WorldWideScience

Sample records for valdek mikli priit

  1. Valdek Palli mälestusõhtu ja fond / Aili Künstler

    Index Scriptorium Estoniae

    Künstler, Aili

    2013-01-01

    Ersa-mokša kultuuriühingu Sjatko eestvedamisel ja TLÜ muuseumi kaaskorraldusel toimus TLÜ teadusinfokeskuses eesti keeleteadlase, rahvusvaheliselt tunnustatud fenno­ugristi ja TLÜ esimese emeriitprofessori Valdek Palli mälestusõhtu. TLÜs asutati professor Valdek Palli nimeline fond soome-ugri teaduse ja kultuuriprojektide toetuseks

  2. Miks olen Reformierakonnas?

    Index Scriptorium Estoniae

    2005-01-01

    Küsimusele vastavad reformierakondlased Reno Laidre, Viivi Maremäe, Ott Kasuri, Kristjan Kahm, Erika Vahtramäe, Urmas Suik, Priit Laineste, Silver Meikar, Kattri Ezzoubi, Anton Teras ja riigikogu liikmed Kristiina Ojuland, Igor Gräzin, Tõnis Kõiv ning Helmer Jõgi

  3. Projekt EDI / Priit Põdra

    Index Scriptorium Estoniae

    Põdra, Priit, 1963-

    2000-01-01

    Projekt EDI töötab välja programmisüsteemi rahvusvaheliste kaubavedude korraldamiseks, dokumentide vormistamiseks ja firmade arvutiprogrammide koostöö korraldamiseks. Projekti tutvustab AS-i EDI VEKTOR juhatuse esimees Priit Põdra

  4. Miks mitte abielluda Iwonaga / Kristel Nõlvak

    Index Scriptorium Estoniae

    Nõlvak, Kristel

    2005-01-01

    A. Tshehhonte ja A. Tshehhovi "Miks mitte abielluda?" Vanalinna Muusikamajas Theatrumi näitlejate esituses ja L. Petersoni lavastuses ning W. Gombrowiczi "Iwona, Burgundi printsess" M. Petersoni lavastuses Theatrumi saalis

  5. Priit Pärna joonisfilmid / Grete Nootre

    Index Scriptorium Estoniae

    Nootre, Grete

    2005-01-01

    Eesti Joonisfilm laskis välja neli videokassetti eesti joonisfilmidega : kaks Priit Pärna viimaste töödega ning kaks tema noorte kolleegide Priit Tenderi, Kaspar Jancise ja Ülo Pikkovi loominguga. Toodud ära ka kirjastuse "Tachen" käsiraamatu "Animation Now!" hinnang Priit Pärnale

  6. Miks, kuidas ja kellele? / Margit Tõnson

    Index Scriptorium Estoniae

    Tõnson, Margit, 1978-

    2009-01-01

    Tiit Ojasoo ja Ene-Liis Semperi "Kuidas seletada pilte surnud jänesele" teatris NO99, Priit Võigemasti "Hecuba pärast" Tallinna Linnateatris ja koreograaf-esitaja Mart Kangro "Can't Get No Satisfaction" Kanuti Gildi saalis

  7. Raadiohiiud plaanivad liitumist / Priit Simson

    Index Scriptorium Estoniae

    Simson Priit, 1977-

    2005-01-01

    Ühineda võivad Trio Grupp ja Sky Media, kuid Trio Grupi juhatuse liikme Priit Jõgi sõnul on võimalik ka ostu-müügitehing. Mõlema kontserni turuosa kommertsraadiote seas on 30-40%. Meediaõppejõu Hagi Sheini, kultuuriministeeriumi osakonnajuhataja Peeter Sookruusi arvamus

  8. Priit Võigemast: äkki mulle ei olegi rohkem antud? / Priit Võigemast ; intervjueerinud Tiiu Laks

    Index Scriptorium Estoniae

    Võigemast, Priit, 1980-

    2010-01-01

    Linnateatri näitleja Priit Võigemasti uuest lavastusest "Homme näeme" ning näitleja- ja lavastajatööst. Loetletud rollid lavastustest, filmidest, telelavastustest, tema enda lavastused ja saadud preemiad

  9. Miks Osama bin Ladenit pole siiani tabatud? / Peeter Ernits

    Index Scriptorium Estoniae

    Ernits, Peeter, 1953-

    2008-01-01

    Afganistanis viibinud ajakirjaniku eesmärgiks oli teada saada, miks vaatamata kõigile püüdlustele vägivald Afganistanis siiski ei vähene ning kus varjab ennast Al Qaeda liider Osama bin Laden. Lisad: Osama bin Laden; 11. september 2001

  10. Priit Tenderi film sai Dresdenis auhinna

    Index Scriptorium Estoniae

    2002-01-01

    Dresdeni 14. filmifestivali animafilmide kategoorias sai teise preemia Priit Tenderi joonisfilm "Mont Blanc". Peapreemia sai saksa režissööri Jonathan Hodgsoni film "Camouflage". Kolmas oli PÖFFi peaauhinna saanud Stepan Birjukovi "Sossedi". Osales ka Nukufilmis diplomitööna valminud Jelena Girlini "Guff"

  11. Priit Tenderi film võitis Norras peaauhinna

    Index Scriptorium Estoniae

    2000-01-01

    Eesti Joonisfilm "Viola" (režissöör Priit Tender) sai 7. Põhjamaade ja Balti mere äärsete riikide animafilmide festivalil Animerte Dager Fredrikstadis Norras grand prix'. Tudengifilmide seas sai esikoha Turu Kunstiakadeemia tudengi, eestlase Kaspar Jancise "Romanss" (õppejõud Priit Pärn)

  12. Priit Põldoja : "V ekonomike Estonii - interesnõi period" / Priit Põldoja ; interv. Areg Arutjunjan, Aleksandr Ikonnikov

    Index Scriptorium Estoniae

    Põldoja, Priit

    2007-01-01

    Hansapank Eesti peadirektor Hansapanga majandusprognoosist 2008. aastaks, Hansapanga laenupoliitikast, laenuintressidest, plaanidest lähitulevikuks, Rootsi ja Eesti pankade erinevustest, oma tööst ja aja planeerimisest, investeerimisportfellist, spordiga tegelemisest, meetmetest Hansapanga kollektiivi kvalifikatsiooni tõstmiseks, edukusest. Lisa: Priit Põldoja

  13. Mik1 levels accumulate in S phase and may mediate an intrinsic link between S phase and mitosis

    DEFF Research Database (Denmark)

    Christensen, P U; Bentley, N J; Martinho, R G

    2000-01-01

    . By studying the mitotic inhibitor Mik1, we have identified evidence for an intrinsic link between unperturbed S phase and mitosis. We propose a model in which S/M linkage can be generated by the production and stabilization of Mik1 protein during S phase. The production of Mik1 during unperturbed S phase...

  14. Priit Pääsukese "Must Peeter" püüab aasta filmi tiitlit

    Index Scriptorium Estoniae

    2008-01-01

    Eesti Filmiajakirjanike Ühing (EFÜ) nimetas 2008.a. filmi auhinna nominendid : Mait Laasi "Aja meistrid", Priit ja Olga Pärna "Elu ilma Gabriella Ferrita", Kadri Kõusaare "Magnus", Priit Pääsukese "Must Peeter", Marko Raadi "Toomiku film"

  15. Kodus Venus, võõrsil Mars / Priit Simson

    Index Scriptorium Estoniae

    Simson Priit, 1977-

    2007-01-01

    Autor leiab, et Eestil ei pole enam vabandusi, miks ta ei peaks hankima rasket sõjatehnikat ja miks peaks keegi teine meie õhuruumi valvama. Autor vaatleb, milline relvastus on mõnedel väikeriikidel, kelle elanike arv ei ületa 6 mln. piiri, ning järeldab, et soovides olla maailma keskmisel tasemel, võiks Eesti muretseda 65 tanki

  16. Tegevusstrateegia : miks peavad ülemused oma käed mustaks tegema / Steve New

    Index Scriptorium Estoniae

    New, Steve

    2002-01-01

    Autor selgitab, miks pole ettevõttes kasulik strateegia- ja tegevtasandit üksteisest eraldada ja tutvustab Ettevõtte Ressursside Planeerimise (ERP - Enterprise Resource Planning) süsteemi, mis eeldab strateegia ja tegevuse sidumist

  17. Kursi koolkond näitab oma töid biennaaliaegses Veneetsias / Priit Pangsepp ; interv. Tiina Sarv

    Index Scriptorium Estoniae

    Pangsepp, Priit

    2007-01-01

    Viljandi kunstniku Priit Pangsepaga Kursi koolkonna 20. aastapäeva tähistavast kunstinäitusest Galleria d'Arte III Millennios Veneetsias. Maale näitavad Priit Pangsepp, Ilmar Kruusamäe, Peeter Allik, Albert Gulk ja Priit Pajos. Näitus ei esinda biennaaliaegses Veneetsias Eestit vaid Kursi koolkonda

  18. Eesti animatsiooni lippu hoidis kõrgel Priit Tender

    Index Scriptorium Estoniae

    2005-01-01

    IX Pimedate Ööde Filmifestivali alafestivali "Animated Dreams" rahvusvahelise võistlusprogrammi grand prix' ja koos sellega kuju Puust Hunt võitis USA-s elav vene animaator Igor Kovaljov animatsiooniga "Piim". Priit Tenderi joonisfilm "Sõnum naabritele" valiti Balti- ja Põhjamaade parimaks animafilmiks, auhinnaks Anoba auhinna nominatsioon

  19. Büroo Ignite = Ignite office / Priit Põldme, Reet Sepp

    Index Scriptorium Estoniae

    Põldme, Priit, 1971-

    2013-01-01

    Büroo Ignite (Tatari 25, Tallinn) sisekujundusest. Sisearhitektid Priit Põldme ja Reet Sepp (SAB Joonprojekt). Arhitektid Heiki Taras ja Ahti Luhaäär (Arhitektibüroo Pilter ja Taras). Sisearhitekti ja ESLi aastapreemiate žürii esimehe Kaido Kivi arvamus

  20. Priit Pärna vanad hitid jõuavad taastatuna kinno / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2008-01-01

    Priit Pärna kuus joonisfilmi on digitaalselt taastatud Nkufilmi stuudios Saksa TrickWILK tehnikaga (restauraator Tõnu Talivee) ja heli osas Ants Andrease juhtimisel firmas Film Audio. Sõpruse kinos toimub eriseanss "Priit Pärn revisited" lühifilmide festivali raames 29. augustil

  1. Multifilmionu on tehtuga rahul / Priit Pärn ; interv. Rünno Saaremäe

    Index Scriptorium Estoniae

    Pärn, Priit, 1946-

    2001-01-01

    Priit Pärn eesti animafilmi olukorrast, oma tööst, 2. nov. Rakvere Keslinna galeriis avatud isikunäitusest "Pärna maailm" (30. novembrini näidatakse Rakveres Virma Dragon House'is iga päev kell 16 tema animafilme). Ottawa filmifestivalil anti Priit Pärnale ASIFA Special Award elutöö eest

  2. Ülemiste kaubanduskeskus = Ülemiste shopping center / Priit Põldme ; kommenteerinud Linda Madalik

    Index Scriptorium Estoniae

    Põldme, Priit, 1971-

    2015-01-01

    Ülemiste kaubanduskeskus Tallinnas Suur-Sõjamäe 4. Sisekujunduse autorid Priit Põldme, Reet Sepp (sisearhitektuuribüroo Joonprojekt); arhitektid Einar Aakeroy (AMB Arkitekter), Lauri Laisaar, Ingel Sirkel-Suviste, Jaanika Oks, Katrin Kõlu (Novarc Group AS). Lühidalt Priit Põldmest ja Reet Sepast

  3. Kuidas, kus ja miks kuulavad noored muusikat? / Marit Mäesalu

    Index Scriptorium Estoniae

    Mäesalu, Marit, 1981-

    2009-01-01

    Artikkel annab ülevaate empiirilise uurimistöö tulemustest. Uuringuga otsiti vastust küsimustele: kuidas, kus ja miks kuulavad tänapäeva Eesti noored muusikat, missugune on nende poolt kuulatav muusika, mida eelistatakse, mida välditakse. Küsitletavateks olid 6.-7. ja 10.-11. klassi õpilased viiest Tallinna koolist

  4. Miks Swed tahab ettevõte pankrotti? Sest pankrotivarale ostja silmapiiril - Helenius / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2011-01-01

    Autor viitab, et Väätsa Agro varade ostuhuviliste ilmumine võib olla oluline põhjus, miks Swedbank suurima tagatud nõuete omanikuna soovib Väätsa Agro pankrotti ja kiiret varade müümist ning on saneerimiskava vaidlustamisega juba riigikohtus. Firma endise omaniku Ago Lillepea hinnangul on Väätsa Agro saneeritav

  5. Miks on tõde üha suhtelisem? / Marju Himma, Jaan-Juhan Oidermaa

    Index Scriptorium Estoniae

    Himma, Marju

    2016-01-01

    Arvamusfestivalil arutasid perearst ja TÜ peremeditsiini vanemteadur Marje Oona, jurist Maarja Pild ja teadusajakirjanik Arko Olesk teemal - miks teevad inimesed infoühiskonnas, kus tõenduspõhist teavet on üha rohkem ja vabamalt kätte saada, valikuid info kasuks, mis ei ole tõendatud

  6. Priit Silla : vanglat võib nimetada täienduskursuseks, õppisin seal näiteks keeli ja ajalugu / Priit Silla ; interv. Egon Valdaru

    Index Scriptorium Estoniae

    Silla, Priit

    2008-01-01

    Vestlus Kaitseliidu Sakala maleva propagandajuhi, endise vabadusvõitleja Priit Sillaga. Sisaldab artiklit: Mees, kes väärtustab Eesti Vabariigi sündimise lugu. Kommenteerinud Jaanika Kressa ja Jaak Pihlak

  7. Priit Pärn ohjab Turus festivali / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2001-01-01

    Turu Kunstiakadeemia animatsiooniosakonda juhatav Priit Pärn lükkas eile käima I Turu animafestivali Tough Eye, kus võistleb ka kolm eesti filmi. Toimub ka Eesti päev, kus näidatakse uute tööde kõrval ka Elbert Tuganovi jt. klassikaks saanud animafilme, kaasaarvatud säilinud lõik esimesest eesti joonisfilmist "Kutsu-Juku seiklused" (1931)

  8. The Arabidopsis leucine-rich repeat receptor kinase MIK2/LRR-KISS connects cell wall integrity sensing, root growth and response to abiotic and biotic stresses.

    Science.gov (United States)

    Van der Does, Dieuwertje; Boutrot, Freddy; Engelsdorf, Timo; Rhodes, Jack; McKenna, Joseph F; Vernhettes, Samantha; Koevoets, Iko; Tintor, Nico; Veerabagu, Manikandan; Miedes, Eva; Segonzac, Cécile; Roux, Milena; Breda, Alice S; Hardtke, Christian S; Molina, Antonio; Rep, Martijn; Testerink, Christa; Mouille, Grégory; Höfte, Herman; Hamann, Thorsten; Zipfel, Cyril

    2017-06-01

    Plants actively perceive and respond to perturbations in their cell walls which arise during growth, biotic and abiotic stresses. However, few components involved in plant cell wall integrity sensing have been described to date. Using a reverse-genetic approach, we identified the Arabidopsis thaliana leucine-rich repeat receptor kinase MIK2 as an important regulator of cell wall damage responses triggered upon cellulose biosynthesis inhibition. Indeed, loss-of-function mik2 alleles are strongly affected in immune marker gene expression, jasmonic acid production and lignin deposition. MIK2 has both overlapping and distinct functions with THE1, a malectin-like receptor kinase previously proposed as cell wall integrity sensor. In addition, mik2 mutant plants exhibit enhanced leftward root skewing when grown on vertical plates. Notably, natural variation in MIK2 (also named LRR-KISS) has been correlated recently to mild salt stress tolerance, which we could confirm using our insertional alleles. Strikingly, both the increased root skewing and salt stress sensitivity phenotypes observed in the mik2 mutant are dependent on THE1. Finally, we found that MIK2 is required for resistance to the fungal root pathogen Fusarium oxysporum. Together, our data identify MIK2 as a novel component in cell wall integrity sensing and suggest that MIK2 is a nexus linking cell wall integrity sensing to growth and environmental cues.

  9. Miks inimesed töötavad? / Maria Kütt

    Index Scriptorium Estoniae

    Kütt, Maria

    2006-01-01

    Inglismaal toimunud Charter Institute of Personnel Development'i aastakonverentsil püüti leida vastust küsimusele, miks inimesed töötavad. Autor on seisukohal, et mida tihedamalt on tasustamine seotud töötaja oskuste ja isiklike eesmärkidega, seda tugevam on palga roll motiveerimisel, kuid raha tajutav väärtus on sissetulekute tõustes kahanev. Töö ja tunnustus on tähtsad eneseteostuseni jõudmiseks

  10. Priit Põldme podnimajet reiting / Ell-Maaja Randküla

    Index Scriptorium Estoniae

    Randküla, Ell-Maaja, 1939-2016

    2005-01-01

    28. X 2004. a. Eesti Sisearhitektide Liidu esimeheks valitud Priit Põldmest ja tema loomingust. P. Põldme eesti sisearhitektuuri maine tõusust Eestis, minimalismist kodukujunduses, ESL-i tulevikuplaanidest jm. 4 ill

  11. Priit Põldme tahab tõsta sisearhitektuuri mainet / Ell-Maaja Randküla

    Index Scriptorium Estoniae

    Randküla, Ell-Maaja, 1939-2016

    2004-01-01

    28. X 2004. a. Eesti Sisearhitektide Liidu esimeheks valitud Priit Põldmest ja tema loomingust. P. Põldme eesti sisearhitektuuri maine tõusust Eestis, minimalismist kodukujunduses, ESL-i tulevikuplaanidest jm. Krista Kodres P. Põldmest sisekujundajana. 4 ill

  12. Enesekuvandeist ja maailmapildist Priit Pärna filmides "Kolmnurk" ja Hotell E" / Mari Laaniste

    Index Scriptorium Estoniae

    Laaniste, Mari, 1977-

    2011-01-01

    Kõrvutatakse kaht Priit Pärna n.ö. "raskete filmide" tsükli 10-aastase vahega loodud filmi, näidates, mil moel peegelduvad linateostes nende aastate jooksul toimunud ulatuslikud muudatused nii enesekuvandis kui ka maailmapildis laiemalt

  13. Põrandakatete + ja - / Ivi-Els Schneider, Kadri - sisearhitekt Tarbe, Priit Põldme

    Index Scriptorium Estoniae

    Schneider, Ivi-Els, 1945-

    2005-01-01

    Sisearhitektid Ivi-Els Schneider, Kadri Tarbe Pärtelpoeg ja Priit Põldme sellest, millist põrandakattematerjali ja millal eelistada. Vaatluse all on naturaalne laudpõrand ja parkett, laminaatparkett, kork, lihvitud betoon, linoleum, vaipkate, keraamiline plaat, looduskivi

  14. Miks erakonnastuda? : ajakirjandus on olnud mugavuslõks ühiskondlikult mõtlevatele inimestele / Barbi Pilvre

    Index Scriptorium Estoniae

    Pilvre, Barbi, 1963-

    2009-01-01

    Autor põhjendab oma otsust loobuda ajakirjanikutööst ja liituda Sotsiaaldemokraatliku Erakonnaga. Muuhulgas viitab ta president Toomas Hendrik Ilvesele, kes "Minu Eesti" kampaania ajal küsis, miks Eestis kodanikud sisenevad avalikku ellu niiöelda tagaukse kaudu, mitte aga otseteed kasutades ehk juba olemasolevate parteide kaudu

  15. Miks ma end ära ei tapa : [luuletused] / Paul-Eerik Rummo

    Index Scriptorium Estoniae

    Rummo, Paul-Eerik, 1942-

    2001-01-01

    Tekst eesti ja inglise k. P.-E. Rummo lühibiograafia eesti ja inglise k. lk. 131. Sisu: Miks ma end ära ei tapa = Why I don't kill myself ; "Maailm mu hinge ei tungind, vaid imbus..." = "The world did not invade my soul, it seeped into it..." ; "Taevas on kummargil üle maa..." = "The sky stoops over the earth..." ; "Nüüd anna jumal jaksu joosta juhuste sajus..." = "Now grant me God the strength to run through the rains of chance..." ; Jälle, jälle, jälle, jälle, jälle... = Again again again again again ; "maailm mille lõpp on mõeldav..." = "a world whose end is conceivable..." ; Kinni hoidmas = Clinging ; Poolüminal = Crooning

