced the occurrence of ILI cases. Ten in-depth interviews with health workers in charge of recording and reporting ILI cases at different levels of the ILI surveillance system were conducted to gain a deeper understanding of factors contributing to explaining the relation between the ILI and the weather factors. The results indicated that the ILI occurred annually in all districts of the Ha Nam province in the five studied years. An epidemic occurred in 2009 with the number of cases three times higher than the average threshold. There was a

    10. Influenza-like illness in a Vietnamese province: epidemiology in correlation with weather factors and determinants from the surveillance system

      Directory of Open Access Journals (Sweden)

      Dao Thi Minh An

      2014-12-01

      Full Text Available Background: Seasonal influenza affects from 5 to 15% of the world's population annually and causes an estimated 250,000–500,000 deaths worldwide. The World Health Organization (WHO recommends ‘sentinel surveillance’ for influenza-like illness (ILI because it is simple and calls for standardized methods at a relatively low cost that can be implemented throughout the world. In Vietnam, ILI is a key priority for public health also because of its annually recurring temporal pattern. Two major factors, on which the spread of influenza depends, are the strain of the virus and its rate of mutation, since flu strains constantly mutate as they compete with host immune systems. In the context of global climate change, the role of climatic factors has been discussed, as they may significantly contribute to the cause of large outbreaks of ILI. Objectives: 1 To describe the epidemiology of ILI in Ha Nam province, Vietnam; 2 to seek scientific evidence on the association of ILI occurrence with weather factors in Ha Nam province; and 3 to analyze factors from the Ha Nam ILI surveillance system that contribute to explaining the correlation between the ILI and the weather factors. Design: A data set of 89,270 monthly reported ILI cases from 2008 to 2012 in Ha Nam was used to describe ILI epidemiological characteristics. Spearman correlation analyses between ILI cases and weather factors were conducted to identify which preceding period of months and weather patterns influenced the occurrence of ILI cases. Ten in-depth interviews with health workers in charge of recording and reporting ILI cases at different levels of the ILI surveillance system were conducted to gain a deeper understanding of factors contributing to explaining the relation between the ILI and the weather factors. Results: The results indicated that the ILI occurred annually in all districts of the Ha Nam province in the five studied years. An epidemic occurred in 2009 with the number of

    11. Intermedilysin induces EGR-1 expression through calcineurin/NFAT pathway in human cholangiocellular carcinoma cells

      International Nuclear Information System (INIS)

      Susilowati, Heni; Okamura, Hirohiko; Hirota, Katsuhiko; Shono, Masayuki; Yoshida, Kaya; Murakami, Keiji; Tabata, Atsushi; Nagamune, Hideaki; Haneji, Tatsuji; Miyake, Yoichiro

      2011-01-01

      Research highlights: → ILY leads to the accumulation of [Ca 2+ ]i in the nucleus in HuCCT1 cells. → ILY induced activation of NFAT1 through a calcineurin-dependent pathway. → Calcineuri/NFAT pathway is involved in EGR-1 expression in response to ILY treatment. -- Abstract: Intermedilysin (ILY) is a cholesterol-dependent cytolysin produced by Streptococcus intermedius, which is associated with human brain and liver abscesses. Although intrahepatic bile duct cells play a valuable role in the pathogenesis of liver abscess, the molecular mechanism of ILY-treated intrahepatic bile duct cells remains unknown. In this study, we report that ILY induced a nuclear accumulation of intracellular calcium ([Ca 2+ ]i) in human cholangiocellular cells HuCCT1. We also demonstrate that 10 ng/ml ILY induced NFAT1 dephosphorylation and its nuclear translocation in HuCCT1 cells. In contrast to the result that ILY induced NF-κB translocation in human hepatic HepG2 cells, ILY did not affect NF-κB localization in HuCCT1 cells. Dephosphorylation and nuclear translocation of NFAT1 caused by ILY were prevented by [Ca 2+ ]i calcium chelator, BAPTA/AM, and calcineurin inhibitors, cyclosporine A and tacrolimus. ILY induced early growth response-1 (EGR-1) expression and it was inhibited by the pre-treatment with cyclosporine A, indicating that the calcineurin/NFAT pathway was involved in EGR-1 expression in response to ILY. ILY-induced calcineurin/NFAT1 activation and sequential EGR-1 expression might be related to the pathogenesis of S. intermedius in human bile duct cells.

    12. Intermedilysin induces EGR-1 expression through calcineurin/NFAT pathway in human cholangiocellular carcinoma cells

      Energy Technology Data Exchange (ETDEWEB)

      Susilowati, Heni [Department of Oral Microbiology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan); Okamura, Hirohiko [Department of Histology and Oral Histology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan); Hirota, Katsuhiko, E-mail: hirota@dent.tokushima-u.ac.jp [Department of Oral Microbiology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan); Shono, Masayuki [Support Center for Advanced Medical Sciences, The University of Tokushima, Tokushima 770-8504 (Japan); Yoshida, Kaya [Department of Fundamental Oral Health Science, School of Oral Health and Welfare, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan); Murakami, Keiji [Department of Oral Microbiology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan); Tabata, Atsushi; Nagamune, Hideaki [Department of Biological Science and Technology, Life System, Institute of Technology and Science, The University of Tokushima Graduate School, Tokushima 770-8506 (Japan); Haneji, Tatsuji [Department of Histology and Oral Histology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan); Miyake, Yoichiro [Department of Oral Microbiology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan)

      2011-01-07

      Research highlights: {yields} ILY leads to the accumulation of [Ca{sup 2+}]i in the nucleus in HuCCT1 cells. {yields} ILY induced activation of NFAT1 through a calcineurin-dependent pathway. {yields} Calcineuri/NFAT pathway is involved in EGR-1 expression in response to ILY treatment. -- Abstract: Intermedilysin (ILY) is a cholesterol-dependent cytolysin produced by Streptococcus intermedius, which is associated with human brain and liver abscesses. Although intrahepatic bile duct cells play a valuable role in the pathogenesis of liver abscess, the molecular mechanism of ILY-treated intrahepatic bile duct cells remains unknown. In this study, we report that ILY induced a nuclear accumulation of intracellular calcium ([Ca{sup 2+}]i) in human cholangiocellular cells HuCCT1. We also demonstrate that 10 ng/ml ILY induced NFAT1 dephosphorylation and its nuclear translocation in HuCCT1 cells. In contrast to the result that ILY induced NF-{kappa}B translocation in human hepatic HepG2 cells, ILY did not affect NF-{kappa}B localization in HuCCT1 cells. Dephosphorylation and nuclear translocation of NFAT1 caused by ILY were prevented by [Ca{sup 2+}]i calcium chelator, BAPTA/AM, and calcineurin inhibitors, cyclosporine A and tacrolimus. ILY induced early growth response-1 (EGR-1) expression and it was inhibited by the pre-treatment with cyclosporine A, indicating that the calcineurin/NFAT pathway was involved in EGR-1 expression in response to ILY. ILY-induced calcineurin/NFAT1 activation and sequential EGR-1 expression might be related to the pathogenesis of S. intermedius in human bile duct cells.

    13. OMREŽNA STIKALA IN KOMUTACIJA LAN/WAN

      OpenAIRE

      Prosenjak, Danijel

      2010-01-01

      Diplomska naloga obravnava koncepte komutacije. Osredotočili se bomo na lokalna omrežja. Podrobneje bomo preučili različice protokola vpetega drevesa in primere le-tega. V naslednjih poglavjih so obravnavana virtualna lokalna omrežja in VLAN povezovalni protokol. Na kratko bomo preučili komutacijo OSI plasti L3, prožnost omrežja in varnost omrežnih stikal.

    14. Effect of influenza-like illness and other wintertime respiratory illnesses on worker productivity: The child and household influenza-illness and employee function (CHIEF) study.

      Science.gov (United States)

      Palmer, Liisa A; Rousculp, Matthew D; Johnston, Stephen S; Mahadevia, Parthiv J; Nichol, Kristin L

      2010-07-12

      Acute respiratory illnesses (ARI), comprising influenza-like illness (ILI) and other wintertime respiratory illnesses (ORI), impose substantial health and economic burdens on the United States. Little is known about the impact of ILI among household members (HHM), particularly children, on employees' productivity. To quantify the impact of employee and HHM-ILI and ARI on employee productivity, a prospective, observational cohort study was conducted among employees from three large US companies. Employees who had at least one child living at home (N=2013) completed a monthly survey during the 2007-2008 influenza season, reporting the number of days missed from work and hours of presenteeism due to: (1) personal ILI, (2) HHM-ILI, and (3) personal and HHM-ARI. Employee ILI ranged from 4.8% (April) to 13.5% (February). Employees reporting ILI reported more absences than employees not reporting ILI (72% vs 30%, respectively; Pemployees surveyed had at least one child with an ILI; these employees missed more days of work due to HHM illness than employees without an ARI-ill child (0.9 days vs 0.3 days, respectively; PEmployees with ILI were less productive, on average, for 4.8h each day that they worked while sick, 2.5h of which was attributable to ILI. HHM illnesses accounted for 17.7% (1389/7868 days) of employee absenteeism, over half of which was due to HHM-ARI. ILI causes a significant amount of employee absence. Household members, particularly children, comprise a sizable proportion of general illness and injury-related employee absences. Copyright 2010 Elsevier Ltd. All rights reserved.

    15. Seasonality of absolute humidity explains seasonality of influenza-like illness in Vietnam

      Directory of Open Access Journals (Sweden)

      Pham Quang Thai

      2015-12-01

      Conclusions: Our results identify a role for AH in driving the epidemiology of ILI in a tropical setting. However, in contrast to temperate regions, high rather than low AH is associated with increased ILI activity. Fluctuation in AH may be the climate factor that underlies and unifies the seasonality of ILI in both temperate and tropical regions. Alternatively, the mechanism of action of AH on disease transmission may be different in cold-dry versus hot-humid settings.

    16. Relating calls to US poison centers for potential exposures to medications to Centers for Disease Control and Prevention reporting of influenza-like illness.

      Science.gov (United States)

      Beauchamp, Gillian A; McKeown, Nathanael J; Rodriguez, Sergio; Spyker, Daniel A

      2016-03-01

      The Centers for Disease Control (CDC) monitors influenza like illness (ILI) and the National Poison Data System (NPDS) warehouses call data uploaded by US poison centers regarding reported exposures to medication. We examined the relationship between calls to poison centers regarding reported exposures to medications commonly used to treat ILI and weekly reports of ILI. The CDC reports ILI, by age group, for each of 10 Health and Human Services (HHS) regions. We examined NPDS summary data from calls reported to poison centers regarding reported exposures to acetaminophen, cough/cold medications, and promethazine, for the same weeks, age groups, and HHS regions for influenza seasons 2000-2013. ILI and NPDS exposures were examined using graphical plots, descriptive statistics, stepwise regression analysis, and Geographic Information Systems (GIS). About 5,101,841 influenza-like illness cases were reported to the CDC, and 2,122,940 calls regarding reported exposures to medications commonly used to treat ILI, were reported by poison centers to the NPDS over the 13 flu seasons. Analysis of stepwise models of the linear untransformed data involving 24 NPDS data groups and for 60 ILI measures, over the 13 influenza seasons, demonstrated that reported exposures to medications used to treat ILI correlated with reported cases of ILI with a median R(2 )=( )0.489 (min R(2 )=( )0.248, max R(2 )=( )0.717), with mean ± SD of R(2 )=( )0.494 ± 0.121. Median number of parameters used (degrees of freedom - 1) was 7. NPDS data regarding poison center calls for selected ILI medication exposures were highly correlated with CDC ILI data. Since NPDS data are available in real time, it provides complimentary ILI monitoring. This approach may provide public health value in predicting other illnesses which are not currently as thoroughly monitored.

    17. ORF Alignment: NC_002696 [GENIUS II[Archive

      Lifescience Database Archive (English)

      Full Text Available ily [imported] - ... Caulobacter crescentus ... Length = 100 ... Query: 213 RIKRFID...DNLCDPELSVGRVAGALGVSPRYVQMVFAGMATTPLAYIXXXXXXXXXXXXXX 272 ... RIKRFIDDNLCDPELSVGRVAGALGV...SPRYVQMVFAGMATTPLAYI ... Sbjct: 1 ... RIKRFIDDNLCDPELSVGRVAGALGVSPRYVQMVFAGMATTPLAYIRRKRLERAARALRE 60 ...

    18. School principals’ and teachers’ views on reasons for the decrease of success in Turkish university entrance exams (case of Malatya [Üniversiteye giriş sınavlarındaki başarının düşme nedenlerine yönelik yönetici ve öğretmen görüşleri (Malatya ili örneği

      Directory of Open Access Journals (Sweden)

      Yeliz TEMLİ-DURMUŞ

      2015-04-01

      Full Text Available High schools’ success in Malatya province decreased during 2011-2012 in the Turkish National University Entrance Exams. The mean of high schools’ success in Turkey was higher for different score types than Malatya. The reasons for the decrease in success in the University Entrance Exams were researched based on school principals’ and teachers’ evaluations. One Science High School, one Anatolian High School, four General High Schools and two Vocational High Schools constitute the sample. In total, six school principals and 47 teachers voluntarily participated in the study. Findings were constructed into three categories as ‘Factors affecting Turkey’, ‘Factors affecting Malatya’, and ‘Solution Proposals’. The first category is composed of five themes; the ‘Problems originating from elementary education’, ‘Reduced authority and loss of respect for teachers’, ‘Rapid and frequent changes in the educational system’, ‘The exams not being perceived as a process by students’, and ‘Technological developments and failure in time-management’. The second category focused on Malatya City, and has six themes; ‘Immigration’, ‘Gangs’, ‘Partisan attitudes’, ‘Overuse of official complaint / request line (Call 147’, ‘Insensitivity of parents’, and ‘Limitation in teacher qualifications’. The third and final category is Solution Proposals and is composed of four themes; ‘Family teaching’, ‘Provincial council meetings for teachers’, ‘Collaboration among institutions’, and ‘Raising student awareness of exams’. School Principals and teachers’ evaluations were parallel with each other; therefore, the two groups have been analyzed together.

    19. Liquid Scintillation Detection of Tritium and other Radioisotopes in Insoluble or Quenching Organic Samples; Detection par compteur a scintillations a liquides du tritium et des autres radioelements contenus dans des echantillons organiques insolubles ou coupeurs; Obnaruzhenie tritiya metodom zhidkostnoj stsintillyatsii v nerastvorimykh ili sposo'nykh gasit' izluchenie organicheskikh o'raztsakh; Deteccion del tritio u otros radioisotopos por centelleo liquido en muestras organicas insolubles o que provocan extincion

      Energy Technology Data Exchange (ETDEWEB)

      Eastham, J F; Westbrook, H L; Gonzales, D [University of Tennessee, Knoxville, TN (United States)

      1962-01-15

      To facilitate a study of the H{sup 1}/H{sup 3} isotope effect in the reduction of organic compounds, it has been necessary to develop procedures to overcome the two major limitations of the most convenient general method of radioassaying organic material, liquid scintillation counting. These limitations, which are scintillation-quenching by many organic samples and limited solubility of others, are particularly common with material of biological significance: The procedures developed involve combustion of the sample wrapped in filter paper in art oxygen-filled flask, formation of a solution of the combustion products in a suitable solvent added to the flask before combustion, and scintillation-counting of the solution. Advantages of the developed, procedures, in addition to overcoming the indicated limitations, include efficacy with samples with a great range of activity (some as low as 1{mu}c/mole), good precision (as great as any other general method of radio-assaying H{sup 3}), and applicability to other soft beta emitters (C{sup 14} and S{sup 35}). With a scintillation spectrometer and the techniques developed, samples triply labelled with H{sup 3}, C{sup 14} and S{sup 35} can be differentially radio assayed. Details of the solvent systems and techniques developed are reported. Analytical results are reported for such quenching material as 2.4-dinitrophenyl-hydrazones dyes and for such insoluble materials as proteins and carbohydrates. Application of the techniques to evaluation of H{sup 1}/H{sup 3} isotope effects in certain reduction reactions are discussed. (author) [French] Pour faciliter l'etude de l'effet isotopique ''1H/''3H dans la reduction des composes organiques, il a fallu mettre au point des procedes permettant d'elargir le champ d'application de la methode generale la plus pratique de radioanalyse des matieres organiques, savoir l'analyse au moyen d'un compteur a scintillations a liquides. En effet, ce champ d'application est limite pour deux raisons: beaucoup d'echantillons organiques provoquent le coupage; d'autres echantillons sont peu solubles. Ces limitations sont particulierement frequentes dans le cas des substances importantes du point de vue biologique. Le procede mis au point par les auteurs comporte la combustion de l'echantillon enveloppe de papier filtre, dans un ballon rempli d'oxygene; la dissolution des produits de combustion dans un solvant approprie ajoute au ballon avant la combustion; enfin, le comptage de la solution. Parmi les avantages de ce procede, on relevera - outre le fait qu'il permet d'elargir le champ d'application de la methode en supprimant les limitations mentionnees plus haut - son efficacite pour des echantillons ayant des activites extremement diverses (dans certains cas, elles ne depassent pas 1 {mu}c par mole), son excellente precision (aussi grande que celle de toute autre methode generale de radioanalyse du tritium) et la possibilite de l'appliquer a d'autres emetteurs beta mous ({sup 14}C et {sup 35}S). Avec un spectrotnetre a scintillations et le procede mis au point par les auteurs, des echantillons marques par trois indicateurs (tritium, carbone-14 et soufre-35) peuvent faire l'objet d'une radioanalyse differentielle. Les auteurs donnent des details sur les solvants utilises et les techniques mises au point, et indiquent les resultats de l'analyse pour des matieres provoquant le coupage telles que les dinitro-2,4, phenylhydrazones et les colorants au thiazole, ainsi que pour des matieres insolubles telles que les proteines et les hydrates de carbone. Ils rendent compte de l'application du procede a l'evaluation des effets isotopiques {sup 1}H/{sup 3}H dans certaines reactions de reduction. (author) [Spanish] Para facilitar el estudio del efecto isotopico {sup 1}H/{sup 3}H en la reduccion de compuestos organicos, ha sido preciso idear procedimientos a fin de vencer los dos inconvenientes principales que presenta el metodo de radioanalisis general mas apropiado para las sustancias organicas, a saber, el recuento por centelleos de liquidos. Estos inconvenientes, que son la extincion del centelleo producida por. muchas muestras organicas y la escasa solubilidad de otras, son particularmente frecuentes en las sustancias de importancia biologica. El procedimiento ideado por los autores consiste en lo siguiente: combustion de la muestra, envuelta en papel de filtro, en un matraz lleno de oxigeno; disolucion de los productos de combustion en un disolvente adecuado que se introduce en el matraz antes de la combustion, y recuento por centelleo de la actividad de la solucion. Ademas de superar los inconvenientes mencionados, este procedimiento posee otras ventajas: eficacia con muestras de actividades muy diversas (algunas, tan baja como 1{mu}c/M), precision (tan elevada como la de cualquier otro metodo general de radioanalisis del {sup 3}H) y posibilidad de aplicarlo a otros emisores beta blandos ({sup 14}C y {sup 35}S). Con un espectrometro de centelleo y merced al procedimiento ideado, es posible efectuar un radioanalisis diferencial de muestras marcadas con tres indicadores ({sup 3}H, {sup 14}C y {sup 35}S). Los autores describen con detalle las tecnicas y los sistemas de disolventes utilizados. Asimismo, exponen los resultados obtenidos en el analisis de sustancias que provocan extincion, como 2,4- dinitrofenilhidrazona s y colorantes de tiazol, y de sustancias insolubles, como proteinas e hidratos de carbono. Estudian la aplicacion de estas tecnicas al analisis de los efectos isotopicos {sup 1}H/{sup 3}H en ciertas reacciones de reduccion. (author) [Russian] CHtoby oblegchit' izuchenie vliyaniya izotopa H{sup 1}/H{sup 3} na vosstanovlenie organicheskikh soedinenij neobkhodimo bylo razrabotat' protsedury dlya preodoleniya dvukh osnovnykh ogranichenij v naibolee udobnom obshchem metode izmereniya radioaktivnosti organicheskikh veshchestv posredstvom zhidkostnogo stsintillyatora . EHti ogranicheniya, kotorymi yavlyayutsya stsintillyatsionnoe gashenie mnogimi organicheskimi obraztsami i ogranichennaya rastvorimost ' drugikh, prisushchi takzhe biologicheskim veshchestvam. Razrabotannye protsedury vklyuchayut v sebya okislenie obernutogo v fil'troval'nuyu bumagu obraztsa v kolbe, napolnennoj kislorodom, obrazovanie rastvora okislennykh produktov v sootvetstvuyushchem rastvoritele, dobavlennom v kolbu pered okisleniem, i stsintillyatsionnyj schet rastvora. Preimushchestva razrabotannykh protsedur dlya preodoleniya ukazannykh ogranichenij vklyuchayut: kachestvo operatsii s obraztsami bol'shogo diapazona aktivnosti (nekotorye s takoj nizkoj aktivnost'yu kak 1{mu}c//mo1e), bol'shuyu tochnost' (takuyu zhe kak pri lyubom drugom obshchem metode izmereniya radioaktivnosti H{sup 3}), i primenimost' k drugim myagkim beta-izluchatelyam (C{sup 14} i k{sup 35}). S pomoshch'yu stsintillyatsionnogo spektrometra i razrabotannykh protsedur mozhet byt' razdel'no izmerena radioaktivnost ' obraztsov mechennykh trizhdy H{sup 3}, C{sup 14} i k{sup 35}. Detali, kasayushchiesya sistem rastvoritelya i razrabotannykh metodov, budut izlozheny v doklade, krome togo v nem budet dana rabochaya kharakteristika novogo, otnositel'no nedorogogo odnokanal'nogo stsintillyatsionnogo spektrometra. Budut izlozheny analiticheskie rezul'taty, kasayushchiesya takogo gasyashchego izluchenie materiala, kak 2,4-dinitro-fenilgidrozony i tiazolidy, a takzhe takikh nerastvorimykh materialov, kak proteiny i ugolevdy. Budet obsuzhdeno primenenie metodov k otsenke izotopnogo ehffekta H{sup 1}/H{sup 3} v opredelennykh reaktsiyakh vosstanovleniya. (author)

    20. Age-related differences in the accuracy of web query-based predictions of influenza-like illness.

      Directory of Open Access Journals (Sweden)

      Alexander Domnich

      Full Text Available Web queries are now widely used for modeling, nowcasting and forecasting influenza-like illness (ILI. However, given that ILI attack rates vary significantly across ages, in terms of both magnitude and timing, little is known about whether the association between ILI morbidity and ILI-related queries is comparable across different age-groups. The present study aimed to investigate features of the association between ILI morbidity and ILI-related query volume from the perspective of age.Since Google Flu Trends is unavailable in Italy, Google Trends was used to identify entry terms that correlated highly with official ILI surveillance data. All-age and age-class-specific modeling was performed by means of linear models with generalized least-square estimation. Hold-out validation was used to quantify prediction accuracy. For purposes of comparison, predictions generated by exponential smoothing were computed.Five search terms showed high correlation coefficients of > .6. In comparison with exponential smoothing, the all-age query-based model correctly predicted the peak time and yielded a higher correlation coefficient with observed ILI morbidity (.978 vs. .929. However, query-based prediction of ILI morbidity was associated with a greater error. Age-class-specific query-based models varied significantly in terms of prediction accuracy. In the 0-4 and 25-44-year age-groups, these did well and outperformed exponential smoothing predictions; in the 15-24 and ≥ 65-year age-classes, however, the query-based models were inaccurate and highly overestimated peak height. In all but one age-class, peak timing predicted by the query-based models coincided with observed timing.The accuracy of web query-based models in predicting ILI morbidity rates could differ among ages. Greater age-specific detail may be useful in flu query-based studies in order to account for age-specific features of the epidemiology of ILI.

    1. Automated data extraction from general practice records in an Australian setting: trends in influenza-like illness in sentinel general practices and emergency departments.

      Science.gov (United States)

      Liljeqvist, Gösta T H; Staff, Michael; Puech, Michele; Blom, Hans; Torvaldsen, Siranda

      2011-06-06

      Influenza intelligence in New South Wales (NSW), Australia is derived mainly from emergency department (ED) presentations and hospital and intensive care admissions, which represent only a portion of influenza-like illness (ILI) in the population. A substantial amount of the remaining data lies hidden in general practice (GP) records. Previous attempts in Australia to gather ILI data from GPs have given them extra work. We explored the possibility of applying automated data extraction from GP records in sentinel surveillance in an Australian setting.The two research questions asked in designing the study were: Can syndromic ILI data be extracted automatically from routine GP data? How do ILI trends in sentinel general practice compare with ILI trends in EDs? We adapted a software program already capable of automated data extraction to identify records of patients with ILI in routine electronic GP records in two of the most commonly used commercial programs. This tool was applied in sentinel sites to gather retrospective data for May-October 2007-2009 and in real-time for the same interval in 2010. The data were compared with that provided by the Public Health Real-time Emergency Department Surveillance System (PHREDSS) and with ED data for the same periods. The GP surveillance tool identified seasonal trends in ILI both retrospectively and in near real-time. The curve of seasonal ILI was more responsive and less volatile than that of PHREDSS on a local area level. The number of weekly ILI presentations ranged from 8 to 128 at GP sites and from 0 to 18 in EDs in non-pandemic years. Automated data extraction from routine GP records offers a means to gather data without introducing any additional work for the practitioner. Adding this method to current surveillance programs will enhance their ability to monitor ILI and to detect early warning signals of new ILI events.

    2. Estimation of community-level influenza-associated illness in a low resource rural setting in India.

      Science.gov (United States)

      Saha, Siddhartha; Gupta, Vivek; Dawood, Fatimah S; Broor, Shobha; Lafond, Kathryn E; Chadha, Mandeep S; Rai, Sanjay K; Krishnan, Anand

      2018-01-01

      To estimate rates of community-level influenza-like-illness (ILI) and influenza-associated ILI in rural north India. During 2011, we conducted household-based healthcare utilization surveys (HUS) for any acute medical illness (AMI) in preceding 14days among residents of 28villages of Ballabgarh, in north India. Concurrently, we conducted clinic-based surveillance (CBS) in the area for AMI episodes with illness onset ≤3days and collected nasal and throat swabs for influenza virus testing using real-time polymerase chain reaction. Retrospectively, we applied ILI case definition (measured/reported fever and cough) to HUS and CBS data. We attributed 14days of risk-time per person surveyed in HUS and estimated community ILI rate by dividing the number of ILI cases in HUS by total risk-time. We used CBS data on influenza positivity and applied it to HUS-based community ILI rates by age, month, and clinic type, to estimate the community influenza-associated ILI rates. The HUS of 69,369 residents during the year generated risk-time of 3945 person-years (p-y) and identified 150 (5%, 95%CI: 4-6) ILI episodes (38 ILI episodes/1,000 p-y; 95% CI 32-44). Among 1,372 ILI cases enrolled from clinics, 126 (9%; 95% CI 8-11) had laboratory-confirmed influenza (A (H3N2) = 72; B = 54). After adjusting for age, month, and clinic type, overall influenza-associated ILI rate was 4.8/1,000 p-y; rates were highest among children value of influenza vaccination among target groups.

    3. Comparison of the efficiency of bacterial and fungal laccases in delignification and detoxification of steam-pretreated lignocellulosic biomass for bioethanol production.

      Science.gov (United States)

      De La Torre, María; Martín-Sampedro, Raquel; Fillat, Úrsula; Eugenio, María E; Blánquez, Alba; Hernández, Manuel; Arias, María E; Ibarra, David

      2017-11-01

      This study evaluates the potential of a bacterial laccase from Streptomyces ipomoeae (SilA) for delignification and detoxification of steam-exploded wheat straw, in comparison with a commercial fungal laccase from Trametes villosa. When alkali extraction followed by SilA laccase treatment was applied to the water insoluble solids fraction, a slight reduction in lignin content was detected, and after a saccharification step, an increase in both glucose and xylose production (16 and 6%, respectively) was observed. These effects were not produced with T. villosa laccase. Concerning to the fermentation process, the treatment of the steam-exploded whole slurry with both laccases produced a decrease in the phenol content by up to 35 and 71% with bacterial and fungal laccases, respectively. The phenols reduction resulted in an improved performance of Saccharomyces cerevisiae during a simultaneous saccharification and fermentation (SSF) process, improving ethanol production rate. This enhancement was more marked with a presaccharification step prior to the SSF process.

    4. Progress in the medicinal chemistry of silicon: C/Si exchange and beyond.

      Science.gov (United States)

      Fujii, Shinya; Hashimoto, Yuichi

      2017-04-01

      Application of silyl functionalities is one of the most promising strategies among various 'elements chemistry' approaches for the development of novel and distinctive drug candidates. Replacement of one or more carbon atoms of various biologically active compounds with silicon (so-called sila-substitution) has been intensively studied for decades, and is often effective for alteration of activity profile and improvement of metabolic profile. In addition to simple C/Si exchange, several novel approaches for utilizing silicon in medicinal chemistry have been suggested in recent years, focusing on the intrinsic differences between silicon and carbon. Sila-substitution offers great potential for enlarging the chemical space of medicinal chemistry, and provides many options for structural development of drug candidates.

    5. Membangun Civil Religion Pada Masyarakat Yang Plural; Dilema Pancasila Di Era Reformasi

      OpenAIRE

      Ruslan, Idrus

      2011-01-01

      Tema civil religion merupakan tema yang terkait dalam konteks sebuah negara yang plural seperti Indonesia. Arti civil religion itu sendiri secara harfiah adalah agama sipil (rakyat), akan tetapi jika dilihat secara apa adanya seakan-akan merupakan agama tersendiri. Oleh karenanya lebih tepat jika diartikan “Keberagamaan sipil”, karena memang dia tidak memiliki Tuhan, kitab suci, rasul, pendeta, biksu dan sebagainya. Indonesia dengan dasar negara Pancasila dimana kata “Tuhan” dalam sila Ketuha...

    6. Operation UPSHOT-KNOTHOLE. Operational Summary, Nevada Proving Grounds, 1 March - 9 June 1953

      Science.gov (United States)

      1982-08-01

      Office was superseded by a group of information representatives from the AEC, the FODA ., and the DOD under the direction of Mfr. Morse S&l31 bury, =E...tests designed for statistical analysis of effects. (5) Tactical coznznications systemax. (6) FOL installations. (7) Field madical installations...involved in the operation. The Silas Mason Company was the contractor responsible for drawing up the route line chart and installing the timing lines and

    7. A traditional boats and navigational history of Odisha, East coast of India

      Digital Repository Service at National Institute of Oceanography (India)

      Tripati, S.

      Environ., vol.40(2); 2015; 80-93 A study of Traditional Boats and Navigational History of Odisha, East coast of India Sila Tripati Marine Archaeology Centre CSIR- National Institute of Oceanography Dona Paula, Goa 403 004... parts of the east coast of India and navigational technology. Keywords: Traditional boats, Navigation, Maritime trade, Odisha, East coast of India 2    Introduction The history of boatbuilding is as old as the relationship between man...

    8. Pozovi menja tihho po imeni / Artur Pärnoja ; interv. Jevgeni Kapov

      Index Scriptorium Estoniae

      Pärnoja, Artur

      2004-01-01

      Narvas filmis vene telekanali ORT võttegrupp seriaali "Tappev jõud" ("Uboinaja sila") järjekordse osa "Relvavendlus" ("Bratstvo po oruzhiju") Eestiga seotud episoode. Filmist ja selle aluseks olnud tõeliselt asetleinud sündmustest jutustab filmi konsultant Artur Pärnoja. Vene Teatri näitleja Kirill Käro räägib oma tööst selles filmis

    9. La mirada transgenérica

      Directory of Open Access Journals (Sweden)

      Judith Halberstam

      2004-01-01

      Full Text Available This text studies the construction and development of the transgender look in contemporary queer cinema, specifically: The Crying Game (Neil Jordan, 1992, Boys don't Cry (Kimberly Peirce, 2000 and By Hook or by Crook (Harry Dodge and Silas Howard, 2001. The analysis examines carefully the constitution of a meaningful materiality of the body through the gaze and the dialogue-confrontation between the transgender look and mainstream cinema's gaze, in its capability to regulate pleasures and sexual identities.

    10. A placebo-controlled trial of Korean red ginseng extract for preventing Influenza-like illness in healthy adults

      Directory of Open Access Journals (Sweden)

      Ha Ki-Chan

      2012-02-01

      Full Text Available Abstracts Background Standardized Korean red ginseng extract has become the best-selling influenza-like illness (ILI remedy in Korea, yet much controversy regarding the efficacy of the Korean red ginseng (KRG in reducing ILI incidence remains. The aim of the study is to assess the efficacy of the KRG extract on the ILI incidence in healthy adults. Methods/Design We will conduct a randomized, double-blind, placebo-controlled study at the onset of the influenza seasons. A total of 100 subjects 30-70 years of age will be recruited from the general populations. The subjects will be instructed to take 9 capsules per day of either the KRG extract or a placebo for a period of 3 months. The primary outcome measure is to assess the frequency of ILI onset in participated subjects. Secondary variable measures will be included severity and duration of ILI symptoms. The ILI symptoms will be scored by subjects using a 4-point scale. Discussion This study is a randomized placebo controlled trial to evaluate the efficacy of the KRG extract compared to placebo and will be provided valuable new information about the clinical and physiological effects of the KRG extract on reduction of ILI incidence including flu and upper respiratory tract infections. The study has been pragmatically designed to ensure that the study findings can be implemented into clinical practice if KRG extract can be shown to be an effective reduction strategy in ILI incidence. Trial Registration NCT01478009.

    11. The Implementation of Web 2.0 Technology for Information Literacy Instruction in Thai University Libraries

      Science.gov (United States)

      Sawetrattanasatian, Oranuch

      2014-01-01

      Web 2.0 technology has drawn much attention recently as a fascinating tool for Information Literacy Instruction (ILI), especially in academic libraries. This research was aimed to investigate the implementation of Web 2.0 technology for ILI in Thai university libraries, in terms of information literacy skills being taught, types of Web 2.0…

    12. Kimi mantlipärija sai mõjukatele ametipostidele / Kaivo Kopli

      Index Scriptorium Estoniae

      Kopli, Kaivo

      2010-01-01

      Põhja-Korea pealinnas toimunud Tööliste Partei kongressil määrati riigi liidri Kim Jong-ili noorim poeg Kim Jong-un kesksõjakomisjoni aseesimeheks ja keskkomitee liikmeks. Poliitbüroosse määrati alternatiivliikmena Kim Jong-ili õe abikaasa Chang Song-taek

    13. O NEKIM ČAKAVSKIM IMENIMA MARIJANSKIH BLAGDANA

      OpenAIRE

      Vulić, Sanja

      1990-01-01

      Imena desetak marijanskih blagdana u desetak različitih čakavskih mjesnih govora međusobno se više ili manje razlikuju. Najčešće su motivirana samim otajstvom blagdana ili toponimom uz koji je vezan početak slavljenja stanovitoga blagdana, odnosno ojkonimom gdje se blagdan osobito svečano slavi.

    14. Influenza-Like Illness among University Students: Symptom Severity and Duration Due to Influenza Virus Infection Compared to Other Etiologies

      Science.gov (United States)

      Mullins, Jocelyn; Cook, Robert; Rinaldo, Charles; Yablonsky, Eric; Hess, Rachel; Piazza, Paolo

      2011-01-01

      Objective: University students with influenza-like illness (ILI) were assessed to determine whether symptom severity, duration, or missed days of school or work varied according to etiology. Participants: Sixty persons presenting to a university health clinic with ILI symptoms during 3 consecutive influenza seasons completed baseline survey and…

    15. Forecasting influenza-like illness dynamics for military populations using neural networks and social media.

      Directory of Open Access Journals (Sweden)

      Svitlana Volkova

      Full Text Available This work is the first to take advantage of recurrent neural networks to predict influenza-like illness (ILI dynamics from various linguistic signals extracted from social media data. Unlike other approaches that rely on timeseries analysis of historical ILI data and the state-of-the-art machine learning models, we build and evaluate the predictive power of neural network architectures based on Long Short Term Memory (LSTMs units capable of nowcasting (predicting in "real-time" and forecasting (predicting the future ILI dynamics in the 2011 - 2014 influenza seasons. To build our models we integrate information people post in social media e.g., topics, embeddings, word ngrams, stylistic patterns, and communication behavior using hashtags and mentions. We then quantitatively evaluate the predictive power of different social media signals and contrast the performance of the-state-of-the-art regression models with neural networks using a diverse set of evaluation metrics. Finally, we combine ILI and social media signals to build a joint neural network model for ILI dynamics prediction. Unlike the majority of the existing work, we specifically focus on developing models for local rather than national ILI surveillance, specifically for military rather than general populations in 26 U.S. and six international locations., and analyze how model performance depends on the amount of social media data available per location. Our approach demonstrates several advantages: (a Neural network architectures that rely on LSTM units trained on social media data yield the best performance compared to previously used regression models. (b Previously under-explored language and communication behavior features are more predictive of ILI dynamics than stylistic and topic signals expressed in social media. (c Neural network models learned exclusively from social media signals yield comparable or better performance to the models learned from ILI historical data, thus

    16. Forecasting influenza-like illness dynamics for military populations using neural networks and social media.

      Science.gov (United States)

      Volkova, Svitlana; Ayton, Ellyn; Porterfield, Katherine; Corley, Courtney D

      2017-01-01

      This work is the first to take advantage of recurrent neural networks to predict influenza-like illness (ILI) dynamics from various linguistic signals extracted from social media data. Unlike other approaches that rely on timeseries analysis of historical ILI data and the state-of-the-art machine learning models, we build and evaluate the predictive power of neural network architectures based on Long Short Term Memory (LSTMs) units capable of nowcasting (predicting in "real-time") and forecasting (predicting the future) ILI dynamics in the 2011 - 2014 influenza seasons. To build our models we integrate information people post in social media e.g., topics, embeddings, word ngrams, stylistic patterns, and communication behavior using hashtags and mentions. We then quantitatively evaluate the predictive power of different social media signals and contrast the performance of the-state-of-the-art regression models with neural networks using a diverse set of evaluation metrics. Finally, we combine ILI and social media signals to build a joint neural network model for ILI dynamics prediction. Unlike the majority of the existing work, we specifically focus on developing models for local rather than national ILI surveillance, specifically for military rather than general populations in 26 U.S. and six international locations., and analyze how model performance depends on the amount of social media data available per location. Our approach demonstrates several advantages: (a) Neural network architectures that rely on LSTM units trained on social media data yield the best performance compared to previously used regression models. (b) Previously under-explored language and communication behavior features are more predictive of ILI dynamics than stylistic and topic signals expressed in social media. (c) Neural network models learned exclusively from social media signals yield comparable or better performance to the models learned from ILI historical data, thus, signals from

    17. Blood Pyrrole-Protein Adducts--A Biomarker of Pyrrolizidine Alkaloid-Induced Liver Injury in Humans.

      Science.gov (United States)

      Ruan, Jianqing; Gao, Hong; Li, Na; Xue, Junyi; Chen, Jie; Ke, Changqiang; Ye, Yang; Fu, Peter Pi-Cheng; Zheng, Jiang; Wang, Jiyao; Lin, Ge

      2015-01-01

      Pyrrolizidine alkaloids (PAs) induce liver injury (PA-ILI) and is very likely to contribute significantly to drug-induced liver injury (DILI). In this study we used a newly developed ultra-high performance liquid chromatography-triple quadrupole-mass spectrometry (UHPLC-MS)-based method to detect and quantitate blood pyrrole-protein adducts in DILI patients. Among the 46 suspected DILI patients, 15 were identified as PA-ILI by the identification of PA-containing herbs exposed. Blood pyrrole-protein adducts were detected in all PA-ILI patients (100%). These results confirm that PA-ILI is one of the major causes of DILI and that blood pyrrole-protein adducts quantitated by the newly developed UHPLC-MS method can serve as a specific biomarker of PA-ILI.

    18. Eight years of the Great Influenza Survey to monitor influenza-like illness in Flanders.

      Directory of Open Access Journals (Sweden)

      Yannick Vandendijck

      Full Text Available In 2003, an internet-based monitoring system of influenza-like illness (ILI, the Great Influenza Survey (GIS, was initiated in Belgium. For the Flemish part of Belgium, we investigate the representativeness of the GIS population and assess the validity of the survey in terms of ILI incidence during eight influenza seasons (from 2003 through 2011. The validity is investigated by comparing estimated ILI incidences from the GIS with recorded incidences from two other monitoring systems, (i the Belgian Sentinel Network and (ii the Google Flu Trends, and by performing a risk factor analysis to investigate whether the risks on acquiring ILI in the GIS population are comparable with results in the literature. A random walk model of first order is used to estimate ILI incidence trends based on the GIS. Good to excellent correspondence is observed between the estimated ILI trends in the GIS and the recorded trends in the Sentinel Network and the Google Flu Trends. The results of the risk factor analysis are in line with the literature. In conclusion, the GIS is a useful additional surveillance network for ILI monitoring in Flanders. The advantages are the speed at which information is available and the fact that data is gathered directly in the community at an individual level.