  16. Vastutustundlik käitumine annab ka rahalist kasu / Jana Kelus, Priit Koff ; intervjueerinud Urve Vilk

    Index Scriptorium Estoniae

    Kelus, Jana

    2009-01-01

    Vastutustundliku ettevõtluse 2009. aasta edetabelis esimesele kohale tulnud Tallinna Vee kvaliteedi- ja keskkonnasüsteemi juht Jana Kelus ning ettevõtte kommunikatsioonijuht Priit Koff vastavad küsimustele, mis puudutavad vastutundlikkuse tähendust ettevõtte jaoks ning soovitusi neile ettevõtetele, kes veel vastutustundlikkusele ei mõtle

  17. Millises olukorras on teie linna lasteaiad? / Jane Mets, Kristi Aavakivi, Priit Metsjärv ... [jt.

    Index Scriptorium Estoniae

    2012-01-01

    Küsimusele vastavad Pärnu abilinnapea Jane Mets, Võru linnavalitsuse haridusspetsialist Kristi Aavakivi, Tartu linnavalitsuse ehitusteenistuse juhataja Priit Metsjärv, Viljandi abilinnapea Ardo Agasild, Rakvere abilinnapea Ain Suurkaev ja Valga linna haridus- ja kultuuriameti juhataja Anneli Rants

  18. Uudiste lõpp ehk kuidas Facebook ajakirjanduse alla neelas / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2016-01-01

    Priit Hõbemägi refereeris Cambridge ülikooli professori ja Columbia ajakirjanduskooli digitaalse ajakirjanduse keskuse direktori Emily Belli meedia­maailmas laineid löönud kõnet sotsiaalmeedia ettevõtete mõju kasvust uudiste levitamise ja sellega raha teenimise üle

  19. Eesti mehed panid maja rääkima / Raivo Raestik, Priit Vimberg ; interv. Einar Ellermaa

    Index Scriptorium Estoniae

    Raestik, Raivo

    2008-01-01

    Firma Yoga Intelligence poolt välja töötatud kinnisvara haldussüsteemi lahendusest, kus majade kütet, ventilatsiooni, mõõdikute kauglugemist, elektri-, turva- ja läbipääsusüsteeme juhitakse ühe süsteemiga. Küsimustele vastavad Raivo Raestik ja Priit Vimberg

  20. Tumeda animatsiooni surm Euroopas : Priit Pärna "Hotell E" / Andreas Trossek

    Index Scriptorium Estoniae

    Trossek, Andreas, 1980-

    2011-01-01

    Vaadeldakse, kuidas M. Gorbatšovi võimuletuleku aastail esilekerkinud sotsiaalkriitilisemate filmide trend Eesti animatsioonis kulmineerub ja ühtlasi lõpeb Priit Pärna joonisfilmiga "Hotell E" (1992) - filmis on kombineeritud endisele Ida-Euroopale iseloomulik sotsialismivastane võimukriitika igatseva ihaga alati virtuaalsena tajutud lääne suunas

  1. Precise integration of inducible transcriptional elements (PrIITE) enables absolute control of gene expression

    DEFF Research Database (Denmark)

    Pinto, Rita; Hansen, Lars; Hintze, John Birger Hjalmar

    2017-01-01

    to be a limitation. Here, we report that the combined use of genome editing tools and last generation Tet-On systems can resolve these issues. Our principle is based on precise integration of inducible transcriptional elements (coined PrIITE) targeted to: (i) exons of an endogenous gene of interest (GOI) and (ii...

  2. Dokumentaalfilm "Maile Grünbergi värvilised maailmad" = "Maile Grünberg's colourful worlds": a documentary / Karin Paulus, Priit Põldme

    Index Scriptorium Estoniae

    Paulus, Karin, 1975-

    2015-01-01

    Sisearhitekt Maile Grünbergist ja 2014. aastal temast valminud dokumentaalfilmist "Maile Grünbergi värvilised maailmad". Režissöör Peeter Brambat, tegevprodutsent Priit Põldme, käsikiri Karin Paulus, Peeter Brambat, Priit Põldme. 2014. aasta Kultuurkapitali Arhitektuuripreemia kandidaat

  3. Precise integration of inducible transcriptional elements (PrIITE) enables absolute control of gene expression

    Science.gov (United States)

    Pinto, Rita; Hansen, Lars; Hintze, John; Almeida, Raquel; Larsen, Sylvester; Coskun, Mehmet; Davidsen, Johanne; Mitchelmore, Cathy; David, Leonor; Troelsen, Jesper Thorvald

    2017-01-01

    Abstract Tetracycline-based inducible systems provide powerful methods for functional studies where gene expression can be controlled. However, the lack of tight control of the inducible system, leading to leakiness and adverse effects caused by undesirable tetracycline dosage requirements, has proven to be a limitation. Here, we report that the combined use of genome editing tools and last generation Tet-On systems can resolve these issues. Our principle is based on precise integration of inducible transcriptional elements (coined PrIITE) targeted to: (i) exons of an endogenous gene of interest (GOI) and (ii) a safe harbor locus. Using PrIITE cells harboring a GFP reporter or CDX2 transcription factor, we demonstrate discrete inducibility of gene expression with complete abrogation of leakiness. CDX2 PrIITE cells generated by this approach uncovered novel CDX2 downstream effector genes. Our results provide a strategy for characterization of dose-dependent effector functions of essential genes that require absence of endogenous gene expression. PMID:28472465

  4. The MIKS (Member Integrated Knowledge System) Model: A Visualization of the Individual Organizational Member's Role When a Knowledge Management System Is Utilized in the Learning Organization

    Science.gov (United States)

    Grobmeier, Cynthia

    2007-01-01

    Relating knowledge management (KM) case studies in various organizational contexts to existing theoretical constructs of learning organizations, a new model, the MIKS (Member Integrated Knowledge System) Model is proposed to include the role of the individual in the process. Their degree of motivation as well as communication and learning…

  5. Kas Priit Pedajase Kõivu-lavastuste piirid on endiselt avarad või hakkavad juba ahistama? / Valle-Sten Maiste

    Index Scriptorium Estoniae

    Maiste, Valle-Sten, 1972-

    2006-01-01

    Madis Kõivu näidendite tõlgendamisest Priit Pedajase lavastustes, aluseks lavastus "Finis nihili" Eesti Draamateatris. Vaadeldakse ka Pedajase Kõivu-lavastuste retseptsiooni. (Aare Pilve artikkel TMK, 2005, nr. 3 ; Luule Epneri artikkel rmt-s "Madis Kõivu mõttelistes maailmades"). Kasut. kirjandus, lk. 55

  6. Director läks ja küsis / Indrek Randveer, Evelyn Karming, Priit Palk ... [jt.

    Index Scriptorium Estoniae

    2010-01-01

    EMT teenindus- ja müügidirektor Indrek Randveer, Estraveli müügidirektor Evelyn Karming, ABC King/Nero/SHU/Suurtüki turundusjuht Anne-Liis Ostov, kohvik-restoran Crepp juhataja Priit Palk ja Sokos Hotel Viru kommunikatsioonijuht Peep Ehasalu vastavad küsimustele, mis puudutavad nende kogemusi keerukate ja absurdsete kliendikaebuste kohta

  7. Frakiga dirigendist värske road-movie peategelaseks / Artur Talvik, Priit Valkna ; interv. Mihkel Niglas

    Index Scriptorium Estoniae

    Talvik, Artur, 1964-

    2007-01-01

    Dokumentaalfilm "Vastutuulesaal" Tõnu Kaljuste poolt Naissaarele Nargen Opera saali ehitamisest. Produtsent ja idee autor Artur Talvik, režissöör Priit Valkna räägivad filmi saamisloost. Lisaks "Teised Tõnu Kaljustest" : Arvo Aun ja Allan Vurma

  8. Kalevi suuraktsionärid Kruuda ja Kotkas tülis / Oliver Kruuda, Priit Kotkas ; interv. Toivo Tänavsuu

    Index Scriptorium Estoniae

    Kruuda, Oliver, 1967-

    2003-01-01

    Priit Kotkase sõnul sõlmib Oliver Kruuda Kalevi juhatajana aktsionäride huvide vastaseid lepinguid oma isiklike ettevõtmiste toetamiseks. Oliver Kruuda sõnul on Priit Kotkas oma firma kaudu Eesti küpsiseid müües võtnud eesmärgiks Kalevi kaubamärgi kahjustamise ja ettevõtte jõuga ülevõtmise.Graafik, diagramm: Kalevi kasum suureneb

  9. Draamateatris müüakse pähkleid, aga ükski ei taha osta / Priit Pedajas ; interv. Aap Egorov

    Index Scriptorium Estoniae

    Pedajas, Priit, 1954-

    1999-01-01

    Eesti Draamateatris Madis Kõivu näidend "Kui me Moondsundi Vasseliga kreeka pähkleid kauplesime, siis ükski ei tahtnud osta", lavastaja Priit Pedajas, kunstnik Pille Jänes, osades Ita Ever, Andrus Vaarik, Ain Lutsepp, Rein Oja, Laine Mägi, Kersti Kreismann jt. Esietendus 9. juunil

  10. Meie "oma" Unabomber - kes ta on? / Valdek Kiiver

    Index Scriptorium Estoniae

    Kiiver, Valdek

    2005-01-01

    1995. a. tabasid USA võimud riiki 17 aastat kirjapommidega terroriseerinud kurjategija, keda kutsuti Unabomberiks. Theodore Kaczynsky (Unabomberi) tegevusest ja tabamisest. Vt. samas: Oklahoma, 1995. Timothy McVeigh kui Oklahoma föderaalkohtuhoones plahvatuse organiseerija

  11. Sünteetiline lähenemine on edu pant / Tamara Luuk, Olga Pärn, Priit Pärn ; intervjueerinud Reet Varblane

    Index Scriptorium Estoniae

    Luuk, Tamara, 1952-

    2011-01-01

    Brügges kuni jaanuari lõpuni 2011 eksponeeritud belgia kunstniku Luc Tuymansi kureeritud näitusest "Madalaima tasandi reaalsus. Visioon Kesk-Euroopast" ("The Reality of the Lowest Rank. A Vision of Central Europe"). Osalema oli kutsutud 43 kunstnikku üle maailma. Priit Pärn Eestist esines söejoonistuste ja filmilõikudega näitusel ning eraldi filmiprogrammiga

  12. Esmamuljed maaülikoolist / Kristi Kägu, Ülle Ütsik, Priit Veeroja, Simon Soll...[jt.] ; küsitlenud Sirje Pärismaa

    Index Scriptorium Estoniae

    2008-01-01

    Küsimusele, kuidas on möödunud esimesed nädalad, vastasid Maaülikooli esmakursuslased: majandusarvestuse ja finantsjuhtimise erialalt Kristi Kägu, ökonoomika ja ettevõtluse erialalt Ülle Ütsik, veemajanduse erialalt Priit Veeroja, maastikuarhitektuuri erialalt Simon Soll, kinnisvara planeerimise erialalt Merlin Henning ja liha- ja piimatehnoloogia erialalt Liina Politanova

  13. Fasulye (Phaseolus Vulgaris L.) yetiştiriciliğinde hümik asit, mikrobiyal gübre ve fosfat kayası uygulamalarının verim ve verim öğelerine etkisi

    OpenAIRE

    ÖZAKTAN, Hamdi

    2017-01-01

    Deneme, 2015 ve 2016 yılları üretim sezonunda Erciyes Üniversitesi Tarımsal Araştırma ve Uygulama Merkezi’ne ait merkez kampüs arazilerinde yürütülmüştür. Deneme tesadüf bloklarında bölünen bölünmüş parseller deneme desenine göre 4 tekerrürlü olarak ve Göynük 98 kuru fasulye (Phaseolus vulgaris L.) çeşidi kullanılarak kurulmuştur. Denemede ana parsellere dekara 2 kg hesabıyla hümik asit (2 uygulama), alt parsellere Bacillus pumilus C26 fosfat çözücü özelliğe sahip mikrobiyal gübre (2...

  14. Matemaatikas paremad ... Miks? / Tiit Lepmann

    Index Scriptorium Estoniae

    Lepmann, Tiit

    2002-01-01

    TÜ matemaatika didaktika õppetool korraldas uurimuse 1996.a. õppekavale üleminekust matemaatikas. 1998.a. mais anketeeriti eesti õppekeelega koolide 7.-10. klassi matemaatikaõpetajaid, 1999.a. korraldati sama küsitlus vene õppekeelega koolides. Küsimused olid jaotatud viide rubriiki: töötingimused, õppekava, õpetuse sisu, meetodid. Tasemetööde ja riigieksamite tulemuste põhjal on vene koolide õpilased matemaatikas eesti õpilastest sageli üle, ehkki õpetuse sisu ja taotlused on samad. Selgitati, mille poolest erinevad eesti ja vene õppekeelega koolide matemaatikaõpetajate harjumused uue materjali esitamisel, selle kinnistamisel, õpilaste teadmiste kontrollimisel ning kodutööde andmisel

  15. Miks halvustada konkurenti? / Timo Riismaa

    Index Scriptorium Estoniae

    Riismaa, Timo

    2006-01-01

    Konkureeriva ettevõtte toodete halvustamisest. ThermiSol OÜ ja Saint Gobain Isover Eesti AS-i vahelisest kohtuasjast. Vt. ka: Kas Eesti tootjad halvustavad üksteise tooteid? Küsimusele vastavad Reiden Plaat AS-i müügijuht Aldo Unga, OÜ V-Temps juhataja Aare Võsu ja Saint-Gobain Isover Eesti AS-i marketingijuht Hellart Kala

  16. Miks tippjuhid nurjuvad? / Mart Raudsaar

    Index Scriptorium Estoniae

    Raudsaar, Mart, 1973-

    2003-01-01

    Majandusajakirja Fortune poolt 2000. aastal koostatud "tähelepanuväärseimalt" ebaõnnestunud tegevjuhtide edetabelis sisaldus kolm arvutifirma Apple tegevdirektorit. Autor kirjeldab John Sculley, Michael Spindleri ja Gil Amelio vigu ettevõtte juhtimisel. Lisa: Otsitakse tippjuhti!

  17. "Miks, kägu, sa mäe peal seal kukkumas käid ..." ; "Pikk on tee. Küla taga, kus aas ...." ; "Milleks sulle mu armastust vaja on veel ..." ; "Terve päev nii möödub üha ..." ; "Väike tütarlaps mõnusalt suplemas jões ..." ; Maasikad ; Mesila

    Index Scriptorium Estoniae

    Romanov, Vladimir

    2004-01-01

    Sisu: "Miks, kägu, sa mäe peal seal kukkumas käid ..." ; "Pikk on tee. Küla taga, kus aas ...." ; "Milleks sulle mu armastust vaja on veel ..." ; "Terve päev nii möödub üha ..." ; "Väike tütarlaps mõnusalt suplemas jões ..." ; Maasikad ; Mesilaste keel. Eluloolisi andmeid autori kohta lk. 371. Luuletused paralleelselt udmurdi ja eesti keeles

  18. Paldiskis alustasid töö kaotanud inimesed näljastreiki / Valdek Kiiver

    Index Scriptorium Estoniae

    Kiiver, Valdek

    2005-01-01

    Paldiski suurim tööandja Baltic Lumber and Moulding, endise nimega TKE Grupp, lõpetas tootmise, jättes kahesajale inimesele välja maksmata poole aasta palga. Liimpuidutehase endised töötajad kuulutasid välja näljastreigi

  19. Tutvustustuur keskraamatukogudes / Priit Kasepalu

    Index Scriptorium Estoniae

    Kasepalu, Priit

    2010-01-01

    Lugemisaasta raames 30. augustist 2. septembrini 2010 korraldatud ringreisil tutvustasid MTÜ Kakora puuteraamatuid ja Eesti Pimedate Raamatukogu oma tegevust ning filateeliakogu "Nägemata nähtud maailm" Narva, Jõhvi, Võrumaa ja Põlva keskraamatukogus

  20. Plaadid / Priit Juurmann

    Index Scriptorium Estoniae

    Juurmann, Priit

    2006-01-01

    Uutest heliplaatidest Alexkid "Caracol", Bob Dylan "Modern Times", Justin Timberlake "Future Sex", Ilves, Pulk ja Rahman "Murõt ei olõ", Audioslave "Revelations", Bill Frisell "Bill Frisell, Ron Carter, Paul Motian", Julie & Khari "Moon Bossa"

  1. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Muusikauudiseid maailmast. Suurejooneline "Heidelbergi kevad", Kaheteistkümnes "Jauna Muzika", Pühendus Peter Maxwell Daviesele, "Kaks ööd ja kaks päeva" Odessas, "Ohren auf Europa", Siemensi preemia Henri Dutilleux'le, Aulis Sallinen 70, Stanley Sadie lahkunud

  2. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2004-01-01

    Mihkel Pollpälvis XVIII Rina Sala Gallo rahvusvahelisel pianistide konkursil esikoha. Igal reedel hakkavad toimuma Vanalinnastuudio väikeses saalis jazziklubi-kontserdid. Vanemuise teatri menumuusikalis "Viiuldaja katusel" astusid esmakordselt vaatajate ette uued osatäitjad. Ardo-Ran Varres ja Tanel Jonas. Pärdil uus teos "Da pacem domine". 28.- 31. X toimuvad Nõmme muusikakoolis üleriigilised klaveriõpetajate päevad

  3. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    EFK salvestab Pärdi "Miserere", "Salve Regina", Nunc dimittis" ja "Littlemore tractus". Georg Otsa nimelise fondi moodustamisest. Pärimusmuusika Lõikuspeost. 24. - 29. IX esineb Eestis Kieli poistekoor. 15. IX avas peadirigent Olari Elts oma Läti Rahvusliku Sümfooniaorkestri uue hooaja. Heli Veskus on kutsutud esinema Läti Rahvusooperi galakontserdile

  4. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2006-01-01

    Eesti Raadio valis aasta muusikuks 2005 Olav Ehala. Hando Nahkur pälvis Toronto Eesti Kunstide Keskuse Kuldteenetemärgi sooloesinemise eest EKK 30. aastapäeva pidulikul kontsertaktusel. 13. I toimib sarjas "Diplomaatilised noodid" Mustpeade majas kontsert vene muusikast. 13. I esitavad EFK, Tallinna Kammerorkester ja solistid Tõnu Kaljuste juhatusel Tallinna Metodisti kirikus kava "Pärt ja Mozart". Eesti jazziliit alustab taas kontserte NO99 väikeses saalis

  5. Plaadid / Priit Pruul

    Index Scriptorium Estoniae

    Pruul, Priit

    2006-01-01

    Uutest heliplaatidest Herbie Hancock "The Essential Herbie Hancock", "Feel The Beat", Tom Petty "Highway Companion", "Richard Dorfmeister vs Madrid de los Austrias", James Dean Bradfield "The Great Western", Gladys Knight "Before Me", "Pirates of the Caribbean"

  6. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    TMKK lastekoor võitis konkursi "Let the Peoples Sing". Pille Lille Muusikute Toetusfond korraldab Pärnu Eliisabeti kirikus kontserdi sarjas "Meistrite akadeemia". Kanuti Gildi saalis esineb kontserdisarjas "Diplomaatilised noodid / Türgi" ansambel Istanbul Sazelender. Paul Mägi juhatas USAs Detroidi Sümfooniaorkestrit. Neeme Järvi tõi New Jersey SOga publiku ette hooaja kolm avakava. Tüüri teoste ettekandeist

  7. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Wolfgang Wagner loobub Bayreuthi festivalist, "Towards the Millennium" Londonis, Kammerkontserdite mammutsari Põhja-Rhein-Westfaali liidumaal, Kreneki päevad Viinis, Leipzigi ooperi järgmine hooaeg

  8. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2007-01-01

    Kevadfestival Budapestis. "Musica Nova" Helsingis. Ensemble Intercontemporain 30. Uudiseid ISCMilt (International Society for Contemporary Music). Philadelphia Muusikaakadeemia 150. Preemiaid ja tunnustusi

  9. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2004-01-01

    3. - 21. XII toimub ooperifestival "Jõulutähed". Malle Maltis võitis "Musica nova 2004" raames peetud konkursil II preemia. Neeme Järvi tegemistest. "Wien Moder" festivalil dirigeeris Eri Klas Viini Raadio Sümfooniaorkestrit. XIV rahvusvahelisel advendi- ja jõulumuusika konkursil Prahas saatis Eesti koore edu. 27. XI tähistati Pärnus Eesti Meestelaulu Seltsi noorte meeskooride tegutsemise 5. aastapäeva

  10. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Lühisõnumid: Rahvusooperi Estonia 2004. aasta, Eduard Oja 100. sünniaastapäeval juubeliüritused toimuvad Tartus ja Tallinnas, soome-rootsi reklaamväljaanne Highlights tutvustab Veljo Tormise suurtsüklite "Eesti kalendrilaulud" ja "Looduspildid" uustrükiseid, pianist Klarika Kuusk esitas Stockholmi Eesti Majas detsembris mitmeid eesti heliteoseid, EMA kammersaalis toimub Melbourne'i Keelpilliorkestri kontsert

  11. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    La Scalaga ei olda enam rahul, Dresdenis tuli lavale Richard Straussi ooper "Ariadne Naxoselt", uus orkestriteos John Adamsilt, Müncheni muusikabiennaali uudiseid, suri üks rahvusvahelise kooriliikumise silmapaistvamaid tegelasi

  12. Plaadid / Priit Juurmann

    Index Scriptorium Estoniae

    Juurmann, Priit

    2006-01-01

    Uutest heliplaatidest Daft Punk "Musique Vol 1", Madlib the Beat Conducta "Movie Scenes 1-2", Dudley Perkins "Expressions", Tartu Popi ja Roki Instituut "Madise margikogu", Secret Machines "Ten Silver Drops", graham Coxon "Love Travels At Illegal Speeds", Mark Knopfler "All The RoadRunning"

  13. Plaadid / Priit Juurmann

    Index Scriptorium Estoniae

    Juurmann, Priit

    2004-01-01

    Uutest heliplaatidest "Pure Fire!", Kelis "Kelis Was Here", Marsmobil "Minx", Kosmikud "Pulmad ja matused", The Rapture "Pieces Of The People We Love", The Killers "Sam's Town", The Panic Channel "One"

  14. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2004-01-01

    Eltsi debüüt London Sinfoniettaga. 19.- 20. XI toimub muusikaakadeemias RAMi 60. aastapäevale pühendatud rahvusvaheline konverents "Meeskoorilaul ja XX sajandi muusikaelu". Novembris tähistab Georg Otsa nimeline Tallinna Muusikakool oma 85. aastapäeva. EMA kitarriüliõpilane Jelena Ossipova osales Hollandis Zwolle kitarrikonkursil. 13. XI oli Lasnamäe muusikakoolis muusika- ja kunstikoolide õpilaste omaloomingupäev

  15. Plaadid / Priit Pruul

    Index Scriptorium Estoniae

    Pruul, Priit

    2006-01-01

    Uutest heliplaatidest Tutty Moreno ft Joyce "Magica", Five O'Clock Heroes "Bend to the breaks", The Game "Doctor's Advocate", Allan Vainola "Unenäopüüdja", Snax "Love pollution", Zhuut "Vagiina ja 49 kuuli", Lucie Silvas "The Same Side"

  16. Plaadid / Priit Juurmann

    Index Scriptorium Estoniae

    Juurmann, Priit

    2006-01-01

    Uutest heliplaatidest Markus Enochson "Night Games ئ In Steps And Sequences", Up Hygh "The Venus Album", Oasis "Stop the Clock", The Who "Endless Wire", Ray Lamantagne "Trouble", Take That "Beautiful World", Danolo Venturi "La Perla: Noir"

  17. [Festivalid] / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2010-01-01

    Lühidalt festivalidest: Salzburgi festival (25. juuli - 30. aug.), Wagneri festival Bayreuthis (25. juuli - 28. aug.), Luzerni festival (12. aug. - 18. sept.). Bostoni sümfooniaorkester Tanglewoodis (9. juuli - 29. aug.)

  18. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2009-01-01

    Lühidalt Mozartwoche'st Salzburgis, Londoni Sümfooniaorkestri uuest hooajast, maailmaesiettekandest Pariisi Rahvusooperis (Philippe Boesmansi uusooper "Yvonne, Burgundia printsess"). Loetelu Eesti muusika esitustest ja muusikute esinemistest maailmalavadel

  19. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Muusikauudiseid maailmast: 15. Austraalia kammermuusika festivalist; Peterburi "Valgete ööde festivalist"; Johannesburgis toimunud festivalist "NewMusicSA"; Kuhmo kammermuusika festivalist; Sapporos 9. juulil algavast festivalist "Pacific Music Festival"; Aspeni muusikafestivalist; Kyoto Prize määramisest N. Harnoncourt'ile; C. M. Giulani surmast

  20. ESK aastakoosolek / Priit Aruvald

    Index Scriptorium Estoniae

    Aruvald, Priit

    2005-01-01

    Eesti Sihtkapital Kanadas pidas 27. aprillil 2005 oma koosolekut Toronto Eesti Majas, esitati aruanded, räägiti rahalistest toetustest, stipendiumidest, uuest tegevuskavast. Esimeheks valiti tagasi Lia Hess

  1. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Irina Zahharenkova võitis 11. IX esikoha Bukaresti XVII rahvusvahelisel pianistide konkursil "Remember Enescu". Vanemuise teater gastroleerib 15. - 17. IX Helsingis Soome Rahvusooperis tantsulavastusega "Armastuse tango" ja ooperiga "Madame Butterfly". Eesti Naislaulu Selts korraldab 17. IX mitu üritust emeriitprofessori koorijuht Ants Söödi 70. sünnipäeva tähistamiseks. MTÜ Tartumaa Rahvakultuuri Keskselts korraldab 17. ja 18. IX festivali "Regiöö". 21. IX esinevad Tartu ülikooli aulas kontserdisarjas "Meistrite akadeemia" Anna-Liisa Bezrodny ja Ivari Ilja. Anu Tali dirigeerib 9. - 18. IX taas Jaapanis. Agentuur Corelli Music avab koos Eesti Klavessiinisõprade Tsunftiga kontserdihooaja "Ajaloo ilu - Johann Sebastian Bach". Sibeliuse festivalist Lahtis. Paavo Järvi avab oma uue hooaja Cincinnati SO peadirigendina. Helsingin Sanomat avaldas pikema intervjuu Olari Eltsiga. Nargen Operalt kontsertetendus "Armida".

  2. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Sõnumeid muusikamaailmast: "Wien Modern 2005". Ooper Norra vabaduse tähtpäevaks. Aasta hinnatumad Saksa ooperis. Cecilia Bartoli maailmaturnee. Anne-Sophie Mutter Mozarti aastaks. Uusi dirigendilepinguid. Preemiaid ja tunnustusi

  3. Arvustused / Priit Kenkmann

    Index Scriptorium Estoniae

    Kenkmann, Priit

    2007-01-01

    Heliplaatidest: Mayhem "Ordo Ad Chao", Minotauri "II", Loits "Must album", Mithras "Behind The Shadows Lie Madness", Poison The Well "Versions", Conspiracy "Reincarnated", April "Tidelines", Devin Townsend "Ziltoid The Omniscient", Beggars Ball "Fight This Town", Breed "Breed", Black Witchery "Desecration of the Holy Kingdom", Blood Tsunami "Trash Metal", Vintersorg "Solens Rötter", HND "PatuRaamaT", W.A.S.P. "Dominator", Megadeth "United Abominations", Manowar "Gods of War", Dimmu Borgir "In Sorte Diaboli", Despised Icon "The Ills of Modern Man", Trouble "Simple Mind Condition", The Esoteric "Subverter", Orange Goblin "Healing Through Fire", Marduk "Rom 5:12", Nicole "Sivu syyttömistä", Korpiklaani "Tervaskanto", Gaia Epicus "Victory", Lumsk "Det Vilde Kor"

  4. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Muusikauudiseid maailmast: Festivalidest "Musica Nova" Helsingis, "Maerzmusik" Berliinis; ansambli Haydn Trio tegemistest; Lazar Mermani, Marcello Viotti surmast; uue muusika festivalidest "Archipel", "Klangvisionen", "Merging Voices"

  5. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Milano La Scala alustas hooaega. "Ameerika tragöödia" New Yorgi Metis. Huddersfieldi festivalilt. Ricard Straussi päevad Dresdenis. Viiuldajate konkurss Helsingis. Haruldasi leide. Tunnustusi ja preemiaid

  6. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2006-01-01

    Uus muusika Huddersfieldis. "Musikhost" Odenses. Kolm tabelit parimatest (10 suurimat Chopini-pianisti, Euroopa parimad sümfooniaorkestrid, maailma 10 parimat saali). Konkursivõite ja tunnustamisi. La Scala avas hooaja. Uusooper jõulukünnisel Metis

  7. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2011-01-01

    Lühisõnumeid muusikamaailmast: Gramophone auhind aastal 2011. Daniel Barenboim La Scala muusikadirektoriks. Lera Auerbachi loomingu esmaettekandeid sügisel. Valmis Ameerika sümfooniate uus diskograafia. Tanel Joamets tutvustab "Põhjamaa piltides" Tubina muusikat

  8. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Lätis jagati kõrgeimaid muusikalisi autasusid, Deliuse ooper esietendus Glasgow's, Helsingi linnaorkester tuuril, Salzburgi Mozarti nädala laureaatidest ja Schönbergi ooperi "Mooses ja Aaron" esiettekandest Metropolitanis

  9. Eripreemia Priit Tenderile

    Index Scriptorium Estoniae

    2000-01-01

    Eesti Joonisfilmi film "Viola" võitis VIII Hiroshima rahvusvahelisel animafilmide festivalil žürii eripreemia. Peapreemia sai Kanada "When the Day Breaks" : režissöörid Wendy Tilby ja Amanda Forbis

  10. Plaadid / Priit Pruul

    Index Scriptorium Estoniae

    Pruul, Priit

    2006-01-01

    Uutest heliplaatidest Miles Davis "Cool & Collected", Rhythm Doctor "Tulgu malakas", Scissor Sisters "Ta-Dah", "Toatuur", Teriyaki Boys "Beef or Chicken", Mana "Amar es combatir", Papa Roach "The Paramour Session"

  11. Pessimistlik Portugal / Priit Kivi

    Index Scriptorium Estoniae

    Kivi, Priit

    2005-01-01

    Suure hoobi Portugali majandusele on andnud paljude välismaiste tööstusettevõtete kolimine odavama tööjõuga riikidesse ning kohalike ettevõtjate passiivsus uute tehnoloogiliste seadmete rakendamisel. Vähenenud on Portugali eksport, riik on kaotamas tuntust turismimaana

  12. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2004-01-01

    EMA muusikateaduste osakonna uurimisprojektist "Muusikaelu Eestis XX sajandi algupoolel". Algab sari "Noored pianistid I - VII". Kristjan Järvi suvelõpp ja sügis. Rahvusooper Estonia otsib peaosatäitjat ooperisse "Väike Napoleon". Andres Mustonen toob 24. IX Eestisse V. Silvestrovi "Reekviemi" ja V. Martõnovi "Klaverikontserdi" teise maailmaettekande. Modern Fox '38 esitles oma uut plaati "Oober"

  13. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Lühidalt muusikasündmustest Eestis: Kuressaares toimuvast Läänemere festivalist ja kammermuusikafestivalist, Lääne-Viru kammerfestivalist, Leigo järvemuusikal toimuvast "Suurte masinate muusikast"

  14. Future classics / Priit Kruus

    Index Scriptorium Estoniae

    Kruus, Priit, 1981-

    2005-01-01

    Sisust: 1.1 Kõusaar - protagonist of a bestseller ; 1.2 Henno, a positive double ; 1.3 Angst filter Jürgen Rooste 1.4 Child-like Wimberg ; 2.1 The Estonian Finnegans Wake : [Berk Vaher's Lugulaul] ; 2.2 Agent Smith : [Mihkel Samarüütel] ; 2.3 A saviour against his will : [Mehis Heinsaar] ; 2.4 Flight : [Heiti Kender] ; 3.1 Viiding's hate and Keil's pain ; 3.2 Kind hearted nerd and beautiful babe : [Jan Kaus, Kerttu Rakke

  15. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Muusikasündmustest Eestis: Improvizz'05, Jazz'n Motion, muusikafestivali "Eduard Tubin ja tema aeg" pressikonverents, laulumäng "Suur Munamägi" Estonia kammersaalis, modernismi pidunädal Tartu Elleri koolis

  16. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2007-01-01

    Lühidalt uvistest tippfestivalidest Ameerikas ja Euroopas (Aspeni muusikafestival, Central City Opera suvefestival, Santa Fe kammerfestival, Santa Fe ooperifestival, Vail Valley festival "Bravo", Salzburgi festival, Bayreuthi Wagneri Festival, Verona ooperifestival, Prantsuse Raadio Festival, Ljubljana festival)

  17. Plaadid / Priit Juurmann

    Index Scriptorium Estoniae

    Juurmann, Priit

    2005-01-01

    Uutest heliplaatidest Nicole Willis and The Soul Investigators "Keep Reachin' Up", Pricess Superstar "My Machine", The Darkness "One Way Ticket To Hell...And Back", System Of A Down "Hypnotize", Röövel Ööbik "Supersymmetry", Fort Minor "The Rising Tied", Korn "See You On The Other Side"

  18. Eksootikat suusatajaile / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2013-01-01

    Worldloppeti sõitude koordinaatori ametit pidav Epp Paal uudistas sarja ihkavaid suusamaratone Kangaroo Hoppetit Austraalias Falls Creekis ja Merino Musteri maratoni Uus-Meremaal. Tabel: Uued eksootilised suusamaratonid Worldloppeti sarjas

  19. Miks pole Keskerakond punk? / Mart Niineste

    Index Scriptorium Estoniae

    Niineste, Mart, 1983-

    2010-01-01

    Autor taunib Keskerakonna noortekogu juhatuse pungiteemaliste särkide aktsiooni Stenbocki maja ees ning toob näite selle kohta, et Keskerakond ei ole punk. Igasugune subkultuuri elementide või sõnumite usurpeerimine asjasse mittepuutuvate inimeste pooolt on küüniline ja labane, ütleb autor

  20. Miks rahvas ajakirjandust ei usalda? / Toomas Alatalu

    Index Scriptorium Estoniae

    Alatalu, Toomas, 1942-

    2001-01-01

    Järgneb: Kesknädal, 6. sept. 2001, lk. 8; 12. sept. 2001, lk. 8; 19. sept. 2001, lk. 8; 26. sept. 2001, lk. 8; 3. okt. 2001, lk. 8; 10. okt. 2001, lk. 8. Väliskapitali omandis ja kolmikliidu teenistuses meedia mures tuleviku pärast

  1. Maksud muutuvad. Miks ja kuidas? / Ivari Padar

    Index Scriptorium Estoniae

    Padar, Ivari, 1965-

    2007-01-01

    Ilmunud ka: Põhjarannik, 15. mai 2007, lk. 2; Severnoje Poberezhje, 15. mai 2007, lk. 2; Võrumaa Teataja, 15. mai 2007, lk. 2; Sõnumitooja, 16. mai 2007, lk. 2; Virumaa Teataja, 16. mai 2007, lk. 11; Vali Uudised, 16. mai 2007, lk. 2; Pärnu Postimees, 16. mai 2007, lk. 15; Meie Maa, 16. mai 2007, lk. 2; Järva Teataja, 17. mai 2007, lk. 2; Vooremaa, 17. mai 2007, lk. 2; Lõunaleht, 17. mai 2007, lk. 2; Kuulutaja, 18. mai 2007, lk. 4; Nädalaleht, 18. mai 2007, lk. 4; Valgamaalane, 22. mai 2007, lk. 2; Lääne Elu, 26. mai 2007, lk. 2. Rahandusminister Ivari Padar valitsuse kavatsusest tõsta mitme kauba aktsiisimaksu ning leevendada järgmise nelja aasta vältel Eesti elanike tulumaksukoormust enam kui 7 miljardi krooni võrra

  2. Miks film Potterist on nii menukas?

    Index Scriptorium Estoniae

    2001-01-01

    Joanne Rowling'u lasteraamatu "Harry Potter ja Tarkade kivi" ekraniseeringu "Harry Potter and the Philosopher's Stone" ülimenuka esilinastuse põhjuste üle avaldavad arvamust Potteri raamatute eesti keelde tõlkija Krista Kaer ja filmikriitik Karlo Funk

  3. Miks astume tarastamise teed? / Herbert Vainu

    Index Scriptorium Estoniae

    Vainu, Herbert, 1929-2011

    2004-01-01

    Kapitalismi ja sotsialismi positiivseid jooni ühitava konvergentsiteooria asendumisest sotsiaalseid aspekte mittearvestava algkapitalismiga Eestis ja teistes Euroopa Liidu riikides. Inglise tarastamissüsteemist kui eeskujust

  4. Miks ma armastan naisi? / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2008-01-01

    Vene naismemuaristidest Nina Berberovast ja Irina Odojevtsevast. N. Berberova kirjutatud Maria Zakrevskaja-Benckendorff-Budbergi eluloost "Kassi hing" (Tallinn : Vagabund, 2007) ning tema põhiteosest "Kursiv moi"

  5. Aga miks mitte panustada teraviljale? / Tarvo Vaarmets

    Index Scriptorium Estoniae

    Vaarmets, Tarvo

    2007-01-01

    Üha populaarsust koguvate ETFide ehk börsil kaubeldavate fondide hulka on lisandunud ka viimaste variatsioonid ETCd ehk börsil kaubeldavad toorained, nende perspektiivikust tõstab tarbimise kasv maailmas. Tabel: Millistel börsidel tehakse tehinguid ETF-idega

  6. Miks mitte parima hariduskorraldusega riigiks? / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2006-01-01

    Ilmunud ka: Pärnu Postimees, Meie Maa, Virumaa Nädalaleht 1. sept. lk. 15,2,13, Põhjarannik, Severnoje Poberezhje 2. sept. lk. 2, Valgamaalane, Järva Teataja, Virumaa Teataja, Võrumaa Teataja, Vooremaa 5. sept. lk. 2,2,11,2,2, Sõnumitooja 6. sept. lk. 2, Hiiu Leht 12. sept. lk. 2. Autori sõnul peaks majanduslike eesmärkide asemel esikohale asetama haridusalased eesmärgid, selleks pakub ta välja omapoolsed lahendused

  7. Miks Res Publica kaotas / Juhan Parts

    Index Scriptorium Estoniae

    Parts, Juhan, 1966-

    2004-01-01

    Ilmunud ka: Severnoje Poberezhje, 29. juuni 2004, lk. 2; Koit, 29. juuni 2004, lk. 6. Europarlamendi valimiste tulemused erakonnale Res Publica. Juhan Partsi kõne 26. juunil Pärnus toimunud Res Publica volikogul. Lühendatult

  8. Miks paisub Avignon viis korda? / Andres Keil

    Index Scriptorium Estoniae

    Keil, Andres, 1974-

    2006-01-01

    Avignoni teatrifestivali OFF-programmist. Pikemalt Bernard-Marie Koltési näidendi "La nuit juste avant les forets" lavastusest (trupp Compagnie Pourquoi) ja lavastusest "Mascarade" (trupp Viva La Commedia)

  9. Miks nahk sügeleb

    Index Scriptorium Estoniae

    2008-01-01

    Briti teadlaste rühm koos kolleegidega Brasiiliast, Lõuna-Aafrika Vabariigist ja Jaapanist uurisid nahahaigust, mille puhul sügelus on väga sage - perekondlikku primaarset naha amüloidoosi. Lisa: Mida saab sügeluse vastu kodus teha

  10. Miks pole Eestis edukat keskklassi? / Heimar Lenk

    Index Scriptorium Estoniae

    Lenk, Heimar, 1946-

    2005-01-01

    Riigikogu liikme sõnul pole Eesti häda mitte rikaste rikkuses, vaid selles, et meil pole välja kujunenud keskklassi. Eestis puudub keskklass seetõttu, et rahvas on majanduslikult liialt kihistunud, tugevalt paremale kaldu poliitika on soodustanud vaid kitsa kildkonna rikastumist

  11. Miks nad niimoodi teevad? / Erika Sari

    Index Scriptorium Estoniae

    Sari, Erika

    2007-01-01

    Kultuuride erinevusi käsitlevast Gert Jan Hofstede raamatust "Kultuuri uurides", mis aitab mõista lapsi, kes tulevad meie kooli teisest kultuurikeskkonnast, keda on kasvatatud meist erinevalt ja mida autor soovitab ajaloo- ja ühiskonnaõpetuse õpetajana ka kolleegidele

  12. Miks peetakse elu maal halvaks? / Ants Laansalu

    Index Scriptorium Estoniae

    Laansalu, Ants, 1938-2011

    2005-01-01

    Eesmärgiga selgitada, kas maaelu tervikuna läheb inimesele korda ja mida peaks riik selles vallas tegema, uurisid uurimiskeskus Factum ja Suhtekorralduse OÜ tänavu veebruaris Põllumajandusministeeriumi tellimusel maaelu mainet. EL-i põllumajandusministrite 2004. a. 5.-7. septembrini toimunud arutelu tulemustest maaelu mainega seotud küsimustes

  13. Miks ta nii teeb? / Kristiina Voolaid

    Index Scriptorium Estoniae

    Voolaid, Kristiina

    1999-01-01

    Kuidas mõtleb ruumikujundaja, kui ta valib vorme, värve, materjale ja esemeid? Sisearhitekt Kristiina Voolaid seletab oma mõtteid Kawe Plaza hoones asuvate Hüvitusfondi ja Werol Tehased kontorite ning noorele perekonnale sisustatud vanalinnakorteri näitel