    19. The Fine Temporal Structure of the Rat Licking Pattern: What Causes the Variabiliy in the Interlick Intervals and How is it Affected by the Drinking Solution?

      Science.gov (United States)

      2013-01-01

      Licking is a repetitive behavior controlled by a central pattern generator. Even though interlick intervals (ILIs) within bursts of licks are considered fairly regular, the conditions that affect their variability are unknown. We analyzed the licking pattern in rats that licked water, 10% sucrose solution, or 10% ethanol solution, in 90-min recording sessions after 4h of water deprivation. The histograms of ILIs indicate that licking typically occurred at a preferred ILI of about 130−140ms with evidence of bimodal or multimodal distributions due to occasional licking failures. We found that the longer the pause between bursts of licks, the shorter was the first ILI of the burst. When bursts of licks were preceded by a pause >4 s, the ILI was the shortest (~110ms) at the beginning of the burst, and then it increased rapidly in the first few licks and slowly in subsequent licks. Interestingly, the first ILI of a burst of licks was not significantly different when licking any of the 3 solutions, but subsequent licks exhibited a temporal pattern characteristic of each solution. The rapid deceleration in intraburst licking rate was due to an increase from ~27ms to ~56ms in the tongue-spout contact duration while the intercontact interval was only slightly changed (80−90ms). Therefore, the contact duration seems to be the major factor that increases the variability in the ILIs and could be another means for the rat to adjust the amount of fluid ingested in each individual lick. PMID:23902635

    20. Personality, psychological stress, and self-reported influenza symptomatology

      Directory of Open Access Journals (Sweden)

      Croon Marcel A

      2007-11-01

      Full Text Available Abstract Background Psychological stress and negative mood have been related to increased vulnerability to influenza-like illness (ILI. This prospective study re-evaluated the predictive value of perceived stress for self-reported ILI. We additionally explored the role of the negative affectivity and social inhibition traits. Methods In this study, 5,404 respondents from the general population were assessed in terms of perceived stress, personality, and control variables (vaccination, vitamin use, exercise, etc.. ILI were registered weekly using self-report measures during a follow-up period of four weeks. Results Multivariable logistic regression analysis on ILI was performed to test the predictive power of stress and personality. In this model, negative affectivity (OR = 1.05, p = 0.009, social inhibition (OR = 0.97, p = 0.011, and perceived stress (OR = 1.03, p = 0.048 predicted ILI reporting. Having a history of asthma (OR = 2.33, p = Conclusion Elderly and socially inhibited persons tend to report less ILI as compared to their younger and less socially inhibited counterparts. In contrast, asthma, trait negative affectivity, and perceived stress were associated with higher self-report of ILI. Our results demonstrate the importance of including trait markers in future studies examining the relation between stress and self-report symptom measures.

    1. Comparison of outpatient medically attended and community-level influenza-like illness-New York City, 2013-2015.

      Science.gov (United States)

      Russell, Kate E; Fowlkes, Ashley; Stockwell, Melissa S; Vargas, Celibell Y; Saiman, Lisa; Larson, Elaine L; LaRussa, Philip; Di Lonardo, Steve; Popowich, Michael; St George, Kirsten; Steffens, Andrea; Reed, Carrie

      2018-05-01

      Surveillance of influenza-like illness (ILI) in the United States is primarily conducted through medical settings despite a significant burden of non-medically attended ILI. To assess consistency between surveillance for respiratory viruses in outpatient and community settings using ILI surveillance from the Centers for Disease Control and Prevention Influenza Incidence Surveillance Project (IISP) and the Mobile Surveillance for Acute Respiratory Infections (ARI) and Influenza-Like Illness in the Community (MoSAIC) Study. The Influenza Incidence Surveillance Project conducts ILI surveillance in 3 primary care clinics in New York City, and MoSAIC conducts community-based ILI/ARI surveillance through text messaging among a cohort of New York City residents. Both systems obtain respiratory specimens from participants with ILI/ARI and test for multiple pathogens. We conducted a retrospective review of ILI cases in IISP and MoSAIC from January 2013 to May 2015 with descriptive analyses of clinical and laboratory data. Five-hundred twelve MoSAIC and 669 IISP participants met an ILI criteria (fever with cough or sore throat) and were included. Forty percent of MoSAIC participants sought care; the majority primary care. Pathogens were detected in 63% of MoSAIC and 70% of IISP cases. The relative distribution of influenza and other respiratory viruses detected was similar; however, there were statistically significant differences in the frequency that were not explained by care seeking. Outpatient and community-based surveillance in the one found similar timing and relative distribution of respiratory viruses, but community surveillance in a single neighborhood may not fully capture the variations in ILI etiology that occur more broadly. Published 2018. This article is a U.S. Government work and is in the public domain in the USA. Influenza and Other Respiratory Viruses published by John Wiley & Sons Ltd.

    2. Hospital triage system for adult patients using an influenza-like illness scoring system during the 2009 pandemic--Mexico.

      Directory of Open Access Journals (Sweden)

      Eduardo Rodriguez-Noriega

      2010-05-01

      Full Text Available Pandemic influenza A (H1N1 virus emerged during 2009. To help clinicians triage adults with acute respiratory illness, a scoring system for influenza-like illness (ILI was implemented at Hospital Civil de Guadalajara, Mexico.A medical history, laboratory and radiology results were collected on emergency room (ER patients with acute respiratory illness to calculate an ILI-score. Patients were evaluated for admission by their ILI-score and clinicians' assessment of risk for developing complications. Nasal and throat swabs were collected from intermediate and high-risk patients for influenza testing by RT-PCR. The disposition and ILI-score of those oseltamivir-treated versus untreated, clinical characteristics of 2009 pandemic influenza A (H1N1 patients versus test-negative patients were compared by Pearson's Chi(2, Fisher's Exact, and Wilcoxon rank-sum tests.Of 1840 ER patients, 230 were initially hospitalized (mean ILI-score = 15, and the rest were discharged, including 286 ambulatory patients given oseltamivir (median ILI-score = 11, and 1324 untreated (median ILI-score = 5. Fourteen (1% untreated patients returned, and 3 were hospitalized on oseltamivir (median ILI-score = 19. Of 371 patients tested by RT-PCR, 104 (28% had pandemic influenza and 42 (11% had seasonal influenza A detected. Twenty (91% of 22 imaged hospitalized pandemic influenza patients had bilateral infiltrates compared to 23 (38% of 61 imaged hospital test-negative patients (p<0.001. One patient with confirmed pandemic influenza presented 6 days after symptom onset, required mechanical ventilation, and died.The triaging system that used an ILI-score complimented clinicians' judgment of who needed oseltamivir and inpatient care and helped hospital staff manage a surge in demand for services.

    3. Seasonality of absolute humidity explains seasonality of influenza-like illness in Vietnam.

      Science.gov (United States)

      Thai, Pham Quang; Choisy, Marc; Duong, Tran Nhu; Thiem, Vu Dinh; Yen, Nguyen Thu; Hien, Nguyen Tran; Weiss, Daniel J; Boni, Maciej F; Horby, Peter

      2015-12-01

      Experimental and ecological studies have shown the role of climatic factors in driving the epidemiology of influenza. In particular, low absolute humidity (AH) has been shown to increase influenza virus transmissibility and has been identified to explain the onset of epidemics in temperate regions. Here, we aim to study the potential climatic drivers of influenza-like illness (ILI) epidemiology in Vietnam, a tropical country characterized by a high diversity of climates. We specifically focus on quantifying and explaining the seasonality of ILI. We used 18 years (1993-2010) of monthly ILI notifications aggregated by province (52) and monthly climatic variables (minimum, mean, maximum temperatures, absolute and relative humidities, rainfall and hours of sunshine) from 67 weather stations across Vietnam. Seasonalities were quantified from global wavelet spectra, using the value of the power at the period of 1 year as a measure of the intensity of seasonality. The 7 climatic time series were characterized by 534 summary statistics which were entered into a regression tree to identify factors associated with the seasonality of AH. Results were extrapolated to the global scale using simulated climatic times series from the NCEP/NCAR project. The intensity of ILI seasonality in Vietnam is best explained by the intensity of AH seasonality. We find that ILI seasonality is weak in provinces experiencing weak seasonal fluctuations in AH (annual power power >17.6). In Vietnam, AH and ILI are positively correlated. Our results identify a role for AH in driving the epidemiology of ILI in a tropical setting. However, in contrast to temperate regions, high rather than low AH is associated with increased ILI activity. Fluctuation in AH may be the climate factor that underlies and unifies the seasonality of ILI in both temperate and tropical regions. Alternatively, the mechanism of action of AH on disease transmission may be different in cold-dry versus hot-humid settings

    4. UČINKOVITOST TRIGGERPOINT TERAPIJE KOD TINITUSA

      OpenAIRE

      Jarak, Irena; Miletić, Marija; Žura, Nikolino

      2016-01-01

      UVOD: Šum u uhu (tinitus) predstavlja percepciju zvuka u uhu ili glavi koja se pojavljuje bez očitog vanjskog zvučnog podražaja, odnosno fantomski slušni podražaj. Pojavu tinitusa može uzrokovati npr. oštećenja ili promjene u otološkom sustavu, tumor, multipla skleroza, kardiovaskularna oboljenja, lijekovi, psihička oboljenja ili mišićnokoštani sustav. Tinitus nije bolest već simptom, tako da ne postoji jedinstvena terapija u njegovom liječenju. M. sternocleidomastoide...

    5. Mura - čovjek - priroda

      OpenAIRE

      Kantar, Sandra; Ivanek-Martinčić, Marjana; Augustinović, Zvjezdana

      2008-01-01

      U ovom je radu dan pregled radova studenata Visokoga gospodarskog učilišta iz Križevaca, nastalih u sklopu Interreg III A projekta suradnje pod naslovom »Mura - čovjek - priroda«. U projektu su sudjelovali Poljoprivredni fakultet Georgikon iz Keszthelyja Sveučilišta Veszprem, Poljoprivredni muzej Georgikon iz Keszthelyja, Nacionalni park Balaton, nevladina organizacija za zaštitu prirode »Bijeli gavran« i Visoko gospodarsko učilište iz Križevaca. Na hrvatskoj strani, priroda uz Muru je vrl...

    6. NITRATI I NITRITI, METABOLIZAM I TOKSIČNOST

      OpenAIRE

      Nujić, Marija; Habuda-Stanić, Mirna

      2017-01-01

      Nitrati i nitriti su kemijski spojevi koji se koriste kao gnojivo, rodenticidi ili konzervansi. Mogu se naći u zraku, tlu, vodi ili hrani (posebice povrću) a mogu se i stvarati u ljudskom tijelu. Nitrati imaju važnu ulogu u hranjenju i metabolizmu biljaka. Nastaju oksidacijom organskog otpada djelovanjem dušičnih bakterija. Ljudi mogu biti izloženi nitratima i nitritima preko konzumacije povrća i mesnih prerađevina, a manjim dijelom preko vode ili ostale hrane. Pijenje vode sa već...

    7. Determination of customer satisfaction with services of pizzerias “Cili pica”

      OpenAIRE

      Pilelienė, Lina; Grigaliūnaitė, Viktorija

      2012-01-01

      Straipsnyje analizuojamas vartotojų pasitenkinimas „Čili pica“ picerijų paslaugomis. Straipsnio tikslas – įvertinus vartotojų pasitenkinimą „Čili pica“ picerijų paslaugomis, nustatyti jį formuojančius veiksnius. Tyrimas atliekamas adaptuojant Europos Vartotojų Pasitenkinimo Indekso metodiką. Remiantis tyrimo rezultatais, „Čili pica“ picerijoms nustatyti modelio kintamieji, kuriuos reikėtų stiprinti, siekiant padidinti vartotojų pasitenkinimą šiomis picerijomis ir jų teikiamomis paslaugomis. ...

    8. Influenza-like illness in an urban community of Salvador, Brazil: incidence, seasonality and risk factors.

      Science.gov (United States)

      Oliveira, Carlos R; Costa, Gisela S R; Paploski, Igor A D; Kikuti, Mariana; Kasper, Amelia M; Silva, Monaise M O; Tavares, Aline S; Cruz, Jaqueline S; Queiroz, Tássia L; Lima, Helena C A V; Calcagno, Juan; Reis, Mitermayer G; Weinberger, Daniel M; Shapiro, Eugene D; Ko, Albert I; Ribeiro, Guilherme S

      2016-03-15

      Our understanding of the epidemiology of influenza is limited in tropical regions, which in turn has hampered identifying optimal region-specific policy to diminish disease burden. Influenza-like illness (ILI) is a clinical diagnosis that can be used as a surrogate for influenza. This study aimed to define the incidence and seasonality of ILI and to assess its association with climatic variables and school calendar in an urban community in the tropical region of Salvador, Brazil. Between 2009 and 2013, we conducted enhanced community-based surveillance for acute febrile illnesses (AFI) among patients ≥ 5 years of age in a slum community emergency unit in Salvador, Brazil. ILI was defined as a measured temperature of ≥ 37.8 °C or reported fever in a patient with cough or sore throat for ≤ 7 days, and negative test results for dengue and leptospirosis. Seasonality was analyzed with a harmonic regression model. Negative binomial regression models were used to correlate ILI incidence with rainfall, temperature, relative humidity and the number of days per month that schools were in session while controlling for seasonality. There were 2,651 (45.6% of 5,817 AFI patients) ILI cases with a mean annual incidence of 60 cases/1,000 population (95% CI 58-62). Risk of ILI was highest among 5-9 year olds with an annual incidence of 105 cases/1,000 population in 2009. ILI had a clear seasonal pattern with peaks between the 35-40th week of the year. ILI peaks were higher and earlier in 5-9 year olds compared with > 19 year olds. No association was seen between ILI and precipitation, relative humidity or temperature. There was a significant association between the incidence of ILI in children 5-9 years of age and number of scheduled school days per month. We identified a significant burden of ILI with distinct seasonality in the Brazilian tropics and highest rates among young school-age children. Seasonal peaks of ILI in children 5-9 years of age were positively associated

    9. Komunikacijski aspekt ukrašavanja tijela u zapadnoj kulturi

      OpenAIRE

      Dadić, Nikolina

      2017-01-01

      Ukrašavanje tijela kroz povijest imalo je različita značenja, bilo religijska, ritualna ili estetska, neovisno o stupnju civilizacijskog razvoja, kulturi i kontinentu. Ukrašavanje se održalo do danas, a tijekom različitih povijesnih razdoblja bilo je podložno modi i trendovima, jednako kao i odjeća, obuća ili frizura. Još uvijek postoje predrasude koje kod nekih osoba izazivaju odbojnost što se tiče ljudi koji nose tetovaže ili ukrase i u čistoj suprotnosti su sa jednim liberalnim pogledo...

    10. ŽENE U ZNANOSTI: STAKLENI STROP

      OpenAIRE

      PRIJIĆ-SAMARŽIJA, Snježana; AVELINI HOLJEVAC, Ivanka; TURK, Marko

      2009-01-01

      Temeljni cilj članka jest propitivanje postojanja "staklenoga stropa" ili podzastupljenosti žena na rukovodećim položajima u ustanovama znanosti i visokog obrazovanja kakvo je Sveučilište u Rijeci, uključivo i mehanizama koji ga uzrokuju. Prvi dio članka sadrži kratak pregled i analizu empirijskih rezultata istraživanja provedenog na Sveučilištu u Rijeci, koji nedvojbeno upućuju na prisutnost efekta "staklenoga stropa" i, shodno tome, na postojanje prikrivene primarne i s...

    11. Vrste i tehnike 3D modeliranja

      OpenAIRE

      Bernik, Andrija

      2010-01-01

      Proces stvaranja 3D stvarnih ili imaginarnih objekata naziva se 3D modeliranje. Razvoj računalne tehnologije omogućuje korisniku odabir raznih metoda i tehnika kako bi se postigla optimalna učinkovitost. Odabir je vezan za klasično 3D modeliranje ili 3D skeniranje pomoću specijaliziranih programskih i sklopovskih rješenja. 3D tehnikama modeliranja korisnik može izraditi 3D model na nekoliko načina: koristi poligone, krivulje ili hibrid dviju spomenutih tehnika pod nazivom subdivizijsko modeli...

    12. Primena metoda ekspertskog ocenjivanja pri oceni profesionalnog rizika

      OpenAIRE

      Zoran Novaković

      2007-01-01

      Osnovni cilj utvrđivanja ocene profesionalnog rizika je preventivno delovanje u funkciji bezbednosti i zaštite zdravlja zaposlenih, tj. preduzimanje opštih i posebnih mera zaštite na radu radi eliminisanja opasnosti ili štetnosti, ili smanjivanja vremena ekspozicije zaposlenog određenim faktorima rizika u sredinama gde je ustanovljena njihova prisutnost. U mnogim slučajevima raspoloživi podaci o prethodnim štetnim događajima su nepotpuni ili nisu dovoljno statistički relevantni...

    13. indicators of apoptosis in Duchenne Muscular Dystrophy Patients

      African Journals Online (AJOL)

      and at the molecular level versus 20 age and socioeconomic matching healthy boys. ... to the tumor necrosis factor superfam- ily and induces apoptosis ... tory cell induced apoptosis in blood of ..... Brain 1997; 120 (Pt 6): 929-38. Butterfield TA ...

    14. BEDEN ETKİLEŞİMLİ MEKAN TASARIMI

      OpenAIRE

      ADIGÜZEL ÖZBEK, Derya

      2018-01-01

      İnsanlar bedenli varlıklar olarak bedeni aracılığı ile dünyaya temaseder, onunla ilişki kurar ve etkileşime geçerler. İnsanların dünya ile ilişkisibeden üzerinden tanımlanmakta, bu ilişki doğrultusunda biçimlenmektedir. Mekanve bedenin etkileşim içindeki devingen ilişkisi tasarımda önemli bir yeresahiptir. Mekanın, statik beden için standart üretimi yerine deneyimleyenkullanıcı için tasarlanması gerekmektedir. Çalışmada, bu anlayışlayapılandırılan Mekan-Beden Etkileşimi dersi ve bu ders kapsa...

    15. Globalizatsija : put dlja vsego tshelovetshestva / Viktor Vaseha

      Index Scriptorium Estoniae

      Vaseha, Viktor

      2000-01-01

      Globaliseeruva maailma sisemistest vastuoludest, "globaalse" eliidi tekkimisest, globaliseerumisest kui uuskolonialismi varjunimest. Vastukaja Mihhail Balev'i artiklile "Eksperiment po globalizatsii, ili Evrosojuz kak simpatitshnõi oksjumoron" Raduga, 2000, nr.1

    16. Influenza surveillance in Europe. Comparing intensity levels calculated using the Moving Epidemic Method.

      LENUS (Irish Health Repository)

      Vega, Tomás

      2015-05-30

      Although influenza-like illnesses (ILI) and acute respiratory illnesses (ARI) surveillance are well established in Europe, the comparability of intensity among countries and seasons remains an unresolved challenge.

    17. Deep sequence characterisation of a divergent HPIV-4a from an adult with prolonged influenza-like illness

      Directory of Open Access Journals (Sweden)

      Katherine E. Arden

      2015-12-01

      Deep sequencing allowed identification and genomic characterisation of a possible pathogen from an ILI as well as being an important tool to aid future understanding of the linkages between viral genetic variation, transmission and disease prognosis.

    18. Advanced Propellants for Scalable, Multipurpose Electrospray Ion Thrusters

      Data.gov (United States)

      National Aeronautics and Space Administration — Ionic liquid ion sources (ILIS) have numerous applications in spacecraft propulsion and focused ion beam technologies. The Space Propulsion Lab at the Massachusetts...

    19. Development of dual field magnetic flux leakage (MFL) inspection technology to detect mechanical damage.

      Science.gov (United States)

      2013-03-01

      This report details the development and testing of a dual magnetization in-line inspection (ILI) : tool for detecting mechanical damage in operating pipelines, including the first field trials of a : fully operational dual-field magnetic flux leakage...

    20. A simple and reliable methodology to detect egg white in art samples

      Indian Academy of Sciences (India)

      2013-04-26

      Apr 26, 2013 ... threshold density values useful for the detection of ovalbumin in samples from ancient works of art. .... slides a mixture of a water solution of dry egg white and the .... ily, facing the problems of sample leakage, background.

    1. Grass survey of the Itremo Massif records endemic central highland ...

      African Journals Online (AJOL)

      Grasses are members of the plant family Poaceae, and are primar- ily known for their ... Madagascar Conservation & Development is the journal of. Indian Ocean .... cording to the classification by Kellogg (2015). With 64 ..... Flowering plants.

    2. Estimation of community-level influenza-associated illness in a low resource rural setting in India.

      Directory of Open Access Journals (Sweden)

      Siddhartha Saha

      Full Text Available To estimate rates of community-level influenza-like-illness (ILI and influenza-associated ILI in rural north India.During 2011, we conducted household-based healthcare utilization surveys (HUS for any acute medical illness (AMI in preceding 14days among residents of 28villages of Ballabgarh, in north India. Concurrently, we conducted clinic-based surveillance (CBS in the area for AMI episodes with illness onset ≤3days and collected nasal and throat swabs for influenza virus testing using real-time polymerase chain reaction. Retrospectively, we applied ILI case definition (measured/reported fever and cough to HUS and CBS data. We attributed 14days of risk-time per person surveyed in HUS and estimated community ILI rate by dividing the number of ILI cases in HUS by total risk-time. We used CBS data on influenza positivity and applied it to HUS-based community ILI rates by age, month, and clinic type, to estimate the community influenza-associated ILI rates.The HUS of 69,369 residents during the year generated risk-time of 3945 person-years (p-y and identified 150 (5%, 95%CI: 4-6 ILI episodes (38 ILI episodes/1,000 p-y; 95% CI 32-44. Among 1,372 ILI cases enrolled from clinics, 126 (9%; 95% CI 8-11 had laboratory-confirmed influenza (A (H3N2 = 72; B = 54. After adjusting for age, month, and clinic type, overall influenza-associated ILI rate was 4.8/1,000 p-y; rates were highest among children <5 years (13; 95% CI: 4-29 and persons≥60 years (11; 95%CI: 2-30.We present a novel way to use HUS and CBS data to generate estimates of community burden of influenza. Although the confidence intervals overlapped considerably, higher point estimates for burden among young children and older adults shows the utility for exploring the value of influenza vaccination among target groups.

    3. Estimating burden of influenza-associated influenza-like illness and severe acute respiratory infection at public healthcare facilities in Romania during the 2011/12-2015/16 influenza seasons.

      Science.gov (United States)

      Gefenaite, Giedre; Pistol, Adriana; Popescu, Rodica; Popovici, Odette; Ciurea, Daniel; Dolk, Christiaan; Jit, Mark; Gross, Diane

      2018-01-01

      Influenza is responsible for substantial morbidity and mortality, but there is limited information on reliable disease burden estimates, especially from middle-income countries in the WHO European Region. To estimate the incidence of medically attended influenza-associated influenza-like illness (ILI) and hospitalizations due to severe acute respiratory infection (SARI) presenting to public healthcare facilities in Romania. Sentinel influenza surveillance data for ILI and SARI from 2011/12-2015/16, including virological data, were used to estimate influenza-associated ILI and SARI incidence/100 000 and their 95% confidence intervals (95% CI). The overall annual incidence of ILI and influenza-associated ILI per 100 000 persons in Romania varied between 68 (95% CI: 61-76) and 318 (95% CI: 298-338) and between 23 (95% CI: 19-29) and 189 (95% CI: 149-240), respectively. The highest ILI and influenza incidence was among children aged 0-4 years. We estimated that SARI incidence per 100 000 persons was 6 (95% CI: 5-7) to 9 (95% CI: 8-10), of which 2 (95% CI: 1-2) to 3 (95% CI: 2-4) were due to influenza. Up to 0.3% of the Romanian population were annually reported with ILI, and 0.01% was hospitalized with SARI, of which as much as one-third could be explained by influenza. This evaluation was the first study estimating influenza burden in Romania. We found that during each influenza season, a substantial number of persons in Romania suffer from influenza-related ILI or are hospitalized due to influenza-associated SARI. © 2017 The World Health Organization. Influenza and Other Respiratory Viruses. Published by John Wiley & Sons Ltd.

    4. Prevalence and Incidence of Respiratory Syncytial Virus and Other Respiratory Viral Infections in Children Aged 6 Months to 10 Years With Influenza-like Illness Enrolled in a Randomized Trial

      Science.gov (United States)

      Nolan, Terry; Borja-Tabora, Charissa; Lopez, Pio; Weckx, Lily; Ulloa-Gutierrez, Rolando; Lazcano-Ponce, Eduardo; Kerdpanich, Angkool; Weber, Miguel Angel Rodriguez; Mascareñas de Los Santos, Abiel; Tinoco, Juan-Carlos; Safadi, Marco Aurelio P.; Seng, Lim Fong; Hernandez-de Mezerville, Marcela; Faingezicht, Idis; Cruz-Valdez, Aurelio; Feng, Yang; Li, Ping; Durviaux, Serge; Haars, Gerco; Roy-Ghanta, Sumita; Vaughn, David W.; Taylor, Sylvia

      2015-01-01

      Background. The high burden of respiratory syncytial virus (RSV)-associated morbidity and mortality makes vaccine development a priority. Methods. As part of an efficacy trial of pandemic influenza vaccines (NCT01051661), RSV epidemiology in healthy children aged 6 months to <10 years at first vaccination with influenza-like illness (ILI) was evaluated in Australia, Brazil, Colombia, Costa Rica, Mexico, the Philippines, Singapore, and Thailand between February 2010 and August 2011. Active surveillance for ILI was conducted for approximately 1 year, with nasal and throat swabs analyzed by polymerase chain reaction. The prevalence and incidence of RSV among ILI episodes were calculated. Results. A total of 6266 children were included, of whom 2421 experienced 3717 ILI episodes with a respiratory sample available. RSV was detected for 359 ILI episodes, a prevalence of 9.7% (95% confidence interval: 8.7–10.7). The highest prevalence was in children aged 12–23 or 24–35 months in all countries except the Philippines, where it was in children aged 6–11 months. The incidence of RSV-associated ILI was 7.0 (6.3–7.7) per 100 person-years (PY). Eighty-eight ILI episodes resulted in hospitalization, of which 8 were associated with RSV (prevalence 9.1% [4.0–17.1]; incidence 0.2 [0.1–0.3] per 100 PY). The incidence of RSV-associated ILI resulting in medical attendance was 6.0 (5.4–6.7) per 100 PY. RSV B subtypes were observed more frequently than A subtypes. Conclusions. Active surveillance demonstrated the considerable burden of RSV-associated illness that would not be identified through hospital-based surveillance, with a substantial part of the burden occurring in older infants and children. PMID:25673560

    5. Influenza like illness monitoring in adults of the State Capitals and Federal District in Brazil by telephone survey.

      Science.gov (United States)

      Reis, Priscilleyne Ouverney; Iser, Betine Pinto Moehlecke; Souza, Líbia Roberta de Oliveira; Yokota, Renata Tiene de Carvalho; de Almeida, Walquiria Aparecida Ferreira; Bernal, Regina Tomie Ivata; Malta, Deborah Carvalho; de Oliveira, Wanderson Kleber; Penna, Gerson Oliveira

      2011-09-01

      In order to estimate the prevalence of influenza like illness (ILI) in adults from all state capitals and geographic regions in Brazil, a periodical monitoring of ILI cases by the national telephone survey (VIGITEL) was carried out in 2010. A cross-sectional study with 47,876 telephone interviews in the state capitals and Federal District, a probabilistic sample of adult population (>18 years-old) with landline telephone. Questions concerning the results of ILI cases and pandemic influenza (H1N1) 2009, from January 10 to November 30, were analyzed. The proportion of cases stratified by sociodemographic characteristics and Brazilian geographic region was weighted with data from the National Survey with Household Sampling (PNAD) 2008. The prevalence of ILI cases in the last 30 days before interview was 31.2% (95%CI 30.2-32.2%) for all state capitals and the Federal District. This prevalence was higher among women, young adults (18 to 29 years-old) and individuals with 9 to 11 years of schooling. According to the geographic region analysis, Northern Brazil presented the highest prevalence of ILI cases. A tendency to increase with further decrease was observed among the geographic regions, except the Northeast. Need for health care assistance was reported by 26.8% (95%CI 25.1-28.5) from ILI cases. Among ILI cases that sought health care assistance, 2.6% (95%CI 1.8-3.4) reported pandemic influenza (H1N1) 2009 medical suspicion. The results of this survey supported influenza surveillance as it provided timeliness and useful surveillance information, which were not captured by the traditional surveillance system, as the occurrence of ILI and need of health care assistance.

    6. AcEST: DK959664 [AcEST

      Lifescience Database Archive (English)

      Full Text Available ILI6|NS1A_TASV2 Non-structural polyprotein 1A OS=Turkey ast... 30 9.3 sp|Q9ILI5|N...S1AB_TASV2 Non-structural polyprotein 1AB OS=Turkey a... 30 9.3 sp|A5DGN9|NACA_PICGU Nascent polypeptide-ass

    7. Cost of intervention delivery in a lifestyle weight loss trial in type 2 diabetes: results from the Look AHEAD clinical trial

      OpenAIRE

      Rushing, J.; Wing, R.; Wadden, T. A.; Knowler, W. C.; Lawlor, M.; Evans, M.; Killean, T.; Montez, M.; Espeland, M. A.; Zhang, P.

      2017-01-01

      Summary Objective The Action for Health in Diabetes (Look AHEAD) trial was a randomized controlled clinical trial to compare the effects of 10?years of intensive lifestyle intervention (ILI) with a control condition of diabetes support and education (DSE) on health outcomes in over 5,000 participants with type 2 diabetes. The ILI had significantly greater weight losses than DSE throughout the trial. The goal of this analysis is to describe the cost of delivering the intervention. Methods The ...

    8. Lifelong learning in public libraries principles, programs, and people

      CERN Document Server

      Gilton, Donna L

      2012-01-01

      Lifelong Learning in Public Libraries demonstrates that public librarians can promote learning by combining the elements of Information Literacy Instruction (ILI) with traditional practices of public libraries. This approach contributes to the information enfranchisement of patrons and enhances the fulfillment of the traditional goals and purposes of libraries. Donna L. Gilton provides background on ILI and current developments in public library instruction and also examines educational the

    9. Strateški značaj informacijsko-komunikacijske tehnologije u suvremenom međunarodnom okolišu

      OpenAIRE

      Svete, Uroš

      2006-01-01

      Podaci, informacije, razumijevanje i znanje kao elementi kognitivne sheme uvijek determiniraju društvenu moć, isto tako uvijek posebno značajno utječu na političku i vojnu sferu. Za njihovu važnost znali su već u starom vijeku (Sun Tzu), te je stoga potpuno razumljivo da će i u vremenu opće društvene uporabe informacijsko-komunikacijske tehnologije (IKT) imati posebno velik utjecaj na međunarodne odnose, stanje sigurnosti te odnose sila u svijetu. Uporaba IKT je naime promijenila odnose izmeđ...

    10. Synthesis and characterization of lanthanum incorporated mesoporous molecular sieves

      International Nuclear Information System (INIS)

      Pesquera, C.; Gonzalez, F.; Blanco, C.; Sanchez, L.

      2004-01-01

      A series of mesoporous materials under reflux conditions have been synthesized with two silicon sources (fumed silica and sodium silicate) and lanthanum added. The following Si/La molar ratio was used in the samples: 100; 75; 50 and 25. The calcined products were characterized by means of X-ray diffraction, nitrogen adsorption isotherms and energy dispersive X-ray spectrometry (EDS). The BET surface area gradually decreases with an increase in the lanthanum content of the LaxMCM-41 samples. Moreover, the average pore size tends to decrease along with the increase in the La content in the samples

    11. Scientific Opinion on the safety and efficacy of potassium sorbate as a silage additive for all animals except dogs and cats

      OpenAIRE

      EFSA Panel on Additives and Products or Substances used in Animal Feed (FEEDAP)

      2013-01-01

      Potassium sorbate is intended to be used as a technological additive to improve the ensiling process in the range of 90 to 300 mg/kg fresh material. The application of potassium sorbate in the preparation of silage up to the maximum proposed dose of 300 mg/kg forage is safe for the target animals. The additive, when used in silage, is not expected to increase substantially consumer exposure to potassium sorbate. Therefore, the FEEDAP Panel concludes that potassium sorbate, when used as a sila...

    12. Multidrug-Resistant CTX-M-(15, 9, 2)- and KPC-2-Producing Enterobacter hormaechei and Enterobacter asburiae Isolates Possessed a Set of Acquired Heavy Metal Tolerance Genes Including a Chromosomal sil Operon (for Acquired Silver Resistance).

      Science.gov (United States)

      Andrade, Leonardo N; Siqueira, Thiago E S; Martinez, Roberto; Darini, Ana Lucia C

      2018-01-01

      Bacterial resistance to antibiotics is concern in healthcare-associated infections. On the other hand, bacterial tolerance to other antimicrobials, like heavy metals, has been neglected and underestimated in hospital pathogens. Silver has long been used as an antimicrobial agent and it seems to be an important indicator of heavy metal tolerance. To explore this perspective, we searched for the presence of acquired silver resistance genes ( sil operon: silE, silS, silR, silC, silF, silB, silA , and silP ) and acquired extended-spectrum cephalosporin and carbapenem resistance genes ( bla CTX-M and bla KPC ) in Enterobacter cloacae Complex (EcC) ( n = 27) and Enterobacter aerogenes ( n = 8) isolated from inpatients at a general hospital. Moreover, the genetic background of the silA (silver-efflux pump) and the presence of other acquired heavy metal tolerance genes, pcoD (copper-efflux pump), arsB (arsenite-efflux pump), terF (tellurite resistance protein), and merA (mercuric reductase) were also investigated. Outstandingly, 21/27 (78%) EcC isolates harbored silA gene located in the chromosome. Complete sil operon was found in 19/21 silA -positive EcC isolates. Interestingly, 8/20 (40%) E. hormaechei and 5/6 (83%) E. asburiae co-harbored silA/pcoD genes and bla CTX-M-(15,2,or9) and/or bla KPC-2 genes. Frequent occurrences of arsB, terF , and merA genes were detected, especially in silA/pcoD -positive, multidrug-resistant (MDR) and/or CTX-M-producing isolates. Our study showed co-presence of antibiotic and heavy metal tolerance genes in MDR EcC isolates. In our viewpoint, there are few studies regarding to bacterial heavy metal tolerance and we call attention for more investigations and discussion about this issue in different hospital pathogens.

    13. Application of neutron radiation inspection at the Pantex Plant

      International Nuclear Information System (INIS)

      Cassidy, J.P.

      1983-01-01

      A neutron radiographic capability has been established at the Pantex Plant in Amarillo, Texas, which is operated for the Department of Energy by Mason and Hanger-Silas Mason Co. A 3 MeV Van de Graaf accelerator is employed as the neutron source. Neutron radiation inspection techniques have been developed to detect and observe discontinuities in explosive materials encased in aluminum, lead, steel and combinations of these casement materials. These data demonstrate that the capability exists for obtaining satisfactory neutron radiographs of many explosive-loaded components. Additional work will be performed in order to further determine applicable capabilities of the 3 MeV Van de Graaf accelerator. (Auth.)

    14. Stone anchors from Minicoy Island, Lakshadweep, India

      Digital Repository Service at National Institute of Oceanography (India)

      Tripati, S.

      and Ali Rajas of Kerala. It appears that the mainland had contact with these islands during the early centuries of the Christian era, if not earlier (Sila Tripati, 1999). Though Islam came to Lakshadweep after the 11th and 12th centuries AD..., stitches, ropes and even sails (Hourani, 1995). With the passage of time the maritime contacts between the people of Lakshadweep and Arabs became closer, as demonstrated by the discovery of an Indo- 3 Arabian stone anchor in the Jama Mosque on Minicoy...

    15. An overview of maritime archaeological studies in India

      Digital Repository Service at National Institute of Oceanography (India)

      Tripati, S.

      stream_size 66180 stream_content_type text/plain stream_name Maritime_contacts_of_the_past_2015_729.pdf.txt stream_source_info Maritime_contacts_of_the_past_2015_729.pdf.txt Content-Encoding UTF-8 Content-Type text/plain; charset...=UTF-8 AN OVERVIEW OF MARITIME ARCHAEOLOGICAL STUDIES IN INDIA 729An overview of maritime archaeological studies in India Sila Tripati, CSIR-National Institute of Oceanography, Goa, India Trade and cultural contacts among the people...

    16. Analiza poslovnega okolja Nemčije in ZDA

      OpenAIRE

      Podlesnik, Mitja

      2017-01-01

      V diplomskem projektu predstavljamo in primerjamo poslovno okolje dveh držav, ZDA in Nemčije. Na eni strani ZDA kot ena izmed največjih svetovnih velesil v gospodarstvu in tudi v ostalih dejavnikih, na drugi strani pa Nemčija kot največja gonilna sila gospodarstva v Evropi. Ker je globalizacija vedno bolj občutna in v porastu, zraven pa je še velik razcvet digitalne tehnologije, praktično mej v gospodarstvu več ni. Vedno več podjetij širi in posluje izven svojih domačih meja v želji po prepoz...

    17. Predstave o seksu u filmovima na temu postapokalipse

      Directory of Open Access Journals (Sweden)

      Ana Banić-Grubišić

      2016-03-01

      Full Text Available Rad se bavi načinima predstavljanja seksualnih odnosa u filmovima na temu postapokalipse. Razmatraju se različiti oblici/vrste seksualnih veza, koje se javljaju u postkataklizmičnom okruženju, u odnosu na dva tipa zajednica/društava koja nastaju nakon kraja sveta. Ti filmovi pokazuju koliko je ideja o nagonskoj, prirodnoj, biološkoj seksualnosti raširena u popularnoj imaginaciji – seks je u postapokalipsi predstavljen kao pokretačka sila, na isti način kao što je to i glad.

    18. An Intensive Lifestyle Intervention Is an Effective Treatment of Morbid Obesity: The TRAMOMTANA Study—A Two-Year Randomized Controlled Clinical Trial

      Science.gov (United States)

      Burguera, Bartolomé; Jesús Tur, Juan; Escudero, Antonio Jorge; Alos, María; Pagán, Alberto; Cortés, Baltasar; González, Xavier Francesc; Soriano, Joan B.

      2015-01-01

      Bariatric surgery is currently the most effective therapy to induce weight loss in morbidly obese patients. Objective. This controlled, clinical trial with a two-year intervention was aimed at comparing the efficacy of two nonsurgical approaches versus bariatric surgery, on body weight changes and metabolic parameters in morbidly obese patients. Methods. Patients were randomized to an Intensive Lifestyle Intervention (ILI) (n = 60) or Conventional Obesity Therapy (COT) (n = 46). The ILI group received behavioral therapy and nutritional counseling. The COT group received standard medical treatment. They were compared with a third group, Surgical Obesity Group (SOG) (n = 37). Results. Patients who received ILI had a greater percentage of weight loss than patients receiving COT (−11.3% versus −1.6%; p < 0.0044). Interestingly 31.4% of patients included in the ILI group were no longer morbidly obese after just six months of intervention, increasing to 44.4% after 24 months of intervention. The percentage weight loss in SOG was −29.6% after that same period of time. Conclusions. ILI was associated with significant weight loss when compared to COT, in a group of patients with obesity. An ILI approach could be an alternative therapy to patients with obesity, who are not candidates to undergo bariatric surgery. This trial is registered with EudraCT 2009-013737-24. PMID:26257780

    19. An Intensive Lifestyle Intervention Is an Effective Treatment of Morbid Obesity: The TRAMOMTANA Study—A Two-Year Randomized Controlled Clinical Trial

      Directory of Open Access Journals (Sweden)

      Bartolomé Burguera

      2015-01-01

      Full Text Available Bariatric surgery is currently the most effective therapy to induce weight loss in morbidly obese patients. Objective. This controlled, clinical trial with a two-year intervention was aimed at comparing the efficacy of two nonsurgical approaches versus bariatric surgery, on body weight changes and metabolic parameters in morbidly obese patients. Methods. Patients were randomized to an Intensive Lifestyle Intervention (ILI (n=60 or Conventional Obesity Therapy (COT (n=46. The ILI group received behavioral therapy and nutritional counseling. The COT group received standard medical treatment. They were compared with a third group, Surgical Obesity Group (SOG (n=37. Results. Patients who received ILI had a greater percentage of weight loss than patients receiving COT (−11.3% versus −1.6%; p<0.0044. Interestingly 31.4% of patients included in the ILI group were no longer morbidly obese after just six months of intervention, increasing to 44.4% after 24 months of intervention. The percentage weight loss in SOG was −29.6% after that same period of time. Conclusions. ILI was associated with significant weight loss when compared to COT, in a group of patients with obesity. An ILI approach could be an alternative therapy to patients with obesity, who are not candidates to undergo bariatric surgery. This trial is registered with EudraCT 2009-013737-24.