  14. Eesti muusikud Pariisis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2006-01-01

    Mais esines Pariisis Notre-Dame'i kirikus organist Aare-Paul Lattik, juunis oli rahvusvahelisel Saint-Denis' festivalil Paavo Järvi juhatusel esitusel Gustav Mahleri teine sümfoonia "Ülestõusmine" (mida aprillis New Yorgi Riverside'i kirikus juhatas Neeme Järvi), kahel festivali lõpukontserdil esines Eesti Filharmoonia Kammerkoor. 5. juulil toimus Pärnus David Oistrahhi festivalil raames Paavo Järvi juhatusel ERSO kontsert (orkestri kontsertmeistriks külalisena oli viiuldaja Kirsti Kuusk Helsingborgist)

  15. Muusikamaailm : Muusikat Londonist / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Muusikasündmustest Londonis : Händeli festivalist, uue muusika festivalist "State of the Nation", festivalist "Böömi muusika kevad", V.Spivakovi sooloõhtust, I.Oistrahhi 70. sünnipäeva kontserdist, Royal Festival Halli 50. aastapäeva galakontserdist, V.Bellini ooperist "I Capuleti e i Montecchi" Kuningliku Ooperi laval

  16. Muusikamaailm : Tipphetked kontserdimajades / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    New Yorgis Carnegie Hallis esinesid Berliini filharmoonikud. Bostoni sümfooniaorkester alustas hooaega dirigent Seiji Ozawa juhatusel. Tokyo Bunka Kaikani saalis andis kontserte Baieri Riigiooper peadirigent Zubin Mehta juhatusel.Amsterdamis Concertgebouws tuli maailmaesiettekandele John Adamsi orkestrioopus. Dresdenis toimusid XV uue muusika päevad. Londonis Barbicani keskuses tutvustai UKs Karlheinz Stockhauseni elektronmuusika retrospektiivi.Ruhrimaa linnades korraldataval a capella koorifestivalil esineb ka Madalmaade Kammerkoor Tõnu Kaljuste juhtimisel.Segovia 32. kammermuusikafestivalil oli sündmuseks 83-aastase itaalia-ameerika viiuldaqja Ruggiero Ricci esinemine. Vilniuses toimunud nüüdismuusika festivalil "Gaida" esineb ka NYYD Ensemble Olari Eltsi juhatusel

  17. Praemium Imperiale 2002 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Preemia said: saksa kunstnik Sigmar Polke, itaalia skulptor Giuliano Vangi, inglise arhitekt Norman Foster, šveitsi filmirežissöör Jean-Luc Godard, saksa laulja ja dirigent Dietrich Fischer-Dieskau

  18. Praemium Imperiale laureaadid / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2006-01-01

    Japan Art Association'i preemia (110000 eurot) said pianist Martha Argerich, balletilavastaja ja -trupijuht Merce Cunningham, maalikunstnik Robert Ryman, skulptuuride eest Issey Miyake ja arhitekt Yoshio Taniguchi

  19. Minge mobiiliga metsa! / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2012-01-01

    Mobiilse orienteerumise kodulehelt mobo.osport.ee saab nutitelefoni laadida tasuta rakendusprogrammi, mis võimaldab telefoniga kasutada orienteerumiskaarte ning lugeda kontrollpunktides olevaid QR ruutkoode. Eesti Terviserajad ja Eesti Orienteerumisliit plaanivad tänavu paigutada mobo-tähised ligi 30 terviserajale

  20. Uus kontserdisaal Roomas / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Rooma uus muusikamaja on valmis. Kevadel avatud kahele saalile lisandus Santa Cecilia Muusikaakadeemia peasaal. Auditooriumi nime kandva kultuurikeskuse viimase osana valmib amfiteatritaoline vabaõhusaal. Arhitekt Renzo Piano

  1. Laidoneri marss 2005 / Priit Silla

    Index Scriptorium Estoniae

    Silla, Priit

    2005-01-01

    2004. aastal Kaitseliidu Sakala maleva pealiku kapten Mehis Borni poolt algatatud tavast - rännakust "Laidoneri marss" - kindral Johan Laidoneri sünniaastapäeva tähistamiseks. Ülevaade 2005. aasta rännakust

  2. Miks kaheksakümnendad? Miks kadunud? = Why the eighties? Why lost? / Sirje Helme

    Index Scriptorium Estoniae

    Helme, Sirje, 1949-

    2010-01-01

    Nõukogude võimu ja sotsialistliku realismi kui ideoloogia lõpukümnendist Eesti kunstielus, kus vormi hakkas omandama erilaadne oludega kohanduv ja kohanev kunstimudel. Paralleelarengutest lääne kunstiga loobuti. Muutuste põhiolemuseks oli erinevate kunstiliikide ümberpositsioneerumine - maalikunst kaotas oma liidripositsiooni, esile kerkisid noored arhitektid, disainerid, sisekujundajad, tarbekunstnikud

  3. Laktoosittomien maitotaloustuotteiden myynti kasvaa - Mikä on suosion salaisuus?

    OpenAIRE

    Etula, Ella

    2012-01-01

    Valio toi laktoosittomat maitotaloustuotteet markkinoille 2000-luvun alussa. Valikoiman laajentuessa vuosien varrella minulla heräsi ajatus opinnäytetyön tekemisestä aiheesta. Opinnäytetyön tietoperusta käsittelee keskeisiä määritelmiä, kuten laktoosia, laktoosi-intoleranssi ja maitoallergiaa. Tämän jälkeen työ keskittyy vähälaktoosisten ja laktoosittomien tuotteiden historiaan sekä Suomessa että ulkomailla. Sen jälkeen keskitytään laktoosittomien maitotaloustuotteiden kehitykseen vuosina...

  4. Eesti riigi regionaalpoliitika ehk Miks elu koondub Tallinna / Taimo Saan

    Index Scriptorium Estoniae

    Saan, Taimo

    2001-01-01

    Eesti rahvastik on koondunud Harjumaale, Ida-Virumaale ja Tartumaale. Regionaalpoliitika tasakaalustamise võimalusi. Tabel: Raha jagunemine maakonniti. Ilmunud ka: Severnoje Poberezhje : Subbota, 18. aug. 2001, lk. 2; Hiiu Leht, 24. aug. 2001, lk. 6; Nädaline, 25. aug. 2001, lk. 4; Vooremaa, 28. aug. 2001, lk. 2; Pärnu Postimees, 29. aug. 2001, lk. 2; Meie Maa, 29. aug. 2001, lk. 2

  5. Miks siis Arco Vara ikkagi pudenes? / Ralf-Martin Soe

    Index Scriptorium Estoniae

    Soe, Ralf-Martin

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 19. dets. lk. 8. Viljar ja Arti Arakase lahkumine Arco Varast on äriringkondades tekitanud erinevaid arvamusi. Vt. samas: Arakas: ma ei tea, kas ma müün; Roose: müüme 40 000 aktsiat. Diagramm: Arco Vara omanikud

  6. Voolab küll, aga miks? / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2002-01-01

    Kaks Teet Kase tantsulavastust : 21. oktoobril Tallinna Linnateatri Taevalaval tantsu- ja multimeediaetendus "Shadowgraph" ja Tartu Sadamateatris 17. oktoobril tantsulavastus "Fluxus", milles on kasutatud Erkki-Sven Tüüri teoseid

  7. Miks Coca-Cola enam ei kihise? / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2004-01-01

    Autor teeb USA äriajakirjanduse põhjal ülevaate Coca-Cola Company maine, turupositsiooni ja aktsiakursi langemise põhjustest alates 1997. aastast. Analüütikute sõnul on korporatsioon olnud ebaedukas tippkaadri voolavuse, sisekonfliktide, pidevate ümberkorralduste ja töötajate koondamiste tõttu. Praegune peadirektor Neville Isdelle on püstitanud eesmärgiks firma sisekultuuri parandamise, et keskenduda liidripositsiooni kindlustamisele turul. Diagramm: Karastusjookidel gaas väljas. Vt. samas: Coca-Cola ja Pepsi - üheskoos alla

  8. Videomuinasjutt algastme eesti keele tundi : miks ka mitte? / Ene Peterson

    Index Scriptorium Estoniae

    Peterson, Ene

    2002-01-01

    Rets. : Tungal, Leelo. Videomuinasjutt "Printsess Mari ja konn Konrad" [Videosalvestis] = A fairytale on video "Princess Mari and frog Konrad". - Tallinn : Elav Teadus, 1993. - 1 videokassett (VHS) (120 min) + 1 raamat (32 lk.)

  9. Teadmistepõhise Eesti poole - miks ja kuidas? / Olav Aarna

    Index Scriptorium Estoniae

    Aarna, Olav, 1942-

    2004-01-01

    Autori sõnul on ühiskonnas kujunemas selge arusaam, et rahvusliku innovatsioonisüsteemi osaks oleval haridussüsteemil on arengumudeli muutmisel täita võtmeroll. Graafik: Eesti arengustsenaariumid. Tabel: Eesti haridusstsenaariumid

  10. Rahvaraamatukogu seadus muudetud. Miks see vajalik oli? / Meeli Veskus

    Index Scriptorium Estoniae

    Veskus, Meeli, 1953-

    2007-01-01

    1. mail 2007 jõustunud rahvaraamatukogu seaduse muutmise seadusest, rahvaraamatukogu ülesannete täpsustamisest seoses töökeskkonna muutumisega, raamatukogu juhtimise ja juhi haridusnõuete muutmisest

  11. Kellele ja miks on vaja õpimotivatsiooni? / Sirje Piht

    Index Scriptorium Estoniae

    Piht, Sirje, 1962-

    2004-01-01

    Ankeetküsitlusest, mis viidi läbi Lääne- ja Hiiumaa esimese kooliastme 45 õpetaja hulgas: õpetajapoolne õpimotiivide loomine ja toetamine; erinevate õpikogemuste pakkumine; õppemeetodite mitmekesisus

  12. Miks mõned meeskonnad toimivad paremini? / Urve Vilk

    Index Scriptorium Estoniae

    Vilk, Urve

    2008-01-01

    Meredith Belbini teooria järgi jagunevad töötajad üheksa meeskonnarolli esindajateks. Tüpaazhide õige kombineerimine meeskonnas tagab selle efektiivse toimimise. Vt. samas: Belbini üheksa meeskonnarolli

  13. Miks parasiit ei sünnita? / Mart Jesse

    Index Scriptorium Estoniae

    Jesse, Mart

    2006-01-01

    Autor väidab teiste riikide kogemustele tuginedes, et kõige positiivsemalt mõjutab iivet ennekõike ligipääs sõimekohtadele. Kui riik soovib iivet positiivselt mõjutada, peaks ta investeerima koolieelsetesse lasteasutustesse või tagama koduse hoidja kulude katmise

  14. Miks on Savisaar ja proua Bush Birma kallal / Mai Loog

    Index Scriptorium Estoniae

    Loog, Mai, 1960-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 29. mai lk. 7. Birma sõjaväeline valitsus otsustas taas pikendada aasta võrra Nobeli rahupreemia laureaadi ja demokraatliku opositsiooni liidri Aung San Suu Kyi 11-aastast koduaresti, mille vastu astusid välja USA senaatorid presidendiproua Laura Bushi juhtimisel kui ka Tallinna linnapea Edgar Savisaar koos Pariisi ja Rooma linnapeadega. Birma hunta plaanitavast konstitutsioonist, kus aatomienergia on pandud riigikaitse ja julgeoleku alla. Venemaa aatomienergia agentuuri Rosatomi lepingust Birma huntaga aatomienergia tootmiseks

  15. Miks IBM müüb kroonijuveeli? / Valdo Randpere

    Index Scriptorium Estoniae

    Randpere, Valdo, 1958-

    2004-01-01

    Kuna konkurents on väga tihe, siis IBM loobub väikese marginaaliga personaalarvutite ärist ning keskendub serveritele ja keerukatele ärilahendustele. Lisa: IBM müüb personaalarvutite divisjoni hiinlastele

  16. Fed ulatas abikäe. Miks? / Romet Kreek

    Index Scriptorium Estoniae

    Kreek, Romet, 1972-

    2011-01-01

    Euroopa Keskpank, Suurbritannia, Jaapani ja Šveitsi keskpank saavad Föderaalreservilt oma valuutade vastu dollareid, mida nad saavad oma maa pankadele edasi laenata. Autor märgib, et ainus põhjus, millega saaks nüüdset Föderaalreservi otsust põhjendada, oli vajadus tegutseda ennetamaks järgmist Lehman Brothersi tüüpi kriisi

  17. Ka vesi mikserisse? Miks mitte! / Marko Kass ; kommenteerinud Arne Tuhkur

    Index Scriptorium Estoniae

    Kass, Marko, 1980-

    2015-01-01

    Maailmas võidab tuntust kompaktsöötmine, mis tähendab, et täisratsioonilisele segasöödale lisatakse täiendav kogus vett ning sööta segatakse söödamikseris intensiivselt ühtlase tugeva seotud massi saamiseni. Taani professori Niels Bastian Kristenseni uurimuse kogemus

  18. Lauri, miks Sul lapsi ei ole? / Endel Susi

    Index Scriptorium Estoniae

    Susi, Endel-Haljand, 1940-

    2006-01-01

    Rahvaliidu Lääne Ühenduse juhatuse esimehe Endel Susi vastukaja Lauri Luige artiklile "Saagu meid palju ja elagem kaua!" 6. juuni "Lääne Elus", kus ta otsib alternatiive negatiivse iibe pidurdamiseks

  19. Börsile? Miks ka mitte! / Gea Velthut-Sokka

    Index Scriptorium Estoniae

    Velthut-Sokka, Gea, 1977-

    2004-01-01

    Infotehnoloogiakaupade hulgimüügifirma TD Baltic kavandab börsile minekut, et teenida raha Venemaa turule laienemiseks. Diagramm: TD Baltic ootab üle 15% kasvu. Lisa: Kuidas Computer 2000 Eestist TD Baltic sai. Kommentaarid Äripäeva toimetajalt Tõnis Ojalt ja konkureeriva arvutifirma GNT Eesti tegevjuhilt Anti Kuivalt

  20. Miks kohus keelas "Magnuse" näitamise? / Tiina Jõgeda

    Index Scriptorium Estoniae

    Jõgeda, Tiina, 1962-

    2008-01-01

    Kadri Kõusaare film "Magnus" on Harju maakohtu otsusega saanud seitsmeaastase avaldamis- ja levitamis keelu nii Eestis kui ka väljaspool. Lisatud väljavõtted kohtuniku seisukohast "Inimväärikus on kõige tähtsam"

  1. Miks on joonestamine vajalik? / Rein Mägi

    Index Scriptorium Estoniae

    Mägi, Rein

    2002-01-01

    Joonestamise kui õppeaine vajalikkusest, selle huvitavamaks muutmisest ja täiustamisest. Tallinna Tehnikagümnaasiumi õpilaste hinnanguid joonestustundide kohta, mille käigus läbisid nad ka arvutigraafika kursuse

  2. Kes oli Litvinenko? Miks ta tapeti? Kes Tappis? / Merit Kask

    Index Scriptorium Estoniae

    Kask, Merit

    2007-01-01

    Andrei Nekrassovi ja Olga Konskaja dokumentaalfilmist "Vastuhakk: Litvinenko juhtum" ("Rebellion: The Litvinenko Case"/"Bunt. Delo Litvinenko") : Suurbritannia - Venemaa 2007. Filmi näidati Cannes'i festivalil

  3. Miks mu meel on enne saabuvaid valimisi murelik? / Raivo Vare

    Index Scriptorium Estoniae

    Vare, Raivo, 1958-

    2007-01-01

    Autoris tekitavad valimislubadused kõhedust, sest erakondade valimisprogrammid ei anna vastust, kust ja kuidas kavatsetakse raha lubaduste täitmiseks leida. Autor käsitleb Lars Christenseni ja Lars Rasmusseni analüüsi Ida-Euroopa majanduslikust seisust, mille kohaselt kuuluvad Balti riigid, sh Eesti, nende riikide kategooriasse, kus on suur oht majanduslikule ja finantsilisele stabiilsusele

  4. Miks Soome lehmad lüpsavad rohkem? / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2007-01-01

    Soome lehmad andsid mullu Eesti lehmadest keskmiselt 1600 kg rohkem piima. Kommenteerivad: Põlva Agro OÜ juhatuse esimees Kalev Kreegipuu, EPKK juhatuse liige Olav Kreen, Põllumajandusministeeriumi põllumajandusturu korraldamise osakonna juhataja Mai Talvik. Vt. samas: Võrdlevat statistikat Soome ja Eesti piimatootmise kohta

  5. Miks 80% neist, kes tulemuspalka kasutavad, rahul ei ole

    Index Scriptorium Estoniae

    2004-01-01

    Palgasüsteemide konsultant, Gowri päevasärkide tehase direktor Mart Kirsipuu ja palgamaksja Aavo Kokku arutlevad teemal tulemuspalk ning palgasüsteemid ettevõttes. Lisad: Motivaatorid, mis panevad inimesed tublisti tööle. Mis on Hay palgasüsteem. Vt. samas: Indrek Orro. Mis on äririski palk?; Kaspars Kaulinsh. Kui firmal läheb halvasti, peavad kannatama ka töötajad

  6. Endise USA vastuluuraja naasmine / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2008-01-01

    USA poliitikateaduste professorist Christopher L. Kukest, kes käesoleval õppeaastal töötab Fulbright Scholar programmi stipendiaadina Tartu Ülikoolis. Lisa: CV. Kommenteerib Tartu Ülikooli riigiteaduste instituudi doktorant Mihkel Solvak

  7. Muusikamaailm : Rahvusvahelised festivalid juulis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Rahvusvahelistest festivalidest juulis: Glyndebourne'i festival Inglismaal, Ravinia festival USA-s, Tanglewoodi festival USA-s, Bad Hersfeldi festival Saksamaal, Aspeni festival USA-s, Verona ooperifestival "Arena"l", Zürichi festival ₂veitsis, Müncheni ooperifestival, Savonlinna ooperifestival, Drottingholmi lossifestival

  8. Milano La Scala suleb uksed / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    1770ndail ehitatud Milano La Scala teatrimaja suleti kaheks aastaks ümberehitusteks ja renoveerimiseks. Milano eeslinnas Bioccas avati Vittorio Gregotti arhitektuuribüroo projekti järgi ehitatud uus teatrimaja Teatro degli Arcimboldi, mis pärast La Scala avamist jääb külalistruppide jaoks

  9. Kolm Saussure'i / Priit Põhjala

    Index Scriptorium Estoniae

    Põhjala, Priit, 1982-

    2011-01-01

    Käsitletakse ja võrreldakse Saussure'i kui "Üldkeeleteaduse kursuse" autorit, kui õppejõudu, kes kajastub õpilaste loengumaterjalides ja kui tõelist Saussure'i, nagu ta ilmneb iseenda ülestähendustes

  10. Pop / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2008-01-01

    Heliplaatidest: Tony Joe White "Deep Cuts", Ray LaMontagne "Gossip In The Grain", Mogwai "The Hawk Is Howling", Kaiser Chiefs "Off With Their Heads", Static-X "Cannibal Killers Live", Hector Zazou "Corps Electriques", Hector Zazou & Swara "In the House of Mirrors", "Ladyhawke", "Friendly Fires"

  11. Raamatukogud kujundavad suhtumist / Maire Killar ; Priit Kasepalu

    Index Scriptorium Estoniae

    Killar, Maire

    2009-01-01

    Pimedate punktkirja looja Louis Braille 200. sünniaastapäeva tähistati ka Eestis. Eesti Pimedate Raamatukogus oli 26. septembrist 31. oktoobrini avatud näitus "Raamatud sõrmedele ja kõrvadele", Viljandi Linnaraamatukogus toimus 7. oktoobril nägemispuudega lugejate konverents

  12. Plaadid / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2006-01-01

    Uutest heliplaatidest Neil Siamond "12 Songs", The Bamboos "Step It Up", Van Morrison "Pay The Devil", Mystery Jets "Making Dens", In Extremo "Raue Spree 2005", "Bossa n' Marley", Liv Kristine "Enter My Religion", Ugly Ducling "Bang The Buck", "Big Boi Presents", Youngblood Brass Band "Is That A Riott", Tosca "Souvenirs", Azymuth "Pure", Eels "With Strings", "Metal For The Masses"

  13. Muusikamaailm : Rahvusvaheliste festivalide juuni / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    22.05-27.06 toimuvast Saint Louisi ooperifestivalist USA-s. Charlestoni festivalist Itaalias 28.05-13.06. Saksamaal toimuvast Halle festivalist 4.-13.06. 5.-26.06 toimuvast Hollandi festivalist. 9.06-3.07 toimuvast San Francisco festivalist USA-s. Garsingtoni ooperipidustustest 14.06-11.07. Peterburis toimuvast "Valgete ööde" festivalist 17.06-1.07. 18.06-4.07 toimuvast Granada festivalist. Orkney Islandsis toimuvatest Peter Maxwell Davise pidustustest 18.-23.06

  14. Pärmiseen kui Metuusala / Priit Ennet

    Index Scriptorium Estoniae

    Ennet, Priit

    2008-01-01

    Lõuna-California ülikooli biogerontoloog Valter Longo ja tema kolleegid lülitasid tavalise pagaripärmi rakkudes kaks geeni välja ja pärmi eluiga pikenes kümme korda. Nüüd uuritakse, kas meetod võib töötada ka inimesel

  15. Järjekordne riigikaitselaager noortele / Priit Silla

    Index Scriptorium Estoniae

    Silla, Priit

    2004-01-01

    Tänavune riigikaitse õppelaager korraldati 24.-29. maini ja 31. maist kuni 5. juunini. Sakala maleva staabis käsitleti eestlaste vastupanu sõdades ning okupatsioonide ajal, kaitsepoliitika aluseid ja põhisuundi, Kaitseväe ja Kaitseliidu ülesandeid ning struktuuri, riigikaitsealaseid seadusi, kaitseväe määrusikke

  16. Plaadid / Virko Pirrus, Urmas Piht, Priit Kenkmann

    Index Scriptorium Estoniae

    Pirrus, Virko

    2008-01-01

    Uutest heliplaatidest My Dying Bride "An Ode To Woe", Hollenton "Opus Magnum", Hail Of Bullets "...Of Frost And War", Obtest "Gyvybes Medis", Krisiun "Southern Storm", Belphegor "Bondage Goat Zombie", Esoteric "The Maniacal Vale"

  17. Plaadid / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2006-01-01

    Uutest heliplaatidest Bruce Springsteen "We Shall Overcome", Langoth "Grounding", Tool "10000 Days", Pet Shop Boys "Fundamental", "Wicked Jazz Sounds 2", Terminaator "Nagu esimene kord", Jamie Foxx "Unpredictable"

  18. World Press Photo'98 / Priit Brennel

    Index Scriptorium Estoniae

    Brennel, Priit

    1998-01-01

    Pressifoto ülemaailmsest konkursist ja aastaringselt järgnevatest üritustest, mida korraldab World Press Photo Foundation (peakorter Amsterdamis) 1955. aastast. 1998. a. peapreemia - France Pressi fotograafi Hocine'i töö 23. septembri ööl toimunud massimõrvast Alžeerias, Benthalas. Eestist osalesid Tiit Räis, Viktor Vesterinen.

  19. USA ajakirjanikud mustavad Eesti ravimiuuringuid / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2011-01-01

    Ajakirjas Vanity Fair ilmunud Donald L. Barlett'i ja James B. Steele artiklist "Tapjad ravimid", milles väidetakse, et suured farmaatsiafirmad teevad Tartus inimeste peal ravimikatseid, saades tulemusi, mis firmasid rahuldab, kuna uuringute järelevalve on väidetavalt puudulik. Ravimiameti peadirektori asetäitja Alar Irs ei nõustu väidetega. Diagramm

  20. Keskastmejuht - pigem juht kui tippspetsialist / Priit Kivinurm

    Index Scriptorium Estoniae

    Kivinurm, Priit

    2007-01-01

    Keskastmejuhtidel, kes tunnevad end olevat nagu kahe tule vahel, soovitab autor muuta oma arusaama enda positsioonist organisatsioonis, võtta hoiak, et keskastmejuht on oma valdkonna juht nii oma ülemuse kui ka oma alluvate ees

  1. Plaadid / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2006-01-01

    Uutest heliplaatidest "Songbook. 20 Classic Standards", Apocalyptica "Amplified", Orson "Bright Idea", Angels & Airwaves", Bodies Without Organs "Halcyon Days", Korn "Live & Rare", "She Wants Revenge"

  2. Plaadid / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2006-01-01

    Uutest heliplaatidest Aimla, Arder, Agan, Mälgand "Mu süda, ärka üles", Cane 141 "Moon Pool", Slide-Fifty "The Way Ahead", Ozzy "Under Cover", "The Chronicles of Narnia", Johnny Panic "The Violent Dazzling", Hilary Duff "Most Wanted"

  3. Plaadid / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2005-01-01

    Uutest heliplaatidest e.s.t. "Viaticum", "Harry Potter and The Goblet of Fire", Rammstein "Rosenrot", The Cardigans "Super Extra Gravity", Courtney Pine "Resistance", "Il Divo", Madonna "Confessions on a Dance Floor"

  4. Võimatu saab võimalikuks / Priit Ennet

    Index Scriptorium Estoniae

    Ennet, Priit

    2008-01-01

    Hetkeline ümberpaiknemine ja nähtamatus võivad tõeks saada juba lähematel aastakümnetel, kaugemas tulevikus realiseerub ka ajaränd. Need on vaid mõned paljudest ennustustest, mille USA füüsikateoreetik Michio Kaku käib välja oma värskes raamatus "Võimatuse füüsika"

  5. Homme algab Eesti festivalisuvi / Priit Pruul

    Index Scriptorium Estoniae

    Pruul, Priit

    2006-01-01

    Suvel Eestis toimuvatest muusikafestivalidest Rabarock 2006, Maailmaküla (muusikafestival), Hard Rock Laager 2006 (vabaõhufestival), Juu Jääb 2006 (retromuusikafestival), Sun Dance Music Festival, Plink Plonk (sõltumatu muusika festival), Viljandi pärimusmuusika festival 2006

  6. Kas Huntington oli prohvet? / Priit Simson

    Index Scriptorium Estoniae

    Simson Priit, 1977-

    2008-01-01

    Autor käsitleb Samuel Huntingtoni teese ning leiab, et tegelikult Huntington ei pakkunud õigustust islamiriikide ründamisele, vaid pigem hoiatas tsivilisatsioonide siseasjusse sekkumise, tekkida võiva ahelreaktsiooni eest, kus üks tsivilisatsiooni liige tõmbab sõtta ka teise

  7. Plaadid / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2006-01-01

    Uutest heliplaatidest "Wolfmother", Futureheads "News and Tributes", Sonic Youth "Rather Ripped", tanel Padar & The Sun "100% rock'n'roll", The Raconteurs "Broken toy Soldiers", neil Young "Living With War", Moloko "Catalogue", Nelly Furtado "Loose", Busta Rhymes "Big Bang", "R2 Live. Vol 1", Tiesto "In Search Of Sunrise", "Moon Taxi", Zero 7 "The Garden"

  8. Tuleviku Tartu trumpab konkurente kultuuriga / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2003-01-01

    Noppeid Tartu linnavalitsuse osakonnajuhatajate tulevikunägemustest ja tänastest probleemidest. Arvamust avaldavad: Urmas Ahven, Raivo Mändmaa, Rein Haak, Malle Blumenau, Katriin Fisch-Uibopuu, Meida Griin

  9. Plaadid / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2006-01-01

    Uutest heliplaatidest George Benson "The Essential George Benson", Roy Orbison "The Essential Roy Orbisson", K.D. Lang "Reintaration", Blondie "Greatest Hits", Chris Isaak "Best Of Chris Isaak", Barry Manilov "The Essential Barry Manilow", ABBA "Greatest Hits"

  10. Eesti muusika saksa leksikonis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Saksa muusikaleksikonist "Die Musik in Geschichte und Gegenwart", mis sisaldab teavet ka Eesti ja eesti muusika kohta, seal esinevatest vigadest. Ettevalmistatavast leksikonist "Who's Who in Estonian Music"

  11. Dolly looja pettub tehtus / Priit Ennet

    Index Scriptorium Estoniae

    Ennet, Priit

    2007-01-01

    Ajaloolise kloonlamba Dolly loonud Shoti teadlane Ian Wilmut ei kavatse edaspidi enam embrüoid kunstlikult valmistada ja loobub seega uurimissuunast. Intervjuus ajalehele Daily Telegraph tunnistab Wilmut, et Jaapani teadlaste avastatud konkureeriva meetodiga on inimese embrüonaalseid tüvirakke loodetavasti palju lihtsam toota

  12. Plaadid / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2005-01-01

    Uutest heliplaatidest Neil Young "Prairie Wind", Sigur Ros "Takk...", Paul McCartney "Chaos and Creation in the Backyard", Lauri Saatpalu, Katrin Mandel "Sa oled hea", "Rock2005", The Corrs "Home", Dandy Warhols "Odditorium or Warlords of Mars"

  13. Sakala malev pani Viljandi lukku / Priit Silla

    Index Scriptorium Estoniae

    Silla, Priit

    2009-01-01

    Kaitseliidu Sakala malevas 23.-25. oktoobrini 2009 toimunud õppusest, mis jagunes kolme etappi: maleva allüksuste formeerimine ja deformeerimine, Viljandisse sisenevate teede sulgemine ning maleva kahe kompanii taktikaline õppus

  14. Roti ajurakud juhivad robotit / Priit Ennet

    Index Scriptorium Estoniae

    Ennet, Priit

    2008-01-01

    Tehnika- ja eluslooduse sümbioos on jõudnud täiesti uuele tasemele: Briti teadlaste loodud roboti liikumist juhib täiel määral bioloogiline "aju" - laboris roti elusatest närvirakkudest kasvatatud kude

  15. Edulugu maapealsest põrgust / Priit Simson

    Index Scriptorium Estoniae

    Simson, Priit, 1977-

    2011-01-01

    Läti on otsustanud oma majanduskriisist väljatuleku tuua eeskujuks ka teistele riikidele. Müügile on tulnud raamat "Kuidas Läti finantskriisist välja tuli" ("How Latvia Came Through the Financial Crisis"). Argentina pidi samuti 2002. aasta majanduskriisist välja tulema ja oli seda Lätist paremini teinud, kuid sellest palju ei räägitud

  16. Muusikamaailm : Rahvusvahelised festivalid augustis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Rahvusvahelistest festivalidest augustis : Glimmerglass, USA (1.07-23.08), Rheinsberg (3.07-15.08), Innsbrucki festival (6.07-29.08), Peraladas (Kataloonia lossifestival 10.07-21.08), Schleswig-Holstein (11.07-29.08), Bregenz (20.07-23.08), Batignano (22.07-15.08), Davos (23.07-14.08), Salzburg (24.07-30.08), Prades (26.07-13.08), Santander (1.-31.08), Stavanger (6.-15.08), Pesaro (7.-22.08)

  17. Plaadid / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2006-01-01

    Uutest heliplaatidest Gnaris Barkley "St. Elsewhwere", Winny Puhh "Täämba õdangu praadimi kunna", Feeder "The Singles", Diesler "Keepie Uppies", Kapusta Ja "Sisekosmosemasin", Suburban Tribe "Revolt Now", Christina Milian "So Amazin", Wind Project "Twilight Patterns", "Kui lähed, mine iseendasse", Hedvig Hanson "Ema laulud", Untsakad "Metsa läksid sa 2", Marie Serneholt "Enjoy The Ride", Cibelle "The Shine Of Dried Electric Leaves", The Da Vinci Project "Music Inspired By Da Vinci"

  18. Pop / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2006-01-01

    Heliplaatidest: The Manhattan Transfer "The Symphony Sessions", The Magic Numbers "Those The Brokes", Electronic "Get the Message: the Best of Electronic", ...And You Will Know Us by the Trail of Dead "So Divided", Tutty Moreno "Magica", Lindsey Buckingham "Under the Skin"

  19. Tahad rahu, muretse printer / Priit Simson

    Index Scriptorium Estoniae

    Simson, Priit, 1977-

    2014-01-01

    Kritiseeritakse kaitseväe hankeplaani, mille järgi bürootehnika ostmiseks kulutatakse palju rohkem raha kui näiteks lahingumoona ja sõjatehnika hankimiseks. Vt. lisaks: Kaitsevägi pani printerikulu summaga kümme korda mööda. Eesti Päevaleht 9. mai, lk. 5. Kümnega jagatud kaitsevägi. Eesti Päevaleht, 14. mai 2014, lk. 2

  20. Children of Geislingen Revisit Displaced Persons Camp / Priit Vesilind ; fotod: Priit Vesilind

    Index Scriptorium Estoniae

    Vesilind, Priit J., 1943-

    2008-01-01

    lastena aastatel 1945-1950 kunagises Geislingeni DP laagris viibinud 22 eestlase taaskokkutulekust 10.-14. sept. 2008 samas Geislingen an der Steige, Saksamaal. Kokkutuleku organiseerija oli arst ja kunstnik Mai Maddisson Melbourne'ist, Austraaliast

  1. Dicty_cDB: VSB468 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FFRKINPRDIRWSMVYRRTYKNTTT DVSAKKKARKTKKVERNIVGASLEVIQQKRAQKPEVKQAAAEQAKREIKEKKKAAAKKAA PKK*mik*tldhycf...FFRKINPRDIRWSMVYRRTYKNTTT DVSAKKKARKTKKVERNIVGASLEVIQQKRAQKPEVKQAAAEQAKREIKEKKKAAAKKAA PKK*mik*tldhycf

  2. Pepeljajevi trupp tuleb Eesti-tuurile / Priit Raud

    Index Scriptorium Estoniae

    Raud, Priit, 1963-

    2000-01-01

    Ühenduse 2.Tants (2.Tants promotion) sarja "City-Dance" raames esineb Tallinnas ja Tartus Moskva nüüdistantsu trupp Sasha Pepeljajevi Kineetiline Teater kavadega "Not There" ja "Qúest - Ce Qúune Ulve?"

  3. Dividendipoliitika Eesti suurettevõtetes / Priit Sander, Keith Trumm

    Index Scriptorium Estoniae

    Sander, Priit, 1973-

    2006-01-01

    Teguritest, millest lähtuvad Eesti suurettevõtted dividendipoliitika kujundamisel. Art. põhineb kahel empiirilisel uurimusel: 150 ettevõtte 1996.-2001. aasta raamatupidamisandmete regressioonianalüüsil ning 2004. a. tehtud ettevõtete küsitlusuuringul. Skeemid. Tabelid

  4. Põrgumasinad turismiparadiisis tegid suurimat kahju kohalikele / Priit Simson

    Index Scriptorium Estoniae

    Simson Priit, 1977-

    2005-01-01

    Ligi 90 inimese surmaga ja 200 vigasaamisega lõppenud terroriaktist Egiptuses Sharm el-Sheikhis. Vastutuse rünnakute eest võttis al-Qaida koosseisu kuuluv rühmitus Süüria ja Egiptuse Abd Allah Azzami brigaadid. Terroriaktide mõjust piirkonna turismile. Vt. samas: Heiki Suurkask. Terrorilöök tabas Egiptuse turismi valusat kohta; Reisid võivad odavamaks minna hotellihinna arvelt. Lisad: Suunav käsi Afganistanis?; Kronoloogia

  5. Muusika DVD-d / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2006-01-01

    Uutest DVD-dest Moody Blues "Lovely to See You - Live", Nick Cave and The Bad Seeds "Road to God Knows Wherw", Thin Lizzy "Thunder and Lightning Tour", Eels "Eels With Strings - Live at Town Hall", Moby "Live. Hotel Tour 2005", Corvus Corax "Cantus Buranus", Destiny's Child "Live in Atlanta"

  6. President jõulu eel Sakala malevas / Priit Silla

    Index Scriptorium Estoniae

    Silla, Priit

    2009-01-01

    President Toomas Hendrik Ilves külastas 18. detsembril 2009 Kaitseliidu Sakala malevat. Oma sõnavõtus peatus president pikemalt kahel teemal - Kaitseliit kui kodanike ühiskonna kõrgeim vorm ja Eesti turvalisus tänapäeva maailmas

  7. Äratajate hääl / Priit Silla

    Index Scriptorium Estoniae

    Silla, Priit

    2008-01-01

    Kolme Võru noormehe algatatud vabadussamba taastamine Võru kalmistul 1987. aasta oktoobris algatas niisuguse poliitilise jäämineku, mis tõi lipu alla tuhandeid inimesi. Vaba-Sõltumatu Noorte Kolonni nr.1 loomine

  8. Murdelahingust Kärstnas 90 aastat / Priit Silla

    Index Scriptorium Estoniae

    Silla, Priit

    2009-01-01

    2.-6. jaanuarini 1919 peeti Kärstnas Vabadussõja raskeid lahinguid. Pikemalt lahingus osalenud sõjaväelastest kolonel Georg Leetsist, kolonel Eduard-Alfred Kubbost, leitnanat Nikolai Fischerist ja leitnant Jaan Vastissonist

  9. Legendaarse Georg Otsa elust valmib film / Tuuli Koch, Priit Rajalo

    Index Scriptorium Estoniae

    Koch, Tuuli

    2006-01-01

    Eesti Filmi Sihtasutus eraldas eile tootmistoetuse režissöör Peeter Simmi mängufilmile "Georg". Eesti, Venemaa ja Soome ühisprojekt on eluloofilm lauljast (stsenaristid Mati Põldre, Aleksandr Borodjanski), nähtuna tema teise naise Asta Otsa silme läbi

  10. Plaadid / Mart Kalvet, Priit Kenkmann, Urmas Piht...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    Uutest heliplaatidest Nihilisticrypt "Perverse Dark Somnolence", Nortt "Galgenfrist", Rotten Sound "Cycles", Severe Torture "Sworn Vengeance", Saattue "Jäähyvästi", Steel Scream "Lock n'load and get ready", Cosa Nostra Klub "L'Hymne a la Joie"

  11. Plaadid / Priit Salusoo, Urmas Piht, Mart Kalvet...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    Uutest heliplaatidest Mord "Necrosodomic Abyss", Origin "The Antithesis", Pin-Up Went Down "2 Unlimited", Spyder Baby "Let Us Prey", Starofash "The Thread", Testament "The Formation Of Damnation", To-Mera "Delusions"

  12. Noorkirjanike sulge juhivad surm, narkootikumid ja kodutus / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2006-01-01

    Kirjastuse Tänapäev ja Eesti Lastekirjanduse Teabekeskuse noorte romaanivõistluse võidutööd: I koht - Diana Leesalu "Mängult on päriselt", II koht - Mare Sabolotny "Kirjaklambritest vöö", III koht - Hele-Riin Moon "Mina, Mortimer" ja Ketlin Priilinn "Maarjamäe kägu"

  13. Bagatellid : maailm / Nele-Eva Steinfeld, Priit Kuusk

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2009-01-01

    Muusikasõnumeid maailmast: Anna Netrebko ja Angela Gheorghiu loobuvad METi rollidest. Viiuldaja Janine Janseni koostööst Paavo Järviga. Rooma Ooperi peadirigendiks saab Riccardo Muti. Ilmuvad uued DVD-d Richard Wagneri loominguga. Lahkus sopran Hildegard Behrens. Paavo Järvi on tunnustatud Beethoveni sümfooniate esitaja

  14. Emajõel võib alata pudeliralli / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2000-01-01

    Iga kuu viimasel pühapäeval ostaks osavõtja 10 krooni eest tühja õllepudeli, mis tähistatakse lipukesega. Pudelid stardivad Kroonuaia silla juurest ja triivivad Kaarsilla juurde. Organisaator kunstnik Tarmo Ladva.