    20. Sentinel surveillance of influenza-like-illness in two cities of the tropical country of Ecuador: 2006-2010.

      Directory of Open Access Journals (Sweden)

      Richard W Douce

      Full Text Available Tropical countries are thought to play an important role in the global behavior of respiratory infections such as influenza. The tropical country of Ecuador has almost no documentation of the causes of acute respiratory infections. The objectives of this study were to identify the viral agents associated with influenza like illness (ILI in Ecuador, describe what strains of influenza were circulating in the region along with their epidemiologic characteristics, and perform molecular characterization of those strains.This is a prospective surveillance study of the causes of ILI based on viral culture of oropharyngeal specimens and case report forms obtained in hospitals from two cities of Ecuador over 4 years. Out of 1,702 cases of ILI, nine viral agents were detected in 597 patients. During the time of the study, seven genetic variants of influenza circulated in Ecuador, causing six periods of increased activity. There appeared to be more heterogeneity in the cause of ILI in the tropical city of Guayaquil when compared with the Andean city of Quito.This was the most extensive documentation of the viral causes of ILI in Ecuador to date. Influenza was a common cause of ILI in Ecuador, causing more than one outbreak per year. There was no well defined influenza season although there were periods of time when no influenza was detected alternating with epidemics of different variant strains.

    1. Safety and potential anticoagulant effects of nebulised heparin in burns patients with inhalational injury at Singapore General Hospital Burns Centre.

      Science.gov (United States)

      Yip, Lian Yee; Lim, Yen Fang; Chan, Hong Ngee

      2011-11-01

      Nebulised heparin, N-acetylcysteine (NAC) and salbutamol were shown to decrease reintubation rates, incidence of atelectasis and mortality in paediatric patients and reduce lung injury scores in adult burns patients with inhalational lung injury (ILI). Nebulised heparin, NAC and salbutamol treatment protocol was introduced in Singapore General Hospital (SGH) Burns Centre in 2006. However, safety data on the use of nebulised heparin and NAC for burns patients with ILI is not well established. In this study, we investigated the safety and potential anticoagulant effects of nebulised heparin in burns patients with ILI. A retrospective study with historical control was conducted. The treatment group consisted of 52 mechanically ventilated adult patients, with a diagnosis of ILI as confirmed by bronchoscopy, admitted to burn intensive care unit (BICU) from the year 2006 to 2009. The group was treated with nebulised heparin, NAC and salbutamol. The control group consists of 11 mechanically ventilated BICU ILI patients treated from year 2001 to 2005 before protocol initiation. Blood coagulation indices (prothrombin time (PT), activated partial thromboplastin time (APTT) and platelet count) were monitored and bleeding incidences were assessed. Blood coagulation indices did not suggest an increase risk of bleeding with nebulised heparin. The APTT, PT and platelet count followed a similar trend for both groups over 7 days. No clinically significant increase in bleeding risk was found to be associated with nebulised heparin. Nebulised heparin was not found to potentiate the risk of bleeding in burns patients with ILI. Copyright © 2011 Elsevier Ltd and ISBI. All rights reserved.

    2. Sentinel Surveillance of Influenza-Like-Illness in Two Cities of the Tropical Country of Ecuador: 2006–2010

      Science.gov (United States)

      Douce, Richard W.; Aleman, Washington; Chicaiza-Ayala, Wilson; Madrid, Cesar; Sovero, Merly; Delgado, Franklin; Rodas, Mireya; Ampuero, Julia; Chauca, Gloria; Perez, Juan; Garcia, Josefina; Kochel, Tadeusz; Halsey, Eric S.; Laguna-Torres, V. Alberto

      2011-01-01

      Background Tropical countries are thought to play an important role in the global behavior of respiratory infections such as influenza. The tropical country of Ecuador has almost no documentation of the causes of acute respiratory infections. The objectives of this study were to identify the viral agents associated with influenza like illness (ILI) in Ecuador, describe what strains of influenza were circulating in the region along with their epidemiologic characteristics, and perform molecular characterization of those strains. Methodology/Findings This is a prospective surveillance study of the causes of ILI based on viral culture of oropharyngeal specimens and case report forms obtained in hospitals from two cities of Ecuador over 4 years. Out of 1,702 cases of ILI, nine viral agents were detected in 597 patients. During the time of the study, seven genetic variants of influenza circulated in Ecuador, causing six periods of increased activity. There appeared to be more heterogeneity in the cause of ILI in the tropical city of Guayaquil when compared with the Andean city of Quito. Conclusions/Significance This was the most extensive documentation of the viral causes of ILI in Ecuador to date. Influenza was a common cause of ILI in Ecuador, causing more than one outbreak per year. There was no well defined influenza season although there were periods of time when no influenza was detected alternating with epidemics of different variant strains. PMID:21887216

    3. EFFECT OF LEVAMISOLE ON POTENTIATION OF CELL MEDIATED IMMNITY IN RHEUMATOID ARTHRITIS

      Directory of Open Access Journals (Sweden)

      MASSOUD A

      1981-05-01

      Full Text Available The leukocyte mi gration test (LHT in the prese nce of na t i v e IgG, and l l e v amis ole were studi ed in 9 patients su f f e ring from cla s s i c a l r h e umatoid ar.thri t i s be f o r e a nd after treatment with l evamisole . Fi f teen heal thy b l o od dono rs we r e s i mi l a r ly l nvestig ated a s cont r o ls ."nT- l ympho c yte s ub-popu lations (To ta l a nd active a nd B-c el l s were als o measured i n both g r o ups simult ane ous l y by E a nd EAC- rosette fo rma t ion Th e results show a significantly diminished leukocyte i nh i b i t o r y fac tor (LIP i n t he p r e sence of nativ a IgG after trea tment wi t h l e v ami s o l e a nd a signifi c a nt inc r e a s e o f active T- c ells in th i s g roup o f patie n t s. In add i t i o n a f t e r treatment tIle Inigration i nde x"nshow an increase i n t he presence o f l e v ami s o l e. We have a lso o b s e r v e d a good cor r e l a t ion between the clinical response o f l e vami sole and ou r immunological d a t a.

    4. Insomnia predicts long-term all-cause mortality after acute myocardial infarction: A prospective cohort study.

      Science.gov (United States)

      Condén, Emelie; Rosenblad, Andreas

      2016-07-15

      Sleep impairment such as insomnia is an established risk factor for the development of cardiovascular disease and acute myocardial infarction (AMI). The aim of the current study was to examine the association between insomnia and all-cause mortality among AMI patients. This prospective cohort study used data on n=732 patients recruited from September 2006 to May 2011 as part of the Västmanland Myocardial Infarction Study (VaMIS), a prospective cohort study of AMI patients living in Västmanland County, Sweden. Participants were followed up for all-cause mortality until December 9, 2015. The outcome of interest was time-to-death (TTD), with the presence of insomnia being the risk factor of main interest. Data were analyzed using a piecewise Cox regression model with change point for insomnia at two years of follow-up, adjusted for socioeconomic, lifestyle and clinical risk factors. In total, n=175 (23.9%) of the participants suffered from insomnia. During a mean (SD) follow-up time of 6.0 (2.5) years (4392person-years), a total of n=231 (31.6%) participants died, n=77 (44.0%) in the insomnia group and n=154 (27.6%) in the non-insomnia group (log-rank test pinsomnia did not imply a higher risk of death during the first two years after AMI (HR 0.849; 95% CI 0.508-1.421; p=0.534). During the period after the first two years, however, insomnia implied a 1.6 times higher risk of death (HR 1.597; 95% CI 1.090-2.341; p=0.016). Insomnia implies a higher risk of death among AMI patients in the long term. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

    5. Planetary gear dynamic response to mesh parametric excitation

      Directory of Open Access Journals (Sweden)

      Vojislav Jovan Batinić

      2013-02-01

      Full Text Available Normal 0 MicrosoftInternetExplorer4 Unutrašnje dinamičke sile i pomeranja po predviđenim stepenima slobode u planetarnim prenosnicima posledica su, prvenstveno, promen-ljivih elastičnih deformacija zubaca u sprezi, vibracija delova prenosnika i odstupanja geometrije ozubljenja usled habanja zubaca i grešaka izrade. U radu se razmatra uticaj vremenski promenljive sprežne krutosti na moguća pomeranja i sile u kontaktima zubaca. Ove funkcije su korišćene kao nelinearni koeficijenti krutosti u sistemu jednačina za ekvivalentni zupčani prenosnik pri utvrđivanju prirode pomeranja i unutrašnjih dinamičkih sila. Rezultati numeričke analize sistema jednačina kojima je opisano dinamičko ponašanje su vremenski - promenljive funkcije pomeranja tačaka sistema i dinamičkih sila u spregama zubaca centralni zupčanik/satelit i satelit/venčanik.

    6. Stabilization of an expansive overconsolidated clay using hydraulic binders

      Directory of Open Access Journals (Sweden)

      Abdelkrim Mahamedi

      2015-04-01

      Full Text Available Urban areas of the wilaya of M’sila in Algeria nowadays experience a considerable development because of an unceasingly increasing demography, from where its extension toward virgin zones is often less favorable than those already urbanized. This wilaya is located in a zone classified as semi-arid, whose geology comprises clayey formations characterized by a high variation of volume when the conditions of their equilibrium are modified (natural climatic phenomena due to a prolonged dryness, human activity by modification of the ground water level because of excessive pumping, configuration of constructions in their environment. This paper presents and analyzes the results of a series of laboratory tests (identification, compaction, penetration and direct shear tests performed on an expansive overconsolidated clay obtained from an urban site situated in Sidi-Hadjrès city (wilaya of M’sila, Algeria, where significant damages frequently appear in the road infrastructures and in the light structures. Test results obtained show that the geotechnical parameteric values deduced from these tests are concordant and confirm the bearing capacity improvement of this natural clay treated with hydraulic binders (composed Portland cement and extinct lime and compacted under the optimum Proctor conditions, which is translated by a significant increase in soil strength and its durability.

    7. Transfer of radiocaesium to barley, rye grass and pea

      International Nuclear Information System (INIS)

      Oehlenschlaeger, M.; Gissel-Nielsen, G.

      1989-11-01

      In areas with intensive farming, as in Denmark, it is of great interest to identify possible countermeasures to be taken in order to reduce the longterm effects of radioactive contamination of arable land. The most important longer-lived radionuclides from the Chernobyl were 137 Cs and 134 Cs. The aim of the present project was to identify crops with relatively low or high root uptake of these two isotopes. Although such differences may be small, a shift in varieties might be a cost-effective way to reduce collective doses. The experiment was carried out at Risoe National Laboratory in the summer of 1988. The species used were: spring barley (Hordeum vulgare L) varieties: Golf, Apex, Anker, Sila; Perennial rye grass (Lolium perenne L.) varieties: Darbo (early) and Patoro (late); Italian rye-grass (Lolium multiflorum) variety: Prego; and pea (Pisum arvense L.) variety: Bodil. Each crop was grown in two types of soil, a clay-loam and an organic soil. 137 Cs was added to the clay-loam. The organic soil, which was contaminated with 137 Cs from the Chernobyl accident, was supplied with 134 Cs. Sila barley and Italian rye-grass were identified among the species tested as plants with a relative high uptake of radio-caesium. (author)

    8. Comparison of Influenza Epidemiological and Virological Characteristics between Outpatients and Inpatients in Zhejiang Province, China, March 2011–June 2015

      Directory of Open Access Journals (Sweden)

      Wei Cheng

      2017-02-01

      Full Text Available Given the rapid rate of global spread and consequently healthcare costs related to influenza, surveillance plays an important role in monitoring the emerging pandemics in China. However, the characteristics of influenza in Southeast of China haven’t been fully studied. Our study use the surveillance data collected from 16 sentinel hospitals across Zhejiang Province during March 2011 through June 2015, including the demographic information and respiratory specimens from influenza-like illness (ILI patients and severe acute respiratory illness (SARI patients. As analysis results, most SARI and ILI patients were in the age group of 0–4 years old (62.38% of ILI and 71.54% of SARI. The respiratory specimens have statistically significantly higher positive rate for influenza among ILI patients than that among SARI patients (p < 0.001. The comparison between ILI patients and SARI patients shows no statistically significantly difference in detecting influenza virus type and influenza A virus subtype. The SARI and ILI patients were found to be positively correlated for overall positive rate (r = 0.63, p < 0.001, the weekly percentage of A(H1N1pdm09 (r = 0.51, p < 0.001, influenza B virus (r = 0.17, p = 0.013, and A/H3N2 (r = 0.43, p < 0.001 among all the positive numbers. Our study demonstrated that the activities of influenza virus, including its subtypes, had a similar temporal pattern between ILI and SARI cases.

    9. Monitoring influenza activity in the United States: a comparison of traditional surveillance systems with Google Flu Trends.

      Directory of Open Access Journals (Sweden)

      Justin R Ortiz

      2011-04-01

      Full Text Available Google Flu Trends was developed to estimate US influenza-like illness (ILI rates from internet searches; however ILI does not necessarily correlate with actual influenza virus infections.Influenza activity data from 2003-04 through 2007-08 were obtained from three US surveillance systems: Google Flu Trends, CDC Outpatient ILI Surveillance Network (CDC ILI Surveillance, and US Influenza Virologic Surveillance System (CDC Virus Surveillance. Pearson's correlation coefficients with 95% confidence intervals (95% CI were calculated to compare surveillance data. An analysis was performed to investigate outlier observations and determine the extent to which they affected the correlations between surveillance data. Pearson's correlation coefficient describing Google Flu Trends and CDC Virus Surveillance over the study period was 0.72 (95% CI: 0.64, 0.79. The correlation between CDC ILI Surveillance and CDC Virus Surveillance over the same period was 0.85 (95% CI: 0.81, 0.89. Most of the outlier observations in both comparisons were from the 2003-04 influenza season. Exclusion of the outlier observations did not substantially improve the correlation between Google Flu Trends and CDC Virus Surveillance (0.82; 95% CI: 0.76, 0.87 or CDC ILI Surveillance and CDC Virus Surveillance (0.86; 95%CI: 0.82, 0.90.This analysis demonstrates that while Google Flu Trends is highly correlated with rates of ILI, it has a lower correlation with surveillance for laboratory-confirmed influenza. Most of the outlier observations occurred during the 2003-04 influenza season that was characterized by early and intense influenza activity, which potentially altered health care seeking behavior, physician testing practices, and internet search behavior.

    10. Monitoring Influenza Activity in the United States: A Comparison of Traditional Surveillance Systems with Google Flu Trends

      Science.gov (United States)

      Ortiz, Justin R.; Zhou, Hong; Shay, David K.; Neuzil, Kathleen M.; Fowlkes, Ashley L.; Goss, Christopher H.

      2011-01-01

      Background Google Flu Trends was developed to estimate US influenza-like illness (ILI) rates from internet searches; however ILI does not necessarily correlate with actual influenza virus infections. Methods and Findings Influenza activity data from 2003–04 through 2007–08 were obtained from three US surveillance systems: Google Flu Trends, CDC Outpatient ILI Surveillance Network (CDC ILI Surveillance), and US Influenza Virologic Surveillance System (CDC Virus Surveillance). Pearson's correlation coefficients with 95% confidence intervals (95% CI) were calculated to compare surveillance data. An analysis was performed to investigate outlier observations and determine the extent to which they affected the correlations between surveillance data. Pearson's correlation coefficient describing Google Flu Trends and CDC Virus Surveillance over the study period was 0.72 (95% CI: 0.64, 0.79). The correlation between CDC ILI Surveillance and CDC Virus Surveillance over the same period was 0.85 (95% CI: 0.81, 0.89). Most of the outlier observations in both comparisons were from the 2003–04 influenza season. Exclusion of the outlier observations did not substantially improve the correlation between Google Flu Trends and CDC Virus Surveillance (0.82; 95% CI: 0.76, 0.87) or CDC ILI Surveillance and CDC Virus Surveillance (0.86; 95%CI: 0.82, 0.90). Conclusions This analysis demonstrates that while Google Flu Trends is highly correlated with rates of ILI, it has a lower correlation with surveillance for laboratory-confirmed influenza. Most of the outlier observations occurred during the 2003–04 influenza season that was characterized by early and intense influenza activity, which potentially altered health care seeking behavior, physician testing practices, and internet search behavior. PMID:21556151

    11. LANL* V1.0: a radiation belt drift shell model suitable for real-time and reanalysis applications

      Directory of Open Access Journals (Sweden)

      J. Koller

      2009-07-01

      Full Text Available We describe here a new method for calculating the magnetic drift invariant, <i>L*>, that is used for modeling radiation belt dynamics and for other space weather applications. <i>L*> (pronounced L-star is directly proportional to the integral of the magnetic flux contained within the surface defined by a charged particle moving in the Earth's geomagnetic field. Under adiabatic changes to the geomagnetic field <i>L*> is a conserved quantity, while under quasi-adiabatic fluctuations diffusion (with respect to a particle's <i>L*> is the primary term in equations of particle dynamics. In particular the equations of motion for the very energetic particles that populate the Earth's radiation belts are most commonly expressed by diffusion in three dimensions: <i>L*>, energy (or momentum, and pitch angle (the dot product of velocity and the magnetic field vector. Expressing dynamics in these coordinates reduces the dimensionality of the problem by referencing the particle distribution functions to values at the magnetic equatorial point of a magnetic "drift shell" (or L-shell irrespective of local time (or longitude. While the use of <i>L*> aids in simplifying the equations of motion, practical applications such as space weather forecasting using realistic geomagnetic fields require sophisticated magnetic field models that, in turn, require computationally intensive numerical integration. Typically a single <i>L*> calculation can require on the order of 105 calls to a magnetic field model and each point in the simulation domain and each calculated pitch angle has a different value of <i>L*>. We describe here the development and validation of a neural network surrogate model for calculating <i>L*> in sophisticated geomagnetic field models with a high degree of fidelity at computational speeds that are millions of times faster than direct numerical field line mapping and integration. This new surrogate model has

    12. Demonstrating the use of high-volume electronic medical claims data to monitor local and regional influenza activity in the US.

      Directory of Open Access Journals (Sweden)

      Cécile Viboud

      Full Text Available Fine-grained influenza surveillance data are lacking in the US, hampering our ability to monitor disease spread at a local scale. Here we evaluate the performances of high-volume electronic medical claims data to assess local and regional influenza activity.We used electronic medical claims data compiled by IMS Health in 480 US locations to create weekly regional influenza-like-illness (ILI time series during 2003-2010. IMS Health captured 62% of US outpatient visits in 2009. We studied the performances of IMS-ILI indicators against reference influenza surveillance datasets, including CDC-ILI outpatient and laboratory-confirmed influenza data. We estimated correlation in weekly incidences, peak timing and seasonal intensity across datasets, stratified by 10 regions and four age groups (<5, 5-29, 30-59, and 60+ years. To test IMS-Health performances at the city level, we compared IMS-ILI indicators to syndromic surveillance data for New York City. We also used control data on laboratory-confirmed Respiratory Syncytial Virus (RSV activity to test the specificity of IMS-ILI for influenza surveillance.Regional IMS-ILI indicators were highly synchronous with CDC's reference influenza surveillance data (Pearson correlation coefficients rho≥0.89; range across regions, 0.80-0.97, P<0.001. Seasonal intensity estimates were weakly correlated across datasets in all age data (rho≤0.52, moderately correlated among adults (rho≥0.64 and uncorrelated among school-age children. IMS-ILI indicators were more correlated with reference influenza data than control RSV indicators (rho = 0.93 with influenza v. rho = 0.33 with RSV, P<0.05. City-level IMS-ILI indicators were highly consistent with reference syndromic data (rho≥0.86.Medical claims-based ILI indicators accurately capture weekly fluctuations in influenza activity in all US regions during inter-pandemic and pandemic seasons, and can be broken down by age groups and fine geographical areas

    13. Clinical characteristics and outcomes of traditional Chinese medicine-induced liver injury: a systematic review.

      Science.gov (United States)

      Wang, Ran; Qi, Xingshun; Yoshida, Eric M; Méndez-Sánchez, Nahum; Teschke, Rolf; Sun, Mingyu; Liu, Xu; Su, Chunping; Deng, Jiao; Deng, Han; Hou, Feifei; Guo, Xiaozhong

      2018-04-01

      Traditional Chinese medicine (TCM) is becoming increasingly popular and related adverse events are often ignored or underestimated. This systematic review aimed to evaluate the clinical characteristics and outcomes of TCM-induced liver injury (TCM-ILI) and to estimate the proportion of TCM-ILI in all drug-induced liver injuries (DILI). China National Knowledge Infrastructure, Wanfang, VIP, PubMed, and Embase databases were searched. Demographic, clinical, and survival data were extracted and pooled. Factors associated with worse outcomes were calculated. For the proportion meta-analyses, the data were pooled by using a random-effects model. Overall, 21,027 articles were retrieved, of which 625 were finally included. There was a predominance of female and older patients. The proportion of liver transplantation was 2.18% (7/321). The mortality was 4.67% (15/321). Male, higher aspartate aminotransferase and direct bilirubin, and lower albumin were significantly associated with an increased risk of death/liver transplantation in TCM-ILI patients. The proportion of TCM-ILI in all DILI was 25.71%. The proportion was gradually increased with year. Our work summarises current knowledge regarding clinical presentation, disease course, and prognosis of TCM-ILI. TCM can result in hepatotoxicity, even death or necessitate life-saving liver transplantation. Governmental regulation of TCM products should be strictly established.

    14. Identifying influenza-like illness presentation from unstructured general practice clinical narrative using a text classifier rule-based expert system versus a clinical expert.

      Science.gov (United States)

      MacRae, Jayden; Love, Tom; Baker, Michael G; Dowell, Anthony; Carnachan, Matthew; Stubbe, Maria; McBain, Lynn

      2015-10-06

      We designed and validated a rule-based expert system to identify influenza like illness (ILI) from routinely recorded general practice clinical narrative to aid a larger retrospective research study into the impact of the 2009 influenza pandemic in New Zealand. Rules were assessed using pattern matching heuristics on routine clinical narrative. The system was trained using data from 623 clinical encounters and validated using a clinical expert as a gold standard against a mutually exclusive set of 901 records. We calculated a 98.2 % specificity and 90.2 % sensitivity across an ILI incidence of 12.4 % measured against clinical expert classification. Peak problem list identification of ILI by clinical coding in any month was 9.2 % of all detected ILI presentations. Our system addressed an unusual problem domain for clinical narrative classification; using notational, unstructured, clinician entered information in a community care setting. It performed well compared with other approaches and domains. It has potential applications in real-time surveillance of disease, and in assisted problem list coding for clinicians. Our system identified ILI presentation with sufficient accuracy for use at a population level in the wider research study. The peak coding of 9.2 % illustrated the need for automated coding of unstructured narrative in our study.

    15. Outbreak of influenza in an overseas student travel group--Taiwan 2008.

      Science.gov (United States)

      Tsou, Tsung-Pei; Lin, Chien-Hui; Lo, Yi-Chun; Li, Yi-Syue; Chiu, Chan-Hsien

      2010-05-01

      Influenza is a frequent cause of acute respiratory illness (ARI). In July 2008, we conducted a retrospective cohort study to investigate an influenza outbreak occurring in an overland travel group of overseas students. ARI was defined as the presence of any respiratory symptom such as cough, rhinorrhoea, sore throat or stuffy nose. Influenza-like illness (ILI) was defined as ARI plus fever > or =38 degrees C. Throat swabs were taken from symptomatic participants and a real-time polymerase chain reaction (RT-PCR) was performed. One hundred and seventy participants were interviewed. Forty-four (26%) had an ARI and 22 (13%) had an ILI. Of the 33 specimens collected, 18 (54%) were positive for influenza A/H3N2. Taiwanese group leaders had increased risk of acquiring both ARI and ILI (ARI relative risk (RR) 2.2, 95% confidence interval (CI) 1.3-3.7 and ILI RR 2.8, 95% CI 1.2-6.3). Fifteen participants were vaccinated. The vaccine effectiveness was 52% for ILI (p = 0.70). The outbreak stopped after cohorting and the use of surgical masks. Vaccination appeared to be effective in preventing infection.

    16. Expectations and Experiences of Information Literacy Instruction

      Directory of Open Access Journals (Sweden)

      Saga Pohjola-Ahlin

      2016-11-01

      Full Text Available In May 2016, 48 third semester undergraduate students enrolled in the physiotherapy program at Karolinska Institutet in Sweden were given three sets of questionnaires; before the information literacy instruction (ILI started, at the end of the first session, and a week after, at the end of the second and last session. The aim of this small-scale pilot study was to shed some light on students’ motivation to attend ILI, how they value the sessions afterwards and how they assess their learning outcome. Furthermore, it was an attempt to do a "students’ user experience study” in a pedagogical setting, with the intention to evaluate and improve teaching in ILI to meet student expectations. The average response rate for the three questionnaires was 92%. The results show that students’ expectations were similar to the actual content of ILI, and that the students were satisfied with their own learning outcome. Both motivation and the sense of relevance got higher scores after students attended ILI. Motivation rose from 7,4 to 8,12 out of 10. This is positive because a high level of motivation often improves the learning outcome (Schunk, 2012. When asked which areas most needed improvement in order to further enhance their learning outcome, the most common responses were “the pedagogy” and “my own achievement”. It would be interesting to start collaborating with a group of students in order to explore new methods and learning activities.

    17. Türkiye’de İhracatın Çeşitlendirilmesi ve Ekonomik Büyüme

      Directory of Open Access Journals (Sweden)

      Ali ACARAVCI

      2015-07-01

      Full Text Available Bu çalışma, Türkiye’de ihracatta ürün çeşitlendirmesi ile ekonomik büyüme arasındaki uzun dönemli ve nedensel ilişkileri, Türkiye ekonomisi için 1995-2012 dönemi verileri ile araştırmaktadır. Değişkenlerin durağanlık analizi için ADF birim kök testi, eşbütünleşme ilişkisini test etmek için ARDL sınır testi yaklaşımı ve değişkenler arasındaki nedensellik ilişkilerinin belirlenmesinde Granger nedensellik testi modeli kullanılmıştır.  Elde edilen sonuçlara göre ihracatta ürün çeşitlendirmesi değişkeninden ekonomide dışa açıklık oranı değişkenine doğru tek yönlü nedensellik ilişkisi bulunurken diğer değişkenler arasında bir nedensellik ilişkisi bulunamamıştır.

    18. The effect of school dismissal on rates of influenza-like illness in New York City schools during the spring 2009 novel H1N1 outbreak.

      Science.gov (United States)

      Egger, Joseph R; Konty, Kevin J; Wilson, Elisha; Karpati, Adam; Matte, Thomas; Weiss, Don; Barbot, Oxiris

      2012-03-01

      The effects of individual school dismissal on influenza transmission have not been well studied. During the spring 2009 novel H1N1 outbreak, New York City implemented an individual school dismissal policy intended to limit influenza transmission at schools with high rates of influenza-like illness (ILI). Active disease surveillance data collected by the New York City Health Department on rates of ILI in schools were used to evaluate the impact. Sixty-four schools that met the Health Department's criteria for considering dismissal were included in the analysis. Twenty-four schools that met criteria subsequently dismissed all classes for approximately 1 school week. A regression model was fit to these data, estimating the effect of school dismissal on rates of in-school ILI following reconvening, adjusting for potential confounders. The model estimated that, on average, school dismissal reduced the rate of ILI by 7.1% over the entire average outbreak period. However, a large proportion of in-school ILI occurred before dismissal criteria were met. A separate model estimated that school absenteeism rates were not significantly affected by dismissal. Results suggest that individual school dismissal could be considered in situations where schools have a disproportionate number of high-risk students or may be unable to implement recommended preventive or infection control measures. Future work should focus on developing more sensitive indicators of early outbreak detection in schools and evaluating the impact of school dismissal on community transmission. © 2012, American School Health Association.

    19. Hepatoprotective Effects of Total Triterpenoids and Total Flavonoids from Vitis vinifera L against Immunological Liver Injury in Mice

      Directory of Open Access Journals (Sweden)

      Tao Liu

      2012-01-01

      Full Text Available Suosuo grape (the fruits of Vitis vinifera L has been used for prevention and treatment of liver diseases in Uighur folk medicine in China besides its edible value. In this study, the hepatoprotective effects of total triterpenoids (VTT and total flavonoids (VTF from Suosuo grape were evaluated in Bacille-Calmette-Guerin- (BCG- plus-lipopolysaccharide- (LPS- induced immunological liver injury (ILI in mice. Various dose groups (50, 150, and 300 mg/kg of VTT and VTF alleviated the degree of liver injury of ILI mice, effectively reduced the BCG/LPS-induced elevated liver index and spleen index, hepatic nitric oxide (NO, and malondialdehyde (MDA content, increased liver homogenate alanine aminotransferase (ALT and aspartate aminotransferase (AST levels, and restored hepatic superoxide dismutase (SOD activity in ILI mice. VTT and VTF also significantly inhibited intrahepatic expression of Th1 cytokines (IFN-γ and IL-2 in ILI mice and increased intrahepatic expression of Th2 cytokines (IL-4 and IL-10. Moreover, the increased Bax/Bcl-2 ratio was significantly downregulated by VTT and VTF in liver tissue of ILI mice. These results are comparable to those of biphenyl dicarboxylate (DDB, the reference hepatoprotective agent and suggest that VTT and VTF play a protective role against immunological liver injury, which may have important implications for our understanding of the immunoregulatory mechanisms of this plant.

    20. SPLETNE UČILNICE IN E-LISTOVNIK "MAHARA"

      OpenAIRE

      Tivadar, Petra

      2011-01-01

      V diplomskem delu smo opredelili, kaj je IKT, e-učenje, e-izobraževanje, izobraževanje na daljavo in hitro e-učenje. Nato smo opredelili, kaj so spletne učilnice in jih nekaj navedli. Opredelili smo, kaj je e-listovnik, kaj nam omogoča ter proučili prednosti in slabosti njegove uporabe. Osredotočili smo se na e-listovnik Mahara. Pregledali in preverili smo možnosti, ki jih Mahara ponuja, ter ugotavljali, zakaj jo uporabljati. Proučili smo tudi, kako jo uporabljati v izobraževanju in kakšne so...

    1. Outcomes of a pilot hand hygiene randomized cluster trial to reduce communicable infections among US office-based employees.

      Science.gov (United States)

      Stedman-Smith, Maggie; DuBois, Cathy L Z; Grey, Scott F; Kingsbury, Diana M; Shakya, Sunita; Scofield, Jennifer; Slenkovich, Ken

      2015-04-01

      To determine the effectiveness of an office-based multimodal hand hygiene improvement intervention in reducing self-reported communicable infections and work-related absence. A randomized cluster trial including an electronic training video, hand sanitizer, and educational posters (n = 131, intervention; n = 193, control). Primary outcomes include (1) self-reported acute respiratory infections (ARIs)/influenza-like illness (ILI) and/or gastrointestinal (GI) infections during the prior 30 days; and (2) related lost work days. Incidence rate ratios calculated using generalized linear mixed models with a Poisson distribution, adjusted for confounders and random cluster effects. A 31% relative reduction in self-reported combined ARI-ILI/GI infections (incidence rate ratio: 0.69; 95% confidence interval, 0.49 to 0.98). A 21% nonsignificant relative reduction in lost work days. An office-based multimodal hand hygiene improvement intervention demonstrated a substantive reduction in self-reported combined ARI-ILI/GI infections.

    2. A case study of the crack sizing performance of the Ultrasonic Phased Array combined crack and wall loss inspection tool on the Centennial pipeline, the defect evaluation, including the defect evaluation, field feature verification and tool performance validation (performed by Marathon Oil, DNV and GE Oil and Gas)

      Energy Technology Data Exchange (ETDEWEB)

      Hrncir, T.; Turner, S. [Marathon Pipe Line LLC, Findley, OH (United States); Polasik, SJ [DNV Columbus, Inc, Dublin, OH 43017 (United States); Vieth, P. [BP EandP, Houston, TX (United States); Allen, D.; Lachtchouk, I.; Senf, P.; Foreman, G. [GE Oil and Gas PII Pipeline Solutions, Stutensee (Germany)], email: geoff.foreman@ge.com

      2010-07-01

      The Centennial Pipeline System is operated by Marathon Pipe Line LLC. It is 754 miles long and carries liquid products from eastern Texas to southern Illinois. Most of it was constructed in 1951 for natural gas, but it was converted in 2001 for liquid product service. GE Oil and Gas conducted an ultrasonic phased array in-line inspection (ILI) survey of this pipeline, whose primary purpose was to detect and characterize stress corrosion cracking. A dig verification was performed in 2008 to increase the level of confidence in the detection and depth-sizing capabilities of this inspection method. This paper outlines of the USCD technology and experience and describes how the ILI survey results were validated, how the ILI data analysis was improved, and the impact on managing the integrity of the line section. Results indicate that the phased array technology approached a 90% certainty predicted depth with a tolerance of 1 mm at a 95% confidence level.

    3. Influenza-like-illness and clinically diagnosed flu: disease burden, costs and quality of life for patients seeking ambulatory care or no professional care at all.

      Science.gov (United States)

      Bilcke, Joke; Coenen, Samuel; Beutels, Philippe

      2014-01-01

      This is one of the first studies to (1) describe the out-of-hospital burden of influenza-like-illness (ILI) and clinically diagnosed flu, also for patients not seeking professional medical care, (2) assess influential background characteristics, and (3) formally compare the burden of ILI in patients with and without a clinical diagnosis of flu. A general population sample with recent ILI experience was recruited during the 2011-2012 influenza season in Belgium. Half of the 2250 respondents sought professional medical care, reported more symptoms (especially more often fever), a longer duration of illness, more use of medication (especially antibiotics) and a higher direct medical cost than patients not seeking medical care. The disease and economic burden were similar for ambulatory ILI patients, irrespective of whether they received a clinical diagnosis of flu. On average, they experienced 5-6 symptoms over a 6-day period; required 1.6 physician visits and 86-91% took medication. An average episode amounted to €51-€53 in direct medical costs, 4 days of absence from work or school and the loss of 0.005 quality-adjusted life-years. Underlying illness led to greater costs and lower quality-of-life. The costs of ILI patients with clinically diagnosed flu tended to increase, while those of ILI patients without clinically diagnosed flu tended to decrease with age. Recently vaccinated persons experienced lower costs and a higher quality-of-life, but this was only the case for patients not seeking professional medical care. This information can be used directly to evaluate the implementation of cost-effective prevention and control measures for influenza. In particular to inform the evaluation of more widespread seasonal influenza vaccination, including in children, which is currently considered by many countries.

    4. Clinical results of neurotransmission SPECT in extra-pyramidal diseases; Resultats cliniques de la TEMP de la neurotransmission en pathologie extra-pyramidale

      Energy Technology Data Exchange (ETDEWEB)

      Baulieu, J.L.; Prunier, C.; Tranquart, F.; Guilloteau, D. [Centre Hospitalier Universitaire Bretonneau, Service de Medecine Nucleaire in vitro, INSERM U316, 37 - Tours (France)

      1999-12-01

      We present some methodological aspects and clinical applications of dopamine D2 receptor and transporter SPECT using new radiotracers radiolabeled with iodine 123. The gamma camera quality control and standardisation has to be adapted to the small volume and deep location of striata, where receptors and transporters are present. Phantom containing hollow spheres of different diameters which can be filled with different amounts of {sup 99m}Tc or {sup 123}I. The semi quantitation of receptor and transporter molecular concentration is based on an equilibrium binding model. According to this model, the binding potential (Bmax. Ka) is equal to the ratio between specific binding in the striatum and circulating activity in a reference region of interest in the occipital cortex. By comparing ECD and ILIS SPECT, it has been shown that striatal ILIS binding does not depend on the local perfusion. The clinical applications mainly concern the extra-pyramidal pathology: ILIS and IBZM SPECT are able to differentiate pre- and post-synaptic lesions. In Parkinson disease the nigrostriatal pathway is damaged and D2 receptors are normal or increased, as shown by normal or elevated IBZM or ILIS uptake. In other extra pyramidal degenerative diseases as progressive supra nuclear palsy or multiple system atrophy striatal D2 receptors are damaged as shown by decreased IBZM or ILIS uptake. In our experience, 88 per cent of patients are correctly classified by ILIS SPECT and 86 per cent with IBZM SPECT. Dopamine transporter SPECT with {beta}CIT and PE2I provides an evaluation of the presynaptic neuronal density in the striatum. One can expect an help for the early diagnosis and the evaluation of Parkinson disease. Another potential application of dopaminergic neurotransmission SPECT is the evaluation of neuronal loss after hypoxo-ischemia. We conclude that dopaminergic neurotransmission SPECT using specific ligands should become a useful diagnosis tool to study a large number of brain

    5. Cost of intervention delivery in a lifestyle weight loss trial in type 2 diabetes: results from the Look AHEAD clinical trial.

      Science.gov (United States)

      Rushing, J; Wing, R; Wadden, T A; Knowler, W C; Lawlor, M; Evans, M; Killean, T; Montez, M; Espeland, M A; Zhang, P

      2017-03-01

      The Action for Health in Diabetes (Look AHEAD) trial was a randomized controlled clinical trial to compare the effects of 10 years of intensive lifestyle intervention (ILI) with a control condition of diabetes support and education (DSE) on health outcomes in over 5,000 participants with type 2 diabetes. The ILI had significantly greater weight losses than DSE throughout the trial. The goal of this analysis is to describe the cost of delivering the intervention. The ILI was designed to promote weight loss and increase physical activity. It involved a combination of group plus individual intervention sessions, with decreasing frequency of contact over the 10 years. The intervention incorporated a variety of strategies, including meal replacement products, to improve weight loss outcomes. The costs of intervention delivery were derived from staff surveys of effort and from records of intervention materials from the 16 US academic clinical trial sites. Costs were calculated from the payer perspective and presented in 2012 dollars. During the first year, when intervention delivery was most intensive, the annual cost of intervention delivery, averaged (standard deviation) across clinical sites, was $2,864.6 ($513.3) per ILI participant compared with $202.4 ($76.6) per DSE participant. As intervention intensity declined, costs decreased, such that from years 5 to 9 of the trial, the annual cost of intervention was $1,119.8 ($227.7) per ILI participant and $102.9 ($33.0) per DSE participant. Staffing accounted for the majority of costs throughout the trial, with meal replacements and materials to promote adherence accounting for smaller shares. The sustained weight losses produced by the Look AHEAD intervention were supported by intervention costs that were within the range of other weight loss programmes. Future work will include an evaluation of the cost-effectiveness of the ILI and will contain additional follow-up data.

    6. Influenza infection in the intensive care unit: Four years after the 2009 pandemic.

      Science.gov (United States)

      Pérez-Carrasco, Marcos; Lagunes, Leonel; Antón, Andrés; Gattarello, Simone; Laborda, César; Pumarola, Tomás; Rello, Jordi

      2016-03-01

      The role of influenza viruses in severe acute respiratory infection (SARI) in Intensive Care Units (ICU) remains unknown. The post-pandemic influenza A(H1N1)pdm09 period, in particular, has been poorly studied. To identify influenza SARI patients in ICU, to assess the usefulness of the symptoms of influenza-like illness (ILI), and to compare the features of pandemic vs. post-pandemic influenza A(H1N1) pdm09 infection. A prospective observational study with SARI patients admitted to ICU during the first three post-pandemic seasons. Patient demographics, characteristics and outcomes were recorded. An influenza epidemic period (IEP) was defined as >100 cases/100,000 inhabitants per week. One hundred sixty-three patients were diagnosed with SARI. ILI was present in 65 (39.9%) patients. Influenza infection was documented in 41 patients, 27 (41.5%) ILI patients, and 14 (14.3%) non-ILI patients, 27 of them during an IEP. Influenza A viruses were mainly responsible. Only five patients had influenza B virus infection, which were non-ILI during an IEP. SARI overall mortality was 22.1%, and 15% in influenza infection patients. Pandemic and post-pandemic influenza infection patients shared similar clinical features. During influenza epidemic periods, influenza infection screening should be considered in all SARI patients. Influenza SARI was mainly caused by subtype A(H1N1)pdm09 and A(H3N2) in post-pandemic seasons, and no differences were observed in ILI and mortality rate compared with a pandemic season. Copyright © 2015 Elsevier España, S.L.U. y Sociedad Española de Enfermedades Infecciosas y Microbiología Clínica. All rights reserved.

    7. Influenza and other respiratory viruses detected by influenza-like illness surveillance in Leyte Island, the Philippines, 2010-2013.

      Directory of Open Access Journals (Sweden)

      Hirono Otomaru

      Full Text Available This study aimed to determine the role of influenza-like illness (ILI surveillance conducted on Leyte Island, the Philippines, including involvement of other respiratory viruses, from 2010 to 2013. ILI surveillance was conducted from January 2010 to March 2013 with 3 sentinel sites located in Tacloban city, Palo and Tanauan of Leyte Island. ILI was defined as fever ≥38°C or feverish feeling and either cough or running nose in a patient of any age. Influenza virus and other 5 respiratory viruses were searched. A total of 5,550 ILI cases visited the 3 sites and specimens were collected from 2,031 (36.6% cases. Among the cases sampled, 1,637 (75.6% were children aged <5 years. 874 (43.0% cases were positive for at least one of the respiratory viruses tested. Influenza virus and respiratory syncytial virus (RSV were predominantly detected (both were 25.7% followed by human rhinovirus (HRV (17.5%. The age distributions were significantly different between those who were positive for influenza, HRV, and RSV. ILI cases were reported throughout the year and influenza virus was co-detected with those viruses on approximately half of the weeks of study period (RSV in 60.5% and HRV 47.4%. In terms of clinical manifestations, only the rates of headache and sore throat were significantly higher in influenza positive cases than cases positive to other viruses. In conclusion, syndromic ILI surveillance in this area is difficult to detect the start of influenza epidemic without laboratory confirmation which requires huge resources. Age was an important factor that affected positive rates of influenza and other respiratory viruses. Involvement of older age children may be useful to detect influenza more effectively.

    8. Influenza-like-illness and clinically diagnosed flu: disease burden, costs and quality of life for patients seeking ambulatory care or no professional care at all.

      Directory of Open Access Journals (Sweden)

      Joke Bilcke

      Full Text Available This is one of the first studies to (1 describe the out-of-hospital burden of influenza-like-illness (ILI and clinically diagnosed flu, also for patients not seeking professional medical care, (2 assess influential background characteristics, and (3 formally compare the burden of ILI in patients with and without a clinical diagnosis of flu. A general population sample with recent ILI experience was recruited during the 2011-2012 influenza season in Belgium. Half of the 2250 respondents sought professional medical care, reported more symptoms (especially more often fever, a longer duration of illness, more use of medication (especially antibiotics and a higher direct medical cost than patients not seeking medical care. The disease and economic burden were similar for ambulatory ILI patients, irrespective of whether they received a clinical diagnosis of flu. On average, they experienced 5-6 symptoms over a 6-day period; required 1.6 physician visits and 86-91% took medication. An average episode amounted to €51-€53 in direct medical costs, 4 days of absence from work or school and the loss of 0.005 quality-adjusted life-years. Underlying illness led to greater costs and lower quality-of-life. The costs of ILI patients with clinically diagnosed flu tended to increase, while those of ILI patients without clinically diagnosed flu tended to decrease with age. Recently vaccinated persons experienced lower costs and a higher quality-of-life, but this was only the case for patients not seeking professional medical care. This information can be used directly to evaluate the implementation of cost-effective prevention and control measures for influenza. In particular to inform the evaluation of more widespread seasonal influenza vaccination, including in children, which is currently considered by many countries.

    9. Multidrug-Resistant CTX-M-(15, 9, 2- and KPC-2-Producing Enterobacter hormaechei and Enterobacter asburiae Isolates Possessed a Set of Acquired Heavy Metal Tolerance Genes Including a Chromosomal sil Operon (for Acquired Silver Resistance

      Directory of Open Access Journals (Sweden)

      Leonardo N. Andrade

      2018-03-01

      Full Text Available Bacterial resistance to antibiotics is concern in healthcare-associated infections. On the other hand, bacterial tolerance to other antimicrobials, like heavy metals, has been neglected and underestimated in hospital pathogens. Silver has long been used as an antimicrobial agent and it seems to be an important indicator of heavy metal tolerance. To explore this perspective, we searched for the presence of acquired silver resistance genes (sil operon: silE, silS, silR, silC, silF, silB, silA, and silP and acquired extended-spectrum cephalosporin and carbapenem resistance genes (blaCTX−M and blaKPC in Enterobacter cloacae Complex (EcC (n = 27 and Enterobacter aerogenes (n = 8 isolated from inpatients at a general hospital. Moreover, the genetic background of the silA (silver-efflux pump and the presence of other acquired heavy metal tolerance genes, pcoD (copper-efflux pump, arsB (arsenite-efflux pump, terF (tellurite resistance protein, and merA (mercuric reductase were also investigated. Outstandingly, 21/27 (78% EcC isolates harbored silA gene located in the chromosome. Complete sil operon was found in 19/21 silA-positive EcC isolates. Interestingly, 8/20 (40% E. hormaechei and 5/6 (83% E. asburiae co-harbored silA/pcoD genes and blaCTX−M−(15,2,or9 and/or blaKPC−2 genes. Frequent occurrences of arsB, terF, and merA genes were detected, especially in silA/pcoD-positive, multidrug-resistant (MDR and/or CTX-M-producing isolates. Our study showed co-presence of antibiotic and heavy metal tolerance genes in MDR EcC isolates. In our viewpoint, there are few studies regarding to bacterial heavy metal tolerance and we call attention for more investigations and discussion about this issue in different hospital pathogens.

    10. Analysis of loads and fluid-structure interactions in a condensation pool

      Energy Technology Data Exchange (ETDEWEB)

      Timperi, A.; Paettikangas, T.; Niemi, J. [VTT, Technical Research Centre of Finland (Finland)

      2007-04-15

      A simplified direct contact condensation model was implemented into the Volume of Fluid model of the Fluent CFD code. Transient three-dimensional test runs for the POOLEX experiments, where steam is blown into a water pool were performed. The model was found to provide too small condensation rate for steam when compared to experiments. In addition, the calculated back and forth oscillation of the steam water interface was much smaller than in the experiments. The model was found to be numerically quite robust. The discrepancies of the simulation, such as the too small condensation rate, could be to some extent cured by making improvements into the condensation model. As an alternative estimation method of thermohydraulic loads in condensation pools, the SILA code based on potential flow theory, was taken into use. SILA solves the pressure distribution caused by oscillating bubbles in a pool, and is easier to use and more flexible than Method of Images studied earlier. SILA has been modified for pools without an inner cylinder and test simulations for the POOLEX water pool were performed. The MpCCI FSI coupling software employs an explicit coupling scheme, which results in numerical instability in the case of the POOLEX facility. In order to improve stability, ways for implementing an implicit coupling scheme with MpCCI were examined. It was found that such a scheme is difficult to achieve without access to the source codes. An implicit coupling scheme is expected to be available with MpCCI in forthcoming years. A method was developed which can be used for analysing two-way FSI problems realistically by using only one-way coupling of CFD and structural analysis codes. In the method, the mass of the fluid is accounted for in the structural motion by adding the fluid to the structural model as an acoustic medium. Validity of the method was examined with promising results mathematically by an order of magnitude analysis and by comparing numerical results with a full

    11. Using Google Flu Trends data in forecasting influenza-like-illness related ED visits in Omaha, Nebraska.

      Science.gov (United States)

      Araz, Ozgur M; Bentley, Dan; Muelleman, Robert L

      2014-09-01

      Emergency department (ED) visits increase during the influenza seasons. It is essential to identify statistically significant correlates in order to develop an accurate forecasting model for ED visits. Forecasting influenza-like-illness (ILI)-related ED visits can significantly help in developing robust resource management strategies at the EDs. We first performed correlation analyses to understand temporal correlations between several predictors of ILI-related ED visits. We used the data available for Douglas County, the biggest county in Nebraska, for Omaha, the biggest city in the state, and for a major hospital in Omaha. The data set included total and positive influenza test results from the hospital (ie, Antigen rapid (Ag) and Respiratory Syncytial Virus Infection (RSV) tests); an Internet-based influenza surveillance system data, that is, Google Flu Trends, for both Nebraska and Omaha; total ED visits in Douglas County attributable to ILI; and ILI surveillance network data for Douglas County and Nebraska as the predictors and data for the hospital's ILI-related ED visits as the dependent variable. We used Seasonal Autoregressive Integrated Moving Average and Holt Winters methods with3 linear regression models to forecast ILI-related ED visits at the hospital and evaluated model performances by comparing the root means square errors (RMSEs). Because of strong positive correlations with ILI-related ED visits between 2008 and 2012, we validated the use of Google Flu Trends data as a predictor in an ED influenza surveillance tool. Of the 5 forecasting models we have tested, linear regression models performed significantly better when Google Flu Trends data were included as a predictor. Regression models including Google Flu Trends data as a predictor variable have lower RMSE, and the lowest is achieved when all other variables are also included in the model in our forecasting experiments for the first 5 weeks of 2013 (with RMSE = 57.61). Google Flu Trends data

    12. ULOGA DEBRIDMANA U LIJEČENJU KRONIČNIH RANA

      OpenAIRE

      HULJEV, DUBRAVKO; GAJIĆ, ALEKSANDAR; TRILLER, CIRIL; KECELJ LESKOVEC, NADA

      2013-01-01

      Debridement je proces uklanjanja mrtvog tkiva iz rane. Struktura, boja i neugodni mirisi devitaliziranog tkiva se razlikuju. osim toga, devitalizirano tkivo može biti suho ili sa secernacijom. Devitalizirano tkivo usporava ili u potpunosti onemogućuje zarastanje rane te je indicirano da ga se u okviru liječenja rana mora odstraniti. Cilj debridmana je pretvaranje kronične rane u stanje akutne rane i iniciranje procesa zaraštavanja. Debridement je osnovni postupak u liječenju svake rane, ali i...

    13. Hlapivi spojevi arome dalmatinske pancete proizvedene u različitim tehnološkim uvjetima

      OpenAIRE

      Krvavica, Marina; Milak, Vedrana

      2017-01-01

      Cilj ovog istraživanja bio je utvrditi u kojoj mjeri razlike u načinu soljenja (sa ili bez aditiva, utrošak soli/salamure, duljina faze soljenja), načinu dimljenja (ložište unutar ili izvan objekta i temperatura dima) te duljina sušenja i zrenja, utječu na sastav hlapivih spojeva arome dalmatinske pancete. U navedenu svrhu uzeta su po 2 uzorka dalmatinske pancete iz dva različita preradbena objekta na području Dalmacije, u kojima je panceta proizvedena na sljedeći način: objekt A – salamurenj...

    14. Etika oglašavanja – problemi definiranja i razgraničenja od srodnih disciplina

      OpenAIRE

      Žanetić, Ivan

      2014-01-01

      Rad ima namjeru da ponudi uvod u etiku oglašavanja, razmatrajući probleme njena definiranja, kao i različite koncepcije tog područja. Primijećene razlike u poimanju discipline okupljene su u tri skupine: (1) oko pitanja o teorijskom ili primijenjenom karakteru etike oglašavanja, (2) oko njene odvojenosti ili uključenosti u marketinšku etiku, te (3) oko izvornih teorijskih doprinosa etike oglašavanja općoj etici kao jedinom razlogu postojanja etike oglašavanja. Posebnu smo pažnju posvetili pri...

    15. Uvodna riječ uz tematski broj časopisa o obitelji i promjenama spolnih uloga

      OpenAIRE

      Marinović Jerolimov, Dinka

      2016-01-01

      Tijekom druge polovice dvadesetog stoljeća, a posebice tijekom posljednjih nekoliko desetljeća, naša iskustva i razumijevanje obitelji i rodnih uloga znatno su se izmijenili. Pojave nezamislive našim djedovima i bakama danas su znatno vidljivije i društveno prihvatljive: razvod, ponovno sklapanje braka nakon razvoda, izvanbračna zajednica, eksperimentalni odnosi, homoseksualni brakovi ili partnerstva sa ili bez djece, jednoroditeljske obitelji, demokratskiji odnosi između roditelja i djece, z...

    16. Case of seasonal reassortant A(H1N2) influenza virus infection, the Netherlands, March 2018.

      Science.gov (United States)

      Meijer, Adam; Swaan, Corien M; Voerknecht, Martin; Jusic, Edin; van den Brink, Sharon; Wijsman, Lisa A; Voordouw, Bettie Cg; Donker, Gé A; Sleven, Jacqueline; Dorigo-Zetsma, Wendelien W; Svraka, Sanela; van Boven, Michiel; Haverkate, Manon R; Timen, Aura; van Dissel, Jaap T; Koopmans, Marion Pg; Bestebroer, Theo M; Fouchier, Ron Am

      2018-04-01

      A seasonal reassortant A(H1N2) influenza virus harbouring genome segments from seasonal influenza viruses A(H1N1)pdm09 (HA and NS) and A(H3N2) (PB2, PB1, PA, NP, NA and M) was identified in March 2018 in a 19-months-old patient with influenza-like illness (ILI) who presented to a general practitioner participating in the routine sentinel surveillance of ILI in the Netherlands. The patient recovered fully. Further epidemiological and virological investigation did not reveal additional cases.

    17. RINITIS U ODRASLIH

      OpenAIRE

      KALOGJERA, LIVIJE

      2011-01-01

      Rinitis je upala nosne sluznice različite etiologije, uključujući infekciju, alergiju ili hiperreaktivni odgovor na raznovrsne podražaje iz okoline. Praćen je simptomima opstrukcije, hipersekrecije, kihanja ili svrbeža nosa. Klasifikacije rinitisa se oslanjaju na etiologiju i težinu simptoma. Iako je s epidemiološkog gledišta najčešći virusni rinitis u sklopu obične prehlade, javnozdravstveno se značenje prvenstveno fokusira na kronični rinitis, alergijski i nealergijski. Alergijski rinitis s...

    18. Upotreba začina u proizvodnji tradicionalnih sireva

      OpenAIRE

      Josipović, Renata; Markov, Ksenija; Frece, Jadranka; Stanzer, Damir; Cvitković, Ante; Mrvčić, Jasna

      2016-01-01

      Sir je visoko cijenjeni mliječni proizvod u mnogim zemljama svijeta, a posebna pažnja pridaje se tradicionalnim sirevima, koji nisu samo hrana već i dio kulture i obilježja neke zemlje. Zahvaljujući zemljopisnom položaju i klimatsko-vegetacijskoj raznolikosti Republike Hrvatske, u pojedinim regijama razvijena je proizvodnja različitih tradicionalnih sireva uz upotrebu začina. Kod proizvodnje sireva sa začinima, začini se dodaju ili u sir koji se potom oblikuje, ili se sir omata lišćem začinsk...

    19. Statističke metode u kontroli kvalitete mlijeka i proizvoda

      OpenAIRE

      Filajdić, Mirko; Ritz, Milana; Vahčić, Nada; Vojnović, Vera; Grüner, Matilda; Vujanić, Diana

      1991-01-01

      Nakon osnivanja Analitičke sekcije na XXVIII. simpoziju mljekarske industrije 1990. godine ukazala se potreba proširenja spoznaja ili obnova znanja iz primjene statističkih metoda u interpretaciji rezultata analiza pri provjeri kakvoće mlijeka i mliječnih proizvoda. 1. Utvrđivanje slučajnih pogrešaka u rezultatima analiza - Prvi dio rada sadrži nekoliko praktičnih primjera utvrđivanja slučajne pogreške rezultata analiza kad se rezultati izražavaju kao kontinuirane ili diskretne veličine mjere...

    20. Okolju prijazno delovanje hotela

      OpenAIRE

      Miljanović, Biljana

      2018-01-01

      Magistrsko delo obravnava problematiko trajnostnega poslovanja hotelov. Tako v hotelski dejavnosti, kot tudi v turističnem sektorju postajajo načela trajnostnega razvoja vse pomembnejša. Ob vplivih na okolje velja poudariti tudi ekonomski in socialni vidik. V raziskavo smo vključili izbrani hotel iz hotelske verige xy. Namen je bilo raziskati, katere možnosti so nam na dosegu za bolj trajnostno poslovanje hotela. Pri tem smo vključili različne vplive na okolje, od odpadkov, porabe električne ...

    1. PLANINSKE VSEBINE V PROGRAMU GIBALNIH DEJAVNOSTI VRTCA

      OpenAIRE

      Pavletič, Zvezdana

      2016-01-01

      V diplomskem delu Planinske vsebine v programu gibalnih dejavnosti vrtca, smo raziskali planinske vsebine, s katerimi v vrtcu spodbujamo gibalni razvoj predšolskih otrok. V teoretičnem delu naloge smo pregledali razvojne značilnosti predšolskih otrok, področja otrokovega razvoja in proučili dejavnike, ki pomembno vplivajo na otrokov razvoj. Proučili smo hojo kot sestavni del razvoja motorike otroka, njen pomen za ohranjanje zdravja, krepitev srčno-žilnega in dihalnega sistema. Predstavili sm...

    2. Frenulektomije - kada i zašto?

      OpenAIRE

      Kopić, Vlatko; Perić, Berislav; Macan, Darko

      2004-01-01

      Podatci iz literature često su dijametralno suprotni što se tiče potrebe da se izvede kirurški zahvat kod perzistentnoga frenuluma, bilo da se radilo o njegovoj izravnoj povezanosti s dijastemom medijanom ili ne. Različita su mišljenja o najpovoljnijem vremenu za zahvat ili na redoslijed intervencije kirurga, odnosno ortodonta. Većina se autora slaže u tome da je zahvat potreban, ali i da se s njim ne treba žuriti. Pojedini autori smatraju kako treba pričekati da iznikne trajni očnjak, a d...

    3. Usporedba materijala i tehnologija za dentalne otiske

      OpenAIRE

      Stričak, Tena

      2017-01-01

      Konvencionalna metoda otiskivanja podrazumijeva otisak pomoću žlice u koju se aplicira otisni materijal. Napredak tehnologije omogućio je razvoj dentalnih skenera kojima se skenira intraoralno (zubni luk) ili ekstraoralno (otisak ili izliveni model). Usporedba materijala i tehnologija predmet je brojnih istraživanja čiji su rezultati pokazali da pacijenti bolje prihvaćaju digitalni otisni postupak. Konvencionalni otisni postupci imaju više faza pri uzimanju otiska pa je rizik od nastanka ...

    4. STRATEGIJA (STRATEGIJE) RAZVOJA

      OpenAIRE

      2011-01-01

      Gledajući televiziju, čitajući dnevni i tjedni tisak, prateći stručne skupove u naravi ili putem medija,stalno čujemo isto “nemamo strategije razvoja”, znači nemamo generalne strategije razvoja na raziniDržave, a nemamo je niti po svim granama gospodarstva, obrazovanja, znanosti, lokalne zajednice itd.,što je razumljivo, jer bi, uvjetno rečeno, zbroj tih strategija ili njihovih značajnijih dijelova, činio tu ge­neralnu strategiju na razini Države.Tako primjerice na okruglom stolu u Hrvatskoj ...

    5. Environmental Assessment Report: Geotechnical Field Investigations.

      Science.gov (United States)

      1975-06-30

      EOARGUEV NVOJOPOOLLACLAC PHACFJ,1A FILIFcjRMIS ARIZONA ENOANGEREO I4YORlOPHYLLACEAC PHACELIA WCESMIJ ARI IONA ENOA004EXD LILJACEAE AGAVE ARIZONI1CA...Jim WaliNAL.innsB-3 STATE STATUS FAM ILY SPECIES AAfrIIONA EhOANOLACU LiIACLAI, AG.AVE MCMfLV~fAhA ARIZONA t NDANCfkLu LILjActAL AGAVE !CHOTTII VAR...ARIZONA THREATENE) ONAC.NACEAL CAM15SONIA ExILI1. ARIZONA THREATENED ONAWACCAE CA,4ISSONIA PARRYI ARIZONA THREATENED ONAC.RACEAL CAMI55ONIA SPECUICOLA

    6. ANALIZA IN PRIMERJAVA MOBILNIH PLATFORM IZ VIDIKA RAZVIJALCA

      OpenAIRE

      Kokol, Nejc

      2014-01-01

      V diplomski nalogi se ukvarjamo s platformami Android, iOS in Windows Phone. Predstavili smo sam začetek pametnih telefonov in prelomnico, ki so jo povzročili na globalnem trgu. Predvsem pa smo se osredotočili na vodilne mobilne platforme Android, Windows Phone in iOS. Opisali smo njihovo zgodovino razvoja in strukturo. Izpostavili smo tudi njihove prednosti in slabosti, ki so še danes prisotne. Velik poudarek smo namenili vidiku razvijalca, kateremu so danes ponujene različne priložnosti za ...

    7. UPRAVLJANJE PROJEKTOM IZGRADNJE ZGRADE SVEUČILIŠNE KNJIŽNICE I MULTIMEDIJALNOG CENTRA U OSIJEKU

      OpenAIRE

      Stanković, Mia

      2016-01-01

      Ovim radom prikazuje se upravljanje projektom izgradnje građevine. U prvom dijelu rada definiran je projekt i njegov životni ciklus. Idućim poglavljem definirano je upravljanje projektima i sva područja upravljanja pojedinim projektom. U radu je prikazan zakonodavni okvir upravljanja projektima u Republici Hrvatskoj. Opisane su tri faze obnove i izgradnje Kampusa Sveučilišta Josipa Jurja Strossmayera u Osijeku. Kao primjer upravljanja projektom prikazana je izgradnja I. faze Sveučilišne knjiž...

    8. ZAŠTITA OKOLIŠA I MARKETING

      OpenAIRE

      Tišma, Sanja

      2001-01-01

      Ekološki pristup na svim područjima života i rada ljudi postao je danas svjetonazor, pa tako i ekološka pitanja dolaze u središte marketinških interesa s istaknutom tendencijom rasta u godinama koje dolaze. Unatoč velikom zanimanju javnosti za ekološki marketing ili kako se u različitim publikacijama često naziva zeleni marketing ili marketing zaštite okoliša, iznimno je malo znanstvenih rasprava u tom području. Ovim se člankom nastoje odrediti okviri u kojima je nastao ekološki marketing,...

    9. Krvarenje iz karcinoma debelog crijeva

      OpenAIRE

      Bušić, Željko; Radi, Mijo; Sekulić, Zvonimir; Bušić, Dubravka

      1988-01-01

      Od siječnja 1985. do lipnja 1987. godine, u Kirurškom odjelu Opće bolnice Nova Gradiška, lije­čeno je i operirano 28 bolesnika zbog karcinoma debelog crijeva. Ispitivani su učestalost i jačina krvarenja iz karcinoma debelog crijeva. Okultno i minimalno krvarenje preoperativno je dijagnosticirano u 20 bolesnika ili 71,5%.. Klinički manifestno obilnije krvarenje dijagnosticirano je samo u jednog bolesnika ili 3,5% bolesnika. Ni u jednom slučaju nije bila potrebna hitna kirurška intervencija zbo...

    10. INOVATIVNI TURISTIČKI PROIZVOD U FUNKCIJI HOTELSKE INDUSTRIJE

      OpenAIRE

      Ivanović, Slobodan

      2003-01-01

      U hotelskoj industriji vrlo često susrećemo više imitatora nego inovatora. Mali je broj hotelskih poduzeća koji su samo kontinuirano inovatori glede usluga. Kreativni imitatori doprinose difuziji inovacije i boljem podmirenju potreba nekih segmenata na turističkom tržištu. Oni uočavaju moguća poboljšanja na turističkom proizvodu ili usluzi koji su predmet inovacije - mijenja se neki atribut koji povećava njihovu vrijednost za domaće ili strane goste. Zato se drži da kreativna imitacija počinj...

    11. Određivanje krutosti planetarnog prenosnika / Determination of gear mesh stiffness in planetary gearing

      Directory of Open Access Journals (Sweden)

      Vojislav Batinić

      2008-04-01

      Full Text Available Kontaktna krutost zubaca jedan je od glavnih generatora unutrašnjih dinamičkih sila u spregama zupčanika planetarnih prenosnika. Neophodan je pri opisivanju dinamičkog ponašanja planetarnih prenosnika, tj. pri postavljanju jednačina dinamičke ravnoteže. U radu je prikazan metodološki pristup analitičkom i eksperimentalnom određivanju krutosti posmatranog planetarnog prenosnika. / Gear mesh stiffness in planetary gearing is one of the main generators of internal dynamic forces. It is necessary in describing dynamic behavior of planetary trains, i.e. in defining their equations of dynamic balance. This paper presents a methodological approach to experimental and analytical calculation of stiffness in planetary gearing.

    12. Vacuum technologies developed for at-400A Type B transportation and storage package

      International Nuclear Information System (INIS)

      Franklin, K.W.; Cockrell, G.D.

      1995-01-01

      The AT-400A TYPE B transportation and storage container will be used at Pantex Plant for the transportation and interim storage of plutonium pits. The AT-400A was designed by a joint effort between Sandia National Labs, Los Alamos National Labs, Lawrence Livermore National Laboratory, and Mason and Hanger-Silas Mason Co., Inc. In order to meet the requirements for transportation and storage, five different vacuum technologies had to be developed. The goals of the various vacuum technologies were to verify the plutonium pit was sealed, perform the assembly verification leak check in accordance with ANSI N-14.5 and to provide a final inert gas backfill in the containment vessel. This paper will discuss the following five vacuum technologies: (1) Pit Leak Testing, (2) Containment Vessel Purge and Backfill with tracer gas, (3) Containment Vessel Leak Testing, (4) Containment Vessel Purge and Final Backfill, and (5) Leak Testing of the Containment Vessel Gas Transfer tube

    13. AT-400A Type B transportation and storage package

      International Nuclear Information System (INIS)

      Cockrell, G.D.; Franklin, K.W.

      1995-01-01

      This paper discusses the design considerations for the AT-400A container which will meet the requirements for the transportation and long-term storage of plutonium pits. The AT-400A was designed by a joint effort between Sandia National Labs, Los Alamos National Labs, Lawrence Livermore National Laboratory, and Mason and Hanger Silas Mason Co., Inc.. The paper will outline the problems and impact on the design of the container necessitated by the need to meet DOT TYPE B transportation requirements and undefined requirements for the interim and long-term storage of pits. Areas covered will include: (1) determining the storage requirements, (2) surveillance program for interim storage, and (3) impact of storage requirements on the containment vessel and inner fixturing design

    14. Plutonium working group report on environmental, safety and health vulnerabilities associated with the department's plutonium storage. Volume II, Appendix B, Part 12: Pantex site assessment team report

      International Nuclear Information System (INIS)

      1994-09-01

      The U.S. DOE Pantex Plant is located in the panhandle of Texas approximately 17 miles northeast of Amarillo. The Plant site was originally constructed in 1942 for conventional shell- and bomb-loading. In 1950, this Plant began to perform nuclear explosives operations. Today, the Pantex Plant is operated by Mason ampersand Hanger - Silas Mason Co., Inc. Pantex Plant functions include (1) final assembly of new nuclear explosives; (2) maintenance, modification, and quality assurance testing of nuclear explosives already in the military stockpile; (3) disassembly of nuclear explosives that are no longer required in the military stockpile; and (4) interim storage of nuclear explosives components. This report presents results of an environmental, safety, and health assessment of the Pantex Plant for the storage of plutonium

    15. Prilog optimalnom projektovanju aktivnog sistema za oslanjanje vozila / A contribution to optimal design of vehicle active suspension system

      Directory of Open Access Journals (Sweden)

      Miroslav Demić

      2005-05-01

      Full Text Available U ovom radu prikazanje sistem za aktivno oslanjanje vozila, uz korišćenje ravanskog modela vozila, bez filtera u povratnim spregama sistema za regulaciju. Za optimizaciju parametara PI kontrolera korišćena je metoda stohastičke parametarske optimizacije. Cilj optimizacije bio je istovremeno minimiziranje vibracijskih ubrzanja oslonjene mase i standardnog odstupanja sila u kontaktima točkova i tla, što poboljšava udobnost i ponašanje vozila na putu. / In this paper, an active suspension system is developed by use of a vehicle plane model without feedback filters in control system. A method of stochastic parameters optimization has been utilized in order to optimize PI controller parameters. The basic optimization goal was a simultaneous minimization of sprung mass acceleration and standard deviation of forces in tire-to-ground contact area, so as to improve vehicle comfort and handling performances.

    16. Analysis of Environmental Physical-Chemical Factors and Macroalga Species In The Coastal Water of Nusalaut, Central Maluku - Indonesia

      Directory of Open Access Journals (Sweden)

      Karel Melsasail

      2018-03-01

      Full Text Available The physical-chemical factors of environment are very influential on the presence and the growth of macrolaga in waters. Well-maintained water habitat is a good environment for the growth of macroalgae. A research has been conducted on the physicochemical environmental factors and the macroalgae species in the coastal waters of Nusalaut Island using transect method, and it was a survey research on four different observation stations. The results of the research showed that station I (Amet Village has the best physicochemical factors for the presence and the growth of macroalgae, compared to station II (Nalahia Village, station III (Sila Village and station IV (Leinitu Village. The most widely found macro algae are from the Rhodophyta class, with a total of 17 species of macroalgae, of which 15 species are found in station I.

    17. Persistence of historical population structure in an endangered species despite near-complete biome conversion in California's San Joaquin Desert.

      Science.gov (United States)

      Richmond, Jonathan Q; Wood, Dustin A; Westphal, Michael F; Vandergast, Amy G; Leaché, Adam D; Saslaw, Lawrence R; Butterfield, H Scott; Fisher, Robert N

      2017-07-01

      Genomic responses to habitat conversion can be rapid, providing wildlife managers with time-limited opportunities to enact recovery efforts that use population connectivity information that reflects predisturbance landscapes. Despite near-complete biome conversion, such opportunities may still exist for the endemic fauna and flora of California's San Joaquin Desert, but comprehensive genetic data sets are lacking for nearly all species in the region. To fill this knowledge gap, we studied the rangewide population structure of the endangered blunt-nosed leopard lizard Gambelia sila, a San Joaquin Desert endemic, using restriction site-associated DNA (RAD), microsatellite and mtDNA data to test whether admixture patterns and estimates of effective migration surfaces (EEMS) can identify land areas with high population connectivity prior to the conversion of native xeric habitats. Clustering and phylogenetic analyses indicate a recent shared history between numerous isolated populations and EEMS reveals latent signals of corridors and barriers to gene flow over areas now replaced by agriculture and urbanization. Conflicting histories between the mtDNA and nuclear genomes are consistent with hybridization with the sister species G. wislizenii, raising important questions about where legal protection should end at the southern range limit of G. sila. Comparative analysis of different data sets also adds to a growing list of advantages in using RAD loci for genetic studies of rare species. We demonstrate how the results of this work can serve as an evolutionary guidance tool for managing endemic, arid-adapted taxa in one of the world's most compromised landscapes. Published 2017. This article is a U.S. Government work and is in the public domain in the USA.

    18. Persistence of historical population structure in an endangered species despite near-complete biome conversion in California's San Joaquin Desert

      Science.gov (United States)

      Richmond, Jonathan Q.; Wood, Dustin A.; Westphal, Michael F.; Vandergast, Amy; Leache, Adam D.; Saslaw, Lawrence; Butterfield, H. Scott; Fisher, Robert N.

      2017-01-01

      Genomic responses to habitat conversion can be rapid, providing wildlife managers with time-limited opportunities to enact recovery efforts that use population connectivity information that reflects predisturbance landscapes. Despite near-complete biome conversion, such opportunities may still exist for the endemic fauna and flora of California's San Joaquin Desert, but comprehensive genetic data sets are lacking for nearly all species in the region. To fill this knowledge gap, we studied the rangewide population structure of the endangered blunt-nosed leopard lizard Gambelia sila, a San Joaquin Desert endemic, using restriction site-associated DNA (RAD), microsatellite and mtDNA data to test whether admixture patterns and estimates of effective migration surfaces (EEMS) can identify land areas with high population connectivity prior to the conversion of native xeric habitats. Clustering and phylogenetic analyses indicate a recent shared history between numerous isolated populations and EEMS reveals latent signals of corridors and barriers to gene flow over areas now replaced by agriculture and urbanization. Conflicting histories between the mtDNA and nuclear genomes are consistent with hybridization with the sister species G. wislizenii, raising important questions about where legal protection should end at the southern range limit of G. sila. Comparative analysis of different data sets also adds to a growing list of advantages in using RAD loci for genetic studies of rare species. We demonstrate how the results of this work can serve as an evolutionary guidance tool for managing endemic, arid-adapted taxa in one of the world's most compromised landscapes.

    19. Viruses Associated With Acute Respiratory Infections and Influenza-like Illness Among Outpatients From the Influenza Incidence Surveillance Project, 2010–2011

      Science.gov (United States)

      Fowlkes, Ashley; Giorgi, Andrea; Erdman, Dean; Temte, Jon; Goodin, Kate; Di Lonardo, Steve; Sun, Yumei; Martin, Karen; Feist, Michelle; Linz, Rachel; Boulton, Rachelle; Bancroft, Elizabeth; McHugh, Lisa; Lojo, Jose; Filbert, Kimberly; Finelli, Lyn

      2017-01-01

      Background The Influenza Incidence Surveillance Project (IISP) monitored outpatient acute respiratory infection (ARI; defined as the presence of ≥2 respiratory symptoms not meeting ILI criteria) and influenza-like illness (ILI) to determine the incidence and contribution of associated viral etiologies. Methods From August 2010 through July 2011, 57 outpatient healthcare providers in 12 US sites reported weekly the number of visits for ILI and ARI and collected respiratory specimens on a subset for viral testing. The incidence was estimated using the number of patients in the practice as the denominator, and the virus-specific incidence of clinic visits was extrapolated from the proportion of patients testing positive. Results The age-adjusted cumulative incidence of outpatient visits for ARI and ILI combined was 95/1000 persons, with a viral etiology identified in 58% of specimens. Most frequently detected were rhinoviruses/enteroviruses (RV/EV) (21%) and influenza viruses (21%); the resulting extrapolated incidence of outpatient visits was 20 and 19/1000 persons respectively. The incidence of influenza virus-associated clinic visits was highest among patients aged 2–17 years, whereas other viruses had varied patterns among age groups. Conclusions The IISP provides a unique opportunity to estimate the outpatient respiratory illness burden by etiology. Influenza virus infection and RV/EV infection(s) represent a substantial burden of respiratory disease in the US outpatient setting, particularly among children. PMID:24338352

    20. Viruses associated with acute respiratory infections and influenza-like illness among outpatients from the Influenza Incidence Surveillance Project, 2010-2011.

      Science.gov (United States)

      Fowlkes, Ashley; Giorgi, Andrea; Erdman, Dean; Temte, Jon; Goodin, Kate; Di Lonardo, Steve; Sun, Yumei; Martin, Karen; Feist, Michelle; Linz, Rachel; Boulton, Rachelle; Bancroft, Elizabeth; McHugh, Lisa; Lojo, Jose; Filbert, Kimberly; Finelli, Lyn

      2014-06-01

      The Influenza Incidence Surveillance Project (IISP) monitored outpatient acute respiratory infection (ARI; defined as the presence of ≥ 2 respiratory symptoms not meeting ILI criteria) and influenza-like illness (ILI) to determine the incidence and contribution of associated viral etiologies. From August 2010 through July 2011, 57 outpatient healthcare providers in 12 US sites reported weekly the number of visits for ILI and ARI and collected respiratory specimens on a subset for viral testing. The incidence was estimated using the number of patients in the practice as the denominator, and the virus-specific incidence of clinic visits was extrapolated from the proportion of patients testing positive. The age-adjusted cumulative incidence of outpatient visits for ARI and ILI combined was 95/1000 persons, with a viral etiology identified in 58% of specimens. Most frequently detected were rhinoviruses/enteroviruses (RV/EV) (21%) and influenza viruses (21%); the resulting extrapolated incidence of outpatient visits was 20 and 19/1000 persons respectively. The incidence of influenza virus-associated clinic visits was highest among patients aged 2-17 years, whereas other viruses had varied patterns among age groups. The IISP provides a unique opportunity to estimate the outpatient respiratory illness burden by etiology. Influenza virus infection and RV/EV infection(s) represent a substantial burden of respiratory disease in the US outpatient setting, particularly among children.

    1. NCBI nr-aa BLAST: CBRC-BTAU-01-2227 [SEVENS

      Lifescience Database Archive (English)

      Full Text Available CBRC-BTAU-01-2227 ref|NP_504494.2| Prion-like-(Q/N-rich)-domain-bearing protein fam...ily member (pqn-13) [Caenorhabditis elegans] gb|AAA96110.3| Prion-like-(q/n-rich)-domain-bearing protein protein 13 [Caenorhabditis elegans] NP_504494.2 2e-08 25% ...

    2. Evaluation of an influenza-like illness case definition in the diagnosis of influenza among patients with acute febrile illness in Cambodia.

      Science.gov (United States)

      Kasper, Matthew R; Wierzba, Thomas F; Sovann, Ly; Blair, Patrick J; Putnam, Shannon D

      2010-11-07

      Influenza-like illness (ILI) is often defined as fever (>38.0°C) with cough or sore throat. In this study, we tested the sensitivity, specificity, and positive and negative predictive values of this case definition in a Cambodia patient population. Passive clinic-based surveillance was established at nine healthcare centers to identify the causes of acute undifferentiated fever in patients aged two years and older seeking treatment. Fever was defined as tympanic membrane temperature >38°C lasting more than 24 hours and less than 10 days. Influenza virus infections were identified by polymerase chain reaction. From July 2008 to December 2008, 2,639 patients were enrolled. From 884 (33%) patients positive for influenza, 652 presented with ILI and 232 acute fever patients presented without ILI. Analysis by age group identified no significant differences between influenza positive patients from the two groups. Positive predictive values (PPVs) varied during the course of the influenza season and among age groups. The ILI case definition can be used to identify a significant percentage of patients with influenza infection during the influenza season in Cambodia, assisting healthcare providers in its diagnosis and treatment. However, testing samples based on the criteria of fever alone increased our case detection by 34%.

    3. Reserve Compensation System Study Supporting Papers. Volume 2. Deferred Compensation and Benefits

      Science.gov (United States)

      1978-06-01

      rtfe REFERENCES &• «•«*■! SOrii CONO.. 2D PKSS.—CH. 70S—JUNK 20,1018 »•ili Midi standards nnd qualifications shall Iw determined perimli...consolidated veterans matters in title 38. In the codification , the expression "six months’ pay" was sub- stituted for "six months’ basic pay (plus

    4. A study of the health and economic effects of influenza-like illness on the working population under different working environments of a large corporation in Hong Kong.

      Science.gov (United States)

      Lee, Kenneth K C; Li, Shu Chuen; Kwong, Kai Sun; Chan, Thomas Y K; Lee, Vivian W Y; Lau, Joseph T F

      2008-01-01

      The incidence, health and economic impacts of influenza-like illness (ILI) among the working population in Hong Kong had never been studied. Due to the nature of the disease, ILIs can have a significant impact on the operation of a corporation in terms of loss of productivity and reduced work performance. The present study was undertaken to determine the health and economic impacts of ILIs under different environmental conditions on the working population of a large corporation. Over 2,000 employees of a large corporation in the travelling and tourism industry were studied with three different types of working environment (confined, typical office and well ventilated) by two structured questionnaires. The most affected group in terms of productivity and health was the group working in a confined area, whilst those working in a well-ventilated area were least affected. However, symptoms of the confined area group seemed to disappear faster. The infection rate appeared to vary according to work environment for the studied population. Policies on preventive measures and early treatment are important for a corporation to reduce loss in productivity due to ILIs.

    5. Working Characteristics of a Mechanical Insufflation-Exsufflation Device

      Directory of Open Access Journals (Sweden)

      Yan Shi

      2014-01-01

      Full Text Available Secretions of ventilated patients must be cleared efficiently and timely; to improve the secretion clearance efficiency of an insufflation-exsufflation device (IL-IE device and lay a foundation for the optimization of the IL-IE device, a mathematical model of the ventilation system with the IL-IE device is set up. Through the experimental and simulation research on the ventilation system, it can be concluded that, firstly, the mathematical model is proved to be authentic and reliable. Secondly, with the deposition of secretion or an increase in the respiratory compliance, the peak exsufflation airflow may be reduced. Thirdly, with a decrease in the suction pressure, the peak exsufflation airflow of the ventilated lung may rise proportionally, but the minimum pressure in the ventilated lung may descend proportionally. To improve the efficiency of the secretion clearance but not to injure the ventilated patient, the suction pressure can be elevated properly. Last, increasing the inspiratory positive airway pressure (IPAP is a method to improve the secretion clearance efficiency. This research lays a foundation for improving the secretion clearance efficiency of the IL-IE device.

    6. Problematika međunarodne regulative prijevoza stvari morem : (prijedlog unifikacijskog usklađivanja

      Directory of Open Access Journals (Sweden)

      Ivo Grabovac

      2001-07-01

      Full Text Available Činjenica da su neke države vezane Haško-Visbyjskim (ili samo Haškim ili Visbyjskim pravilima, a i o Protokolu iz 1979. godine također valja voditi računa, dok su druge spremne primjenjivati Hamburška pravila, ili druge kombinacije s Haaško-Visbyjskim pravilima, ne pridonosi ujednačavanju pomorskog prava na području prijevoza stvari. Postoji i mišljenje da bi ujednačavanju pomorskog prijevoza stvari pridonijela suvremena koncepcija nove konvencije koja bi na temeljima dosadašnjih iskustava optimalnije uvažavala interese broda i tereta. U radu se, upravo u cilju tog ujednačavanja, nastoje pronaći zajednička rješenja, iste ili bliske pravne regulacije u obje međunarodne konvencije. Međutim, iskazuju se i znatne razlike u rješenjima, a u Hamburškim pravilima ima i odredaba koje uređuju sasvim nove odnose. Prati se i rad u okviru Comité maritime international (CMI pa se izlažu i stajališta nacionalnih udruženja za pomorsko pravo. Konačno, izlažu se mnogobrojna komparativna rješenja.