  15. Shmigun shokeeris positiivse dopinguprooviga / Andrus Nilk, Priit Pullerits

    Index Scriptorium Estoniae

    Nilk, Andrus, 1962-

    2002-01-01

    Eesti olümpiamedalilootuse organismis ületas anaboolse toimega hormooni 19-norandrosteroni tase lubatud piiri. Vt. ka art. Spordijuhid loodavad kiiret B-proovi analüüsi. Skeem: Kristina Shmiguni suusatajakarjääri silmapaistvamad saavutused

  16. Murtud lubadused / Peter Singer ; tõlkinud Priit Simson

    Index Scriptorium Estoniae

    Singer, Peter, 1946-

    2010-01-01

    Maailma riikide juhid võtsid 2000. a. vastu "Millenniumi deklaratsiooni", milles lubasid 2015. aastaks vähendada poole võrra ülima vaesuse ja nälja all kannatavate inimeste osakaalu. Autori hinnangul paistab praegu, et kui saabub aasta 2015, siis selgub, et riigijuhid ei suuda oma (lahjendatud) lubadustest kinni pidada

  17. Politseimaja rent nõuab uurimist / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2005-01-01

    Siseminister Kalle Laanet kinnitab, et politseiameti, Põhja politseiprefektuuri ja piirivalve üürilepingud Kalevi endise kommivabriku ruumide rentimiseks on riigile soodsad. Riigiprokuratuur andis AS-i Kalev kinnisvaratehingutega seoses alustatud kriminaalasja eeluurimise Kaitsepolitseiameti menetlusse. Lisa: Renditav Kalevi endine maja

  18. Mida Adolf Hitler tummfilmis ütles? / Priit Pruul

    Index Scriptorium Estoniae

    Pruul, Priit

    2006-01-01

    Frank Huberi poolt välja töötatud arvuti tarkvara ALR võimaldab Adolf Hitlerist tema mägimajas tehtud tummfilmidest välja lugeda füüreri suuliigutustega edasiantud teksti. (The Daily Telegraphi põhjal)

  19. Vägivaldne Jamaica getoromaan / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2015-01-01

    Maailma suurimad kirjandusauhinnad - Nobeli kirjanduspreemia ja Man Bookeri auhind läksid teostele, mis kirjeldavad suletud kogukondi ja seal toimuvaid jubedusi. Man Bookeri auhinna võitis Jamaicalt pärit Marlon James romaaniga "Brief history of seven killings". Nobeli kirjandusauhind läks Svetlana Aleksijevitšile

  20. Mõttevabaduse edendajad jagavad omavahel 50 000 eurot / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2005-01-01

    50 000 euro suurune Sahharovi mõttevabaduse auhind läheb tänavu jagamisele kolme võitja vahel: preemia jagavad omavahel julmade islamiseaduste vastu sõdiv Nigeeria naisjurist Hauwa Ibrahim, meediavabaduse eest võitlev rahvusvaheline ühendus Piirideta Ajakirjanikud ja Kuuba dissidentide naissoost sugulased. Lisa: Laureaadid

  1. Schönberg ja Kandinsky / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Nimetuse all "Schönberg ja Kandinsky - maalikunst ja muusika dialoogis" toimub näitus Uues Tretjakovi galeriis ja kontserdisari Moskva Konservatooriumi Suures saalis. Näitusel on väljas Vassili Kandinsky ja Arnold Schönbergi taiesed

  2. Maailmapank pidas Eesti ärikliimat paranenuks / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2005-01-01

    Maailmapanga ettevõtlusraportis "Doing Business in 2006" tõusis Eesti 155 analüüsitud riigi seas mulluselt 30. kohalt 16.-le. Maailmapank ja Eesti spetsialistid on seisukohal, et väga tõsiselt ei saa neid kahte aastat siiski võrrelda, kuna eelmisel aastal analüüsitud seitsme valdkonna asemel oli seekord luubi all kümme ning samuti on muudetud hindamise metoodikat. Lisa: Ärikeskkonna edetabel

  3. Uus vaimulik teos Arvo Pärdilt / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2003-01-01

    Arvo Pärdi teose "Il principio" maailmaesiettekandest Austrias Grazi Herz-Jesu kirikus. Heliplaadipreemiate Classical Brit Awards jagamisel Londoni Royal Albert Hallis võitis preemia Arvo Pärt plaadiga "Orient & Occident", esitajad plaadil Rootsi Raadio koor ja sümfooniaorkester Tõnu Kaljuste juhatusel

  4. Plaadid / Kaur Garshnek, Ave Randviir, Priit Pruul...[jt.

    Index Scriptorium Estoniae

    2007-01-01

    Uutest heliplaatidest Jaak Sooäär, Raul Vaigla, Tanel Ruben "No99 Jazzklubis", Black Strobe "Burn Your Own Church", The Quantic Soul Orchestra "Tropidelico", Uni "Kosmikud II", Bugge Wesseltoft "IM", Gabrielle "Always"

  5. Nargen Opera toob vaataja ette uue eesti kammerooperi / Priit Pruul

    Index Scriptorium Estoniae

    Pruul, Priit

    2006-01-01

    20. apr. esietendub Von Krahli Teatris Peeter Jalaka lavastuses Tõnu Kõrvitsa kammerooper "Mu luiged, mu mõtted", mille aluseks on luuletaja Marie Heibergi saatus. Libreto autor on Maarja Kangro. Kammerooper tuleb lavale Von Krahli Teatri ja Nargen Opera koostöös. Esitavad Kädy Plaas, Helen Lokuta, Nargen Opera koor ja Tallinna Kammerorkester, dirigent Tõnu Kaljuste

  6. Eesti nimekaim ilukirurg jagab enesekindlust / Peep Pree ; intevjueerinud Priit Pullerits

    Index Scriptorium Estoniae

    Pree, Peep, 1958-

    2006-01-01

    Vestlus Tartu esteetilise kirurgia erakliiniku Clinica juhatajaga tööst, vastutustundest, ebaõnnestumistest. Kommenteerivad Tartu linnapea Laine Jänes ja Tartu Ülikooli arstiteaduskonna emeriitprofessor Ennu Sepp

  7. Praemium Imperiale kätteandmine / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Jaapani kunstide auhinnad Praemium Imperiale (230 000 Saksa marka) anti kätte Tokios. Laureaatideks koreograaf Pina Bausch, saksa kunstnik Anselm Kiefer, kanada dzhässpianist Oscar Peterson, prantsuse päritolu USA kunstnik Louise Bourgeois, jaapani arhitekt Fumihiko Maki

  8. Avatud majandus, ummuksis mõte / Priit Simson

    Index Scriptorium Estoniae

    Simson, Priit, 1977-

    2009-01-01

    Autor küsib, kus on uuem eestikeelne majanduskirjandus. Eesti keeles pole käimasoleva kriisi kohta midagi avaldatud - kui paksemad parteilised bukletid välja arvata, tõlgitud pole isegi majandusteadlase John Maynard Keynesi töid

  9. Kogumikud / Priit Pruul, Veiko Pesur, Mihkel Raud...[jt.

    Index Scriptorium Estoniae

    2007-01-01

    Uutest heliplaatidest "Magic Nordic Voices", Godsmack "Good Times, Bad Times... Ten Years Of Godsmack", Chicago "The Best Of Chicago", Nelly Furtado "Loose ئ The Concert", "Triptease Vol. 1", Texas "The BBC Sessions", Nana Mouskouri "The Ultimate Collection"

  10. Muusikamaailm : Festivalid. Pariisi ooperihooaja tippe. Uusooper ka Amsterdamis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Festivalidest Euroopas : "Whitsun Festival" Salzburgis, Aldeburgh' rahvusvaheline festival, A.Brendeli juubelifestival Londonis, Viini pidunädalad. Berliozi teose "Fausti needmine" lavastusest Pariisi Opera Bastille's. P.Boulez juhatab Chatelet' teatris 6-osalist Bartoki-tsüklit. T.Loewendie uusooper "Johnny & Jones" maailmaesiettekandest Amsterdami Muziektheateris

  11. Finantshierarhia teooria ja finantseerimisotsused Eesti ettevõtetes / Priit Sander

    Index Scriptorium Estoniae

    Sander, Priit, 1973-

    2003-01-01

    Finantshierarhia (pecking order) kujutab endast sisuliselt finantseerimisallikate paremusjärjestust. Ettevõte kasutab enne ära soodsamad finantseerimisallikad ja siis võtab tarvitusele vähemsoodsad. Tabelid

  12. Eesti mees otsis Aafrikas kuulsa poolaka naist / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2006-01-01

    Looduse- ja rännumees Henrik Relve sattus Madagaskaril ekspeditsioonil olles kuulsa poola maailmaränduri Arkady Fiedleri (1894-!975) jälgedele. Rändur kirjeldas oma raamatus "Küla Madagaskaril", kuidas ta kohaliku naise võttis. Relve uuris, mis sai naisest pärast Fiedleri lahkumist saarelt

  13. Ameerika hävitaja tegi Eestisse visiidi / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2005-01-01

    15. novembril USA hävitajaga F-16 Eestisse viisakusvisiidi teinud Baltimaade õhuruumi turvava USA üksuse komandör Joseph Locke kohtus Eesti riigijuhtidega ja tutvustas hävitajat F-16 lennujaama päästeüksusele. Lisa: Hävitaja F-16

  14. Plaadid / Dannar Leitmaa, Priit Pruul, Toomas Puna...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    Uutest heliplaatidest Roots Manuva "Slime and Reason", Buena Vista Social Club "At Cargnegie Hall", New Kids on the Block "The Block", Queen + Paul Roger "The Cosmos Rocks", Bad Orange "Tuli ja Jää"

  15. Muusikamaailm : LPO kevadturnee. Tippmuusikud Berliinis. Uudiseid ooperimajadest / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    LPO traditsioonilisest kevadturneest Euroopas. Berliini Musikbiennale'st. Uudiseid New Yorgi Metropolitan Operast, Washingtoni Ooperist, Chicago Lyric Operast, Londoni Royal Operast, Pariisi Chatelet' teatrist, Hollandi Ooperist ja Zürichi Ooperist

  16. Mehaanikateaduskonna roll Eesti masinatööstuses / Priit Kulu

    Index Scriptorium Estoniae

    Kulu, Priit, 1945-

    2006-01-01

    Mehaanikainsenere on Eestis koolitatud alates 1918. aastast, mil alustati kõrgharidusega inseneride ja arhitektide ettevalmistamist Eesti Tehnikaseltsi Tehnilistel Erikursustel. Tänane mehaanikateaduskond Tallinna Tehnikaülikoolis, inseneride kvaliteedi tagamine, teadus- ja arendustegevus

  17. Kuidas juutidele sambaid tehakse / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2004-01-01

    Autor on jõudnud järeldusele, et nõudmine märkida Teises maailmasõjas Eestis hukatud juutide arvuks 20 000 on tulnud USA välismaal asuva Ameerika pärandi säilitamise komisjoni (U.S. Commission for the Preservation of America's Heritage Abroad) liikmetelt endilt või nende abilistelt

  18. Oistrahhi festival läheb Euroopasse / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2004-01-01

    Pärnu David Oistrahhi festivali (festivali juht Allar Kaasik) "Europa Festiva" kontserdisarja alustamisest Budapestis Euroopa päeval 9. mail Euroopa Liidu suurprogrammi "Culture 2000" toel. Kontserdist Ferenz Liszti nim. Muusikaakadeemia suures saalis, esinejatest

  19. Ida-Virumaa vajab Eesti elu / Priit Kama

    Index Scriptorium Estoniae

    Kama, Priit, 1971-

    2017-01-01

    Justiitsministeeriumi vanglate osakonna asekantsleri arvamusartikkel Sisekaitseakadeemia Ida-Virumaale kolimise mõjudest kohaliku sotsiaalkultuurilise olukorra parandamisel ja sellega Eesti julgeolekutaseme tõstmisel

  20. Inglismaa juhib, Eesti on 36. Milles asi? / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2007-01-01

    Riikide brändide reitingus on Eesti 36. kohal. Kommenteerib EAS-i turundus- ja kommunikatsiooniüksuse direktor Erki Peegel; Vt. samas: Simon Anholt; Tabel: Riikide brändide reiting; Riik ei riku väärt kaupa

  1. Tuhanded mehed lihvivad tantsupeoks viimaseid samme / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2006-01-01

    11. juunil Rakveres toimuvast esimesest Eesti meeste tantsupeost, mille idee autor, üldjuht ja lavastaja on tantsuõpetaja Maie Orav. Lisaks Rakvere Teatri direktori Indrek Saare ja Tallinna vangla direktori Toomas Malva arvamused tantsupeost

  2. Koolijuhid sõid miitingu ajal abilinnapeaga torti / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit

    2004-01-01

    Keskerakonna noortekogu korraldas Tartus haridus- ja teadusministeeriumi ees õpilaste miitingu, millega nõudsid haridusministri tagasiastumist. Samal ajal toimus Tartu koolidirektorite koosviibine ja kohtumine abilinnapeaga

  3. Muusikamaailm : Suvefestivalid täies hoos / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Suvefestivalidest : Aix-en-Provence'i festivalist, Londoni "Promenaadikontsertidest", Spoleto "Kahe maailma festivalist", Sapporo "Pacific Music Festival'ist", Bregenzi festivalist, New Yorgi Lincoln Center'i festivalist ja Verbieri festivalist

  4. Kallis müügitrikk laste arvel / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2010-01-01

    Piret Raua digitaalsest pildiraamatust lastele "Emma roosad asjad" (Suurbritannia : WingedChariot, 2010), mida on võimalik kasutada Apple´i elektroonikatoodetes iPad, iPhone ja iPod (eesti, inglise ja jaapani keeles)

  5. Ka kalal võivad olla tunded / Priit Ennet

    Index Scriptorium Estoniae

    Ennet, Priit

    2016-01-01

    Simon McKenzie ja Sonia Ray katsest sebrakaladega, mida nad tõlgendavad nii, et stressiseisundis kalad kutsusid selle leevendamiseks meelega esile palaviku seisundi eelistades ujuda harjumuspärasest kõrgema temperatuuriga vees

  6. Maru ühendatud : Poesie United esines Tartus / Priit Kruus

    Index Scriptorium Estoniae

    Kruus, Priit

    2005-01-01

    23. mail esinesid Tartus saksa, ameerika, prantsuse ja eesti luuletajad spoken word-kirjandusüritusega "Poesie united". Osalesid Wehwalt Koslovsky, Tobias Hoffmann, Milo Martin, Ben Porter Lewis, Antoine Faure, Jürgen Rooste, Asko Künnap ja fs

  7. Uue paradigma poole monumendikeskustelus / Priit-Kalev Parts

    Index Scriptorium Estoniae

    Parts, Priit-Kalev, 1972-

    2007-01-01

    Autor püstitab küsimuse, kas on üldse sünnis luua igavesi ja muutumatuid vorme. Paindlikumat tõlgendamist võimaldab näiteks muutlik ja hävinev puu, mida võib vesta või istutada. Pingemaandajana sobiks tordist monumendikoopia

  8. Radar - interaktiivne kultuurilooline kaart / Tõnno Jonuks, Priit Lätti

    Index Scriptorium Estoniae

    Jonuks, Tõnno

    2006-01-01

    Radar on digitaalne Eesti kaart, mis kajastab ümbritseva maastiku kujutamist ja mõtestamist elanike poolt. Pilootprojektina alustati Eesti Kirjandusmuuseumi folkloristika osakonnas Lääne-Viru maakonna kaardistamist 2003. a.

  9. Kuus sammu küberruumis / Priit Ennet

    Index Scriptorium Estoniae

    Ennet, Priit

    2008-01-01

    Washingtonis Redmondis asuva Microsoft Researchi teadlased Eric Horvitz ja Jure Leskovec uurisid kogu maailmas ühe kuu jooksul Microsoft Messengeri kaudu peetud vestlusi. Teadlaste kinnitusel kulub inimesel ükskõik millise MSN-sõnumi edastamiseks keskmiselt 6,6 sammu

  10. President Ilves annab nõu president Obamale / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2009-01-01

    President Toomas Hendrik Ilves andis rahvusvahelises uudisteajakirjas Newsweek nõu USA presidendiks valitud Barack Obamale: Ilves, Toomas Hendrik. The Challenge in Europe. Newsweek : Special Edition Issues, 2008, dets., lk. 35. (http://www.newsweek.com/id/177415/output/print). Eesti president kutsub Ameerika Ühendriike üles kaitsma liberaalse demokraatia väärtusi ning rõhutab USA ja Euroopa koostöö tähtsust Venemaa ohjeldamisel. Ülevaade artiklist ilmunud ka: Eesti Elu 9. jaan. 2009, lk. 16, pealk.: President Ilves andis nõu president Obamale; Eesti Päevaleht (Stockholm) 21. jaan. 2009, lk. 2, pealk.: Eesti president kutsuti USA uuele presidendile nõu andma; Vaba Eesti Sõna 22. jaan. 2009, lk. 3, pealk.: President Ilves annab president Obamale nõu

  11. Aitab vestlusringidest! : kes vastutab? / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2010-01-01

    Tallinnasse püstitatud Vabadussõja võidusamba paneelid koosnevad odavast akrüülmassist ja on vaid kaetud klaasiga. Tšehhi firmaga Sans Souci sõlmitud lepingu järgi peaksid plaadid aga olema klaasist

  12. Muusikamaailm : Aasta heliplaadid. Aastavahetus muusikalavadel. Aage Haugland surnud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Financial Timesi kriitiku A. Clarki äramärgitud heliplaatidest aastast 2000. Aastavahetuse ooperietendustest ja kontsertidest New Yorgis, Washingtonis, Pariisis, Amsterdamis, Frankfurdis, Milanos, Londonis ja Barcelonas. Lühidalt A. Hauglandist

  13. Euroopa Liit taotleb Venemaaga heakskiitu piirileppele Eestiga / Priit Simson

    Index Scriptorium Estoniae

    Simson Priit, 1977-

    2005-01-01

    Euroopa Parlamendi liikmed Toomas Hendrik Ilves ja Veronique Keyser esitasid EL-i ülemkogule arupärimise, kas ja kuidas mõjutab Venemaa-poolne allkirjade tagasivõtmine Eesti-Vene piirilepingult Euroopa Liidu ja Venemaa suhteid

  14. Dominique Moisi : Obama tooks murrangu / Dominique Moisi ; interv. Priit Simson

    Index Scriptorium Estoniae

    Moisi, Dominique

    2008-01-01

    Prantsuse politoloog USA presidendikandidaatide erinevusest, nende populaarsusest maalimas. Euroopa ja Ameerika vastandumisest. Rahvusvaheline poliitika Venemaa-suunal, Gruusia õppetund, NATO ühiskaitsetkäsitlev artikkel 5. Lisa: Dominique Moisi

  15. Rumaluse marss Afganistanis / Jaswant Singh ; tõlkinud Priit Simson

    Index Scriptorium Estoniae

    Singh, Jaswant

    2010-01-01

    India endine välisminister on seisukohal, et Afganistani tungimine rajanes väärarvestusel. Seda maad on võimalik ehk mõneks ajaks okupeerida, kuid ainult ajutiselt. Tähtis on leppida sellega, et Afganistani pole võimalik keskselt valitseda, vaid ainult juhendada

  16. Muru-uurija Priit Pärn hakkab eesti joonisfilmi harima / Priit Pärn ; interv. Kaarel Kressa

    Index Scriptorium Estoniae

    Pärn, Priit, 1946-

    2006-01-01

    Animafilmirežissöör ja karikaturist oma tegevusest ja kunstipõhimõtetest, ka sügisel tema juhtimisel algavast animafilmiõpetusest Eesti Kunstiakadeemias. Lisatud lühiandmed P. Pärna kohta ning Ülo Pikkovi ja Andres Laasiku arvamused temast

  17. Image as Gesture: Notes on Aernout Mik's Communitas and the Modern Political Film

    NARCIS (Netherlands)

    Pisters, P.

    2015-01-01

    Walking through Aernout Mik’s exhibition Communitas, dwelling in the encounter with the people and situations in front of and on the screens, one is struck by the cinematic and political qualities of the gestures in these powerful video installations. In this article I will develop some

  18. Euroopa täitekorralduse tõend: miks ja millal? / Meeli Kaur

    Index Scriptorium Estoniae

    Kaur, Meeli

    2012-01-01

    Euroopa täitekorralduse määrusest (805/2004/EÜ) ja selle kohaldamisest tsiviilkohtumenetluse seadustiku sätetega. Euroopa täitekorralduse tõendi väljastamise eeldustest, määruse reguleerimisalas olevatest Eesti kohtulahenditest, kohtualluvusest ja menetlusele kohaldatavatest miinimumnõuetest

  19. Euroopa keelemapp Eestis : mis, miks ja kuidas? / Tõnu Tender, Ülle Türk

    Index Scriptorium Estoniae

    Tender, Tõnu, 1965-

    2004-01-01

    Artiklis tutvustatakse Euroopa keelemapi eesmärke, koostamis- ja kasutamispõhimõtteid ning õppetöösse juurutamise võtteid. Esitatakse ka Euroopa Nõukogu keeleoskustasemete süsteem ja sellepõhine enesehindamise skaala

  20. Miks me ostame ühe miljoni euro eest positiivset vanemlust? / Maie Tuulik

    Index Scriptorium Estoniae

    Tuulik, Maie, 1941-

    2014-01-01

    Sotsiaalministeeriumi laste ja perede arengukava 2012-2020 oluline aluspõhimõte on teadmispõhine lähenemine. Austraalia teadlase Matthew Sandersi väljatöötatud programmi Triple P headuse ja usaldusväärsuse põhiargument ongi teadmispõhisus

  1. Miks märts võttis meilt nii palju suurkujusid? / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2016-01-01

    Märtsis lahkus meie seast ridamisi suurmehi. Kas tänavune märts oli surmade poolest kurjakuulutavalt eriline. Sel teemal vastavad küsimustele hingearst Jüri Ennet, perearst Diana Ingerainen, folklorist Marju Kõivupuu ja kirikuõpetaja Jaan Tammsalu

  2. Miks on post-sotsialistlikes riikides vähe sotsiaalset kapitali? / Eve Parts

    Index Scriptorium Estoniae

    Parts, Eve, 1970-

    2005-01-01

    Osaliselt on sotsiaalse kapitali languse põhjuseks siirderiikides kohanemisraskused turumajandusega, teisalt aga individualistlike väärtushinnangute esiletõus analoogiliselt arenenud riikidega, väidab autor. Diagrammid

  3. Miks IMF ei kiirusta riike rahanduskriisist päästma? / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2008-01-01

    Mitu riiki taotleb IMF-ilt kriisiabi, IMF esitab neile abi andmiseks rangeid nõudeid. Varasemates kriisides on IMF-i rahast piisanud, kuid suuremaid tööstusriike ta välja aidata ei suudaks, selle juhi Dominique Strauss-Kahni prognoosi kohaselt peab IMF seekord välja andma sadu miljardeid dollareid. Lisa: Pangajuhti tabas seksiskandaal

  4. Miks tahavad riigid nüüd kõik korraga hirmsasti eksportida? / Edward Hugh

    Index Scriptorium Estoniae

    Hugh, Edward

    2009-01-01

    Autor kirjeldab lääneriikide näitel, kuidas rahvastiku vananemine mõjutab riigi jooksevkonto defitsiiti ja säästmist ning väidab, et sama protsess toimub ka Balti riikides. Probleemiks on, et kui kõik riigid tahavad eksportida, siis kes kogu selle ekspordi ära tarbib. Graafik: Rahvastiku vanuse mõju jooksevkontole

  5. Miks 1993. aastal kingiti Eesti merd? / Igor Gräzin

    Index Scriptorium Estoniae

    Gräzin, Igor, 1952-

    2007-01-01

    Vastuseks Pärnu Postimehes ilmunud artiklitele: Toomas Alatalu "Euroopa toru ja kahe mehe torud" (25.09) ja "Rosinatega tähelepanu mujale" (4.10.) ning Trivimi Velliste "Riigipiir kui rosinasai" (4.10.)

  6. Miks Põhja-Korea on Hiinale ebamugav teema / Christopher Hill ; tõlkinud Villu Zirnask

    Index Scriptorium Estoniae

    Hill, Christopher

    2011-01-01

    Hiina suhtumisest oma naaberriiki. Hiina mõistab, et Põhja-Korea ei saa oma praegusel kujul püsima jääda ja on püüdnud julgustada sealseid juhte viima majandusreformi ellu poliitiliste muutusteta, sest Põhja-Korea lõpp tähendaks USA võitu ja Hiina kaotust

  7. Peaaegu nagu inimene. Miks ja mida räägitakse lemmikloomadest

    OpenAIRE

    Maarja Villandi

    2006-01-01

    In the present work I analyse stories told about pets in groups. Stories about pets can be regarded as folklore because it is oral lore and those stories can normally not be found in literary sources. They are based on personal experiences or stories heard from other people. There are three requirements for a situation which to be favourable for the storytellers: contact between two or more persons; the situation creates an atmosphere of storytelling; an interest in pets by at least one pe...

  8. Riigikohtunik: miks ei kärbi riigikogu esinduskulusid? / Mirko Ojakivi

    Index Scriptorium Estoniae

    Ojakivi, Mirko

    2009-01-01

    Riigikohtus tuli arutusele president Toomas Hendrik Ilvese ettepanek tunnistada Riigikogu liikme palga ajutise korralduse seadus põhiseadusega vastuolus olevaks. Vt. samas: Lang: sissetulekut on võimalik piirata. Justiitsminister Rein Langi sõnavõtt Riigikohtus

  9. Miks tuli "Kevade" läinud aastal teisiti / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare

    2008-01-01

    "Aasta rosina" auhinna võitnud Oskar Lutsu "Kevade" kommenteeritud kooliväljaandest "Kui Arno isaga koolimajja jõudis..." (Tallinn : Ilo, 2007), mille koostasid Aili Kalavus ja Mare Müürsepp ning illustreeris Mare Hunt

  10. Miks peab lõhkuma hägustunud piire? / Reelika Reinomägi

    Index Scriptorium Estoniae

    Reinomägi, Reelika

    2007-01-01

    Kaasaegse tantsulavastuse ja teatri ühisosast, seoses festivaliga "Uus tants". Tantsuetendustest: Katrin Essensoni "Manusega mõtted", Mart Kangro "Start. Based on a True Story", Kaja Kannu "There are Laika Dogs Living in Estonia"

  11. Imar Raag : miks rekordpalka nautiv Vahtur Kersna ETVd põhjab? / Kaspar Käänik

    Index Scriptorium Estoniae

    Käänik, Kaspar

    2007-01-01

    ETV endine juht arvustab teleajakirjanik Vahur Kersna avalikku kriitikat oma tööandja aadressil. Artiklis tsiteeritakse Ilmar Raagi 25. sept. ajalehes Postimees ilmunud artiklit "Huvide konflikt : Vahur Kersna näide"

  12. "Isegi pankrotis Kreeka ei kaotanud politseinike eripensione, miks meie siis ometi seda teeme?" / Marvel Riik

    Index Scriptorium Estoniae

    Riik, Marvel

    2016-01-01

    Valitsus otsustas kaotada alates 2020. aastast kaitseväe, prokuröride, politsei ja piirivalveametnike eripensionid. Arvamust avaldavad reservkolonelleitnant Leo Kunnas ja ekspolitseinik Aivar Toompere

  13. Miks projektivõrgustikud projektmeeskondadele tuule alla teevad ? / Jonathan Cummings, Carol Pletscher

    Index Scriptorium Estoniae

    Cummings, Jonatahan

    2011-01-01

    Õige ja asjakohase oskusteabe leidmise keerukusest teadmistemahukate meeskonnaprojektide realiseerimisel. Projektvõrgustike analüüs. Skeemid: Mille poolest finaalijõudnud meeskonnad erinesid?, Kuidas projektvõrgustikud laiendavad meeskonna haaret?, Kuidas kasutada projektvõrgustikke?

  14. Miks tulite e-õppe konverentsile? / Tia Vene, Tatjana Guž, Eha Kaukveer...[jt.

    Index Scriptorium Estoniae

    2009-01-01

    Konverentsist " Õppijalt õppijale". Küsimusele vastavad: Kallavere Keskkooli algklassiõpetaja Tia Vene, Lasnamäe Põhikooli inglise keele õpetaja Tatjana Guž, Tallinna Päikesejänku lasteaia õpetaja Eha Kaukveer, Pelgulinna Gümnaasiumi IT-arendusjuht, arvutiõpetaja Birgit Lorenz ja Haapsalu Sanatoorse Internaatkooli õpetaja Villu Baumann

  15. Miks Juhan peab õppima, kui Juku seda juba tegi? / Aivi Parijõgi

    Index Scriptorium Estoniae

    Parijõgi, Aivi, 1967-

    2010-01-01

    Joensuus kogunesid LINBA projekti osalised. LINBA (Learning Insights in the Nordic Baltic Area) koondab Soome, Eesti, Läti ja Leedu täiskasvanuhariduse asjatundjaid. Eestist on projektipartneriks Tallinna Ülikool ja seda esindavad andragoogika osakonna juhataja dotsent Larissa Jõgi ja lektor Kristiina Krabi. Joensuus tutvuti õpiasutusi väisates Soome täiskasvanukoolituse kogemusega

  16. Miks on täna jõustuv Kyoto protokoll oluline? / Liisi Poll

    Index Scriptorium Estoniae

    Poll, Liisi, 1980-

    2005-01-01

    1997. aastal vastu võetud Kyoto protokollist, selle üle toimunud läbirääkimistest, leppe ratifitseerimisest riikides. USA vastuseisust leppele. Autori sõnul peaks selleks, et lepe tõesti mõjus oleks, selle eesmärke veelgi karmistama ning seda ka arenguriikidele laiendama. Diagramm: Kasvuhoonegaaside kogused

  17. Miks ja millal ameeriklased sõtta lähevad? / Erik Reinhold

    Index Scriptorium Estoniae

    Reinhold, Erik

    2004-01-01

    Artiklis tutvustatakse 2. novembril 1984 USA kaitseministri C. W. Weinberger'i poolt peetud kõnes "Sõjalise jõu kasutamine" esitatud sõjajõudude kasutamise põhimõtteid väljaspool USA-d, mida tuntakse ka "Weinbergeri doktriini" nime all. Weinbergeri kriteeriumide rakendamise võimalustest Eestis. Tabel: USA sõjalised aktsioonid ja Weinbergeri doktriin Vietnamist Bosniani (Michael I. Handeli järgi)

  18. Miks õpilased ei oska jooniseid lugeda? / Kristelle Kaarmaa, Erika Jüriado

    Index Scriptorium Estoniae

    Kaarmaa, Kristelle

    2007-01-01

    Uuriti 2005. aastal, kuidas on gümnaasiumiõpilased omandanud keemilised vooluallika ja elektrolüüsiprotsessi põhimõtte. Selgus, et teemad osutusid õpilastele raskeks, kusjuures abi ei osatud otsida ka küsimuste juurde lisatud selgitavatelt joonistelt

  19. Miks meil on kogu aeg kiire? / David Allen ; interv. Endrik Randoja

    Index Scriptorium Estoniae

    Allen, David

    2006-01-01

    Produktiivsuse ekspert vastab küsimustele ettevõetud tegevuste tulemuslikumalt lõpule viimise kohta. Lisa: Aja paremaks kasutamiseks pakub David Allen lisaks veel kolm tõhusat ja lihtsasti rakendatavat põhimõtet

  20. Peterburi sõjaväeprokuratuur ei tea, miks Ustimenko Eestisse pages / Toomas Sildam

    Index Scriptorium Estoniae

    Sildam, Toomas, 1961-

    2002-01-01

    Peterburi garnisoni prokurör Vladimir Grishko Eestis kuritegusid toime pannud Juri Ustimenkost ja Dmitri Medvedjevist. Skeem: Ustimenko ja Medvedjev. Vt. samas art. "Kuues teaduskond" - Peterburi mereväeinstituudi tutvustus

  1. Miks Teie hääletate Arnold Rüütli poolt?

    Index Scriptorium Estoniae

    2006-01-01

    Järg: Kesknädal 20. sept., lk. 4-7,10. Küsimustele vastavad valijamehed: Aarne Lember, Juhan Särgava, Toivo Kroon, Jaan Pajos, Einar Pärnpuu, Toivo Põldma, Heiki Kortspärn, Ülle Juht, Toomas Tuula, Erika Salumäe, Sulo Nurmeots, Arno Sild, Aivar Tubli, Ardo Lass, Leonid Priimäe, Vilja Alamaa, Eha Polluks, Lea Kiivit, Kajar Lember, Aavo Keerme, Aadu Jõgiaas, Aavo Mölder, Arno Rossman, Märt Riisenberg, Leemet Lõo

  2. Miks Teie hääletate Arnold Rüütli poolt?

    Index Scriptorium Estoniae

    2006-01-01

    Järg 20. sept. lk. 4,5,6,7,10. Küsimustele vastavad valijamehed: Aarne Lember, Juhan Särgava, Toivo Kroon, Jaan Pajos, Einar Pärnpuu, Toivo Põldma, Heiki Kortspärn, Ülle Juht, Toomas Tuula, Erika Salumäe, Sulo Nurmeots, Arno Sild, Aivar Tubli, Ardo Lass, Leonid Priimäe, Vilja Alamaa, Eha Polluks, Lea Kiivit, Kajar Lember, Aavo Keerme, Aadu Jõgiaas, Aavo Mölder, Arno Rossman, Märt Riisenberg, Leemet Lõo

  3. Mustad jõulud Geenivaramus ehk miks tekkis tõrge Eesti võimsaimas teadusprojektis

    Index Scriptorium Estoniae

    2004-01-01

    Sihtasutuste Eesti Geenivaramu ja Eesti Geenikeskus, AS-i EGeen ja EGeen International Inc. tegevusest, Eesti geeniprojektiga seotud investoritest, projekti hetkeseisust ning võimalikest tulevikustsenaariumitest. Tabel ja diagrammid: SA Eesti Geenivaramu kulud 2001-2003; Geenidoonorite arv kvartaalselt. Lisad: Inimgenoomi projekt; Erinevate projektide võrdlus; Eesti Geenivaramu lühike ajalugu; Eesti geeniprojekti SWOT-analüüs

  4. Miks tõlkisite raamatu tuulegeneraatori sündroomist? / Hans Kuusiku ; intervjueerinud Helen Arusoo

    Index Scriptorium Estoniae

    Kuusiku, Hans

    2013-01-01

    Intervjuu müramõõtjana töötanud füüsikuga, kes tõlkis eesti keelde Nina Pierpont'i uurimuse Tuulegeneraatori sündroom, mida saab lugeda aadressilt http://www.windturbinesyndrome.com/img/WTS-estonian.pdf

  5. Miks on oluline Eesti Energiaga võrgukokkulepe sõlmida? / Kätlin Sumberg

    Index Scriptorium Estoniae

    Sumberg, Kätlin

    2004-01-01

    Ilmunud ka: Põhjarannik, 15. sept. 2004, lk. 4; Pärnu Postimees, 16. sept. 2004, lk. 8; Sakala, 17. sept. 2004, lk. 5; Hiiumaa, 18. sept. 2004, lk. 6; Meie Maa, 18. sept. 2004, lk. 4; Järva Teataja, 21. sept. 2004, lk. 2; Harjumaa, 21. sept. 2004, lk. 2; Võrumaa Teataja, 21. sept. 2004, lk. 5; Valgamaalane, 23. sept. 2004, lk. 2; Linnaleht : Tallinn, 24. sept. 2004, lk. A12; Koit : Tarbijainfo, 30. sept. 2004, lk. 11; Nädaline, 7. okt. 2004, lk. 8; Virumaa Teataja, 7. okt. 2004, lk. 5. Võrguleping on Eesti Energia ja kliendi suhet reguleeriv ning sätestav dokument, lisaks märgib see ära omandisuhete piirid ettevõtte ja kliendi vahel

  6. Miks Hispaania farmerid kasvatavad GM-maisi / Tiit Kändler

    Index Scriptorium Estoniae

    Kändler, Tiit, 1948-

    2004-01-01

    Nüüdseks on geneetiliselt muundatud taimi maailmas kasvatatud kümme aastat. Jätkub geneetiliselt muundatud taimede pooldajate ja vastaste vaheline külm sõda. Lisaks joonis: Kuidas võõrgeen taime viiakse

  7. Miks Cannes'is peab käima / Jaan Ruus

    Index Scriptorium Estoniae

    Ruus, Jaan, 1938-2017

    2004-01-01

    57. Cannes'i filmifestivalil nähtud filme - Sembene Ousmane'i "Moolaade" (Senegal), Agnes Jaoui "Vaata mind" (Prantsusmaa), John Nosseiteri dokumentaal "Mondovino" (USA), Pedro Almodovari "Halb haridus" (Hispaania), Emir Kusturica "Elu on ime" (Jugoslaavia/Prantsusmaa), Hirokazu Kore-Eda "Ükski ei tea" (Jaapan). Ka eesti produtsentide tegutsemisest filmiturul

  8. Põldoja lahkub igavavõitu pangaelust / Kadrin Karner, Katre Pilvinski

    Index Scriptorium Estoniae

    Karner, Kadrin

    2008-01-01

    Hansapank Eesti juht Priit Põldoja lahkub pangast ning asub tööle investeerimisfirmasse Alta Capital. Vt. samas: Hansapank Eesti uus juht Priit Perens; Alta Capital Partners; Maatrikssüsteem ei meeldinud konkurendile. Kommenteerib Priit Perens

  9. Vastuseks Valentin Kuigile ja Lauri Kärgile. Miks mõned head stsenaariumid ei saa filmiks? / Jaak Lõhmus

    Index Scriptorium Estoniae

    Lõhmus, Jaak

    2005-01-01

    Eesti Filmi Sihtasutuse peaeksperdi selgitused Valentin Kuigi raamatust "Keskea rõõmud. Stsenaariumid" kirjutanud Lauri Kärgi artiklis ja Tiit Tuumalu poolt raamatu autoriga tehtud intervjuus (mõlemad 6.10. 2005.a. Postimehes) tõstatatud süüdistuste asjus EFSA filmide rahastamispoliitika kohta

  10. Miks ühel õnnestub ja teisel mitte? / Amy Edmonson, Richard Bohmer, Gary Pisano ; tõlk. Kadre Vaik

    Index Scriptorium Estoniae

    Edmonson, Amy

    2003-01-01

    16 meditsiinikeskuses läbi viidud uuringust eesmärgiga jälgida kirurgimeeskondade tööd ning kohanemist uute töömeetoditega. Kommenteerivad Toomas-Andres Sulling, Tiit Ojaveski ja Ela Velström. Vt. samas: Uus meetod murtud südame parandamiseks; Kahe haigla lugu. Lisa: Õppiv liider

  11. Miks on Eestis nii vähe patente ja kasulikke mudeleid? / Toivo Tänavsuu, Argo Ideon

    Index Scriptorium Estoniae

    Tänavsuu, Toivo

    2008-01-01

    Eesti mahajäämusest patendinduses, teiste maade kogemustest, teadus- ja arendustegevuse arendamise vajalikkusest. Lisad: Teadus- ja arenduskulutused Euroopas ja mõnedes tööstusriikides; Soome suuremad patenteerijad 2006. Vt. ka Aivar Kaljula. Lihtne leiutamine, lk. 19-20

  12. Ökoloogiline maksureform - mis see on ja miks seda vaja on / Silja Lüpsik, Urmas Koidu

    Index Scriptorium Estoniae

    Lüpsik, Silja

    2006-01-01

    Ökoloogilise maksureformi eesmärkidest, läbiviimise põhimõtetest ja ajakavast, kavandatavatest meetmetest ning oodatavatest tulemustest nii keskkonnakaitsest, üldisest majanduslikust, sotsiaalsest kui ka rahanduslikust aspektist lähtuvalt. Graafik. Diagrammid. Tabel

  13. Miks Eesti soost Steve Jurvetson peab nanotehnoloogiat järgmiseks suureks asjaks / Richard Waters ; tõlk. Erik Aru

    Index Scriptorium Estoniae

    Waters, Richard

    2005-01-01

    Steve Jurvetsoni hinnangul muutuvad nanotehnoloogilise revolutsiooni tulemused nähtavaks järgmise 3-5 aasta jooksul. Ettevõtjatel soovitab ta mitte karta mõelda suurelt ja oodata tulevikku, mis võib veel praegu näida fantastiline. Tema sõnul on Interneti ajalugu juba jõudnud punkti, kus äri muutvad sündmused on saamas reaalsuseks. Lisa: Steve Jurvetsoni tulevikuvisioon

  14. Miks ohverdada veel üks põlvkond? / Christopher õBeazley ; interv. Berit Teeäär

    Index Scriptorium Estoniae

    õBeazley, Christopher

    2008-01-01

    Euroopa Parlamendi Balti-Euroopa tugirühma esimees Christopher Beazley vastab küsimustele, mis puudutavad tema huvi Balti riikide ja Läänemere regiooni vastu, Läänemere piirkonnas paiknevate Euroopa Liidu vanade ja uute liikmesriikide kontseptuaalsete erinevuste tõttu tekkida võivaid lahkhelisid, Euroopa Liidu ja Venemaa suhete seisu ja arenguperspektiive, liidu ühise välispoliitika kujunemise võimalikkust, Kaliningradi oblasti demilitariseerimist ning selle enklaavi muutmist Euroopa Liidu ja Venemaa vahelise vabakaubanduse pilootprojektiks, Läänemere ökoloogilise olukorra parandamist

  15. Miks liisiti Arnold Rüütlile ja Helle Merile kallid ametiautod? / Toomas Sildam ; interv. Rain Pruul

    Index Scriptorium Estoniae

    Sildam, Toomas

    2008-01-01

    Presidendi kantselei liisis president Lennart Meri lesele Helle Merile 640 000 krooni maksva Jeep Grand Cherokee ja president Arnold Rüütlile 633 500 krooni maksva mahtuniversaali Chrysler Grand Voyageri. Selgitab Vabariigi Presidendi avalike suhete nõunik Toomas Sildam

  16. Miks Ida-Euroopa reformidest väsis / Stefan Wagstyl, Christopher Condon ; tõlk. Erik Aru

    Index Scriptorium Estoniae

    Wagstyl, Stefan

    2006-01-01

    Ungari, Tšehhi, Poola, Slovakkia sisepoliitilisest olukorrast. Autorite sõnul on kõikjal piirkonnas langenud eurotsooniga liitumise kavad poliitika ohvriks; majandusteadlaste väitel jätab Kesk-Euroopa kasutamata võimaluse läbi viia uuendusi, mida peab hiljem niikuinii tegema

  17. Miks sponsoreerivad ettevõtted suurüritusi? / Frank Svenhard, Liivi Tadolder ; interv. Annika Rõõmus

    Index Scriptorium Estoniae

    Svenhard, Frank

    2006-01-01

    ALD Automotive Baltikumi tegevdirektor ja AS-i Liviko turundusjuht valikutest sponsoreerimisel, koostööst sponsoreeritavate organisatsioonidega, rahvusvahelise juhtimiskonverentsi EC2006 toetamisest

  18. Robert Putnam : miks peaksime naabritega rohkem rääkima? / Robert Putnam ; interv. Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Putnam, Robert

    2006-01-01

    26. mail Tallinnas toimuva Avatud Ühiskonna Foorumi peaesineja, Harvardi Ülikooli professor väidab, et mida paremini tuntakse oma naabreid, mida aktiivsemalt osaletakse kohalikus elus ning mida rohkem inimesed omavahel suhtlevad, seda paremaks ja turvalisemaks muutub nende elukeskkond. Lisad: Robert Putnam (sünd 1941); Kuidas kasvatada sotsiaalset kapitali?