    7. Uelekeo wa Maana za Kipolisemia katika Msamiati wa Kiswahili ...

      African Journals Online (AJOL)

      Data iliyotumika ni kutoka Kamusi ya Kiswahili Sanifu (TUKI, 2013). Ili kukidhi malengo hayo tumetumia Nadharia ya Maana kama Dhana, ambapo tunahusisha maana (dhana) mpya za kipolisemia na maana ya msingi ya neno hilo. Matokeo ya utafiti huu yamebaini kuwa polisemia huwa na maana zaidi ya moja ...

    8. Kauli za utendwa/utendewa katika tamthilia za Machozi ya ...

      African Journals Online (AJOL)

      Kazi hii ni ya utafiti wa kiisimu mitindo unaolenga kulinganisha na kulinganua kazi mbili za tamthiliya za Kiswahili ambazo ni Heshima Yangu (Muhando, 1974) na Machozi ya Mwanamke (Ngozi, 1977). Kwanza, makala inachunguza matumizi ya kauli za utendwa/utendewa katika tamthiliya hizi ili kujua kama ni ya hiari au ...

    9. Opitz C syndrome: Trigonocephaly, mental retardation and ...

      African Journals Online (AJOL)

      J.A. Avina Fierro

      2015-06-09

      Jun 9, 2015 ... metopic suture, but also can be distinguished the other minor facial anomalies that are found in ... synostosis in the metopic suture, it is a triangular shaped ..... ily, cause a form of the C (Opitz trigonocephaly) syndrome. Am J.

    10. Heterogeneity in both cytokine production and responsiveness of a panel of monoclonal human Epstein-Barr virus-transformed B-cell lines

      NARCIS (Netherlands)

      Jochems, G. J.; Klein, M. R.; Jordens, R.; Pascual-Salcedo, D.; van Boxtel-Oosterhof, F.; van Lier, R. A.; Zeijlemaker, W. P.

      1991-01-01

      To optimize growth and Ig production of in vitro-cultured Epstein-Barr virus (EBV)-transformed B cells, a panel of six monoclonal EBV B-cell lines was analyzed for autocrine growth factor production and responsiveness to various cytokines. Three cell lines produced Il-I and four produced Il-6,

    11. Loci of points in the Euclidean plane are deter- mined from ...

      Indian Academy of Sciences (India)

      Loci of points in the Euclidean plane are deter- mined from prescribed relations of the points with given points, and/or, lines. The depen- dence of these relations on parameters lead to the differential equations representing the fam- ily of loci under concern. Incidentally most of the differential equations thus obtained are non ...

    12. "Pedagogias Del Camaleon"/Pedagogies of the Chameleon: Identity and Strategies of Survival for Transnational Indigenous Latino Immigrants in the US South

      Science.gov (United States)

      Machado-Casas, Margarita

      2012-01-01

      Based on a 3-year qualitative research study that took place in a new immigrant-receiving community in North Carolina, the manuscript examines the implications of transnational cultural and sociolinguistic patterns of multilingual indigenous Latino immigrants (ILIs), and its effects on their survival in the US. Utilizing narrative analysis, it…

    13. Influenza-Like Illnesses in Senegal: Not Only Focus on Influenza Viruses

      Science.gov (United States)

      Dia, Ndongo; Diene Sarr, Fatoumata; Thiam, Diamilatou; Faye Sarr, Tening; Espié, Emmanuelle; OmarBa, Ibrahim; Coly, Malang; Niang, Mbayame; Richard, Vincent

      2014-01-01

      Influenza surveillance in African countries was initially restricted to the identification of circulating strains. In Senegal, the network has recently been enhanced (i) to include epidemiological data from Dakar and other regions and (ii) to extend virological surveillance to other respiratory viruses. Epidemiological data from the sentinel sites is transmitted daily by mobile phone. The data include those for other febrile syndromes similar to influenza-like illnesses (ILI), corresponding to integrated approach. Also, clinical samples are randomly selected and analyzed for influenza and other respiratory viruses. There were 101,640 declared visits to the 11 sentinel sites between week 11-2012 and week 35-2013; 22% of the visits were for fever syndromes and 23% of the cases of fever syndrome were ILI. Influenza viruses were the second most frequent cause of ILI (20%), after adenoviruses (21%) and before rhinoviruses (18%) and enteroviruses (15%). Co-circulation and co-infection were frequent and were responsible for ILI peaks. The first months of implementation of the enhanced surveillance system confirmed that viruses other the influenza make large contributions to influenza-like illnesses. It is therefore important to consider these etiologies in the development of strategies to reduce respiratory infections. More informative tools and research studies are required to assess the burden of respiratory infections in developing countries. PMID:24675982

    14. Association between influenza vaccination and reduced risks of major adverse cardiovascular events in elderly patients.

      Science.gov (United States)

      Chiang, Ming-Hsien; Wu, Hau-Hsin; Shih, Chia-Jen; Chen, Yung-Tai; Kuo, Shu-Chen; Chen, Te-Li

      2017-11-01

      This study was conducted to determine the protective effect of influenza vaccine against primary major adverse cardiovascular events (MACEs) in elderly patients, especially those with influenza-like illness (ILI). This retrospective, population-based case-control study of an elderly population (age≥65 years) was conducted using Taiwan's National Health Insurance Research Database (2000-2013). One control was selected for each MACE case (n=80,363 each), matched according to age, year of study entry, and predisposing factors for MACEs. ILI and MACEs (myocardial infarction [MI] and ischemic stroke) were defined according to the International Classification of Diseases, Ninth Revision, Clinical Modification. Odds ratios (ORs) were calculated for the association between MACEs and vaccination. Influenza vaccination received in the previous year was associated with reduced risks of primary MACEs overall (adjusted OR [aOR] 0.80, 95% CI 0.78-0.82, Prisks of MACEs (aOR 1.24, 95% CI 1.18-1.29, PVaccination attenuated the heightened risks associated with ILI (MACEs: aOR 0.99, 95% CI 0.92-1.07, P=.834; MI: aOR 1.05, 95% CI 0.92-1.21, P=.440; ischemic stroke: aOR 0.96, 95% CI 0.89-1.05, P=.398). Results of this study suggest that influenza vaccination is associated with reduced primary MACE risks in the elderly population, including those with ILI. Copyright © 2017 Elsevier Inc. All rights reserved.

    15. Anaesthetic efficacy of intraligamentary injection techniques on mandibular molars diagnosed with asymptomatic irreversible pulpitis: A retrospective study.

      Science.gov (United States)

      Lin, Shaul; Wigler, Ronald; Huber, Ronen; Kaufman, Arieh Y

      2017-04-01

      The objective of this study was to evaluate the success rate of intraligamentary injections (ILI) using a two- or four-site injection technique. One hundred and fifty-one mandibular molars diagnosed with asymptomatic irreversible pulpitis received ILI at the mesiobuccal and distobuccal aspects of the roots. Patients who experienced pain when the access cavity was performed received additional supplemental ILI in the mesiolingual and distolingual aspects. Pulpal anaesthesia was considered successful when complete analgesia was achieved. The data were analysed by means of the Fisher's exact and Pearson's chi-square tests. IL anaesthesia was successful for 92.1% of the teeth. Forty-eight teeth (31.8%) were sufficiently anaesthetised using the two-site ILI and 91 teeth (60.3%) following supplemental IL anaesthesia in two more sites. The results of this study indicate that the use of four-site IL injections as a primary anaesthetic technique may be considered a favourable alternative to the common IANB. © 2016 Australian Society of Endodontology Inc.

    16. Usmirenije Severnoi Korei / Joseph S. Nye ; tõlk. Nikolai Zhdanovitsh

      Index Scriptorium Estoniae

      Nye, Joseph S.

      2006-01-01

      USA president George Bush lootis, et tal õnnestub Põhja-Korea tuumaprobleemi lahendada režiimi vahetamisega. Arvestati, et isolatsioon ja sanktsioonid viivad Kim Jong Il'i diktatuuri kukutamiseni. Kuna režiim osutus vastupidavaks, nõustuti kuuepoolsete läbirääkimistega Hiina, Venemaa, Jaapani ja mõlema Koreaga

    17. Population study of Pyxis arachnoides brygooi (Vuillemin ...

      African Journals Online (AJOL)

      Tantelinirina Rakotondriamanga, Jean Kala and Jutta M. Hammer

      CH-8057 Zurich, Switzerland. Missouri Botanical Garden (MBG). Madagascar Research and Conservation Program. BP 3391. Antananarivo, 101 ..... south are clearly influenced by tourism, where forests are heav- ily exploited for construction material and charcoal production. (Du Puy and Moat 1998, Seddon et al. 2000).

    18. The Effect of Educational Computerized Games on Learning English Spelling among Iranian Children

      Science.gov (United States)

      Mehrpour, Saeed; Ghayour, Maaedeh

      2017-01-01

      The present study investigated the effects of educational computerized games on learning English spelling among Iranian children. In doing so, 66 young Iranian English learners with the average age of 9.5, attending the children's branch of Iran Language Institute (ILI), the most well-established state-run language teaching institute in Iran,…

    19. Ufundishaji wa Kusoma na Kuandika Kiswahili: Uzoefu wa Idara ya ...

      African Journals Online (AJOL)

      Makala haya yanahusu shughuli za kufundisha Kiswahili kama lugha ya kigeni katika Chuo Kikuu cha Sebha nchini Libya. Kwanza inaeleza historia ya Kiswahili – yaani kilianza lini kufundishwa kwa madhumuni gani na nani walikuwa wanzilishi. Halikadhalika makala ya naeleza utaratibu uliowekwa na idara ili kuweza ...

    20. NJP VOLUME 40 No 4 Corrected

      African Journals Online (AJOL)

      PROF. EZECHUKWU

      2013-05-04

      May 4, 2013 ... births and only 4% of cases are products of twin preg- nancies. The first documented case occurring in ... ily history of congenital malformations, the index preg- nancy was preceded by three successive ... Both babies were discharged home at the age of 24 days to be followed up in the clinic. However, the ...

    1. Therapeutic groin dissection for melanoma : Risk factors for short term morbidity

      NARCIS (Netherlands)

      Poos, H. P. A. M.; Kruijff, S.; Bastiaannet, E.; van Ginkel, R. J.; Hoekstra, H. J.

      Aims: Ilio-inguinal lymph node dissection for stage III melanoma is often complicated by wound healing disturbances. A retrospective study was performed to investigate the wound healing disturbances after therapeutic ili-inguinal lymphj node dissection. Patients and methods: Between 1989 and 2007,

    2. Teorijske i praktične osnove TIG postupka zavarivanja

      OpenAIRE

      Horvat, Marko; Kondić, Veljko; Brezovački, Dražen

      2014-01-01

      TIG/GTAW postupak zavarivanja je elektrolučni postupak zavarivanja netaljivom elektrodom u zaštitnoj atmosferi inertnih plinova ili smjesa plinova. U radu je prikazana kratka povijest i teorijske osnove postupka, prednosti i nedostaci te osvrt na praktične osnove primjene postupka.

    3. Sajajalgne : [luuletused] / Kalju Kangur

      Index Scriptorium Estoniae

      Kangur, Kalju, 1925-1989

      2001-01-01

      Sisu: Sajajalgne; Hajameelne tramm; Pildiraamat; Vanad krokodillid; Tantsulugu; Õhtulaul; Boamadu Pikaldane; Boamadu Boo; Lugu hundirattast; Õilis teeröövel Krauh-Karmauh; Rännumees; Kuningalugu; Kuninga kass; Muinasjutuaias; Kass Karlotte; Koogiteolaul; Laul kurvameelsest lohemaost; Kukerpall; "Lähme, lapsed..."; Küllasõit; Pisuhännalugu; Koduläte

    4. The Relationship Between Acoustic Target Strength and Body Length for Atlantic Sturgeon (Acipenser oxyrinchus oxyrinchus)

      Science.gov (United States)

      2010-10-01

      sturgeon feeding portray them as opportunistic benthivores, feeding primar- ily on mollusks, polychaete worms, amphipods, isopods, shrimp and small bottom...dwelling fishes and insect larvae (Gilbert 1989; Smith 1985). The Atlantic sturgeon is anadromous, entering freshwater rivers to spawn at water...bottom (small rubble, gravel, hard clay, and limestone) is required for successful egg attachment and incubation, while also protecting larvae from

    5. THE PITFALLS OF THE NUMISMATIC EVIDENCE. THE AUXILIARY FORT OF ARCOBADARA (ILIŞUA, BISTRIŢA-NĂSĂUD COUNTY, ROMANIA

      Directory of Open Access Journals (Sweden)

      Cristian Anton Gazdac

      2015-09-01

      Full Text Available In the light of the publication of the numismatic monograph from the site of Arcobadara (Ilişua in Roman Dacia (Romania, the present work is pointing out the pitfalls that the scholar may have to face when dealing with old and non-professional publication of artefacts.

    6. Studying employee well-being : Moving forward

      NARCIS (Netherlands)

      Ilies, R.; Pluut, Helen; Aw, S.S.Y.

      2015-01-01

      In this article, we attempt to integrate the commentaries to our position paper on intra-individual models of employee well-being (EWB; Ilies, R., Aw, S. S. Y., & Pluut, H. (2015). Intraindividual models of employee well-being: What have we learned and where do we go from here? European Journal of

    7. Correlation between national influenza surveillance data and google trends in South Korea.

      Science.gov (United States)

      Cho, Sungjin; Sohn, Chang Hwan; Jo, Min Woo; Shin, Soo-Yong; Lee, Jae Ho; Ryoo, Seoung Mok; Kim, Won Young; Seo, Dong-Woo

      2013-01-01

      In South Korea, there is currently no syndromic surveillance system using internet search data, including Google Flu Trends. The purpose of this study was to investigate the correlation between national influenza surveillance data and Google Trends in South Korea. Our study was based on a publicly available search engine database, Google Trends, using 12 influenza-related queries, from September 9, 2007 to September 8, 2012. National surveillance data were obtained from the Korea Centers for Disease Control and Prevention (KCDC) influenza-like illness (ILI) and virologic surveillance system. Pearson's correlation coefficients were calculated to compare the national surveillance and the Google Trends data for the overall period and for 5 influenza seasons. The correlation coefficient between the KCDC ILI and virologic surveillance data was 0.72 (pcorrelation was between the Google Trends query of H1N1 and the ILI data, with a correlation coefficient of 0.53 (pcorrelation with a correlation coefficient of 0.93 (pcorrelation coefficient compared with ILI data for three consecutive seasons: Tamiflu (r = 0.59, 0.86, 0.90, pcorrelated with national surveillance data in South Korea. The results of this study showed that Google Trends in the Korean language can be used as complementary data for influenza surveillance but was insufficient for the use of predictive models, such as Google Flu Trends.

    8. Four-Year Change in Cardiorespiratory Fitness and Influence on Glycemic Control in Adults With Type 2 Diabetes in a Randomized Trial

      Science.gov (United States)

      Jakicic, John M.; Egan, Caitlin M.; Fabricatore, Anthony N.; Gaussoin, Sarah A.; Glasser, Stephen P.; Hesson, Louise A.; Knowler, William C.; Lang, Wei; Regensteiner, Judith G.; Ribisl, Paul M.; Ryan, Donna H.

      2013-01-01

      OBJECTIVE To examine an intensive lifestyle intervention (ILI) compared with diabetes support and education (DSE) on 4-year change in fitness and physical activity (PA), and to examine the effect of change in fitness and PA, adjusting for potential confounders, on glycemic control in the Look AHEAD Trial. RESEARCH DESIGN AND METHODS Subjects were overweight/obese adults with type 2 diabetes mellitus (T2DM) with available fitness data at 4 years (n = 3,942).This clinical trial randomized subjects to DSE or ILI. DSE subjects received standard care plus information related to diet, PA, and social support three times per year. ILI subjects received weekly intervention contact for 6 months, which was reduced over the 4-year period, and were prescribed diet and PA. Measures included weight, fitness, PA, and HbA1c. RESULTS The difference in percent fitness change between ILI and DSE at 4 years was significant after adjustment for baseline fitness and change in weight (3.70 vs. 0.94%; P Fitness change at 4 years was inversely related to change in HbA1c after adjustment for clinical site, treatment, baseline HbA1c, prescribed diabetes medication, baseline fitness, and weight change (P fitness and PA in overweight/obese individuals with T2DM. Change in fitness was associated with improvements in glycemic control, which provides support for interventions to improve fitness in adults with T2DM. PMID:23223405

    9. Effectiveness of 2010/2011 seasonal influenza vaccine in Ireland.

      LENUS (Irish Health Repository)

      Barret, A S

      2012-02-01

      We conducted a case-control study to estimate the 2010\\/2011 trivalent influenza vaccine effectiveness (TIVE) using the Irish general practitioners\\' influenza sentinel surveillance scheme. Cases were influenza-like illness (ILI) patients with laboratory-confirmed influenza. Controls were ILI patients who tested negative for influenza. Participating sentinel general practitioners (GP) collected swabs from patients presenting with ILI along with their vaccination history and other individual characteristics. The TIVE was computed as (1 - odds ratiofor vaccination) x100%. Of 60 sentinel GP practices, 22 expressed interest in participating in the study and 17 (28%) recruited at least one ILI patient. In the analysis, we included 106 cases and 85 controls. Seven controls (8.2%) and one influenza case (0.9%) had been vaccinated in 2010\\/2011. The estimated TIVE against any influenza subtype was 89.4% [95% CI: 13.8; 99.8%], suggesting a protective effect against GP-attended laboratory confirmed influenza. This study design could be used to monitor influenza vaccine effectiveness annually but sample size and vaccination coverage should be increased to obtain precise and adjusted estimates.

    10. Profiling the Youth Leader: Personality and Emotional Intelligence Trends and Their Relationship to Leadership Skills

      Science.gov (United States)

      McElravy, L. J.; Hastings, Lindsay J.

      2014-01-01

      The transfer of leadership to younger generations is an important factor in agricultural communities and is likely one reason developing leaders is a central mission of many youth organizations, including 4-H and FFA. In adults, researchers have extensively explored the relationship between personality traits and leadership (Judge, Bono, Ilies,…

    11. Hiinlased tahavad ehitada Ringtee silda

      Index Scriptorium Estoniae

      2007-01-01

      2007. a. suvel kohtusid Tartu linnajuhtidega Shangai projekteerimisfirma Lin Tung-Yen & Li Guo-Hao Consultants Ltd ja Jiangsu provintsist pärit ehitusfirma Jiangyn Bridge Engineering Ltd esindajad, et esitada oma nägemus Tartusse planeeritavast Ringtee sillast. Anto Ili kommentaar

    12. Utafiti Wa Lahaja Za Kiswahili: Uzoefu Wa Uwandani | Ismail ...

      African Journals Online (AJOL)

      Katika ujumla wake, historia ya utafiti, na hasa utafiti wa uwandani, ni historia ya jitihada za binadamu katika kujishughulisha kwake ili ayaelewe masuala mengi mtambuka katika mazingira fungamanishi. Hakuna mtafiti yeyote anayeweza kudai kuwa utafiti wa mada fulani katika eneo fulani umekamilika na ...

    13. Riwaya ya Kiswahili katika ufundishaji wa historia | Mlaga | Kiswahili

      African Journals Online (AJOL)

      Makala haya yanachunguza uwezekano wa riwaya ya Kiswahili kutumika katika ufundishaji wa historia. Makala yamejiegemeza katika kuonesha namna ambavyo riwaya kama utanzu mmojawapo wa fasihi unafaa kufundishia historia. Hivyo basi, hoja mbalimbali zinabainishwa ili kuonesha namna ambavyo riwaya ya ...

    14. Correlates and predictors of obesity-specific quality of life of former participants of a residential intensive lifestyle intervention

      DEFF Research Database (Denmark)

      Elbe, A-M; Elsborg, P; Dandanell, S

      2018-01-01

      Introduction: The aim of this study was to investigate the relationship between weight loss during and after a unique type of weight loss intervention, namely, a residential intensive lifestyle intervention (ILI), and participants' obesity-specific health-related quality of life (HRQOL) several...

    15. [Influenza-like illness. Therapeutic experience in family medicine].

      Science.gov (United States)

      Muñoz-Cortés, Gerardo; García-Zavala, Guadalupe Ulises; Estrada-Andrade, María Elena

      2013-01-01

      influenza is a highly contagious respiratory disease. Surveillance in Mexico is based on the detection of Influenza-Like Illness (ILI) and antiviral treatment should begin within 48 hours to avoid the main complication, pneumonia. The aim was to describe the experience of treatment of ILI in a family medicine unit. a descriptive study included patients presented to the emergency room with ILI (38°C fever, headache and cough accompanied by other symptoms). We reviewed the reporting formats of Influenza. To follow up, we contacted them by telephone. Data are expressed as mean ± standard deviation. there were 537 patients attended with diagnosis of upper airway infection, 1.3 % met criteria for ILI. 85.7 % were men. The mean age was 18 ± 24.21 years. The patients were seen in a mean time of 19.14 hours after the symptoms have started; 100 % of the patients received treatment with oseltamivir and zanamivir; 14.3 % developed pneumonia. All the patients recovered without concomitant disease or complications. The use of a protocol in patients with influenza in a family medicine unit led an early diagnosis and treatment that favored the patients' health restoration.

    16. FİNANSAL VEKTÖREL ZAMAN DİZİLERİNDE ÖZDEĞER-ÖZVEKTÖR ANALİZİYLE EŞZAMANLI VE GECİKMELİ DOĞRUSAL İLİŞKİLERİN TESBİTİ

      Directory of Open Access Journals (Sweden)

      REŞAT KASAP

      2013-05-01

      Full Text Available Bu çalışmada, vektörel zaman dizilerinde modelleme aşamasında, dizilerin birbirleriyle ilişkilerini ortaya koyan eşzamanlı ve gecikmeli doğrusal ilişkilerin tesbiti, iki farklı gerçek veri grubu üzerinde gösterilmiştir. Bunlardan birincisi, üç diziden oluşan Ziraat Bankası(TCZB’nın verdiği kredi dizileridir. Diğeri ise, ABD Doları’nın BP(İngiliz Sterlini, DM(Alman Markı, SF(İsviçre Frangı, ve YEN(Japon Yeni’e göre değişimlerini veren dört dizidir. Analizler sonucunda vektör AR(1 ile modellenen her iki grupdan; birincisinde doğrusal ilişkilerin her ikisinin de olmadığı, diğer veri grubunda ise her iki ilişkinin de var olduğu görülmüştür.

    17. Psychological distress and depression in urbanising elderly black ...

      African Journals Online (AJOL)

      1991-04-20

      Apr 20, 1991 ... and 44% would have been treated for a depressive disorder if .... emotional and motivational state, vegetative symptoms, and ... respondents rated as positive for most of the items was con- .... that contributed most to ilie differences between Langa and ... considerable degree of impairment of function.

    18. lkyaNgonde : a preliminary analy- sis*

      African Journals Online (AJOL)

      This paper's main objective is to present a grammatical sketch oflkyaNgonde. ... are not identical to be cardinal vowels of the IPA since they are less tense. .... 'to teach/teaching'. 16 ... The symbol '<'will be used to indicate that a given form ... singular prefix is recognized by the morpheme /iii-- ily-/ and its correlative plural is.

    19. Journal of Earth System Science | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      This study used a combination of the wavelet cross-correlation technique and numerical analysis ofvegetative feedback to study the role of climate–vegetation feedback from 1981 to 2009 in the northernTianshan Mountains, Xinjiang Province, China. The study area included the Irtysh River, the Bortalaand Ili River valleys, ...

    20. Partial-Discharge Tests of Multiwinding High-Voltage Transformers for Space TWTAs (Traveling-Wave Tube Amplifiers).

      Science.gov (United States)

      1985-09-23

      34" .-* .V° --. 𔄁° "’" . y-. " .,- .r- ..-- . ru-. . La.L 4.’. C’... o 0 0 I,-- E - o Q0 Ldhi z0 LA-, =E ;’-’. -0 L.C AA. r- 0"" 7-- ., I-:. ILI.’ I I I

    1. NCBI nr-aa BLAST: CBRC-OLAT-26-0221 [SEVENS

      Lifescience Database Archive (English)

      Full Text Available CBRC-OLAT-26-0221 ref|NP_504494.2| Prion-like-(Q/N-rich)-domain-bearing protein fam...ily member (pqn-13) [Caenorhabditis elegans] gb|AAA96110.3| Prion-like-(q/n-rich)-domain-bearing protein protein 13 [Caenorhabditis elegans] NP_504494.2 3e-23 25% ...

    2. FINDIK TARIMI YAPILAN TOPRAKLARIN BİYOKİMYASAL AKTİVİTE ÖZELLİKLERİ İLE TOPRAK ÖZELLİKLERİ ARASINDAKİ İLİŞKİLER

      Directory of Open Access Journals (Sweden)

      Ayten KARACA

      1998-03-01

      Full Text Available Bu araştırmada, Terme - Ünye yöresinde fındık tarımı yapılan topraklarda üreaz, ß- Glikosidaz, asit ve alkali fosfataz enzim aktiviteleri belirlenmiş ve bu aktiviteler ile toprakların bazı önemli özellikleri ile, iz element ve ağır metal içerikleri arasındaki ilişkiler ortaya konulmaya çalışılmıştır. Yapılan regrasyon-korelasyon analiz sonuçlarına göre, üreaz enzim aktivitesi ile organik madde, azot ve ekstrakte edilebilir Cu , asit fosfataz aktivitesi ile organik madde, organik C ve azot arasında pozitif, ekstrakte edilebilir Mn arasında da negatif bir ilişki belirlenmiştir. Ayrıca, alkali fosfataz enzim aktivitesi ile pH, alınabilir P, ekstrakte edilebilir Cu, Zn ve Pb arasında önemli pozitif ilişki bulunmuştur. Toprakların ß-Glikosidaz aktivitesi ile toprak özellikleri arasında C/N oranı ve ekstrakte edilebilir Cd miktarı hariç, hiçbir önemli ilişki bulunamamıştır.

    3. Internet-based surveillance of Influenza-like-illness in the UK during the 2009 H1N1 influenza pandemic

      Directory of Open Access Journals (Sweden)

      Ealden Toby

      2010-10-01

      Full Text Available Abstract Background Internet-based surveillance systems to monitor influenza-like illness (ILI have advantages over traditional (physician-based reporting systems, as they can potentially monitor a wider range of cases (i.e. including those that do not seek care. However, the requirement for participants to have internet access and to actively participate calls into question the representativeness of the data. Such systems have been in place in a number of European countries over the last few years, and in July 2009 this was extended to the UK. Here we present results of this survey with the aim of assessing the reliability of the data, and to evaluate methods to correct for possible biases. Methods Internet-based monitoring of ILI was launched near the peak of the first wave of the UK H1N1v influenza pandemic. We compared the recorded ILI incidence with physician-recorded incidence and an estimate of the true number of cases over the course of the epidemic. We also compared overall attack rates. The effect of using different ILI definitions and alternative denominator assumptions on incidence estimates was explored. Results The crude incidence measured by the internet-based system appears to be influenced by individuals who participated only once in the survey and who appeared more likely to be ill. This distorted the overall incidence trend. Concentrating on individuals who reported more than once results in a time series of ILI incidence that matches the trend of case estimates reasonably closely, with a correlation of 0.713 (P-value: 0.0001, 95% CI: 0.435, 0.867. Indeed, the internet-based system appears to give a better estimate of the relative height of the two waves of the UK pandemic than the physician-recorded incidence. The overall attack rate is, however, higher than other estimates, at about 16% when compared with a model-based estimate of 6%. Conclusion Internet-based monitoring of ILI can capture the trends in case numbers if

    4. Estimating the disease burden of 2009 pandemic influenza A(H1N1 from surveillance and household surveys in Greece.

      Directory of Open Access Journals (Sweden)

      Vana Sypsa

      Full Text Available The aim of this study was to assess the disease burden of the 2009 pandemic influenza A(H1N1 in Greece.Data on influenza-like illness (ILI, collected through cross-sectional nationwide telephone surveys of 1,000 households in Greece repeated for 25 consecutive weeks, were combined with data from H1N1 virologic surveillance to estimate the incidence and the clinical attack rate (CAR of influenza A(H1N1. Alternative definitions of ILI (cough or sore throat and fever>38°C [ILI-38] or fever 37.1-38°C [ILI-37] were used to estimate the number of symptomatic infections. The infection attack rate (IAR was approximated using estimates from published studies on the frequency of fever in infected individuals. Data on H1N1 morbidity and mortality were used to estimate ICU admission and case fatality (CFR rates. The epidemic peaked on week 48/2009 with approximately 750-1,500 new cases/100,000 population per week, depending on ILI-38 or ILI-37 case definition, respectively. By week 6/2010, 7.1%-15.6% of the population in Greece was estimated to be symptomatically infected with H1N1. Children 5-19 years represented the most affected population group (CAR:27%-54%, whereas individuals older than 64 years were the least affected (CAR:0.6%-2.2%. The IAR (95% CI of influenza A(H1N1 was estimated to be 19.7% (13.3%, 26.1%. Per 1,000 symptomatic cases, based on ILI-38 case definition, 416 attended health services, 108 visited hospital emergency departments and 15 were admitted to hospitals. ICU admission rate and CFR were 37 and 17.5 per 100,000 symptomatic cases or 13.4 and 6.3 per 100,000 infections, respectively.Influenza A(H1N1 infected one fifth and caused symptomatic infection in up to 15% of the Greek population. Although individuals older than 65 years were the least affected age group in terms of attack rate, they had 55 and 185 times higher risk of ICU admission and CFR, respectively.

    5. Outbreaks of health care-associated influenza-like illness in France: Impact of electronic notification.

      Science.gov (United States)

      Munier-Marion, Elodie; Bénet, Thomas; Dananché, Cédric; Soing-Altach, Sophan; Maugat, Sylvie; Vaux, Sophie; Vanhems, Philippe

      2017-11-01

      Mandatory notification of health care-associated (HA) infections, including influenza-like illness (ILI) outbreaks, has been implemented in France since 2001. In 2012, the system moved to online electronic notification of HA infections (e-SIN). The objectives of this study are to describe ILI outbreak notifications to Santé publique France (SPF), the French national public health agency, and to evaluate the impact of notification dematerialization. All notifications of HA ILI outbreaks between July 2001 and June 2015 were included. Notifications before and after e-SIN implementation were compared regarding notification delay and information exhaustiveness. Overall, 506 HA ILI outbreaks were reported, accounting for 7,861 patients and health care professionals. Median delay between occurrence of the first case and notification was, respectively, 32 and 13 days before and after e-SIN utilization (P < .001). Information exhaustiveness was improved by electronic notification regarding HA status (8.5% of missing data before and 2.3% after e-SIN, P = .003), hypotheses of cause (25.4% of missing data before vs 8.0% after e-SIN, P < .001), and level of event control (23.7% of missing data before vs 7.5% after e-SIN, P < .001). HA influenza notifications, including HA ILI or influenza, to health authorities are essential to guide decisional instances and health care practices. Electronic notifications have improved the timeliness and quality of information transmitted. Copyright © 2017 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

    6. Enterovirus genotypes among patients with severe acute respiratory illness, influenza-like illness, and asymptomatic individuals in South Africa, 2012–2014

      Science.gov (United States)

      Hellferscee, Orienka; Tempia, Stefano; Walaza, Sibongile; Variava, Ebrahim; Dawood, Halima; Wolter, Nicole; Madhi, Shabir A.; du Plessis, Mignon; Cohen, Cheryl; Treurnicht, Florette K.

      2017-01-01

      Enteroviruses can cause outbreaks of severe acute respiratory illness (SARI) and EV-A, -B, -C, and -D species have different pathogenic profiles and circulation patterns. We aimed to characterize and determine the prevalence of enterovirus genotypes among South African patients with respiratory illness and controls during June 2012 to July 2014. Syndromic SARI and influenza-like illness (ILI) surveillance was performed at two sentinel sites. At each site nasopharyngeal/oropharyngeal specimens were collected from SARI and ILI patients as well as controls. Specimens were tested for enterovirus by real-time PCR. Positive specimenswere further genotyped by sequencing a region of theVP1 gene. The prevalence of enterovirus was 5.8% (87/1494), 3.4% (103/3079), and 3.4% (46/1367) among SARI, ILI, and controls, respectively (SARI/controls, P=0.002 and ILI/control, P = 0.973). Among the 101/236 (42.8%) enterovirus-positive specimens that could be genotyped, we observed a high diversity of circulating enterovirus genotypes (a total of 33 genotypes) from all four human enterovirus species with high prevalence of Enterovirus-B (60.4%; 61/101) and Enterovirus-A (21.8%; 22/101) compared to Enterovirus-C (10.9%; 11/101) and Enterovirus-D (6.9%; 7/101) (P = 0.477). Of the enterovirus genotypes identified, Echovirus 30 (9.9%, 10/101), Coxsackie virus B5 (7.9%, 8/101) and Enterovirus-D68 (6.9%, 7/101) were most prevalent. There was no difference in disease severity (SARI or ILI compared to controls) between the different enterovirus species (P = 0.167).We observed a high number of enterovirus genotypes in patients with respiratory illness and in controls from South Africa with no disease association of EV species with disease severity. PMID:28574589

    7. Lifestyle Intervention Improves Heart Rate Recovery from Exercise in Adults with Type 2 Diabetes: Results from the Look AHEAD Study

      Directory of Open Access Journals (Sweden)

      Paul M. Ribisl

      2012-01-01

      Full Text Available The primary aims of this paper were (1 to evaluate the influence of intensive lifestyle weight loss and exercise intervention (ILI compared with diabetes support and education (DSE upon Heart Rate Recovery (HRR from graded exercise testing (GXT and (2 to determine the independent and combined effects of weight loss and fitness changes upon HRR. In 4503 participants (45–76 years who completed 1 year of intervention, HRR was measured after a submaximal GXT to compare the influence of (ILI with (DSE upon HRR. Participants assigned to ILI lost an average 8.6% of their initial weight versus 0.7% in DSE group (P<0.001 while mean fitness increased in ILI by 20.9% versus 5.8% in DSE (P<0.001. At Year 1, all exercise and HRR variables in ILI improved (P<0.0001 versus DSE: heart rate (HR at rest was lower (72.8±11.4 versus 77.7±11.7 b/min, HR range was greater (57.7±12.1 versus 53.1±12.4 b/min, HR at 2 minutes was lower (89.3±21.8 versus 93.0±12.1 b/min, and HRR was greater (41.25±22.0 versus 37.8±12.5 b/min. Weight loss and fitness gain produced significant separate and independent improvements in HRR.

    8. Underdiagnosis of Influenza Virus Infection in Hospitalized Older Adults.

      Science.gov (United States)

      Hartman, Lauren; Zhu, Yuwei; Edwards, Kathryn M; Griffin, Marie R; Talbot, H Keipp

      2018-03-01

      To describe factors associated with provider-ordered influenza testing in hospitalized older adults. Information on participant demographics, symptoms, and provider-ordered influenza testing were collected by questionnaire and chart review. We conducted prospective laboratory-based surveillance using reverse-transcriptase polymerase chain reaction (RT-PCR), the criterion standard for diagnosis of influenza, to determine how participant characteristics and provider-ordered testing affected accurate influenza diagnosis. One academic and three community hospitals in Davidson County, Tennessee. Adults aged 18 and older with acute respiratory illness or nonlocalizing fever (N=1,422). We compared characteristics of participants with and without provider-ordered testing for influenza using the Wilcoxon test and Pearson chi-square test. Multivariable logistic regression models were used to identify factors predictive of provider-ordered influenza testing. Twenty-eight percent (399/1,422) of participants had provider-ordered influenza testing. Participants who were tested were younger than those not tested (58 ± 18 vs 66 ± 15, p<.001) and more likely to have influenza-like illness (ILI) (71% vs 49%, p<.001). ILI decreased with increasing age (aged 18-49, 63%; aged 50-64, 60%; aged ≥65, 48%). ILI and younger age were independent predictors of provider-ordered testing. Of the 136 participants with influenza confirmed using RT-PCR, ILI was the only significant predictor of provider-ordered testing (adjusted odds ratio=3.43, 95% confidence interval=1.22-9.70). Adults aged 65 and older hospitalized with fever or respiratory symptoms during influenza season are less likely to undergo a provider-ordered influenza test than younger adults. Some, but not all, of this disparity is due to a lower likelihood of ILI. Further strategies are needed to increase clinician awareness and testing in this vulnerable group. © 2018, Copyright the Authors Journal compilation © 2018

    9. Risk factors of respiratory syncytial virus infection among pediatric influenza-like illness and severe acute respiratory infections in Suzhou, China.

      Science.gov (United States)

      Huang, Yukai; Hua, Jun; Wang, Dan; Chen, Liling; Zhang, Jun; Zhu, Hong; Tian, Jianmei; Zhang, Tao; Zhao, Genming

      2018-03-01

      The characteristics and risk factors of respiratory syncytial virus (RSV) infection among children has not yet been fully understood. To address the characteristics of RSV-associated illness and risk factors of RSV infection among children under 5 years of age in Suzhou, China. From April 2011 to March 2014, we conducted a prospective surveillance among children in Suzhou, China. Nasal or throat swabs were collected from outpatients with influenza-like illness (ILI) and inpatients with severe acute respiratory infections (SARI). RSV was detected by reverse-transcriptase polymerase chain reaction and direct fluorescent antibody assay for children with ILI and SARI, respectively. Multivariable logistic-regression models were constructed to explore risk factors and symptoms of RSV infection. Of 3267 ILI and 1838 SARI children enrolled in the study, 192 (5.9%) and 287 (15.6%) tested positive for RSV, respectively. Among ILI patients, children with RSV infections visited clinics more often (P = 0.005) and had longer duration of fever (P = 0.032) than those without RSV infection. All RSV-positive children had an increased risk of having cough (OR = 2.9), rhinorrhea (OR = 1.6), breathing difficulty (OR = 3.4), wheezing (OR = 3.3), and irritability (OR = 2.7). Children aged respiratory infections (OR = 1.3) were more likely to get infected by RSV. Children with SARI had higher positive rate of RSV than those with ILI. Cough, rhinorrhea, and wheezing were the most common symptoms in RSV infection. Children aged respiratory infections were the potential risk factors for RSV infection. © 2017 Wiley Periodicals, Inc.

    10. Continued dominance of pandemic A(H1N1 2009 influenza in Victoria, Australia in 2010

      Directory of Open Access Journals (Sweden)

      James E. Fielding

      2011-08-01

      Full Text Available The 2010 Victorian influenza season was characterized by normal seasonal influenza activity and the dominance of the pandemic A(H1N1 2009 strain. General Practice Sentinel Surveillance rates peaked at 9.4 ILI cases per 1000 consultations in week 36 for metropolitan practices, and at 10.5 ILI cases per 1000 in the following week for rural practices. Of the 678 ILI cases, 23% were vaccinated, a significantly higher percentage than in previous years. A significantly higher percentage of ILI patients were swabbed in 2010 compared to 2003–2008, but similar to 2009, with a similar percentage being positive for influenza as in previous years. Vaccination rates increased with patient age. Melbourne Medical Deputising Service rates peaked in week 35 at 19.1 ILI cases per 1000 consultations. Of the 1914 cases of influenza notified to the Department of Health, Victoria, 1812 (95% were influenza A infections - 1001 (55% pandemic A(H1N1 2009, 4 (<1% A(H3N2 and 807 (45% not subtyped; 88 (5% were influenza B; and 14 (< 1% were influenza A and B co-infections. The World Health Organization Collaborating Centre for Reference and Research on Influenza tested 403 isolates of which 261 were positive for influenza, 250 of which were influenza A and 11 were influenza B. Ninety-two per cent of the influenza A viruses were pandemic A(H1N1 2009, and following antigenic analysis all of these were found to be similar to the current vaccine strain. Three viruses (0.9% were found to be oseltamivir resistant due to an H275Y mutation in the neuraminidase gene.

    11. Lessons from the epidemiological surveillance program, during the influenza A (H1N1 virus epidemic, in a reference university hospital of Southeastern Brazil

      Directory of Open Access Journals (Sweden)

      Maria Luiza Moretti

      2011-08-01

      Full Text Available INTRODUCTION: The case definition of influenza-like illness (ILI is a powerful epidemiological tool during influenza epidemics. METHODS: A prospective cohort study was conducted to evaluate the impact of two definitions used as epidemiological tools, in adults and children, during the influenza A H1N1 epidemic. Patients were included if they had upper respiratory samples tested for influenza by real-time reverse transcriptase polymerase chain reaction during two periods, using the ILI definition (coughing + temperature > 38ºC in period 1, and the definition of severe acute respiratory infection (ARS (coughing + temperature > 38ºC and dyspnoea in period 2. RESULTS: The study included 366 adults and 147 children, covering 243 cases of ILI and 270 cases of ARS. Laboratory confirmed cases of influenza were higher in adults (50% than in children (21.6% ( p < 0.0001 and influenza infection was more prevalent in the ILI definition (53% than ARS (24.4% (p < 0.0001. Adults reported more chills and myalgia than children (p = 0.0001. Oseltamivir was administered in 58% and 46% of adults and children with influenza A H1N1, respectively. The influenza A H1N1 case fatality rate was 7% in adults and 8.3% in children. The mean time from onset of illness until antiviral administration was 4 days. CONCLUSIONS: The modification of ILI to ARS definition resulted in less accuracy in influenza diagnosis and did not improve the appropriate time and use of antiviral medication.

    12. Laboratory surveillance of influenza-like illness in seven teaching hospitals, South Korea: 2011-2012 season.

      Directory of Open Access Journals (Sweden)

      Ji Yun Noh

      Full Text Available BACKGROUND: A well-constructed and properly operating influenza surveillance scheme is essential for public health. This study was conducted to evaluate the distribution of respiratory viruses in patients with influenza-like illness (ILI through the first teaching hospital-based surveillance scheme for ILI in South Korea. METHODS: Respiratory specimens were obtained from adult patients (≥18 years who visited the emergency department (ED with ILI from week 40, 2011 to week 22, 2012. Multiplex PCR was performed to detect respiratory viruses: influenza virus, adenovirus, coronavirus, respiratory syncytial virus, rhinovirus, human metapneumovirus, parainfluenza virus, bocavirus, and enterovirus. RESULTS: Among 1,983 patients who visited the ED with ILI, 811 (40.9% were male. The median age of patients was 43 years. Influenza vaccination rate was 21.7% (430/1,983 during the 2011-2012 season. At least one comorbidity was found in 18% of patients. The positive rate of respiratory viruses was 52.1% (1,033/1,983 and the total number of detected viruses was 1,100. Influenza A virus was the dominant agent (677, 61.5% in all age groups. The prevalence of human metapneumovirus was higher in patients more than 50 years old, while adenovirus was detected only in younger adults. In 58 (5.6% cases, two or more respiratory viruses were detected. The co-incidence case was identified more frequently in patients with hematologic malignancy or organ transplantation recipients, however it was not related to clinical outcomes. CONCLUSION: This study is valuable as the first extensive laboratory surveillance of the epidemiology of respiratory viruses in ILI patients through a teaching hospital-based influenza surveillance system in South Korea.

    13. Učinak potonuća plovila na vezu na pravni odnos između stranaka ugovora o vezu i čuvanju plovila

      Directory of Open Access Journals (Sweden)

      Adriana Vincenca Padovan

      2018-02-01

      Full Text Available Slučajevi potonuća brodice ili jahte na vezu u marini nisu česti, ali statistika pokazuje da se povremeno događaju, i tada je vrlo vjerojatno da će incident u konačnici dovesti do spora za naknadu štete prouzročene potonućem između vlasnika odnosno korisnika brodice ili jahte i marine. Osim očite štete na samoj brodici ili jahti, takav incident u marini će neizbježno rezultirati troškovima vađenja, spašavanja ili uklanjanja potonulog plovnog objekta, a potencijalno i do štete na infrastrukturi i opremi marine. Takav štetni događaj utjecat će na ugovor o vezu između marine i vlasnika, odnosno korisnika brodice ili jahte. Odgovornost za štetu ovisit će o okolnostima svakog pojedinog slučaja, a interpretirat će se sukladno ugovoru o vezu i mjerodavnom nacionalnom pravu. Uzroci potonuća mogu biti razni, od ekstremnih vremenskih uvjeta, do tehničkih nedostataka koji brodicu odnosno jahtu čine nesposobnom za plovidbu, ili neadekvatnog veza, sidrenog sustava, opreme za vezivanje, poplave, požara, lošeg održavanja, sudara, i dr. U svakom pojedinom slučaju trebat će ustanoviti uzrok potonuća, i ovisno o tome utvrditi postoji li odgovornost jedne od ugovornih strana. Nadalje, postavlja se pitanje koja je sudbina ugovora o vezu nakon takvog potonuća, tj. ostaje li ugovor na snazi, ili automatski prestaje samom činjenicom potonuća, ili ima li koja od ugovornih strana pravo na raskid ili otkaz ugovora odnosno pravo na naknadu štete te koja se šteta u takvom slučaju naknađuje. Navedene pravne posljedice također će ovisiti o uzroku potonuća i uvjetima ugovora o vezu. Analizirajući učinak potonuća na ugovor o vezu, autorice razmatraju i statističke podatke o učestalosti takvih događaja u hrvatskim marinama, poslovnu praksu, interne protokole i opće uvjete poslovanja hrvatskih marina te općenito preventivne mjere koje koncesionari domaćih marina uobičajeno primjenjuju u interesu sigurnosti plovidbe. Analiza

    14. Rapid detection of pandemic influenza in the presence of seasonal influenza

      Directory of Open Access Journals (Sweden)

      Robertson Chris

      2010-11-01

      Full Text Available Abstract Background Key to the control of pandemic influenza are surveillance systems that raise alarms rapidly and sensitively. In addition, they must minimise false alarms during a normal influenza season. We develop a method that uses historical syndromic influenza data from the existing surveillance system 'SERVIS' (Scottish Enhanced Respiratory Virus Infection Surveillance for influenza-like illness (ILI in Scotland. Methods We develop an algorithm based on the weekly case ratio (WCR of reported ILI cases to generate an alarm for pandemic influenza. From the seasonal influenza data from 13 Scottish health boards, we estimate the joint probability distribution of the country-level WCR and the number of health boards showing synchronous increases in reported influenza cases over the previous week. Pandemic cases are sampled with various case reporting rates from simulated pandemic influenza infections and overlaid with seasonal SERVIS data from 2001 to 2007. Using this combined time series we test our method for speed of detection, sensitivity and specificity. Also, the 2008-09 SERVIS ILI cases are used for testing detection performances of the three methods with a real pandemic data. Results We compare our method, based on our simulation study, to the moving-average Cumulative Sums (Mov-Avg Cusum and ILI rate threshold methods and find it to be more sensitive and rapid. For 1% case reporting and detection specificity of 95%, our method is 100% sensitive and has median detection time (MDT of 4 weeks while the Mov-Avg Cusum and ILI rate threshold methods are, respectively, 97% and 100% sensitive with MDT of 5 weeks. At 99% specificity, our method remains 100% sensitive with MDT of 5 weeks. Although the threshold method maintains its sensitivity of 100% with MDT of 5 weeks, sensitivity of Mov-Avg Cusum declines to 92% with increased MDT of 6 weeks. For a two-fold decrease in the case reporting rate (0.5% and 99% specificity, the WCR and

    15. Halkın Genetiği Değiştirilmiş Ürünlere/Üretilme Süreçlerine Yönelik Algıları ve Etik İnançları

      Directory of Open Access Journals (Sweden)

      Özlen Özgen

      2014-02-01

      Full Text Available Bu araştırmanın amacı, halkın genetiği değiştirilmiş ürünlere ve üretilme süreçlerine yönelik fayda/risk algıları ile etik inançları arasındaki ilişkinin incelenmesidir. Araştırma materyalinin toplanmasında karşılıklı görüşme tekniği kullanılmıştır. Likert tipi cümlelere verilen yanıtlar puanlanmış, geçerlik ve güvenirlik analizi yapılmıştır. Yaş değişkenine bağlı farklılığın belirlenebilmesi için t-testi uygulanmıştır. Bireylerin genetiği değiştirilmiş ürünlere/üretilme süreçlerine bağlı fayda/risk algıları ile etik inançları arasındaki ilişkinin incelenmesi amacı ile Pearson korelasyon analizi yapılmıştır. Bulgular; tüketicilerin genetiği değiştirilmiş ürünlere ilişkin fayda algılarının, genetiği değiştirilmiş ürünlere ve üretilme süreçlerine ilişkin risk algılarının, genetiği değiştirilmiş ürünlere ve üretilme süreçlerine ilişkin etik inançlarının yaşa bağlı olarak değiştiğini göstermektedir. Pearson korelasyon analizi sonucunda p<0.001 düzeyinde anlamlı ilişkiler saptanmıştır.

    16. Secondary household transmission of 2009 pandemic influenza A (H1N1 virus among an urban and rural population in Kenya, 2009-2010.

      Directory of Open Access Journals (Sweden)

      Clara Y Kim

      Full Text Available BACKGROUND: In Kenya, >1,200 laboratory-confirmed 2009 pandemic influenza A (H1N1 (pH1N1 cases occurred since June 2009. We used population-based infectious disease surveillance (PBIDS data to assess household transmission of pH1N1 in urban Nairobi (Kibera and rural Lwak. METHODS: We defined a pH1N1 patient as laboratory-confirmed pH1N1 infection among PBIDS participants during August 1, 2009-February 5, 2010, in Kibera, or August 1, 2009-January 20, 2010, in Lwak, and a case household as a household with a laboratory-confirmed pH1N1 patient. Community interviewers visited PBIDS-participating households to inquire about illnesses among household members. We randomly selected 4 comparison households per case household matched by number of children aged <5. Comparison households had a household visit 10 days before or after the matched patient symptom onset date. We defined influenza-like illnesses (ILI as self-reported cough or sore throat, and a self-reported fever ≤8 days after the pH1N1 patient's symptom onset in case households and ≤8 days before selected household visit in comparison households. We used the Cochran-Mantel-Haenszel test to compare proportions of ILIs among case and comparison households, and log binomial-model to compare that of Kibera and Lwak. RESULTS: Among household contacts of patients with confirmed pH1N1 in Kibera, 4.6% had ILI compared with 8.2% in Lwak (risk ratio [RR], 0.5; 95% confidence interval [CI], 0.3-0.9. Household contacts of patients were more likely to have ILIs than comparison-household members in both Kibera (RR, 1.8; 95% CI, 1.1-2.8 and Lwak (RR, 2.6; 95% CI, 1.6-4.3. Overall, ILI was not associated with patient age. However, ILI rates among household contacts were higher among children aged <5 years than persons aged ≥5 years in Lwak, but not Kibera. CONCLUSIONS: Substantial pH1N1 household transmission occurred in urban and rural Kenya. Household transmission rates were higher in the rural area.

    17. Rapid detection of pandemic influenza in the presence of seasonal influenza

      Science.gov (United States)

      2010-01-01

      Background Key to the control of pandemic influenza are surveillance systems that raise alarms rapidly and sensitively. In addition, they must minimise false alarms during a normal influenza season. We develop a method that uses historical syndromic influenza data from the existing surveillance system 'SERVIS' (Scottish Enhanced Respiratory Virus Infection Surveillance) for influenza-like illness (ILI) in Scotland. Methods We develop an algorithm based on the weekly case ratio (WCR) of reported ILI cases to generate an alarm for pandemic influenza. From the seasonal influenza data from 13 Scottish health boards, we estimate the joint probability distribution of the country-level WCR and the number of health boards showing synchronous increases in reported influenza cases over the previous week. Pandemic cases are sampled with various case reporting rates from simulated pandemic influenza infections and overlaid with seasonal SERVIS data from 2001 to 2007. Using this combined time series we test our method for speed of detection, sensitivity and specificity. Also, the 2008-09 SERVIS ILI cases are used for testing detection performances of the three methods with a real pandemic data. Results We compare our method, based on our simulation study, to the moving-average Cumulative Sums (Mov-Avg Cusum) and ILI rate threshold methods and find it to be more sensitive and rapid. For 1% case reporting and detection specificity of 95%, our method is 100% sensitive and has median detection time (MDT) of 4 weeks while the Mov-Avg Cusum and ILI rate threshold methods are, respectively, 97% and 100% sensitive with MDT of 5 weeks. At 99% specificity, our method remains 100% sensitive with MDT of 5 weeks. Although the threshold method maintains its sensitivity of 100% with MDT of 5 weeks, sensitivity of Mov-Avg Cusum declines to 92% with increased MDT of 6 weeks. For a two-fold decrease in the case reporting rate (0.5%) and 99% specificity, the WCR and threshold methods

    18. Early detection for cases of enterovirus- and influenza-like illness through a newly established school-based syndromic surveillance system in Taipei, January 2010 ~ August 2011.

      Directory of Open Access Journals (Sweden)

      Ting Chia Weng

      Full Text Available School children may transmit pathogens with cluster cases occurring on campuses and in families. In response to the 2009 influenza A (H1N1 pandemic, Taipei City Government officials developed a School-based Infectious Disease Syndromic Surveillance System (SID-SSS. Teachers and nurses from preschools to universities in all 12 districts within Taipei are required to daily report cases of symptomatic children or sick leave requests through the SID-SSS. The pre-diagnosis at schools is submitted firstly as common pediatric disease syndrome-groups and re-submitted after confirmation by physicians. We retrieved these data from January 2010 to August 2011 for spatio-temporal analysis and evaluated the temporal trends with cases obtained from both the Emergency Department-based Syndromic Surveillance System (ED-SSS and the Longitudinal Health Insurance Database 2005 (LHID2005. Through the SID-SSS, enterovirus-like illness (EVI and influenza-like illness (ILI were the two most reported syndrome groups (77.6% and 15.8% among a total of 19,334 cases, respectively. The pre-diagnosis judgments made by school teachers and nurses showed high consistency with physicians' clinical diagnoses for EVI (97.8% and ILI (98.9%. Most importantly, the SID-SSS had better timeliness with earlier peaks of EVI and ILI than those in the ED-SSS. Furthermore, both of the syndrome groups in these two surveillance systems had the best correlation reaching 0.98 and 0.95, respectively (p<0.01. Spatio-temporal analysis observed the patterns of EVI and ILI both diffuse from the northern suburban districts to central Taipei, with ILI spreading faster. This novel system can identify early suspected cases of two important pediatric infections occurring at schools, and clusters from schools/families. It was also cost-effective (95.5% of the operation cost reduced and 59.7% processing time saved. The timely surveillance of mild EVI and ILI cases integrated with spatial analysis may help

    19. Farmakoekologija – okolišna sudbina lijekova

      Directory of Open Access Journals (Sweden)

      Valerije Vrček

      2017-03-01

      Full Text Available Lijekovi koji se upotrebljavaju za preventivu ili terapiju završavaju u otpadnim vodama, rijekama, jezerima i morima, ali također u vodi za piće. U posljednjih je dvadesetak godina objavljeno na stotine analitičkih studija koje pokazuju prisutnost gotovo svih terapijskih skupina u okolišu. Koncentracije lijekova u okolišu su niske, ali to ne znači da rizik za ljude ili okoliš ne postoji, jer lijekovi su kemikalije dizajnirane da izazivaju biološke učinke upravo pri vrlo niskim dozama. Pojavnost svakog lijeka u okolišu izravno je povezana s intenzitetom njegove primjene. Stoga su psihoaktivni lijekovi, poput karbamazepina, najčešća farmaceutska zagađivala okoliša. Detekcija sve viših koncentracija lijekova u okolišu nije rezultat razvoja analitičke kemije i preciznosti instrumenata, već je posljedica porasta uporabe lijekova. Poseban problem lijekova u okolišu predstavljaju njihovi razgradni produkti ili metaboliti. Pod utjecajem svjetla ili prilikom kemijske obrade otpadnih voda mnogi se lijekovi transformiraju u nove strukture o kojima znanost vrlo malo zna. Neki metaboliti mogu biti toksičniji od ishodnih spojeva. Također, metaboliti mogu biti otporniji prema biorazgradnji, pa se dulje vremena zadržavaju u okolišu. Metaboliti se najčešće ne razmatraju prilikom službenih procjena okolišnog rizika lijekova. Konačne potvrde da lijekovi zaista dovode do ekoloških katastrofa nalaze se u objavljenim znanstvenim studijama koje prikazuju kolaps riblje populacije u Sjevernoj Americi, zbog djelovanja sintetskih estrogena ili nestanak ptica na indijskom potkontinentu uslijed veterinarske uporabe Voltarena. Budući da je ekološka cijena uporabe lijekova mjerljiva, rasprave o niskim ili (nedovoljnim dozama lijekova u okolišu zapravo su – zakašnjele. Lijekovi i njihovi razgradni produkti već djeluju na žive organizme, a pitanje je vremena kad će slični učinci biti uočeni i u ljudskoj populaciji.

    20. Vađenje podrtina i potonulih stvari u svjetlu novele Pomorskog zakonika iz 2013. godine

      Directory of Open Access Journals (Sweden)

      Vesna Skorupan Wolff

      2017-11-01

      Full Text Available Materiju vađenja podrtina i potonulih stvari uređuju odredbe upravnopravne prirode koje reguliraju odnose između vlasnika podrtine ili potonule stvari, odnosno ovlaštene osobe i upravnih tijela, a kojima se uređuju razni pravni aspekti postupka vađenja. Pravo vaditi podrtinu ili potonulu stvar primarno ima njezin vlasnik odnosno ovlaštena osoba. Zakon vlasnicima podrtina i potonulih stvari, odnosno ovlaštenim osobama, ostavlja primjeren rok u kojem mogu pokrenuti upravni postupak za dobivanje dozvole za vađenje podrtine ili potonule stvari. Na taj način jamči se nepovredivost vlasništva i utvrđuje načelo prema kojem činjenica da je stvar potonula ili se nasukala ne utječe izravno na vlasnička prava njezina dotadašnjeg vlasnika. Međutim, ako vlasnik, odnosno ovlaštena osoba ne zatraži odobrenje za vađenje podrtine ili potonule stvari, ili kad bez opravdanog razloga prekine ili napusti započeto vađenje kao i u slučaju ako je ovlaštena osoba nepoznata, PZ nudi pravni okvir i omogućuje da vađenje podrtine ili potonule stvari poduzme pošteni nalaznik ili lučka kapetanija. U okviru instituta vađenja podrtina i potonulih stvari uvodi se posebno pravno uređenje za nalaz stvari u moru te se precizno normiraju svi segmenti postupka vađenja kada ga poduzima pošteni nalaznik ili lučka kapetanija. Uređuju se i sva relevantna pitanja u svezi postupanja s izvađenim stvarima kao što su njihovo čuvanje te u propisanim slučajevima mogućnost prodaje na javnoj dražbi. PZ-om se precizno uređuju obvezni odnosi koji nastaju između vlasnika, odnosno ovlaštene osobe i poštenog nalaznika te vlasnika, odnosno ovlaštene osobe i lučke kapetanije, ovisno o tome tko je poduzeo vađenje, a koji se odnose na plaćanje naknade za vađenje, čuvanje, nalazninu i druge tražbine koje zakon priznaje poštenim nalaznicima i lučkim kapetanijama. U okviru toga, uređuje se i posebno stvarnopravno uređenje za stjecanje prava vlasni

    1. FİNANSAL HİZMET İŞLETMELERİNDE KURUMSAL REKLAMCILIK

      OpenAIRE

      MERAL, Pınar Seden

      2011-01-01

      Kurumsal reklamcılık, bütünleşik pazarlama iletişimi anlayışı dahilinde, halkla ilişkiler ve reklamın birlikte hareket ettiği bir alandır. Kurumsal reklam, kurum kültürü, kurum kimliği ve kurum imajı gibi halkla ilişkilerin uygulama alanı içerisinde bulunan kavramlara yönelik olarak gerçekleştirilmek­tedir. Sanayi üretime yönelik işletmelerde ürünün fiziksel varlığı, o işletmenin tanımını yapabilmek için güçlü bir baz sağlar. Bununla birlikte hizmet işletmeleri, hizmetlerin soyut olma...

    2. Teacher led school-based surveillance can allow accurate tracking of emerging infectious diseases - evidence from serial cross-sectional surveys of febrile respiratory illness during the H1N1 2009 influenza pandemic in Singapore

      Directory of Open Access Journals (Sweden)

      Soh Shu E

      2012-12-01

      Full Text Available Abstract Background Schools are important foci of influenza transmission and potential targets for surveillance and interventions. We compared several school-based influenza monitoring systems with clinic-based influenza-like illness (ILI surveillance, and assessed the variation in illness rates between and within schools. Methods During the initial wave of pandemic H1N1 (pdmH1N1 infections from June to Sept 2009 in Singapore, we collected data on nation-wide laboratory confirmed cases (Sch-LCC and daily temperature monitoring (Sch-DTM, and teacher-led febrile respiratory illness reporting in 6 sentinel schools (Sch-FRI. Comparisons were made against age-stratified clinic-based influenza-like illness (ILI data from 23 primary care clinics (GP-ILI and proportions of ILI testing positive for pdmH1N1 (Lab-ILI by computing the fraction of cumulative incidence occurring by epidemiological week 30 (when GP-ILI incidence peaked; and cumulative incidence rates between school-based indicators and sero-epidemiological pdmH1N1 incidence (estimated from changes in prevalence of A/California/7/2009 H1N1 hemagglutination inhibition titers ≥ 40 between pre-epidemic and post-epidemic sera. Variation in Sch-FRI rates in the 6 schools was also investigated through a Bayesian hierarchical model. Results By week 30, for primary and secondary school children respectively, 63% and 79% of incidence for Sch-LCC had occurred, compared with 50% and 52% for GP-ILI data, and 48% and 53% for Sch-FRI. There were 1,187 notified cases and 7,588 episodes in the Sch-LCC and Sch-DTM systems; given school enrollment of 485,723 children, this represented 0.24 cases and 1.6 episodes per 100 children respectively. Mean Sch-FRI rate was 28.8 per 100 children (95% CI: 27.7 to 29.9 in the 6 schools. We estimate from serology that 41.8% (95% CI: 30.2% to 55.9% of primary and 43.2% (95% CI: 28.2% to 60.8% of secondary school-aged children were infected. Sch-FRI rates were similar across

    3. Parametrik Olmayan Çok Değişkenli Varyans Analizi ve Sağlık Alanında Bir Uygulaması

      OpenAIRE

      PASİN, Özge; ANKARALI, Handan; CANGÜR, Şengül; SUNGUR, Mehmet Ali

      2016-01-01

      Sağlık araştırmalarında, etkenlerin genellikle birbirleriyle ilişkili birden fazla sonucu olabilir. Bu ilişkili sonuçları ayrı analiz etmek 1.Tip hatanın artmasına neden olur. Ancak pratik uygulamalarda veri analizinde sıklıkla bu hata yapılmakta, daha basit, kolay yorumlanabilen tek değişkenli analiz yöntemlerinden yararlanılmaktadır.  Ayrıca sağlık araştırmalarındaki özelliklerin önemli bir bölümü tek değişkenli parametrik modellerin varsayımlarından olan normal dağılım ve varyansların homo...

    4. Utjecaj imidža marke na odabir luksuznog kozmetičkog proizvoda

      OpenAIRE

      Jurić, Monika

      2018-01-01

      Ponašanje potrošača je dinamička interakcija spoznaje i čimbenika okružja koji se reflektiraju na ponašanje i promjenu raznih aspekata života potrošača. Danas diljem svijeta postoje milijarde potrošača koji kupuju proizvode. Kozmetički proizvod je svaka tvar ili smjesa koja je namijenjena dodiru s vanjskim dijelovima tijela (koža, kosa, nokti) ili sa zubima i sluznicom usne šupljine isključivo radi njihova čišćenja, parfimiranja, zaštite i održavanja u dobrom stanju, mijenjanja njihova izgled...

    5. Cerambycids of Southeast Serbia (Coleoptera, Cerambycidae

      Directory of Open Access Journals (Sweden)

      Gnjatović, I.

      2010-12-01

      Full Text Available The cerambycids (longhorn beetles are known as very attractive insects, as well as pests, especially in forestry. Our investigation and collecting the specimens on the territory of Serbia has started in the middle of the nineteenth century. Up today, 242 species were registered in the fauna of Serbia (Ilić, 2005. The first information about cerambycids in Serbia was published by Bobić (1871. Significant contribution in researching of the family Cerambycidae was given by Košanin (1904. Finally, there were several domestic authors occupied by longhorn beetles: Adamović (1950, Mikšić (1963, Ćurčić et al. (2003 and Ilić (2005. In this review forty-nine species reviewed from 34 genera which belong to five subfamilies: Prioninae, Lepturinae, Spondylidinae, Cerambycinae and Lamiinae. Examined material has been collected in the Southeastern Serbia. The most numerous were the subfamily Cerambycinae, comprising 18 species from 15 genera.

    6. KÜRE DÜZLEMİNDEKİ OPERATÖR RIESZ POTENSİYEL iNTEGRALINI HESAPLAMADA (p, q)'UN SINIRLlLlGI

      OpenAIRE

      Karakaş, Mehmet

      2002-01-01

      Kiire düzlemindeki Riesz potansiyel integralının lnsıni hesaplama işlemlerine ilişkin bir çol{ araştırınalar ortaya llt;oyulmuş ancak, hesaplama işlemlerind e oper atör (değişim) durumu Jlek ele alı nmamıştır . Bu araştırmada, operatör Rie�'Z potansiyel i ntegralnun lusmi hesapı ama işlemlerinin yöntem ve araştırmaya ilişl un özell iider ortaya }{oyulmuştur.

    7. KÜRE DÜZLEMİNDEKİ OPERATÖR RIESZ POTENSİYEL iNTEGRALINI HESAPLAMADA (p, q'UN SINIRLlLlGI

      Directory of Open Access Journals (Sweden)

      Mehmet Karakaş

      2002-09-01

      Full Text Available Kiire düzlemindeki Riesz potansiyel integralının lnsıni hesaplama işlemlerine ilişkin bir çol{ araştırınalar ortaya llt;oyulmuş ancak, hesaplama işlemlerind e oper atör (değişim durumu Jlek ele alı nmamıştır . Bu araştırmada, operatör Rie�'Z potansiyel i ntegralnun lusmi hesapı ama işlemlerinin yöntem ve araştırmaya ilişl un özell iider ortaya }{oyulmuştur.

    8. 23 Ekim 2011 Tabanlı-Van Depreminin Sismik Jeomorfolojisi ve Doğu Anadolu’daki Aktif Tektonik Yapılarla Olan İlişkisi

      OpenAIRE

      Özkaymak, Çağlar; Sözbilir, Hasan; Bozkurt, Erdin; Dirik, Kadir; Topal, Tamer; Alan, Hüseyin; Çağlan, Dündar

      2011-01-01

      Bu çalışma, 23 Ekim 2011 tarihindemeydana gelen Tabanlı-Van (M = 7.2) depreminin bölgenin aktif tektoniğiiçerisindeki konumunu açıklamayı amaçlamaktadır. Bu bağlamda Tabanlı-Van depremindensonra arazi çalışmaları yapılmış, depremle ilişkili deformasyon yapılarıincelenmiş ve arazi gözlemlerinden elde edilen veriler ile Van ili veçevresiyle ilgili olarak daha önce yapılmış aktif tektonik çalışmalarıkarşılaştırılarak değerlendirmeye gidilmiştir. Depremsırasında veya hemen sonrasında yeryüzünde/y...

    9. Posttraumatski stresni poremećaj

      OpenAIRE

      Glavaš, Vlatko

      2017-01-01

      Ritam života današnjeg čovjeka ubrzan je i mnogi ne obraćaju pažnju na vlastito psihološko stanje. Posljedica toga je nakupljanje traumatskih ili stresnih događaja u ljudima. Stres ili trauma tumači se kao događaj izvan uobičajenog ljudskog iskustva. Jedan oblik bolesti koji se u vezi s time javlja je posttraumatski stresni poremećaj (PTSP). PTSP zahvaća oboljelu osobu u cjelini djelujući na sve aspekte razvoja osobe, odnosno biološke, psihološke i socijalne aspekte. Na biološkom p...

    10. Facebook’ta Bulunma Amacı ve Facebook Reklamlarına Duyulan İlgi Arasındaki İlişki

      OpenAIRE

      Ay, Arş. Grv. Ufuk

      2014-01-01

      Bu araştırmada Facebook’ta bulunma amaçları ile Facebook reklamlarına duyulan ilgi arasında bir ilişki olup olmadığı ölçülmüştür. Bu amaçla internet üzerinden 283 kişiye anket uygulanmıştır. Araştırmanın bulguları Facebook’ta bulunma amaçları olarak tanımlanan “sosyal arama” ve “sosyal tarama” değişkenleriyle Facebook reklamlarına duyulan ilgi arasında anlamlı ilişkiler olduğunu destekler niteliktedir.

    11. Racionalno upravljanje z odpadno embalažo v hotelu Veter d.o.o.

      OpenAIRE

      Smolinger, Rok

      2017-01-01

      Potrošništvo, marketing, zadovoljevanje vedno večjih potreb strank in ostale podobne prvine potrošništva, posredno vplivajo na vedno večjo nastalo količino odpadne embalaže. Še večje količine odpadne embalaže pa nastanejo v industriji. Za namen našega diplomskega dela se osredotočimo na povprečen hotel. V diplomskem delu bomo preučili obstoječe stanje na področju odpadne embalaže v hotelu Veter d.o.o. Osredotočili se bomo predvsem na potek nastanka od embalaže do odpadne embalaže ter na ravn...

    12. Oglašavanje poduzeća putem mobilnih uređenja

      OpenAIRE

      Cvitković, Verica

      2018-01-01

      Marketing je sveprisutan društveni i upravljački proces pomoću kojeg pojedinci ili skupine putem određenih faktora dobivaju ono što im je potrebno ili ono što žele. Sastoji od različitih metoda koje su se s vremenom mijenjale i napredovale, tradicionalne metode poput marketinga putem novina su potisnute te se u novije vrijeme marketing sve više okreće internetu. Svrha marketinga je da usmjeri gospodarski tijek dobara i usluga od proizvođača prema potrošaču, na način da učinkovito prilagodi po...

    13. OGLAŠAVANJE PODUZEĆA PUTEM MOBILNIH UREĐAJA

      OpenAIRE

      Cvitković, Verica

      2017-01-01

      Marketing je sveprisutan društveni i upravljački proces pomoću kojeg pojedinci ili skupine putem određenih faktora dobivaju ono što im je potrebno ili ono što žele. Sastoji od različitih metoda koje su se s vremenom mijenjale i napredovale, tradicionalne metode poput marketinga putem novina su potisnute te se u novije vrijeme marketing sve više okreće internetu. Svrha marketinga je da usmjeri gospodarski tijek dobara i usluga od proizvođača prema potrošaču, na način da učinkovito prilagodi po...

    14. Anomaly detection using magnetic flux leakage technology

      Energy Technology Data Exchange (ETDEWEB)

      Rempel, Raymond G. [BJ Pipeline Inspection Services, Alberta (Canada)

      2005-07-01

      There are many aspects to properly assessing the integrity of a pipeline. In-line-Inspection (ILI) tools, in particular those that employ the advanced use of Magnetic Flux Leakage (MFL) technology, provide a valuable means of achieving required up-to-date knowledge of a pipeline. More prevalent use of High Resolution MFL In-Line-Inspection tools is growing the knowledge base that leads to more reliable and accurate identification of anomalies in a pipeline, thus, minimizing the need for expensive verification excavations. Accurate assessment of pipeline anomalies can improve the decision making process within an Integrity Management Program and excavation programs can then focus on required repairs instead of calibration or exploratory digs. Utilizing the information from an MFL ILI inspection is not only cost effective but, as well, can also prove to be an extremely valuable building block of a Pipeline Integrity Management Program. (author)

    15. Franšizno poslovanje u Hrvatskoj

      OpenAIRE

      Košić, Karolina

      2017-01-01

      Većina poduzetnika kreće sa svojim poslovanjem od nule s predmetom kojeg će predstavljati na tržištu. Svoje poslovanje razvija postepeno, a kroz razvoj svog poslovanja susreće se s problemima i velikim troškovima, izlaže se riziku od neuspjeha na tržištu ili barem nesigurnosti u samom početku što može doći i do samog zatvaranja poduzeća. Ovaj način je težak jer se ulažu velika financijska sredstva za marketing, oglašavanje odnosno dokazivanje svojeg proizvoda ili usluge na tržištu. S druge st...

    16. UPORABA PISARNE V OBLAKU ZA POTREBE DRUŽINSKEGA IN MLADINSKEGA CENTRA

      OpenAIRE

      Repnik, Tina

      2013-01-01

      V diplomski nalogi smo v prvem delu teoretično obravnavali teledelo in računalništvo v oblaku. Preučili smo poznane rešitve računalništva v oblaku na trgu in se odločili za uporabo storitev enega izmed vodilnih podjetij s tega področja Google. Opredelili smo začetke in razvoj Googlea v svetu. Za potrebe Družinskega in mladinskega centra v Cerkljah smo z uporabo storitve Google Drive in Google Koledar ustvarili pisarno v oblaku. Za vse, ki niso vešči uporabe naštetih storitev, smo pripravi...

    17. Türkiye’de Sosyal Demokratların Avrupa Birliği’ne Yaklaşımları

      OpenAIRE

      ERDEM, Seçil

      2008-01-01

      Türkiye ve Avrupa Birliği arasındaki ilişkiler ve bu süreci ilgilendiren güncel gelişmeler Türkiye’deki ekonomik, siyasal ve toplumsal dinamikler üzerinde doğrudan ve dolaylı etkileri olan önemli konulardır. Bu bağlamda Avrupa Birliği, Türkiye’deki politik tartışmaların da önemli bir konusu haline gelmiştir. Bu çalışma, Türk Sosyal Demokrasi Hareketi çerçevesi içindeki çeşitli politik unsurların Türkiye-Avrupa Birliği ilişkilerinin belirlenmesi sürecindeki rolleri ve yaklaşımlarını analiz etm...

    18. TURİST REHBERLERİNİN MOTİVASYONU İLE PERFORMANSI ARASINDAKİ İLİŞKİNİN BELİRLENMESİ

      OpenAIRE

      KÖROĞLU, ÖZLEM; AVCIKURT, CEVDET

      2015-01-01

      Turist rehberlerinin performans düzeylerinin ölçülmesi, rehberlerin motivasyonu ile performansı arasında herhangi bir ilişkinin bulunup bulunmadığının tespit edilmesi ve turist rehberlerinin demografik değişkenleri ile motivasyonu ve performansı arasındaki ilişkilerin belirlenmesi bu çalışmanın amacını oluşturmaktadır. Elde edilen kuramsal bilgilere dayanarak araştırma hipotezi belirlenmiş ve araştırma modeli geliştirilmiştir. Verilerin elde edilmesi için anket tekniği kullanılarak turist reh...

    19. “PESTEL Analizi” ile Türkiye-Almanya Ekonomik İlişkilerinin İncelenmesi

      OpenAIRE

      AKÇA, Hasan; ŞAHİN, Levent; KAYA, Zekayi

      2016-01-01

      Bu çalışmanın amacı; Türkiye ve Almanya arasındaki ekonomik ilişkileri PESTEL Analizi ile irdelemektir. Çalışmada ikincil veriler (1924-2015) kullanılmıştır. PESTEL Analizinden elde edilen bazı sonuçlar şu şekilde özetlenebilir. Almanya bir taraftan gelecekte enerji darboğazı çekmemek için enerji koridorunda bulunan Türkiye ile ilişkileri olumlu yönde tutmaya çalışırken; diğer yandan Türkiye’nin AB’ye üyeliğine mesafeli durmaktadır. 1954-2015/Ağustos döneminde Türkiye’ye yatırım yapan toplam ...

    20. „Ritualno” i „struktuirano” odbacivanje u arheološkim interpretacijama: primer sistema za vodosnabdevanje na lokalitetu „Kale” u Krševici

      Directory of Open Access Journals (Sweden)

      Ivan Vranić

      2016-11-01

      Full Text Available Pitanja vezana za rituale, kultove, religiju ili magiju predstavljaju važne ali u značajnoj meri zanemarene i teorijski nedovoljno precizno utemeljene teme u savremenim arheološkim interpretacijama. Cilj rada jeste da na konkretnim primerima potencijalno ritualnih aktivnosti vezanih za izgradnju i moguće „ritualno ubijanje” sistema za vodosnabdevanje na lokalitetu „Kale” u Krševici pokaže kako ovo zanemarivanje nije samo posledica aktuelnosti i trendova o odabiru istraživačkih tema, već se radi o ozbiljnijem problemu koji pokazuje određene nedostatke savremenih pristupa vezanih za arheologiju identiteta i koncepte struktuiranog ili simboličkog odbacivanja.

    1. Tip 2 Diabetes Mellituslu Hastalarda Mikroalbuminüri, İnsülin Direnci ve Kardiyovasküler Risk

      OpenAIRE

      ERSOY, Canan; TAŞLI, Babürşah; YILDIZ, Abdülmecit; İMAMOĞLU, Şazi

      2006-01-01

      Son çalışmalar tip 2 diyabette mikroalbuminüri (MAU) varlığı ile hedef organ hasarları ve kardiyovasküler hastalık riski arasındaki ilişkilere yönelmişlerdir. Bu çalışmada, Tip 2 diabetes mellituslu (DM) hastalarda MAU ile glisemik kontrol, insülin direnci (İR) ve diğer kardiyovasküler risk faktörleri arasındaki ilişki değerlendirilmiştir. İnsülin gereksinimi olmayan, normal renal fonksiyonlu 29 mikroalbuminürik ve 68 normoalbuminürik tip 2 DM'lu hasta çalışmaya dahil edildi. Tüm hast...

    2. Characteristics of patients with influenza-like illness, severe acture respiratory illness, and laboratory-confirmed influenza at a major children's hospital in Angola, 2009-2011.

      Science.gov (United States)

      Cardoso, Yolanda; Oliveira, Erika; Vasconcelos, Jocelyne; Cohen, Adam L; Francisco, Moises

      2012-12-15

      There are no published data on influenza trends in Angola, where pneumonia is a leading cause of death among young children. This study aims to describe the seasonal trends, types, and subtypes of influenza virus recovered from patients with respiratory illness who were admitted to the major children's hospital in Angola from May 2009 through April 2011. Nasal and oral swabs were collected from patients seen in the outpatient clinic with influenza-like illness (ILI) or hospitalized with severe acute respiratory illness (SARI) and tested for influenza virus by polymerase chain reaction assays. Of 691 samples collected, 334 (48%) were from case patients with ILI, and 357 (52%) were from case patients with SARI. Most (86%) of these children were Angola.

    3. Working group 8: inspection tools

      Energy Technology Data Exchange (ETDEWEB)

      Billey, Deb; Kania, Richard; Nickle, Randy; Wang, Rick; Westwood, Stephen

      2011-07-01

      This eighth working group of the Banff 2011 conference discussed the inspection tools and techniques used by the upstream and downstream pipeline industry to evaluate pipeline integrity. Special attention was given to the challenges and successes related to in-line inspection (ILI) technology. The background of current dent assessment criteria in B31.8 was presented, including dent definition for ILI vendors and pipeline operators as well as codes (CSA Z662 and B31.8). The workshop described examples of dents and assessments showing inconsistency with current criteria as set out by TCPL and Marathon. This workshop produced a single, industry-wide definition of the dent. It was found that the strain based criteria were more practical because depth based is conservative and may miss shallow occurrences. The creation of joint industry group was proposed to develop strain based criteria for incorporation into CSAZ662 and B31.8.

    4. Sudar vozila u vlasništvu istog leasing društva i problem treće osobe iz AO osiguranja

      OpenAIRE

      Radionov, Nikoleta; Padovan, Adriana Vincenca

      2012-01-01

      U radu se razmatraju pravni odnosi koji nastaju u slučaju sudara dvaju (ili više) vozila u vlasništvu istog leasing društva (slučaj leasing – leasing). Prema uvriježenoj praksi na domaćem tržištu osiguranja, u takvim slučajevima dolazi do isključenja iz osiguranja šteta na vozilu temeljem osiguranja automobilske odgovornosti (AO), s obzirom na to da su vozila u vlasništvu istog leasing društva koje je i jedini osiguranik po policama AO oba (ili više) vozila sudionika nezgode. Primatelj leasin...

    5. MARKETING INFORMACIJA

      OpenAIRE

      Mecanović, Ivan

      1991-01-01

      Informacija se sve više pojavljuje kao roba na tržištu. Bez obzira ima li ona status medijske vijesti, ili informacije, koja se dobiva iz informatičkog sistema, informacija se proizvodi; sortira, čuva i lansira, te na taj način postaje proizvod, koji ima svoju cijenu koštanja, kao i svoju prodajnu cijenu, svoje potrošače i svoje tržište. Zbog toga je potrebno stvarati i marketing informacija. No, informacija je specifična roba osobne potrošnje. Korištenjem, ili spoznajnošču informacije od poj...

    6. Effects of seasonal and pandemic influenza on health-related quality of life, work and school absence in England: Results from the Flu Watch cohort study.

      Science.gov (United States)

      Fragaszy, Ellen B; Warren-Gash, Charlotte; White, Peter J; Zambon, Maria; Edmunds, William J; Nguyen-Van-Tam, Jonathan S; Hayward, Andrew C

      2018-01-01

      Estimates of health-related quality of life (HRQoL) and work/school absences for influenza are typically based on medically attended cases or those meeting influenza-like-illness (ILI) case definitions and thus biased towards severe disease. Although community influenza cases are more common, estimates of their effects on HRQoL and absences are limited. To measure quality-adjusted life days and years (QALDs and QALYs) lost and work/school absences among community cases of acute respiratory infections (ARI), ILI and influenza A and B and to estimate community burden of QALY loss and absences from influenza. Flu Watch was a community cohort in England from 2006 to 2011. Participants were followed up weekly. During respiratory illness, they prospectively recorded daily symptoms, work/school absences and EQ-5D-3L data and submitted nasal swabs for RT-PCR influenza testing. Average QALD lost was 0.26, 0.93, 1.61 and 1.84 for ARI, ILI, H1N1pdm09 and influenza B cases, respectively. 40% of influenza A cases and 24% of influenza B cases took time off work/school with an average duration of 3.6 and 2.4 days, respectively. In England, community influenza cases lost 24 300 QALYs in 2010/11 and had an estimated 2.9 million absences per season based on data from 2006/07 to 2009/10. Our QALDs and QALYs lost and work and school absence estimates are lower than previous estimates because we focus on community cases, most of which are mild, may not meet ILI definitions and do not result in healthcare consultations. Nevertheless, they contribute a substantial loss of HRQoL on a population level. © 2017 The Authors. Influenza and Other Respiratory Viruses. Published by John Wiley & Sons Ltd.

    7. Guess Who’s Not Coming to Dinner? Evaluating Online Restaurant Reservations for Disease Surveillance

      OpenAIRE

      Nsoesie, Elaine O; Buckeridge, David L; Brownstein, John S

      2014-01-01

      Background Alternative data sources are used increasingly to augment traditional public health surveillance systems. Examples include over-the-counter medication sales and school absenteeism. Objective We sought to determine if an increase in restaurant table availabilities was associated with an increase in disease incidence, specifically influenza-like illness (ILI). Methods Restaurant table availability was monitored using OpenTable, an online restaurant table reservation site. A daily sea...

    8. Telephone Support During Overseas Deployment for Military Spouses

      Science.gov (United States)

      2017-12-01

      Communication Skills: How to Be Effective Put it into Practice Active Listening Checklist Hunt the Good Stuff Worksheet Online Communication...important (Green, Nurius, & Lester, 2013). One such program is the Army’s Comprehensive Soldier and Fam- ily Fitness Program, a curriculum that...U.S. Army Medical Research and Materiel Command. References Barak, A., Hen, L., Boniel-Nissim, M., & Shapira, N. (2008). A comprehensive review and a

    9. Optics Research

      Science.gov (United States)

      1977-12-31

      still ~30% below the optimum correction. This difference results primar- ily not from any deficiency of the mirror but from the fact that only third...TAW) 2 -2 k2 tk2 -(TAw) 2)2.4(TA„) 2J1’𔃼 [4k 2(TAw) 2H-(l-(TAw) 2)2J ’/2 Ratio of /C \\ light velocity to ^V> pulie

    10. EVALUATION OF RIGHT ILIAC FOSSA MASS-A RETROSPECTIVE STUDY

      OpenAIRE

      Raja Billy Graham; Vijayabhasker

      2016-01-01

      Mass in right iliac fossa is one of the common clinical surgical entity with varied etiologies, involving intra peritoneal organs like vermiform appendix, caucus, ileum, retroperitoneal structures like kidneys, blood vessels etc., and abdominal wall masses like desmoids tumor. To know the etiology and the various pattern of presentation of right iliac fossa mass in our institution a retrospective study was designed including all adult patients diagnosed to have a mass in right ili...

    11. AMC-SWMO Countermeasures Study. Volume 1. Guide to How Countermeasures Affect Smart Weapons

      Science.gov (United States)

      1992-01-01

      orco~~ictrI~ N1@OAC, VISILE WI~tMWI LWI MQ 1~~~ ~~ O( . it MM 1111, 0IIET1111( l I t Is ~ r.ll D~hOULAIT, I(V~tUA0 P~Ili~l2O0 0~ IMAil TlLLSCO~~~l~~., W 0

    12. 100. obljetnica albanske zajedničke grafije

      OpenAIRE

      Kumnova, Mazllom; Shabani, Fahredin

      2010-01-01

      Albanci su prije studenoga 1908. imali jedan zajednički jezik, albanski, a različite grafije (abecede, slovopise, alfabete) latinske osnove: slavenske, grčke, arapske ili kombinirane grafije. Jedinstvena grafija (slovopis, abeceda) albanskoga jezika usvojena je prije stotinjak godina u Manastiru na kongresu na kojem je sudjelovala elita albanskih intelektualaca i ostalih djelatnika koji su se zalagali za neovisnost Albanije. Kongres nije zabilježio samo rješenja problema grafije albanskoga je...

    13. Congenital Primary Pachydermoperiostosis and Striate Palmoplantar Keratoderma - a Case Report

      OpenAIRE

      Stojanović Slobodan; Vučković Nada; Jovanović Marina; Petrović Kosta

      2014-01-01

      Uvod. Pahidermoperiostoza (PDP) predstavlja heterogeni sindrom za koji su karakteristične hipertrofi čne promene prvenstveno kože i kostiju ekstremiteta: pahidermija, klabing (clubbing) prstiju šaka i stopala i hipertrofi čna osteoartropatija. Primarna pahidermoperiostoza − sinonim Turen−Solent−Goleov sindrom (Touraine-Solente-Golé) (PPDP), ili primarna hipertrofi čna osteoartropatija (PHO), redak je nasledni poremećaj i predstavlja jedan od dva tipa hipertrofi čne osteoartropatije....

    14. H.S.H. Prince Radu of Hohenzollern-Veringen, Special Representative of the Romanian Government for Integration, Co-operation and Sustainable Development

      CERN Multimedia

      Maximilien Brice

      2002-01-01

      H.S.H. Prince Radu of Hohenzollern-Veringen, Special Representative of the Romanian Government for Integration, Co-operation and Sustainable Development (third from left) with (left to right) Florian Ciolacu (Romanian Mission in Geneva), Cornel Comsa (personal adviser to the Prince), Sorin Ilie (CERN), Calin Alexa (ATLAS), Iosif Legrand (Caltech/CMS), Mihaela Gheata (ALICE), Andrei Gheata (ALICE), and Sorin Zgura (ALICE).

    15. Derivation of inner magnetospheric electric field (UNH-IMEF model using Cluster data set

      Directory of Open Access Journals (Sweden)

      H. Matsui

      2008-09-01

      Full Text Available We derive an inner magnetospheric electric field (UNH-IMEF model at <I>L>=2–10 using primarily Cluster electric field data for more than 5 years between February 2001 and October 2006. This electric field data set is divided into several ranges of the interplanetary electric field (IEF values measured by ACE. As ring current simulations which require electric field as an input parameter are often performed at <I>L>=2–6.6, we have included statistical results from ground radars and low altitude satellites inside the perigee of Cluster in our data set (<I>L>~4. Electric potential patterns are derived from the average electric fields by solving an inverse problem. The electric potential pattern for small IEF values is probably affected by the ionospheric dynamo. The magnitudes of the electric field increase around the evening local time as IEF increases, presumably due to the sub-auroral polarization stream (SAPS. Another region with enhanced electric fields during large IEF periods is located around 9 MLT at <I>L>>8, which is possibly related to solar wind-magnetosphere coupling. Our potential patterns are consistent with those derived from self-consistent simulations. As the potential patterns can be interpolated/extrapolated to any discrete IEF value within measured ranges, we thus derive an empirical electric potential model. The performance of the model is evaluated by comparing the electric field derived from the model with original one measured by Cluster and mapped to the equator. The model is open to the public through our website.

    16. Case of seasonal reassortant a(H1N2) influenza virus infection, the Netherlands, March 2018

      NARCIS (Netherlands)

      Meijer, A. (Adam); C. Swaan (Corien); Voerknecht, M. (Martin); E. Jusic (Edin); van den Brink, S. (Sharon); Wijsman, L.A. (Lisa A.); A.C.G. Voordouw (Bettie); G.A. Donker (Gé); Sleven, J. (Jacqueline); Dorigo-Zetsma, W.W. (Wendelien W.); S. Svraka-Latifovic (Sanela); M. van Boven (Michiel); Haverkate, M.R. (Manon R.); A. Timen (Aura); J.T. van Dissel (Jaap); M.P.G. Koopmans D.V.M. (Marion); T.M. Bestebroer (Theo); R.A.M. Fouchier (Ron)

      2018-01-01

      textabstractA seasonal reassortant A(H1N2) influenza virus harbouring genome segments from seasonal influenza viruses A(H1N1)pdm09 (HA and NS) and A(H3N2) (PB2, PB1, PA, NP, NA and M) was identified in March 2018 in a 19-months-old patient with influenza-like illness (ILI) who presented to a general

    17. Case of seasonal reassortant A(H1N2) influenza virus infection, the Netherlands, March 2018.

      NARCIS (Netherlands)

      Meijer, A.; Swaan, C.M.; Voerknecht, M.; Jusic, E.; Brink, S. van den; Wijsman, L.A.; Voordouw, B.C.G.; Donker, G.A.; Sleven, J.; Dorigo-Zetsma, W.W.; Svraka, S.; Boven, M. van; Haverkate, M.R.; Timen, A.; Dissel, J.T. van; Koopmans, M.P.G.; Besteboer, T.M.; Fouchier, R.A.M.

      2018-01-01

      A seasonal reassortant A(H1N2) influenza virus harbouring genome segments from seasonal influenza viruses A(H1N1)pdm09 (HA and NS) and A(H3N2) (PB2, PB1, PA, NP, NA and M) was identified in March 2018 in a 19-months-old patient with influenza-like illness (ILI) who presented to a general

    18. Case of seasonal reassortant A(H1N2) influenza virus infection, the Netherlands, March 2018.

      NARCIS (Netherlands)

      Meijer, Adam; Swaan, Corien M; Voerknecht, Martin; Jusic, Edin; van den Brink, Sharon; Wijsman, Lisa A; Voordouw, Bettie Cg; Donker, Gé A; Sleven, Jacqueline; Dorigo-Zetsma, Wendelien W; Svraka, Sanela; van Boven, Michiel; Haverkate, Manon R; Timen, Aura; van Dissel, Jaap T; Koopmans, Marion Pg; Bestebroer, Theo M; Fouchier, Ron Am

      A seasonal reassortant A(H1N2) influenza virus harbouring genome segments from seasonal influenza viruses A(H1N1)pdm09 (HA and NS) and A(H3N2) (PB2, PB1, PA, NP, NA and M) was identified in March 2018 in a 19-months-old patient with influenza-like illness (ILI) who presented to a general

    19. Special Inspector General for Iraq Reconstruction, Report to Congress, October 30, 2006

      Science.gov (United States)

      2006-10-30

      challenges have limited the teaching , coaching, and mentoring that form the core of the PRT capacity-development mission. PRT members are at particular...es p o n si b ili ti es . A s n ec es sa ry , th e M O A s h o u ld b e u p d at ed s o t h at it ac cu ra te ly r efl ec ts t h e b u

    20. Special Inspector General for Iraq Reconstruction (SIGIR): The Year of Transition Enters the Fourth Quarter

      Science.gov (United States)

      2006-10-30

      have limited the teaching , coaching, and mentoring that form the core of the PRT capacity-development mission. PRT members are at particular risk when...si b ili ti es . A s n ec es sa ry , th e M O A s h o u ld b e u p d at ed s o t h at it ac cu ra te ly r efl ec ts t h e b u si n es

    1. THE EXPERIMENTAL STUDY ABOUT THE USAGE OF SILICA FUME IN MORTAR PLASTER PRODUCTION

      Directory of Open Access Journals (Sweden)

      M. HALUK ÇELİK

      2005-06-01

      Full Text Available Bu çalışmada silis dumanının sıva harcıyla olan ilişkisi araştırılmıştır. bu amaçla silis dumanı %0, %5, %10 ve %15 oranlarında çimentonun ağırlıkça yerine kullanılmıştır.

    2. Transversus Abdominis Plane Versus Ilioinguinal and Iliohypogastric Nerve Blocks for Analgesia Following Open Inguinal Herniorrhaphy

      Directory of Open Access Journals (Sweden)

      Anatoli Stav

      2016-07-01

      Full Text Available Objectives We hypothesized that preoperative (pre-op ultrasound (US-guided posterior transversus abdominis plane block (TAP and US-guided ilioinguinal and iliohypogastric nerve block (ILI+IHG will produce a comparable analgesia after Lichtenstein patch tension-free method of open inguinal hernia repair in adult men. The genital branch of the genitofemoral nerve will be blocked separately. Methods This is a prospective, randomized, controlled, and observer-blinded clinical study. A total of 166 adult men were randomly assigned to one of three groups: a pre-op TAP group, a pre-op ILI+IHG group, and a control group. An intraoperative block of the genital branch of the genitofemoral nerve was performed in all patients in all three groups, followed by postoperative patient-controlled intravenous analgesia with morphine. The pain intensity and morphine consumption immediately after surgery and during the 24 hours after surgery were compared between the groups. Results A total of 149 patients completed the study protocol. The intensity of pain immediately after surgery and morphine consumption were similar in the two “block” groups; however, they were significantly decreased compared with the control group. During the 24 hours after surgery, morphine consumption in the ILI+IHG group decreased compared with the TAP group, as well as in each “block” group versus the control group. Twenty-four hours after surgery, all evaluated parameters were similar. Conclusion Ultrasound-guided ILI+IHG provided better pain control than US-guided posterior TAP following the Lichtenstein patch tension-free method of open inguinal hernia repair in men during 24 hours after surgery. (ClinicalTrials.gov number: NCT01429480.

    3. Analysis of the United States Navy Foreign Area Officer Program

      Science.gov (United States)

      2013-03-01

      t!U ~· 1 1\\e Stcntlritl cf tbt Y.ili!Jn’ D!p~r~~mem -:tlap c~u]ad P 10 mmpszrt p:apns to mMt tbt DMdJ a! lhC ~ md tbt 011alr 0~ ~mpocvmts md 4.1.1... tbt ~ cc:mrit• OlllpCAi m which th.ty speci&lia 1\\1 .’\

    4. Facemasks, hand hygiene, and influenza among young adults: a randomized intervention trial.

      Directory of Open Access Journals (Sweden)

      Allison E Aiello

      Full Text Available Limited vaccine availability and the potential for resistance to antiviral medications have led to calls for establishing the efficacy of non-pharmaceutical measures for mitigating pandemic influenza. Our objective was to examine if the use of face masks and hand hygiene reduced rates of influenza-like illness (ILI and laboratory-confirmed influenza in the natural setting. A cluster-randomized intervention trial was designed involving 1,178 young adults living in 37 residence houses in 5 university residence halls during the 2007-2008 influenza season. Participants were assigned to face mask and hand hygiene, face mask only, or control group during the study. Discrete-time survival models using generalized estimating equations to estimate intervention effects on ILI and confirmed influenza A/B infection over a 6-week study period were examined. A significant reduction in the rate of ILI was observed in weeks 3 through 6 of the study, with a maximum reduction of 75% during the final study week (rate ratio [RR] = 0.25, [95% CI, 0.07 to 0.87]. Both intervention groups compared to the control showed cumulative reductions in rates of influenza over the study period, although results did not reach statistical significance. Generalizability limited to similar settings and age groups. Face masks and hand hygiene combined may reduce the rate of ILI and confirmed influenza in community settings. These non-pharmaceutical measures should be recommended in crowded settings at the start of an influenza pandemic.[corrected] Clinicaltrials.gov NCT00490633.

    5. Čizmar

      OpenAIRE

      Rajčić, Vlatka; Čizmar, Dean

      2008-01-01

      U proteklih nekoliko godina, stvaraju se novi materijali na osnovi drva i polimera – drvoplastika (Wood Plastic Composites - WPC). Drvoplastika se definira kao kompozitni materijal koji sadrži drvo (u bilo kojem obliku) i termoplastične polimere ili termostabilne polimere. U radu se prikazuje povijesni pregled uporabe drvoplastike, struktura i način proizvodnje, tipični elementi od kompozitnih materijala, fizikalna i mehanička svojstva, te prednosti i mane ovog materijala.

    6. Investigation of Methods to Produce Sodium Perchlorate without the Use of Platinum. Part 1 - Literature Review; Part 2 - Laboratory Work

      Science.gov (United States)

      1951-08-31

      8217 radioactive sod~iwn salt. _orrcrystallizations from a~ reduced the amount of sodium to a very ow vaius; ten extraction$ of th& evaorated salt with...German Fot./1919,,, ICIO., Polutions 27cC. Villiams/1920 Ma~OM, 600 to 700 R.!1. Ft. Fe 1n’-tin’ily ý1out 101C. (146) (Oev~lewltg *(Frrpdue1 ly risee to

    7. Facemasks, Hand Hygiene, and Influenza among Young Adults: A Randomized Intervention Trial

      Science.gov (United States)

      Aiello, Allison E.; Perez, Vanessa; Coulborn, Rebecca M.; Davis, Brian M.; Uddin, Monica; Monto, Arnold S.

      2012-01-01

      Limited vaccine availability and the potential for resistance to antiviral medications have led to calls for establishing the efficacy of non-pharmaceutical measures for mitigating pandemic influenza. Our objective was to examine if the use of face masks and hand hygiene reduced rates of influenza-like illness (ILI) and laboratory-confirmed influenza in the natural setting. A cluster-randomized intervention trial was designed involving 1,178 young adults living in 37 residence houses in 5 university residence halls during the 2007–2008 influenza season. Participants were assigned to face mask and hand hygiene, face mask only, or control group during the study. Discrete-time survival models using generalized estimating equations to estimate intervention effects on ILI and confirmed influenza A/B infection over a 6-week study period were examined. A significant reduction in the rate of ILI was observed in weeks 3 through 6 of the study, with a maximum reduction of 75% during the final study week (rate ratio [RR] = 0.25, [95% CI, 0.07 to 0.87]). Both intervention groups compared to the control showed cumulative reductions in rates of influenza over the study period, although results did not reach statistical significance. Generalizability limited to similar settings and age groups. Face masks and hand hygiene combined may reduce the rate of ILI and confirmed influenza in community settings. These non-pharmaceutical measures should be recommended in crowded settings at the start of an influenza pandemic. Trail Registration Clinicaltrials.gov NCT00490633 PMID:22295066

    8. Knowledge, Skills, and Abilities for Military Leader Influence

      Science.gov (United States)

      2011-03-01

      tactics. The attributes vary in breadth, encompassing broad traits, such as those represented in the five-factor model of personality ( FFM ; e.g...attributes related to the application of influence strategies, together with their definitions, are shown in Table 10. The FFM includes extroversion...leadership. For example, Judge, Bono, Ilies, and Gerhardt (2002) conducted a meta-analysis investigating the relationship between FFM personality traits

    9. Meet the Parents? The Causal Effect of Family Size on the Geographic Distance between Adult Children and Older Parents

      OpenAIRE

      Holmlund, Helena; Rainer, Helmut; Siedler, Thomas

      2009-01-01

      An emerging question in demographic economics is whether there is a link between family size and the geographic distance between adult children and elderly parents. Given current population trends, understanding how different configurations of fam- ily size and sibship influence patterns of child-parent proximity is vitally important, as it impacts on issues such as intergenerational care and everyday mobility. It may be the case, for example, that larger families enable the responsibility of...

    10. Automated Library System Specifications.

      Science.gov (United States)

      1986-06-01

      Battelle Software Products), TOMAS (Carlyle Systems, Inc), ULYSIS/84 (Universal Library Systems), Unicorn Collection Management System (Sirsi Corp...STOR{ AGE CAPA3ILITY Dependent on mixc of processors an~d dikdrives. ’KxIUI OFREORS Depends upon mix of application. programs, and includes...BASIC -- - -Ultiniate, Prime, DEC VAXv PZRIHERIALS SUPPORTED Wyse, Viewpoints, Inter.ec lig;htpens, HP Ili~htpens, C-Itoh STO AGE CAPABILITY 66 MB to

    11. Organic/Inorganic Hybrid Perovskite FETs for Electrically Injected Laser Action

      Science.gov (United States)

      2015-09-01

      UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) 8. PERFORMING ORGANIZATION Wake Forest University REPORT NUMBER Department of Physics...Action PI, Oana D. Jurchescu, Wake Forest University In collaboration with Z. Valy Vardeny ( University of Utah) -supported under N00014-15-1-2524 ONR...between mob ili ty and y can be clearly observed. The mobility increases over fi ve orders of magnitude as a result of decreasing y by about 20 times

    12. Combining Surveillance Systems: Effective Merging of U.S. Veteran and Military Health Data

      Science.gov (United States)

      2016-08-04

      Department of Defense, Silver Spring, Maryland, United States of America, 2 Applied Physics Laboratory, Johns Hopkins University, Laurel, Maryland...was used to examine seasonal influenza trends, a gastrointestinal (GI) illness epidemic and a heat-related event. This provided the first example of the... geriatric clinics, women’s primary care, infectious diseases and emergency medicine. We grouped visits into an influenza-like-illness (ILI) syndrome

    13. Internal Medicine in World War 2. Volume 1. Activities of Medical Consultants

      Science.gov (United States)

      1961-01-01

      hiit ,v at t he 7t hi ienieral I los-pital to coniduct st (Idies tIer 1ili4he!. 1hle supervision of Lt. C oh. (Liter (Col.) Lan11-irete B. EHlis. MC...i’apelu ~s slowly lntd led t heimi to ittrttibu te lpiolperit es to thle drug t hiit it dloes riot posse’ss. Sutpplies of’ quinlimti were sniiiI in thle

    14. Nowcasting influenza outbreaks using open-source media report.

      Energy Technology Data Exchange (ETDEWEB)

      Ray, Jaideep; Brownstein, John S. [Boston Children%3CU%2B2019%3Es Hospital, Boston, MA

      2013-02-01

      We construct and verify a statistical method to nowcast influenza activity from a time-series of the frequency of reports concerning influenza related topics. Such reports are published electronically by both public health organizations as well as newspapers/media sources, and thus can be harvested easily via web crawlers. Since media reports are timely, whereas reports from public health organization are delayed by at least two weeks, using timely, open-source data to compensate for the lag in %E2%80%9Cofficial%E2%80%9D reports can be useful. We use morbidity data from networks of sentinel physicians (both the Center of Disease Control's ILINet and France's Sentinelles network) as the gold standard of influenza-like illness (ILI) activity. The time-series of media reports is obtained from HealthMap (http://healthmap.org). We find that the time-series of media reports shows some correlation ( 0.5) with ILI activity; further, this can be leveraged into an autoregressive moving average model with exogenous inputs (ARMAX model) to nowcast ILI activity. We find that the ARMAX models have more predictive skill compared to autoregressive (AR) models fitted to ILI data i.e., it is possible to exploit the information content in the open-source data. We also find that when the open-source data are non-informative, the ARMAX models reproduce the performance of AR models. The statistical models are tested on data from the 2009 swine-flu outbreak as well as the mild 2011-2012 influenza season in the U.S.A.

    15. Segregation of virulent influenza A(H1N1 variants in the lower respiratory tract of critically ill patients during the 2010-2011 seasonal epidemic.

      Directory of Open Access Journals (Sweden)

      Antonio Piralla

      Full Text Available BACKGROUND: Since its appearance in 2009, the pandemic influenza A(H1N1 virus circulated worldwide causing several severe infections. METHODS: Respiratory samples from patients with 2009 influenza A(H1N1 and acute respiratory distress attending 24 intensive care units (ICUs as well as from patients with lower respiratory tract infections not requiring ICU admission and community upper respiratory tract infections in the Lombardy region (10 million inhabitants of Italy during the 2010-2011 winter-spring season, were analyzed. RESULTS: In patients with severe ILI, the viral load was higher in bronchoalveolar lavage (BAL with respect to nasal swab (NS, (p<0.001 suggesting a higher virus replication in the lower respiratory tract. Four distinct virus clusters (referred to as cluster A to D circulated simultaneously. Most (72.7%, n = 48 of the 66 patients infected with viruses belonging to cluster A had a severe (n = 26 or moderate ILI (n = 22. Amino acid mutations (V26I, I116M, A186T, D187Y, D222G/N, M257I, S263F, I286L/M, and N473D were observed only in patients with severe ILI. D222G/N variants were detected exclusively in BAL samples. CONCLUSIONS: Multiple virus clusters co-circulated during the 2010-2011 winter-spring season. Severe or moderate ILI were associated with specific 2009 influenza A(H1N1 variants, which replicated preferentially in the lower respiratory tract.

    16. Outbreak of H3N2 influenza at a US military base in Djibouti during the H1N1 pandemic of 2009.

      Directory of Open Access Journals (Sweden)

      Michael T Cosby

      Full Text Available BACKGROUND: Influenza pandemics have significant operational impact on deployed military personnel working in areas throughout the world. The US Department of Defense global influenza-like illness (ILI surveillance network serves an important role in establishing baseline trends and can be leveraged to respond to outbreaks of respiratory illness. OBJECTIVE: We identified and characterized an operationally unique outbreak of H3N2 influenza at Camp Lemonnier, Djibouti occurring simultaneously with the H1N1 pandemic of 2009 [A(H1N1pdm09]. METHODS: Enhanced surveillance for ILI was conducted at Camp Lemonnier in response to local reports of a possible outbreak during the A(H1N1pdm09 pandemic. Samples were collected from consenting patients presenting with ILI (utilizing a modified case definition and who completed a case report form. Samples were cultured and analyzed using standard real-time reverse transcriptase PCR (rt-RT-PCR methodology and sequenced genetic material was phylogenetically compared to other published strains. RESULTS: rt-RT-PCR and DNA sequencing revealed that 25 (78% of the 32 clinical samples collected were seasonal H3N2 and only 2 (6% were A(H1N1pdm09 influenza. The highest incidence of H3N2 occurred during the month of May and 80% of these were active duty military personnel. Phylogenetic analysis revealed that sequenced H3N2 strains were genetically similar to 2009 strains from the United States of America, Australia, and South east Asia. CONCLUSIONS: This outbreak highlights challenges in the investigation of influenza among deployed military populations and corroborates the public health importance of maintaining surveillance systems for ILI that can be enhanced locally when needed.

    17. Outbreak of H3N2 influenza at a US military base in Djibouti during the H1N1 pandemic of 2009.

      Science.gov (United States)

      Cosby, Michael T; Pimentel, Guillermo; Nevin, Remington L; Fouad Ahmed, Salwa; Klena, John D; Amir, Ehab; Younan, Mary; Browning, Robert; Sebeny, Peter J

      2013-01-01

      Influenza pandemics have significant operational impact on deployed military personnel working in areas throughout the world. The US Department of Defense global influenza-like illness (ILI) surveillance network serves an important role in establishing baseline trends and can be leveraged to respond to outbreaks of respiratory illness. We identified and characterized an operationally unique outbreak of H3N2 influenza at Camp Lemonnier, Djibouti occurring simultaneously with the H1N1 pandemic of 2009 [A(H1N1)pdm09]. Enhanced surveillance for ILI was conducted at Camp Lemonnier in response to local reports of a possible outbreak during the A(H1N1)pdm09 pandemic. Samples were collected from consenting patients presenting with ILI (utilizing a modified case definition) and who completed a case report form. Samples were cultured and analyzed using standard real-time reverse transcriptase PCR (rt-RT-PCR) methodology and sequenced genetic material was phylogenetically compared to other published strains. rt-RT-PCR and DNA sequencing revealed that 25 (78%) of the 32 clinical samples collected were seasonal H3N2 and only 2 (6%) were A(H1N1)pdm09 influenza. The highest incidence of H3N2 occurred during the month of May and 80% of these were active duty military personnel. Phylogenetic analysis revealed that sequenced H3N2 strains were genetically similar to 2009 strains from the United States of America, Australia, and South east Asia. This outbreak highlights challenges in the investigation of influenza among deployed military populations and corroborates the public health importance of maintaining surveillance systems for ILI that can be enhanced locally when needed.

    18. Aircraft Fatigue - with Particular Emphasis on Australian Operations and Research.

      Science.gov (United States)

      1983-04-01

      its research on the fatigue behaviour of full-scale alluminium -alloy structures by undertaking a major investigation using surplus wings from North...on the corrosion fatigue of Taper-Lok bolted joints in D6AC steel. In March 1973 the RAAF finally took delivery of its first F-IliC, and among the...development of multiple defects, corrosion /stress corrosion , detvrirrat- ion of bonded joints, undetected cracks or damage, inadquate repairs 2r untested

    19. Impact of Human Immunodeficiency Virus on the Burden and Severity of Influenza Illness in Malawian Adults: A Prospective Cohort and Parallel Case-Control Study.

      Science.gov (United States)

      Ho, Antonia; Aston, Stephen J; Jary, Hannah; Mitchell, Tamara; Alaerts, Maaike; Menyere, Mavis; Mallewa, Jane; Nyirenda, Mulinda; Everett, Dean; Heyderman, Robert S; French, Neil

      2018-03-05

      The impact of human immunodeficiency virus (HIV) infection on influenza incidence and severity in adults in sub-Saharan Africa is unclear. Seasonal influenza vaccination is recommended for HIV-infected persons in developed settings but is rarely implemented in Africa. We conducted a prospective cohort study to compare the incidence of laboratory-confirmed influenza illness between HIV-infected and HIV-uninfected adults in Blantyre, Malawi. In a parallel case-control study, we explored risk factors for severe influenza presentation of severe (hospitalized) lower respiratory tract infection, and mild influenza (influenza-like illness [ILI]). The cohort study enrolled 608 adults, of whom 360 (59%) were HIV infected. Between April 2013 and March 2015, 24 of 229 ILI episodes (10.5%) in HIV-infected and 5 of 119 (4.2%) in HIV-uninfected adults were positive for influenza by means of polymerase chain reaction (incidence rate, 46.0 vs 14.5 per 1000 person-years; incidence rate ratio, 2.75; 95% confidence interval, 1.02-7.44; P = .03; adjusted for age, sex, household crowding, and food security). In the case-control study, influenza was identified in 56 of 518 patients (10.8%) with hospitalized lower respiratory tract infection, and 88 or 642 (13.7%) with ILI. The HIV prevalence was 69.6% and 29.6%, respectively, among influenza-positive case patients and controls. HIV was a significant risk factor for severe influenza (odds ratio, 4.98; 95% confidence interval, 2.09-11.88; P factor for influenza-associated ILI and severe presentation in this high-HIV prevalence African setting. Targeted influenza vaccination of HIV-infected African adults should be reevaluated, and the optimal mechanism for vaccine introduction in overstretched health systems needs to be determined. © The Author 2017. Published by Oxford University Press for the Infectious Diseases Society of America.

    20. TEDARİK ZİNCİRİ YÖNETİMİNDE GÜÇ İLİŞKİSİNİN STRATEJİK BOYUTU VE TEDARİKÇİ TATMİNİ ÜZERİNE BİR ARAŞTIRMA

      Directory of Open Access Journals (Sweden)

      Hande AKGÜNLÜ

      2015-09-01

      Full Text Available ÖzetAlıcı-tedarikçi ilişkilerinde tedarikçi tatmini üzerine yapılan çalışma, kavramsal bir çalışmadır. Buçalışmadaki amaçlardan biri; bilimsel olarak tedarik zinciri gücünün tedarikçi tatmini üzerindeki etkisiniölçmektir. Tedarikçi tatminindeki faktörler üzerinde gücün etkilerini araştırmak, tedarik zinciri ilişkilerindekigü.-tatmin bağlantısını anlamada kilit bir rol üstlenmektedir. Bu çalışma alıcı-tedarikçi ilişkisinintedarikçi tatminini nasıl etkilediğini göstermektedir. Çalışmada ü. amaç sözkonusudur; farklı gü. unsurlarınınsatış yapan firmalarda tatmini nasıl etkilediğini kanıtlamak, gücü düzenleyen ilişkilerin tedarikçitatminini nasıl etkilediğini araştırmak ve gü. etkilerinin otomobil sekt.ründeki tedarikçi tatmininde nasıletkili olduğunu ölçmek. Modelde; performans ve tatminin sürekli olarak anlamsız çıkmasına rağmen,belirgin pozitif etkiye sahip olmak hem performans hem de tatmin üzerinde gü.-etkilenen alıcı-tedarikçiilişkisi bulunmuştur.

    1. Generating Natural Language Under Pragmatic Constraints.

      Science.gov (United States)

      1987-03-01

      Computation and Mathematics Department Bethesda, Maryland 20084 Captain Grace M. Hopper, USNR I copy Naval Data Automation Command, Code OOH Washington Navy...Institute Mathematical Science New York University New York, NY 10012 Dr. Morgan I copy University of Pennsylvania Dept. of Computer Science & Info. Sci...If mi initerpretatioi wvith the group’s concepts i 4hut Alrealdv present ili mlemory. ,1 lew higzh- lvel interpretltion cii 1e created and indexed off

    2. ONR Far East Scientific Bulletin. Volume 13, Number 2, April - June 1988

      Science.gov (United States)

      1988-06-01

      National Cancer Institute in Bethesda, MD. tions, and in 1985 he wac appointed scien- From 1965-68 he was a clinical associate in tific advisor to...o! 16 !rAd :i* OTOi ion Robo tics Research F~io*,(Cl!Ioloyx’, a ’urn- U t1 l;o! * Joulrnal of iliU l* : a %c I B iochtil utstv T IT,! 1 0i 1 1- 11 of

    3. UTJECAJ STUPNJA USVOJENOSTI MARKETING KONCEPCIJE NA PROFITABILNOST PODUZEĆA

      OpenAIRE

      Nefat, Ariana; Belullo, Alen

      2000-01-01

      Autori su u radu istražili utjecaj stupnja usvojenosti marketing koncepcije na profitabilnost poduzeća izraženog putem ROA, jer tržišna orijentacija kao primjena marketing koncepcije univerzalno je prihvatljiva filozofija za istraživana poduzeća u Hrvatskoj. Nalaz njihova istraživanja potvrđuje hipotezu ovog rada da primjena marketing koncepcije pridonosi profitabilnosti poduzeća.

    4. Impact of influenza vaccination on respiratory illness rates in children attending private boarding schools in England, 2013-2014: a cohort study.

      Science.gov (United States)

      Brousseau, N; Green, H K; Andrews, N; Pryse, R; Baguelin, M; Sunderland, A; Ellis, J; Pebody, R

      2015-12-01

      Several private boarding schools in England have established universal influenza vaccination programmes for their pupils. We evaluated the impact of these programmes on the burden of respiratory illnesses in boarders. Between November 2013 and May 2014, age-specific respiratory disease incidence rates in boarders were compared between schools offering and not offering influenza vaccine to healthy boarders. We adjusted for age, sex, school size and week using negative binomial regression. Forty-three schools comprising 14 776 boarders participated. Almost all boarders (99%) were aged 11-17 years. Nineteen (44%) schools vaccinated healthy boarders against influenza, with a mean uptake of 48·5% (range 14·2-88·5%). Over the study period, 1468 respiratory illnesses were reported in boarders (5·66/1000 boarder-weeks); of these, 33 were influenza-like illnesses (ILIs, 0·26/1000 boarder-weeks) in vaccinating schools and 95 were ILIs (0·74/1000 boarder-weeks) in non-vaccinating schools. The impact of vaccinating healthy boarders was a 54% reduction in ILI in all boarders [rate ratio (RR) 0·46, 95% confidence interval (CI) 0·28-0·76]. Disease rates were also reduced for upper respiratory tract infections (RR 0·72, 95% CI 0·61-0·85) and chest infections (RR 0·18, 95% CI 0·09-0·36). These findings demonstrate a significant impact of influenza vaccination on ILI and other clinical endpoints in secondary-school boarders. Additional research is needed to investigate the impact of influenza vaccination in non-boarding secondary-school settings.

    5. Fotografski albumi u funkciji građenja popularnog mita

      OpenAIRE

      Ćalović, Dragan

      2014-01-01

      U tekstu se analiziraju principi građenja popularnog mita. Popularni mit sagledan je kao rezultat popularne proizvodnje koja eksploatira materiju metajezika kao drugostupanjskog semiološkog sustava. Za razliku od Barthesovog koncepta mitifikacije samog mita, ili popularnog korištenja mita u duhu Fiskeovog razumijevanja snaga popularnog, popularni mit svoj izraz pronalazi u slobodnom korištenju potencijala metajezika. Popularni mit preuzima mehanizme metajezične značenjske produkcije kako bi m...

    6. Timeliness of syndromic influenza surveillance through work and school absenteeism

      OpenAIRE

      Bollaerts, K; Antoine, J; Robesyn, E; Van Proeyen, L; Vomberg, J; Feys, E; De Decker, E; Catry, B

      2010-01-01

      In this paper, we investigate the usefulness of work and school absenteeism surveillance as an early warning system for influenza. In particular, time trends in daily absenteeism rates collected during the A(H1N1)2009 pandemic are compared with weekly incidence rates of influenza-like illness (ILI) obtained from the Belgian Sentinel General Practitioner (SGP) network. The results indicate a rise in absenteeism rates prior to the onset of the influenza epidemic, suggesting that absenteeism sur...

    7. Short Communication. Effect of the health status and geographical origin on the cork production characteristics of Western Algeria cork oak stands

      Directory of Open Access Journals (Sweden)

      B. Dahane

      2013-04-01

      Full Text Available Aim of study: To analyze the effect of health status on cork production, analyzing if this influence is uniform or is affected by site conditions.Area of study: Two Western Algerian cork tree forests have been studied: M’Sila located in the coastal plains under semiarid climate, and Zarieffet, located in the mountainous interior under sub-humid climate.Material and Methods: 40 trees were selected in each forest and classified according to their health status as healthy, weakened, or decaying. A sample of cork from each tree has been obtained to measure the key variables related to cork production. A two-way ANOVA was performed considering two factors: site and health status.Main results: Quercus suber L. productivity is affected by the vitality of trees in the same way in both sources, showing values between 5.96 ± 7.1 kg • m-2 (coast, weakened trees and 8.13 ± 0.45 kg • m-2 (mountain, healthy trees. The health status also affects the number and area of pores, especially in the cork oak groves of the coast, where the coefficient of porosity ranges from 3.79 ± 0.84% (healthy trees to 8.11 ± 1.91% (decaying trees. The variables where the site has presented a stronger effect are those related to the amount of cork produced by the phellogen (density -kg·l-1, p<0.000- and productivity -kg·m-2, p=0.001-, and pore density (1·cm-2, p=0.001. Scrap thickness (mm and porosity (% show a smaller effect although still representative (p=0.041 and 0.038 respectively. Porosity and pore density show interaction site*health status. They all have higher values in the mountain (Zarieffet than in the coast (M’Sila. The effect of tree vitality on the formation of pores in the cork oak phellogen is lower in the mountain than in the coast. No significant effects were found for any of the two factors neither on the annual growth rate nor on the thickness of the cork.Research highlights: Results lead to the conclusion that the effect of health status on

    8. Okulöncesi Öğretmenlerinin Erken Matematik Eğitimine İlişkin Özyeterlikleri

      OpenAIRE

      ÇELİK, Meryem

      2017-01-01

      Bu araştırmanın amacı, okulöncesi öğretmenlerinin erken matematik eğitimine ilişkin özyeterlik düzeyleri ve bu düzeylerle çeşitli değişkenler arasındaki ilişkileri incelemektir. Araştırmanın örneklemini oluşturan 2013 yılında okulöncesi öğretmenliği yapan 60 öğretmene “Okulöncesi Öğretmenlerinin Erken Matematik Eğitimine İlişkin Yeterliklerini Belirleme Aracı” uygulanmıştır. Analizler sonucunda öğretmenlerin erken matematik eğitimine ilişkin yeterlilik düzeylerinin iyi olduğu sonucuna ulaşılm...

    9. Kişisel Motivasyon Faktörlerinin Olumsuz Elektronik Ağızdan Ağıza İletişim Yapma Niyeti Üzerindeki Etkisi

      OpenAIRE

      ÇELİK, Zübeyir; ÖZKARA, Behçet Yalın

      2017-01-01

      Pazarlama literatürü incelendiğinde, tüketicileriürünlere ilişkin olarak elektronik ağızdan ağıza iletişime yönelten farklımotivasyon kaynakları olduğu görülmektedir. Konuya ilişkin yapılmış çalışmalarilgili motivasyon kaynaklarının ekonomik teşvikler, tavsiye arama, kendinigeliştirme, firmaya yardım etme, olumlu duyguları ifade etme, güç uygulamaolduğuna ilişkin sonuçlara ulaşmışlardır. Ancak literatürde özellikle kişiyeözel motivasyon unsurlarının etkilerinin göz ardı edilmiş olduğu görülme...

    10. Establishing seasonal and alert influenza thresholds in Cambodia using the WHO method: implications for effective utilization of influenza surveillance in the tropics and subtropics.

      Science.gov (United States)

      Ly, Sovann; Arashiro, Takeshi; Ieng, Vanra; Tsuyuoka, Reiko; Parry, Amy; Horwood, Paul; Heng, Seng; Hamid, Sarah; Vandemaele, Katelijn; Chin, Savuth; Sar, Borann; Arima, Yuzo

      2017-01-01

      To establish seasonal and alert thresholds and transmission intensity categories for influenza to provide timely triggers for preventive measures or upscaling control measures in Cambodia. Using Cambodia's influenza-like illness (ILI) and laboratory-confirmed influenza surveillance data from 2009 to 2015, three parameters were assessed to monitor influenza activity: the proportion of ILI patients among all outpatients, proportion of ILI samples positive for influenza and the product of the two. With these parameters, four threshold levels (seasonal, moderate, high and alert) were established and transmission intensity was categorized based on a World Health Organization alignment method. Parameters were compared against their respective thresholds. Distinct seasonality was observed using the two parameters that incorporated laboratory data. Thresholds established using the composite parameter, combining syndromic and laboratory data, had the least number of false alarms in declaring season onset and were most useful in monitoring intensity. Unlike in temperate regions, the syndromic parameter was less useful in monitoring influenza activity or for setting thresholds. Influenza thresholds based on appropriate parameters have the potential to provide timely triggers for public health measures in a tropical country where monitoring and assessing influenza activity has been challenging. Based on these findings, the Ministry of Health plans to raise general awareness regarding influenza among the medical community and the general public. Our findings have important implications for countries in the tropics/subtropics and in resource-limited settings, and categorized transmission intensity can be used to assess severity of potential pandemic influenza as well as seasonal influenza.

    11. Sacre Coeur Nursing Home, Station Road, Tipperary Town, Tipperary

      LENUS (Irish Health Repository)

      Brabazon, E D

      2010-01-01

      The use of routinely available electronic sources of healthcare data on the spread of influenza has the potential to enhance current surveillance activities. This study aimed to develop a method for identifying influenza-related records from general practitioner(GP) out-of-hours (OOH) services in Ireland. Data from one such service were interrogated for keywords relating to influenza-like illness (ILI) and a proxy measure of influenza activity in the community setting was developed. Comparison of this syndromic surveillance measure with national data on ILI consultation rates demonstrated a statistically significant temporal correlation.In five out of six influenza seasons investigated,peaks in the GP OOH influenza-related calls appeared at least one week ahead of peaks in the national ILI consultation rates. The method described in this paper has been extended to nine OOH services in Ireland (covering 70% of the Irish population) to provide weekly figures on self-reported illness for influenza in the community and its data have been incorporated into the national weekly influenza reports produced by the Health Protection Surveillance Centre. These data should provide early warnings of both seasonal and pandemic influenza in Ireland.

    12. Guess who's not coming to dinner? Evaluating online restaurant reservations for disease surveillance.

      Science.gov (United States)

      Nsoesie, Elaine O; Buckeridge, David L; Brownstein, John S

      2014-01-22

      Alternative data sources are used increasingly to augment traditional public health surveillance systems. Examples include over-the-counter medication sales and school absenteeism. We sought to determine if an increase in restaurant table availabilities was associated with an increase in disease incidence, specifically influenza-like illness (ILI). Restaurant table availability was monitored using OpenTable, an online restaurant table reservation site. A daily search was performed for restaurants with available tables for 2 at the hour and at half past the hour for 22 distinct times: between 11:00 am-3:30 pm for lunch and between 6:00-11:30 PM for dinner. In the United States, we examined table availability for restaurants in Boston, Atlanta, Baltimore, and Miami. For Mexico, we studied table availabilities in Cancun, Mexico City, Puebla, Monterrey, and Guadalajara. Time series of restaurant use was compared with Google Flu Trends and ILI at the state and national levels for the United States and Mexico using the cross-correlation function. Differences in restaurant use were observed across sampling times and regions. We also noted similarities in time series trends between data on influenza activity and restaurant use. In some settings, significant correlations greater than 70% were noted between data on restaurant use and ILI trends. This study introduces and demonstrates the potential value of restaurant use data for event surveillance.

    13. Long-term Impact of Weight Loss Intervention on Changes in Cognitive Function: Exploratory Analyses from the Action for Health in Diabetes Randomized Controlled Clinical Trial.

      Science.gov (United States)

      Espeland, Mark A; Carmichael, Owen; Hayden, Kathleen; Neiberg, Rebecca H; Newman, Anne B; Keller, Jeffery N; Wadden, Thomas A; Rapp, Stephen R; Hill, James O; Horton, Edward S; Johnson, Karen C; Wagenknecht, Lynne; Wing, Rena R

      2018-03-14

      Diabetes adversely impacts cognition. Lifestyle change can improve diabetes control and potentially improve cognition. We examined whether weight loss through reduced caloric intake and increased physical activity was associated with slower cognitive aging in older adults with type 2 diabetes mellitus. The Look AHEAD randomized controlled clinical trial delivered 10 years of intensive lifestyle intervention (ILI) that yielded long-term weight losses. During 5 years spanning the end of intervention and postintervention follow-up, repeated cognitive assessments were obtained in 1,091 individuals who had been assigned to ILI or a control condition of diabetes support and education (DSE). We compared the means and slopes of scores on cognitive testing over these repeated assessments. Compared with DSE, assignment to ILI was associated with a -0.082 SD deficit in mean global cognitive function across repeated assessments (p = .010). However, overweight (body mass index [BMI] memory. The behavioral weight loss intervention was associated with small relative deficits in cognitive function among individuals who were obese and marginally greater cognitive decline overall compared to control. ClinicalTrials.gov Identifier: NCT00017953.

    14. FİLMLERLE İLETİŞİM VE YABANCILAŞMA

      OpenAIRE

      ÖZTÜRK, Serdar

      2018-01-01

      Yabancılaşma konusu genellikle iktisadi, sosyolojik ve psikoloji boyutlarıyla tartışılmıştır. Oysa bir anlam paylaşımı olarak iletişim, yabancılaşmayla doğrudan ilişkilidir. Buna karşın iletişim ile yabancılaşma ilişkisini, analize filmleri de katarak inceleyen çok az çalışma bulunmaktadır. Bu çalışma, yabancılaşma kavramını tartışarak, yabancılaşmanın iletişim ile ilişkisini incelemektedir. Buna göre insanın kendi ürettiği sembollerine, medyanın üretim bölgesinde üretilen sembollere yabancıl...

    15. A designated centre for people with disabilities operated by Nua Healthcare Services, Laois

      LENUS (Irish Health Repository)

      Brabazon, E D

      2010-01-01

      The use of routinely available electronic sources of healthcare data on the spread of influenza has the potential to enhance current surveillance activities. This study aimed to develop a method for identifying influenza-related records from general practitioner(GP) out-of-hours (OOH) services in Ireland. Data from one such service were interrogated for keywords relating to influenza-like illness (ILI) and a proxy measure of influenza activity in the community setting was developed. Comparison of this syndromic surveillance measure with national data on ILI consultation rates demonstrated a statistically significant temporal correlation.In five out of six influenza seasons investigated,peaks in the GP OOH influenza-related calls appeared at least one week ahead of peaks in the national ILI consultation rates. The method described in this paper has been extended to nine OOH services in Ireland (covering 70% of the Irish population) to provide weekly figures on self-reported illness for influenza in the community and its data have been incorporated into the national weekly influenza reports produced by the Health Protection Surveillance Centre. These data should provide early warnings of both seasonal and pandemic influenza in Ireland.

    16. Bayesian inferences of generation and growth of corrosion defects on energy pipelines based on imperfect inspection data

      International Nuclear Information System (INIS)

      Qin, H.; Zhou, W.; Zhang, S.

      2015-01-01

      Stochastic process-based models are developed to characterize the generation and growth of metal-loss corrosion defects on oil and gas steel pipelines. The generation of corrosion defects over time is characterized by the non-homogenous Poisson process, and the growth of depths of individual defects is modeled by the non-homogenous gamma process (NHGP). The defect generation and growth models are formulated in a hierarchical Bayesian framework, whereby the parameters of the models are evaluated from the in-line inspection (ILI) data through the Bayesian updating by accounting for the probability of detection (POD) and measurement errors associated with the ILI data. The Markov Chain Monte Carlo (MCMC) simulation in conjunction with the data augmentation (DA) technique is employed to carry out the Bayesian updating. Numerical examples that involve simulated ILI data are used to illustrate and validate the proposed methodology. - Highlights: • Bayesian updating of growth and generation models of defects on energy pipelines. • Non-homogeneous Poisson process for defect generation. • Non-homogeneous gamma process for defect growth. • Updating based on inspection data with detecting and sizing uncertainties. • MCMC in conjunction with data augmentation technique employed for the updating.

    17. Runoff variations in Lake Balkhash Basin, Central Asia, 1779-2015, inferred from tree rings

      Science.gov (United States)

      Panyushkina, Irina P.; Meko, D. M.; Macklin, M. G.; Toonen, W. H. J.; Mukhamadiev, N. S.; Konovalov, V. G.; Ashikbaev, N. Z.; Sagitov, A. O.

      2018-01-01

      Long highly-resolved proxies for runoff are in high demand for hydrological forecasts and water management in arid Central Asia. An accurate (R2 = 0.53) reconstruction of October-September discharge of the Ili River in Kazakhstan, 1779-2015, is developed from moisture-sensitive tree rings of spruce sampled in the Tian Shan Mountains. The fivefold extension of the gauged discharge record represents the variability of runoff in the Lake Balkhash Basin for the last 235 years. The reconstruction shows a 40 year long interval of low discharge preceded a recent high peak in the first decade of the 2000s followed by a decline to more recent levels of discharge not seen since the start of the gauged record. Most reconstructed flow extremes (± 2σ) occur outside the instrumental record (1936-2015) and predate the start of large dam construction (1969). Decadal variability of the Ili discharge corresponds well with hydrological records of other Eurasian internal drainages modeled with tree rings. Spectral analysis identifies variance peaks (highest near 42 year) consistent with main hemispheric oscillations of the Eurasian climatic system. Seasonal comparison of the Ili discharge with sea-level-pressure and geopotential height data suggests periods of high flow likely result from the increased contribution of snow to runoff associated with the interaction of Arctic air circulation with the Siberian High-Pressure System and North Atlantic Oscillation.

    18. Okul Müdürlerinin Bilgi Teknolojisi Sınıflarına İlişkin Görüşleri

      OpenAIRE

      Dr., Sadegül Akbaba Altun Yrd. Doç.

      2004-01-01

      Bu çalışmanın amacı, ‘Temel Eğitim Programı' kapsamı çerçevesinde kurulan ilköğretim okullarındaki Bilgi Teknolojisi (BT) sınıflarına ilişkin olarak okul müdürlerinin BT sınıflarının kurulumundaki rollerinin belirlenmesi, BT sınıflarına ilişkin yaşadıkları sorunlar ve bu sorunların çözümüyle ilgili önerilerle BT sınıflarının etkiliğine ilişkin görüşlerini belirlemektir. Bu amaçla, okulunda BT sınıfı olan 17 ilköğretim okulu müdürü ile görüşme yapılmış ve bu görüşmeler d...

    19. The impact of alternative diagnoses on the utility of influenza-like illness case definition to detect the 2009 H1N1 pandemic.

      Science.gov (United States)

      Rumoro, Dino P; Bayram, Jamil D; Silva, Julio C; Shah, Shital C; Hallock, Marilyn M; Gibbs, Gillian S; Waddell, Michael J

      2012-01-01

      To investigate the impact of excluding cases with alternative diagnoses on the sensitivity and specificity of the Centers for Disease Control and Prevention's (CDC) influenza-like illness (ILI) case definition in detecting the 2009 H1N1 influenza, using Geographic Utilization of Artificial Intelligence in Real-Time for Disease Identification and Alert Notification, a disease surveillance system. Retrospective cross-sectional study design. Emergency department of an urban tertiary care academic medical center. 1,233 ED cases, which were tested for respiratory viruses from September 5, 2009 to May 5, 2010. The main outcome measures were positive predictive value, negative predictive value, sensitivity, specificity, and accuracy of the ILI case definition (both including and excluding alternative diagnoses) to detect H1N1. There was a significant decrease in sensitivity (chi2 = 9.09, p < 0.001) and significant improvement in specificity (chi2 = 179, p < 0.001), after excluding cases with alternative diagnoses. When early detection of an influenza epidemic is of prime importance, pursuing alternative diagnoses as part of CDC's ILI case definition may not be warranted for public health reporting due to the significant decrease in sensitivity, in addition to the resources required for detecting these alternative diagnoses.

    20. Viral aetiology influenza like illnesses in Santa Cruz, Bolivia (2010-2012).

      Science.gov (United States)

      Delangue, Julie; Roca Sanchez, Yelin; Piorkowski, Géraldine; Bessaud, Maël; Baronti, Cécile; Thirion-Perrier, Laurence; Mafayle, Roxana Loayza; Ardaya, Cinthia Avila; Aguilera, Gabriela Añez; Guzman, Jimmy Revollo; Riera, Javier Lora; de Lamballerie, Xavier

      2014-02-24

      Acute respiratory infections represent a serious public health issue worldwide but virological aetiologies of Influenza Like Illnesses (ILIs) remain largely unknown in developing countries. This study represents the first attempt to characterise viral aetiologies of ILIs in Bolivia. It was performed in Santa Cruz city from January 2010 to September 2012, based on 564 naso-pharyngeal swabs collected in a National Reference Laboratory and real-time PCR techniques, viral cultures and phylogenetic analyses. 50.2% of samples were positive for at least one virus with influenza viruses (Flu A: ~15%; Flu B: ~9%), rhinoviruses (~8%), coronaviruses (~5%) and hRSV (~4%) being the most frequently identified. The pattern of viral infections varied according to age groups. The elucidation rate was the highest (>60%) amongst patients under 10 yo and the lowest (Bolivia in the study period, originating from Central and North America, Europe, Asia and Australia. Our results emphasise the requirement for a reinforced epidemiological and genetic follow-up of influenza and other ILIs in Bolivia to further inform the preparation of vaccines used in the region, guide vaccination campaigns and improve the medical management of patients.

    1. Viral aetiology influenza like illnesses in Santa Cruz, Bolivia (2010–2012)

      Science.gov (United States)

      2014-01-01

      Background Acute respiratory infections represent a serious public health issue worldwide but virological aetiologies of Influenza Like Illnesses (ILIs) remain largely unknown in developing countries. This study represents the first attempt to characterise viral aetiologies of ILIs in Bolivia. Methods It was performed in Santa Cruz city from January 2010 to September 2012, based on 564 naso-pharyngeal swabs collected in a National Reference Laboratory and real-time PCR techniques, viral cultures and phylogenetic analyses. Results 50.2% of samples were positive for at least one virus with influenza viruses (Flu A: ~15%; Flu B: ~9%), rhinoviruses (~8%), coronaviruses (~5%) and hRSV (~4%) being the most frequently identified. The pattern of viral infections varied according to age groups. The elucidation rate was the highest (>60%) amongst patients under 10 yo and the lowest (Bolivia in the study period, originating from Central and North America, Europe, Asia and Australia. Conclusion Our results emphasise the requirement for a reinforced epidemiological and genetic follow-up of influenza and other ILIs in Bolivia to further inform the preparation of vaccines used in the region, guide vaccination campaigns and improve the medical management of patients. PMID:24564892

    2. An Outbreak of 2009 Pandemic Influenza A (H1N1) Virus Infection in an Elementary School in Pennsylvania

      Science.gov (United States)

      Bhattarai, Achuyt; Fagan, Ryan P.; Ostroff, Stephen; Sodha, Samir V.; Moll, Mària E.; Lee, Bruce Y.; Chang, Chung-Chou H.; Ennis, Brent; Britz, Phyllis; Fiore, Anthony; Nguyen, Michael; Palekar, Rakhee; Archer, W. Roodly; Gift, Thomas L.; Leap, Rebecca; Nygren, Benjamin L.; Cauchemez, Simon; Angulo, Frederick J.; Swerdlow, David

      2011-01-01

      In May 2009, one of the earliest outbreaks of 2009 pandemic influenza A virus (pH1N1) infection resulted in the closure of a semi-rural Pennsylvania elementary school. Two sequential telephone surveys were administered to 1345 students (85% of the students enrolled in the school) and household members in 313 households to collect data on influenza-like illness (ILI). A total of 167 persons (12.4%) among those in the surveyed households, including 93 (24.0%) of the School A students, reported ILI. Students were 3.1 times more likely than were other household members to develop ILI (95% confidence interval [CI], 2.3–4.1). Fourth-grade students were more likely to be affected than were students in other grades (relative risk, 2.2; 95% CI, 1.2–3.9). pH1N1 was confirmed in 26 (72.2%) of the individuals tested by real-time reverse-transcriptase polymerase chain reaction. The outbreak did not resume upon the reopening of the school after the 7-day closure. This investigation found that pH1N1 outbreaks at schools can have substantial attack rates; however, grades and classrooms are affected variably. Additioanl study is warranted to determine the effectiveness of school closure during outbreaks. PMID:21342888

    3. Compensation of matrix effects in gas chromatography-mass spectrometry analysis of pesticides using a combination of matrix matching and multiple isotopically labeled internal standards.

      Science.gov (United States)

      Tsuchiyama, Tomoyuki; Katsuhara, Miki; Nakajima, Masahiro

      2017-11-17

      In the multi-residue analysis of pesticides using GC-MS, the quantitative results are adversely affected by a phenomenon known as the matrix effect. Although the use of matrix-matched standards is considered to be one of the most practical solutions to this problem, complete removal of the matrix effect is difficult in complex food matrices owing to their inconsistency. As a result, residual matrix effects can introduce analytical errors. To compensate for residual matrix effects, we have developed a novel method that employs multiple isotopically labeled internal standards (ILIS). The matrix effects of ILIS and pesticides were evaluated in spiked matrix extracts of various agricultural commodities, and the obtained data were subjected to simple statistical analysis. Based on the similarities between the patterns of variation in the analytical response, a total of 32 isotopically labeled compounds were assigned to 338 pesticides as internal standards. It was found that by utilizing multiple ILIS, residual matrix effects could be effectively compensated. The developed method exhibited superior quantitative performance compared with the common single-internal-standard method. The proposed method is more feasible for regulatory purposes than that using only predetermined correction factors and is considered to be promising for practical applications. Copyright © 2017 Elsevier B.V. All rights reserved.

    4. MESLEKÎ VE ÖRGÜTSEL BAĞLILIĞIN, ÖRGÜTSEL DAVRANIŞA İLİŞKİN SONUÇLARLA İLİŞKİLERİ

      OpenAIRE

      ŞİMŞEK, M. Şerif; ASLAN, Şebnem

      2012-01-01

      Çalışmanın amacı, meslekî bağlığın üç öğesiyle, örgütsel bağlılığın üç öğesi arasındaki ilişkileri incelemektir. Araştırmanın bir diğer amacı, meslekî bağlılığın ve örgütsel bağlılığın üç öğesinin, temel iş özellikleri, rol stresi, meslekî faaliyete katılım, iş doyumu, örgütsel sonuçlar ve yaşam doyumuyla ilişkilerini araştırmaktır. Çalışmanın kapsamını Konya ilindeki 272 hemşire oluşturmaktadır. Araştırmanın sonucunda, meslekî bağlılık örgütsel bağlılıkla ilişkili bulunmuştur. Meslekî ve örg...

    5. General practice out-of-hours service in Ireland provides a new source of syndromic surveillance data on influenza.

      LENUS (Irish Health Repository)

      Brabazon, E D

      2010-01-01

      The use of routinely available electronic sources of healthcare data on the spread of influenza has the potential to enhance current surveillance activities. This study aimed to develop a method for identifying influenza-related records from general practitioner(GP) out-of-hours (OOH) services in Ireland. Data from one such service were interrogated for keywords relating to influenza-like illness (ILI) and a proxy measure of influenza activity in the community setting was developed. Comparison of this syndromic surveillance measure with national data on ILI consultation rates demonstrated a statistically significant temporal correlation.In five out of six influenza seasons investigated,peaks in the GP OOH influenza-related calls appeared at least one week ahead of peaks in the national ILI consultation rates. The method described in this paper has been extended to nine OOH services in Ireland (covering 70% of the Irish population) to provide weekly figures on self-reported illness for influenza in the community and its data have been incorporated into the national weekly influenza reports produced by the Health Protection Surveillance Centre. These data should provide early warnings of both seasonal and pandemic influenza in Ireland.

    6. Türkiye’de Vergi Gelirleri ile Ekonomik Kalkınma Arasındaki İlişki: Frekans Alanı Nedensellik Analizi

      Directory of Open Access Journals (Sweden)

      Mehmet Vahit EREN

      2018-01-01

      Full Text Available Çalışmanın amacı, Türkiye’de 1975-2013 dönemine ait yıllık verilerle vergi gelirleri ile kalkınma arasındaki ilişkinin varlığını araştırmakla beraber söz konusu ilişkinin yönünü farklı ekonometrik testlerle analiz etmektir. Hacker ve Hatemi nedensellik testi bulgularına göre, dolaylı vergi gelirlerinden kalkınmaya doğru tek yönlü; Breitung ve Caldelon frekans alanı nedensellik testi ise toplam vergi gelirlerinden kalkınmaya, dolaysız vergi gelirlerinden kalkınmaya ve kalkınmadan dolaylı vergi gelirlerine doğru tek yönlü ilişkiler tespit edilmiştir.

    7. Improving incidence estimation in practice-based sentinel surveillance networks using spatial variation in general practitioner density

      Directory of Open Access Journals (Sweden)

      Cécile Souty

      2016-11-01

      Full Text Available Abstract Background In surveillance networks based on voluntary participation of health-care professionals, there is little choice regarding the selection of participants’ characteristics. External information about participants, for example local physician density, can help reduce bias in incidence estimates reported by the surveillance network. Methods There is an inverse association between the number of reported influenza-like illness (ILI cases and local general practitioners (GP density. We formulated and compared estimates of ILI incidence using this relationship. To compare estimates, we simulated epidemics using a spatially explicit disease model and their observation by surveillance networks with different characteristics: random, maximum coverage, largest cities, etc. Results In the French practice-based surveillance network – the “Sentinelles” network – GPs reported 3.6% (95% CI [3;4] less ILI cases as local GP density increased by 1 GP per 10,000 inhabitants. Incidence estimates varied markedly depending on scenarios for participant selection in surveillance. Yet accounting for change in GP density for participants allowed reducing bias. Applied on data from the Sentinelles network, changes in overall incidence ranged between 1.6 and 9.9%. Conclusions Local GP density is a simple measure that provides a way to reduce bias in estimating disease incidence in general practice. It can contribute to improving disease monitoring when it is not possible to choose the characteristics of participants.

    8. BENLİK İMAJI UYUMU, TÜKETİCİ TATMİNİ VE MARKA SADAKATİ İLİŞKİSİ ÜZERİNE GÖRGÜL BİR ARAŞTIRMA

      OpenAIRE

      ARMUTLU, Can; ÜNER, M.Mithat

      2009-01-01

      Tüketici davranışları yazınında, tüketicilerin marka imajı ve benlik imajı algılamaları arasındaki uyumu ifade eden, “benlik imajı uyumu ” çalışmalarının, kavramın satın alma öncesi etkileri üzerinde yoğunlaştığı görülmektedir. Bu çalışmanın amacı benlik imajı uyumunun tüketici tatmini ve marka sadakati ile doğrudan ve dolaylı ilişkilerini ortaya koyarak satın alma sonrası etkilerini belirlemektir. Araştırmada benlik imajı uyumu ve marka sadakati ilişkisinde tüketici tatmininin aracılık ilişk...

    9. Evlilik İçi Zorla Cinsel İlişki Üzerine Bir Anket Çalışması

      Directory of Open Access Journals (Sweden)

      Mehmet Fatih Yavuz

      1998-08-01

      Full Text Available Bu çalışmada, 170’i hukuk mezunu, 480’i toplumun çeşitli kesimlerinden olmak üzere toplam 650 kişinin evlilikiçi zorla cinsel ilişki konusundaki görüşlerini belirleyen anket formlarının sonuçları değerlendirilmiştir. Çalışmaya katılanların % 65’inin, hukukçuların % 45’inin ve toplumdan katılanların % 71’inin kocanın karısıyla zorla cinsel ilişkide bulunmasının bir ırza geçme suçu oluşturacağına inandıkları görülmektedir.Çalışmaya katılanların yarıdan fazlasının bu görüşte olması evlilikiçi zorla cinsel ilişkinin ırza geçme suçu olarak düzenlenmesi yolundaki tartışmalara basamak oluşturmaktadır. Anahtar kelimeler: Evlilik, Irza geçme.

    10. TÜRKİYE’NİN AB’YE ÜYELİK SÜRECİNİN MALİ GÖSTERGELER AÇISINDAN AB’NİN YENİ ÜYE ÜLKELERİYLE KARŞILAŞTIRILMASI

      OpenAIRE

      YAVUZ, Hakan; YAVUZ, Sinem

      2015-01-01

      Türkiye’nin Avrupa Birliği (AB) ile ilişkisi uzun bir tarihsel geçmişe dayanmasına rağmen, halen nihai hedefine ulaşamamıştır. Ancak tam üyelik yolunda önemli adımların atıldığı söylenebilir. Söz konusu gelişmelere paralel olarak, Türkiye-AB ilişkilerine yönelik literatür de genişlemektedir. Literatürde bazı çalışmalar ilişkinin ekonomik, mali, bazı çalışmalar da siyasi, kültürel ve sosyal boyutunu ele almaktadır. Bu çalışmanın amacı, Türkiye’nin AB üyelik sürecinin mali göstergelere gösterdi...

    11. Estimation of the burden of pandemic(H1N12009 in developing countries: experience from a tertiary care center in South India.

      Directory of Open Access Journals (Sweden)

      Mahesh Moorthy

      Full Text Available The burden of the pandemic (H1N1 2009 influenza might be underestimated if detection of the virus is mandated to diagnose infection. Using an alternate approach, we propose that a much higher pandemic burden was experienced in our institution.Consecutive patients (n = 2588 presenting to our hospital with influenza like illness (ILI or severe acute respiratory infection (SARI during a 1-year period (May 2009-April 2010 were prospectively recruited and tested for influenza A by real-time RT-PCR. Analysis of weekly trends showed an 11-fold increase in patients presenting with ILI/SARI during the peak pandemic period when compared with the pre-pandemic period and a significant (P<0.001 increase in SARI admissions during the pandemic period (30 ± 15.9 admissions/week when compared with pre-pandemic (7 ± 2.5 and post-pandemic periods (5 ± 3.8. However, Influenza A was detected in less than one-third of patients with ILI/SARI [699 (27.0%]; a majority of these (557/699, 79.7% were Pandemic (H1N12009 virus [A/H1N1/09]. An A/H1N1/09 positive test was correlated with shorter symptom duration prior to presentation (p = 0.03. More ILI cases tested positive for A/H1N1/09 when compared with SARI (27.4% vs. 14.6%, P = 0.037. When the entire study population was considered, A/H1N1/09 positivity was associated with lower risk of hospitalization (p<0.0001 and ICU admission (p = 0.013 suggesting mild self-limiting illness in a majority.Analysis of weekly trends of ILI/SARI suggest a higher burden of the pandemic attributable to A/H1N1/09 than estimates assessed by a positive PCR test alone. The study highlights methodological consideration in the estimation of burden of pandemic influenza in developing countries using hospital-based data that may help assess the impact of future outbreaks of respiratory illnesses.

    12. Enterovirus genotypes among patients with severe acute respiratory illness, influenza-like illness, and asymptomatic individuals in South Africa, 2012-2014.

      Science.gov (United States)

      Hellferscee, Orienka; Tempia, Stefano; Walaza, Sibongile; Variava, Ebrahim; Dawood, Halima; Wolter, Nicole; Madhi, Shabir A; du Plessis, Mignon; Cohen, Cheryl; Treurnicht, Florette K

      2017-10-01

      Enteroviruses can cause outbreaks of severe acute respiratory illness (SARI) and EV-A, -B, -C, and -D species have different pathogenic profiles and circulation patterns. We aimed to characterize and determine the prevalence of enterovirus genotypes among South African patients with respiratory illness and controls during June 2012 to July 2014. Syndromic SARI and influenza-like illness (ILI) surveillance was performed at two sentinel sites. At each site nasopharyngeal/oropharyngeal specimens were collected from SARI and ILI patients as well as controls. Specimens were tested for enterovirus by real-time PCR. Positive specimens were further genotyped by sequencing a region of the VP1 gene. The prevalence of enterovirus was 5.8% (87/1494), 3.4% (103/3079), and 3.4% (46/1367) among SARI, ILI, and controls, respectively (SARI/controls, P = 0.002 and ILI/control, P = 0.973). Among the 101/236 (42.8%) enterovirus-positive specimens that could be genotyped, we observed a high diversity of circulating enterovirus genotypes (a total of 33 genotypes) from all four human enterovirus species with high prevalence of Enterovirus-B (60.4%; 61/101) and Enterovirus-A (21.8%; 22/101) compared to Enterovirus-C (10.9%; 11/101) and Enterovirus-D (6.9%; 7/101) (P = 0.477). Of the enterovirus genotypes identified, Echovirus 30 (9.9%, 10/101), Coxsackie virus B5 (7.9%, 8/101) and Enterovirus-D68 (6.9%, 7/101) were most prevalent. There was no difference in disease severity (SARI or ILI compared to controls) between the different enterovirus species (P = 0.167). We observed a high number of enterovirus genotypes in patients with respiratory illness and in controls from South Africa with no disease association of EV species with disease severity. © 2017 Wiley Periodicals, Inc.

    13. Evaluating Google, Twitter, and Wikipedia as Tools for Influenza Surveillance Using Bayesian Change Point Analysis: A Comparative Analysis.

      Science.gov (United States)

      Sharpe, J Danielle; Hopkins, Richard S; Cook, Robert L; Striley, Catherine W

      2016-10-20

      Traditional influenza surveillance relies on influenza-like illness (ILI) syndrome that is reported by health care providers. It primarily captures individuals who seek medical care and misses those who do not. Recently, Web-based data sources have been studied for application to public health surveillance, as there is a growing number of people who search, post, and tweet about their illnesses before seeking medical care. Existing research has shown some promise of using data from Google, Twitter, and Wikipedia to complement traditional surveillance for ILI. However, past studies have evaluated these Web-based sources individually or dually without comparing all 3 of them, and it would be beneficial to know which of the Web-based sources performs best in order to be considered to complement traditional methods. The objective of this study is to comparatively analyze Google, Twitter, and Wikipedia by examining which best corresponds with Centers for Disease Control and Prevention (CDC) ILI data. It was hypothesized that Wikipedia will best correspond with CDC ILI data as previous research found it to be least influenced by high media coverage in comparison with Google and Twitter. Publicly available, deidentified data were collected from the CDC, Google Flu Trends, HealthTweets, and Wikipedia for the 2012-2015 influenza seasons. Bayesian change point analysis was used to detect seasonal changes, or change points, in each of the data sources. Change points in Google, Twitter, and Wikipedia that occurred during the exact week, 1 preceding week, or 1 week after the CDC's change points were compared with the CDC data as the gold standard. All analyses were conducted using the R package "bcp" version 4.0.0 in RStudio version 0.99.484 (RStudio Inc). In addition, sensitivity and positive predictive values (PPV) were calculated for Google, Twitter, and Wikipedia. During the 2012-2015 influenza seasons, a high sensitivity of 92% was found for Google, whereas the PPV for

    14. Public Relations In Strategic Management: The Case Of Metropolitan Municipalities In Turkey Stratejik Yönetimde Halkla İlişkiler: Türkiye Büyükşehir Belediyeleri Araştırması

      Directory of Open Access Journals (Sweden)

      Hasan GÜLLÜPUNAR

      2013-07-01

      Full Text Available Public relations is an application field providing management of all communication processes in institutional field. It forms management of strategic communication and a part of strategic management. In this regard, it is an important part of strategic planning process.In the study, the place of public relations in strategic management of municipality is handled in terms of strategic plans prepared by metropolitan municipalities. Strategic plans of sixteen metropolitan municipalities were analyzed by content analysis method in terms of public relations approach.The study revealed that public relations is an accepted fact in strategic planning process but it did not turn into an efficient application. Especially the following points can be mentioned as the significant ones; there is no sufficient coordination between public relations and other departments, there is no culture of working in coordination with public relations in terms of efficiency in services and increasing quality and there is no duty and responsibility given to public relations in aims and targets of strategic management.The study analyzes strategic plans of metropolitan municipalities to understand role and impact of public relations in Turkey. For this reason, the research contributes to understanding the role and significance of public relations in strategic planning processes. Because this paper is one of the initial studies done concerning strategic planning focused on public relations in Turkey. Its findings show the place of public relations in strategic management of metropolitan municipalities in Turkey. Halkla ilişkiler kurumsal alanda bütün iletişim süreçlerininyönetimini sağlayan bir uygulama alanıdır. Hem stratejik bir iletişimyönetimi hem de stratejik yönetimin bir unsurudur. Bu nedenlestratejik planlama sürecinin önemli bir parçasıdır.Çalışmada belediyelerin stratejik yönetiminde halkla ilişkilerinyeri, büyükşehir belediyeleri taraf

    15. Influenzanet: Citizens Among 10 Countries Collaborating to Monitor Influenza in Europe.

      Science.gov (United States)

      Koppeschaar, Carl E; Colizza, Vittoria; Guerrisi, Caroline; Turbelin, Clément; Duggan, Jim; Edmunds, W John; Kjelsø, Charlotte; Mexia, Ricardo; Moreno, Yamir; Meloni, Sandro; Paolotti, Daniela; Perrotta, Daniela; van Straten, Edward; Franco, Ana O

      2017-09-19

      The wide availability of the Internet and the growth of digital communication technologies have become an important tool for epidemiological studies and health surveillance. Influenzanet is a participatory surveillance system monitoring the incidence of influenza-like illness (ILI) in Europe since 2003. It is based on data provided by volunteers who self-report their symptoms via the Internet throughout the influenza season and currently involves 10 countries. In this paper, we describe the Influenzanet system and provide an overview of results from several analyses that have been performed with the collected data, which include participant representativeness analyses, data validation (comparing ILI incidence rates between Influenzanet and sentinel medical practice networks), identification of ILI risk factors, and influenza vaccine effectiveness (VE) studies previously published. Additionally, we present new VE analyses for the Netherlands, stratified by age and chronic illness and offer suggestions for further work and considerations on the continuity and sustainability of the participatory system. Influenzanet comprises country-specific websites where residents can register to become volunteers to support influenza surveillance and have access to influenza-related information. Participants are recruited through different communication channels. Following registration, volunteers submit an intake questionnaire with their postal code and sociodemographic and medical characteristics, after which they are invited to report their symptoms via a weekly electronic newsletter reminder. Several thousands of participants have been engaged yearly in Influenzanet, with over 36,000 volunteers in the 2015-16 season alone. In summary, for some traits and in some countries (eg, influenza vaccination rates in the Netherlands), Influenzanet participants were representative of the general population. However, for other traits, they were not (eg, participants underrepresent the

    16. API focuses on cleanliness, economics of fossil fuels

      International Nuclear Information System (INIS)

      Anon.

      1993-01-01

      Fossil fuels, consumed in free markets, are playing positive economic and environmental roles as the world economy becomes integrated, industry leader said last week. Environmental zealots threaten to force conversion from gasoline as a motor fuel in the U.S. and oppose the growing integration of the world economy. Fossil fuels, free markets, human creativity, and entrepreneurial spirit--not government intervention--are the keys to a clean environment, said API pres. Charles J. DiBona and outgoing Chairman C.J. (Pete) Silas, chairman and chief executive officer of Phillips Petroleum Co. DiBona said proponents of the BTU tax defeated earlier this year used erroneous assumptions to make a case against oil use in an effort to replace the efficiency of the marketplace with the inefficiency of bureaucracy. The government's role is to set tough standards and avoid dictating the way environmental standards are met, they said. Other speakers warned that voluntary measures put forward by the Clinton administration of address global climate change issues likely will fall short

    17. The transfer of radionuclides in the terrestrial environment

      International Nuclear Information System (INIS)

      Oehlenschlaeger, M.

      1991-04-01

      The transfer of radionuclides in the terrestrial environment have been investigated. The thesis is divided into two parts. Part I; Dynamic model for the transfer of radionuclides in the terrestrial environment. The study comprises the development of a compartment model, that simulates the dynamic transport of radioactive pollution in the terrestrial environment. The dynamic processes include, dry and wet deposition, soil resuspension, plant growth, root uptake, foliar interception, animal metabolism, agricultural practice, and production of bread. The ingested amount of radioactivity, by man, is multiplied by a dose conversion factor to yield a dose estimate. The dynamic properties and the predictive accuracy of the model have been tested. The results support the dynamics very well and predicitions within a factor of three, of a hypothetical accident, are likely. Part II; Influence of plant variety on the root transfer of radiocaesium. Studies of genetic differences, in plant uptake of radiocaesium, were concluded with a pot experiment. Four varieties of spring barley and three varieties of rye-grass have been tested in two types of soil. The results for barley showed a significant difference between the four varieties. Analyses of variance confirmed a high root uptake of radiocaesium in the variety Sila and a significantly lower root uptake in the variety Apex in each type of soil. The pattern between the varieties was identical in 1988, 1989 and 1990. Similarly for the grass varieties, one variety, the Italian rye grass, was identified as having the relatively highest uptake of radiocaesium. (author) 22 tabs., 30 ills., 56 refs

    18. The binding of [3H]AF-DX 384 to rat ileal smooth muscle muscarinic receptors

      International Nuclear Information System (INIS)

      Entzeroth, M.; Mayer, N.

      1991-01-01

      The tritiated cardioselective muscarinic antagonist AF-DX 384 (5,11-dihydro-11-[2-[-(8-dipropylamino)methyl]-1-piperidinyl-ethyl-amino-carbonyl]-6H-pyrido [2,3-b] [1,4]benzodiazepin-6-one) was used to label muscarinic receptors in the rat ileum. Saturation binding to membrane suspensions revealed a high affinity binding site with a Kd of 9.2 nM. The maximal number of binding sites labeled in this tissue (Bmax) is 237 fmol/mg protein. The association and dissociation kinetics were well represented by single exponential reactions, and the dissociation constant obtained from the ratio of rate constants was in agreement with that derived from saturation experiments. Specific binding was inhibited by muscarinic antagonists with a rank order of potencies of atropine (pKi: 8.80) greater than 4-DAMP (pKi: 8.23) = AF-DX 384 (pKi: 8.20) greater than AF-DX 116 (pKi: 7.09) = hexahydro-sila-difenidol (pKi: 6.97) greater than pirenzepine (pKi: 6.49) and is consistent with the interaction of [3H]AF-DX 384 with muscarinic receptors of the M2 subtype. It can be concluded that [3H]AF-DX 384 can be used to selectively label M2 muscarinic receptors in heterogeneous receptor populations

    19. New insights on Lepidoptera of Southern Italy with description of the male of Coenotephria antonii Hausmann 2011 (Lepidoptera

      Directory of Open Access Journals (Sweden)

      M. Infusino

      2017-09-01

      Full Text Available Southern Italy is of particular biogeographic interest due to the location at the center of the Mediterranean Basin and its great environmental heterogeneity. Despite the faunistic interest of this territory, many insect taxa are still little investigated. Among insects, Lepidoptera have a relatively well known fauna, significantly increased in recent years, but there are still some gaps of knowledge in several habitats. The aim of this work was to contribute to the knowledge of the Macrolepidoptera of Southern Italy, focusing our study in Calabria, and to offer some thoughts on the role played by the Mediterranean mountain forests for the biodiversity conservation. Samplings were carried out in three mountainous areas of Calabria (Pollino Massif, Sila Massif and Serre Mountains in May-November 2015 and in April-November 2016, using UV-LED light traps. We found ten species of high faunistic interest. Three species, Nebula senectaria, Perizoma lugdunaria and Acasis appensata, were for the first time recorded from Southern Italy, while seven were for the first time recorded from Calabria: Coenotephria antonii, Thera obeliscata, Triphosa dubitata, Trichopteryx carpinata, Asteroscopus sphinx, Lithophane semibrunnea and Sideridis reticulata. Of great interest was the discovery of the first male certainly attributable to Coenotephria antonii, endemic of Southern Italy, here described for the first time. The results exposed confirm that the fauna of Southern Italy is of great conservation value, hosting endemisms and several relict populations of European and Asiatic species with differentiated genetic lineages highly vulnerable to the climate change expected for the coming decades.

    20. The Evolution of the Appendectomy: From Open to Laparoscopic to Single Incision

      Directory of Open Access Journals (Sweden)

      Noah J. Switzer

      2012-01-01

      Full Text Available Beginning with its initial description by Fitz in the 19th century, acute appendicitis has been a significant long-standing medical challenge; today it remains the most common gastrointestinal emergency in adults. Already in 1894, McBurney advocated for the surgical removal of the inflamed appendix and is credited with the initial description of an Open Appendectomy (OA. With the introduction of minimally invasive surgery, this classic approach evolved into a procedure with multiple, smaller incisions; a technique termed Laparoscopic Appendectomy (LA. There is much literature describing the advantages of this newer approach. To name a few, patients have significantly less wound infections, reduced pain, and a reduction in ileus compared with the OA. In the past few years, Single Incision Laparoscopic Appendectomy (SILA has gained popularity as the next major evolutionary advancement in the removal of the appendix. Described as a pioneer in the era of “scarless surgery,” it involves only one transumbilical incision. Patients are postulated to have reduced post-operative complications such as infection, hernias, and hematomas, as well as a quicker recovery time and less post-operative pain scores, in comparison to its predecessors. In this review, we explore the advancement of the appendectomy from open to laparoscopic to single incision.