  19. Läätsa Kalatööstus järjekordne MSC sertifikaadi omanik / Alar Mik

    Index Scriptorium Estoniae

    Mik, Alar

    2014-01-01

    MSC (Marine Stewardship Council)-märgis toodetel tõendab, et tegemist on keskkonnaalaselt vastutustundliku ettevõttega, kelle toodangutsükkel on kala püüdmisest kuni valmistoodangu tarbijani jõudmiseni rangelt seaduslik ja keskkonnasäästlik. Vestlusest ettevõtte juhatuse liikme Toomas Auliga

  20. Miks meile vaja maastikuarhitektuuri? = Why do we need landscape architecture? / Reinhard Micheller, Günther Schalk, Katrin Koov

    Index Scriptorium Estoniae

    Micheller, Reinhard, 1977-

    2013-01-01

    EKA arhitektuuri ja linnaplaneerimise osakonna III kursuse 2009-2012 aastail erialase projekteerimise ülesande raames on vestlusringis maastikuarhitektuurse osa juhendajad Reinhard Micheller ja Günther Schalk (michellerundschalk, München) ning Katrin Koov (KAVAKAVA, EKA maastikuarhitektuuri õppekava juht)

  1. Miks Milla? = Почему Милла? / Anna Fedina

    Index Scriptorium Estoniae

    Fedina, Anna

    2009-01-01

    Hollandi režissöör Paul Verhoeven valis filmi "Lumekuninganna" Amalia Bežetskaja rolli Milla Jovovichi. Film vändatakse Boriss Akunini romaani "Azazel" / "The Winter Queen" järgi. Filmivõtete algus on planeeritud juuliks 2009 Peterburis

  2. Mikä vetää verkkokauppaan? Saavutettavuuden ja sosioekonomisten tekijöiden vaikutus ruokaostosten tekoon verkossa

    OpenAIRE

    Rintamäenpää, Erika

    2017-01-01

    Verkkokauppa on kasvattanut tasaisesti osuuttaan kaikesta vähittäiskaupasta viimeisten vuosikymmenien aikana. Internetyhteyksien yleistyminen ja palveluvalikoiman monipuolistuminen on mahdollistanut yhä useamman kuluttajan pääsyn eri tuotteiden verkkokauppojen tarjonnan äärelle. Verkosta ostamisella on monia ajankäytöllisiä etuja perinteiseen vähittäiskauppaan verrattuna, sillä se mahdollistaa ostosten tekemisen missä ja milloin tahansa. Päivittäistavaroiden verkkokauppa on moniin muihin tuot...

  3. Mikä herättää terveydenhoitajan huolen? : Huolen tunnistamisen ja toimimisen haasteet lastenneuvolassa ja kouluterveydenhuollossa

    OpenAIRE

    Poutiainen, Hannele

    2016-01-01

    The universal services and regular, extensive health check-ups at child health clinics and school health services provide an opportunity to reach the entire age cohort. This enables the assessment of risk factors affecting children, adolescents and families, the identification of potential need for support, and the targeted provision of assistance and support at an early stage. The purpose of the study was to chart the concerns that arise in public health nurses during health check-ups o...

  4. Mis on ökoloogiline maksureform ja miks on seda vaja? / Silja Lüpsik, Urmas Koidu

    Index Scriptorium Estoniae

    Lüpsik, Silja

    2005-01-01

    Ökoloogilisest maksureformist nii teooria kui praktika seisukohast, reformi põhimõistetest. Eestis kavandatava ökoloogilise maksureformi eesmärkidest, elluviimise põhimõtetest ja ajakavast, meetmetest ning oodatavatest tulemustest. Graafik. Diagrammid. Tabel

  5. Miks köögiviljakuningad ei taha ühineda? / Silja Lättemäe

    Index Scriptorium Estoniae

    Lättemäe, Silja, 1952-

    2006-01-01

    Euroopa Liit hüvitab osaliselt ühistegevuse kulud köögiviljasektoris. Eesti köögiviljakasvatajatel ei ole õnnestunud oma tootjaorganisatsiooni luua. Eesti juhtivad köögiviljatootjad on Ants Pak Kadarbiku talust, Kalle Reiter Agro AS-ist ja Johannes Valk Laheotsa talust. Vt. ka: Juur- ja köögiviljade eksport Eestist 2005. a jaanuar-oktoober

  6. Matkafoto 2002 / Kaupo Kikkas

    Index Scriptorium Estoniae

    Kikkas, Kaupo, 1983-

    2003-01-01

    Konkursi võitis Valdek Udris fotoga "Nägemus" Mont Blanci vallutamisest, teine oli Marten Kaevatsi foto "Priimusele" ja Peeter Saabase foto "Ajaviitemuusika", kolmanda koha said Aivo Kärbo, Arne Sarapuu ja Viktor Palm

  7. Tosin Pärnumaalast haris end noorõpetaja juhendajaks / Silvi Kanošina

    Index Scriptorium Estoniae

    Kanošina, Silvi

    2005-01-01

    Vestlusest Tallinna Ülikooli avatud ülikooli juures mentorikursuse läbinud Sauga Põhikooli nooremõpetaja Mari Leesarega ja Tallinna Ülikooli avatud ülikooli täiendusõppe programmijuhi Valdek Rohtmaga

  8. Väätsa Agro omanik: ma ei usu, et pank pankroti korral võidab. Intervjuu Priit Veeringuga / Priit Veering ; intervjueerinud Hannes Sarv ; kommenteerinud Mart Siilivask

    Index Scriptorium Estoniae

    Veering, Priit

    2011-01-01

    Väätsa Agro omanikke esindava Hanseatic Capitali juht ütleb, firma saneerimiskava on üles ehitatud selliselt, et kõik võlausaldajad saaksid rohkem kui firma pankroti korral. Ettevõte suudab oma tegevust käigus hoida ja põhitegevuses ollakse juba kasumis

  9. Pärnograafiline / Andreas Trossek

    Index Scriptorium Estoniae

    Trossek, Andreas, 1980-

    2007-01-01

    Priit Pärna näitus Kumu Kunstimuuseumis kuni 21. X. Kuraator Eha Komissarov. 11. V toimus Kumu auditooriumis Priit Pärna loomingule pühendatud rahvusvaheline seminar, peaesinejaks oli Edwin Carels Belgiast. Esitamisele tuli filmiprogramm Priit Pärna filmidest ning toimus ümarlaud, milles osalesid Andreas Trossek, Mari Laaniste ja Priit Pärn

  10. Muusikamaailm : James Levine 25 aastat Metis. Taveneri ja MacMillani millenniumiteosed. Avafestival Sydneys / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    J. Harbisoni ooperi "The Great Gatsby" esmalavastusega tähistab New Yorgi Metropolitan Opera oma 25-aastast koostööd J. Levine'iga. J. Taveneri uudisteosest "The Fall and Resurrection", J. MacMillani millenniumiteose "Magnificat" maailmaesiettekandest. 5.-26. jaan. toimuvast Sydney muusikafestivalist

  11. Muusikamaailm : Uus hooaeg ooperiteatrites, kontserdimajades. Elliott Carteri esikooper. Birgit Cullberg surnud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Uue hooaja kavadest Los Angeles Operas, Kölni Opernhausis, New York City Operas, Inglise Rahvusooperis, San Francisco Operas; Detroidi Sümfooniaorkestri, Turu ja Helsingi Linnaorkestri ja San Francisco Symhony Orchestra hooaja avakontserditest. E.Carteri esikooperi "What Next" maailmaesiettekandest Berliini Riigiooperis. B.Cullbergi tegevusest

  12. Muusikamaailm : Pfingstfestspiele (suvistefestival) Baden Badenis. Glyndebourne'is, Leipzigis... . Strasbourg Pariisis. Alfred Brendeli juubeliks / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    H. von Karajani mälestuseks korraldatud suvistepühafestivalist Baden Badenis. Festivalidest : Glyndebourne'i ooperifestivalist, Leipzigi Bachi festivalist, Schwetzingeni lossifestivalist. Strasbourg'i ooperiteatri külalisetendustest Pariisi Chatelet' teatris. A.Brendeli 70. juubeli tähistamisest Londoni South Bank Centre'is

  13. Raul Eamets: kuidas anda töötutele lootust? / Raul Eamets ; intervjueerinud Priit Simson

    Index Scriptorium Estoniae

    Eamets, Raul, 1964-

    2010-01-01

    Töötuid aitavad lühemas perspektiivis sotsiaalsed töökohad ja palgadotatsioonid, võimalus lubada osaajaga töötamist, kusjuures säiliks töötu abiraha mingis proportsioonis. Pikaajaline töötu ei peaks tööpakkumiste puhul väga valiv olema

  14. Hansapank Eesti uus juht alustab tasa / Priit Perens ; interv. Hetlin Villak

    Index Scriptorium Estoniae

    Perens, Priit, 1964-

    2008-01-01

    Hansapank Eesti uus juht vastab küsimustele, millised on esimesed ülesanded uuel ametipostil, mis hakkab toimuma laenuturul, kas Hansapank jätkab konservatiivset laenupoliitikat, kas ta lähitulevikus näeb euribori tõusu või pigem langust

  15. Muusikamaailm : Messiaeni mälestusfestival. Masuri lahkumiskontserdid USAs. Kolmest kaotusest / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Olivier Messiaeni mälestusfestivalist "musik sehen, licht hören". Kurt Masur lahkub New Yorgi Filharmoonia orkestri peadirigendi ametist. Teated Xavier Montsalvatge, Dorothy DeLay ja Dzhansug Kahhidze surmast

  16. Muusikamaailm : "MaerzMusik" Berliinis. Rostropovitshi juubel algas. Wolfganf Rihm 50 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Endine Saksa DV "Musik-Biennale Berlin" hakkab kandma uut nime "MaerzMusik. Festival für aktuelle Musik". 75aastaseks saav Mstislav Rostropovitsh tähistab oma juubelit mitmete kontsertidega. Lühidalt saksa helilooja Wolfgang Rihmist, kes sai hiljuti 50-aastaseks

  17. Kas e-äri võrdub pankrotiga / Priit Vaikmaa

    Index Scriptorium Estoniae

    Vaikmaa, Priit

    2001-01-01

    E-äride pankrotilaine aastal 2000. Firmadevaheline äri internetis - B2B (business-to-business). B2B ärikeskkondade kodulehekülgede aadressid. B2B ja e-äri lahenduste pakkujad Eestis. Diagramm: B2B e-kommertsi prognoositud käive 2004.a.

  18. Sõjareporter peab ajakirjanduse objektiivsust kättesaamatuks / Allan Little ; interv. Priit Pullerits

    Index Scriptorium Estoniae

    Little, Allan

    2005-01-01

    Briti telekompanii BBC staazhikas väliskorrespondent vastab küsimustele, mis puudutavad BBC saadete objektiivsust, telekompanii vasakliberaalseid hoiakuid, BBC suhtumist Iisraeli-Palestiina konflikti ning keerukate välispoliitiliste teemade kajastamist. Lisa: Allan Little

  19. Sundsäästmine Soome kaitseväes / Priit Silla

    Index Scriptorium Estoniae

    Silla, Priit

    2005-01-01

    Soome Eduskund võttis vastu rahakärpimise ettepaneku, mis näeb ette Savo brigaadi, Helsingi õhutõrjerügemendi ja Kotka rannakaitseüksuse hajutamist 2007. aasta alguses. Kokku tuleb hoida vähemalt 50 miljonit eurot. Kaart

  20. Lääne maleva patrullvõistlus Valge laev / Priit Silla

    Index Scriptorium Estoniae

    Silla, Priit

    2005-01-01

    Läänemaal Keedika ja Tuksi vahel peeti 2-3. aprillil järjekordne Lääne maleva patrullvõistlus, mille eesmärgiks oli kontrollida luurepatrullide ettevalmistust ja selgitada Lääne maleva võistkond Eel-Ernal. Osales 27 võistkonda üle Eesti

  1. Vabadusvõitlejad väärivad tunnustust / Priit Silla

    Index Scriptorium Estoniae

    Silla, Priit

    2003-01-01

    23. augustil pidasid Eesti vabadusvõitlejad Rakveres 11. kokkutuleku. osalesid Riigikogu liikmed Tunne Kelam ja Trivimi Velliste, justiitsminister Ken-Marti Vaher. Vastu võetud avaldusest EL-iga liitumise kohta

  2. Vene juudid Ameerikas ehk Nõukogude Liidu Jurassic Park / Boris Fishman ; intervjueerinud Priit Hõbemägi

    Index Scriptorium Estoniae

    Fishman, Boris

    2016-01-01

    Intervjuu Tallinna külastanud ameerika kirjaniku Boris Fishmaniga, kes pidas Tallinna ülikoolis loengu ja vestles ameerika vene-juudi kultuuri teemal. Eesti keeles ilmus tema teos "Asenduselu" 2015. aastal

  3. Horisontaalsed eesmärgid ja hankelepingu esemega mitteseotud hindamiskriteeriumid riigihankemenetluses / Priit Lember

    Index Scriptorium Estoniae

    Lember, Priit, 1987-

    2013-01-01

    Mittemajanduslikest ehk horisontaalsetest eesmärkidest Euroopa Liidu riigihankemenetluses. Vastavast kohtupraktikast ja UNICITRALi mudelseadusest. Artikkel põhineb 2013. aasta kevadel Tartu Ülikooli õigusteaduskonnas kaitstud magistritööl "Keskkonnakaitselised horisontaalsed eesmärgid riigihankemenetluse pakkumuste hindamise staadiumis"

  4. Soomlaste oma Eesti ajalugu / Heino Arumäe, Mati Graf, Priit Raudkivi

    Index Scriptorium Estoniae

    Arumäe, Heino

    2008-01-01

    Rets. rmt.: Seppo Zetterberg. Viron historia. Helsinki, 2007. Suomalaisen Kirjallisuuden Seuran Toimituksia ; 1118. Tegemist on mahukaima mitteeestlase sulest ilmunud Eesti ajalugu käsitleva teosega. Teos on mõeldud soome lugejale. Rikkalikult illustreeritud raamatu paljude fotode autor on Seppo Zetterberg ise

  5. Muusikamaailm. Festival ECLAT Stuttgardis. Ooperiõhtute tipphetki. Liebermanni "Medea" Pariisis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Uue muusika festivalist Stuttgardi Theaterhausis. Ooperiõhtute tipphetki Milanos, Karlsruhes, New Yorgis. Pariisi Rahvusooperis Opera Bastille's tuli esiettekandele Rolf Liebermanni lavatükk "Medea".

  6. Toit ja restoran peavad rääkima sama lugu / Peeter Pihel ; intervjueerinud Priit Pruul

    Index Scriptorium Estoniae

    Pihel, Peeter

    2015-01-01

    Intervjuu Rootsi parima restorani Fäviken Magasineti sous chef'i ehk peakoka parema käe Peeter Piheliga olulisest tänapäeva restoranide kommunikatsioonis, kommunikatsiooni korraldusest Fäviken Magasinetis

  7. Uus president lubab Portugali rahakotti täita / Priit Kivi

    Index Scriptorium Estoniae

    Kivi, Priit

    2006-01-01

    22. jaanuaril Portugalis toimunud presidendivalimised võitis Portugali endine paremtsentristist peaminister Anibal Cavaco Silva, kes kogus 50,6 protsenti valijate häältest. Lisa: Anibal Cavaco Silva

  8. Ohtlike jäätmete lao põleng Irus / Priit Orusalu

    Index Scriptorium Estoniae

    Orusalu, Priit

    2004-01-01

    4. juunil 2004. a. Iru ohtlike ainete laos toimunud tulekahju tõi välja kitsaskohad päästeteenistuste tegevuses. Kommenteerivad Päästeameti operatiivteenistuse osakonna juhataja Mart Haljaste ja Põhja-Eesti häirekeskuse juhataja Eva Rinne

  9. Loomade kohtlemine kui tsiviliseerituse mõõdupuu / Peter Singer ; tõlkinud Priit Simson

    Index Scriptorium Estoniae

    Singer, Peter, 1946-

    2011-01-01

    Loomakaitseseadustest Suurbritannias (loomadest tsirkuses), Hollandis (loomade uimastamisest enne tapmist), Hiinas (loomade väärkohtlemisest loomaaedades), Euroopa Liidus (kariloomade ja kanade liikumisruumi piiratusest), Ameerika Ühendriikides (kariloomade kohtlemisest)

  10. Millise tuleviku You Tube meile toob? / Peeter Marvet ; interv. Pullerits, Priit

    Index Scriptorium Estoniae

    Marvet, Peeter, 1970-

    2008-01-01

    Tehnokratina tuntud Peeter Marvet, uue meedia juhtiv asjatundja Eestis, on viimastel aastatel jälginud noorte ja internetiga toimuvat kogu maailmas, mistõttu Postimees palus tema hinnangut, milline võiks olla veebi roll Soome koolimõrvades

  11. Kumb on targem, kas lind või ahv? / Priit Ennet

    Index Scriptorium Estoniae

    Ennet, Priit

    2016-01-01

    Onur Güntürkün Bochumi Ruhri Ülikoolist ja Thomas Bugnyar Viini Ülikoolist kummutavad oma artiklis seisukoha, et lindude mõistus küünib ahvide omaga samale tasemele üksnes mõnedes väga kindlates olukordades

  12. Rasked valikud tehtud! : ajalookirjanduse aasta- ja Tuna artiklipreemia 2014 / Priit Raudkivi

    Index Scriptorium Estoniae

    Raudkivi, Priit, 1954-

    2014-01-01

    Ajalookirjanduse aastapreemia nominentidest. Aastapreemia: "Eesti ajalugu. III. Vene-Liivimaa sõjast Põhjasõjani". Artiklipreemia: Lea Kõiv "Uue vagaduse otsinguil. Andreas Sandhagen ja ortodoksne luterlus Tallinnas"

  13. Muusikamaailm : Külluslik ooperisuvi Londonis. Dirigent Carlos Kleiber ئ 70. Soome festivalid helisevad / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Peterburi Maria Teatri ooperitrupi külalisetendustest Londonis Covent Gardenis. Lühidalt C. Kleiberist. Festivalidest Soomes ئ Ilmajoe muusikapidustustest, Naantali 21. festivalist, Avanti! festivalist Porvoos, Korsholmi festivalist, Savonlinna ooperifestivalist

  14. Sõltumatud kodanikud otsustavad superriigi juhi saatuse / Christopher Kukk ; interv. Priit Pullerits

    Index Scriptorium Estoniae

    Kukk, Christopher

    2008-01-01

    Eesti päritolu Lääne-Connecticuti politoloogiaprofessor vastab küsimustele, mis puudutavad USA presidendivalimisi ja presidendikandidaatide Barack Obama ja John McCaini võimalusi. Vt. samas: Kes on Christopher Kukk?

  15. Lobitööd pole vaja keelata / Idir Laurent Khiar ; intervjueerinud Priit Pruul

    Index Scriptorium Estoniae

    Khiar, Idir Laurent

    2016-01-01

    Lobitegevuse reguleerimisest. Intervjuu 2007.-2009. aastate finantskriisi ajal valitsus- ja tööstussuhete juhina rahvusvahelise kindlustusettevõtte juures töötanud Idir Laurent Khiariga lobitegevusest ning era- ja avalike huvide läbipõimunud suhetest

  16. Meelelahutuse kaks erinevat palet käibemaksu kontekstis / Priit Lätt

    Index Scriptorium Estoniae

    Lätt, Priit, 1976-

    2005-01-01

    Autori kriitika Eesti käibemaksuseadusele meelelahutusvaldkonna kontekstis, mis on vastuolus põhiseadusega, maksuõiguse põhimõtetega ning Euroopa Liidu õigusega. Lisatud: Urboja, Liina. Kultuuriministeerium ei nõustu artikli tõlgendusega, lk. 31 ; Lehis, Lasse. Järjekordne näide meie seadusloome kvaliteedist, lk. 32-33 ; Koidu, Urmas. Eestis kehtiv käibemaksuseadus ei ole kultuuriteenuste maksustamisel Euroopa Liidu õigusega vastuolus, lk. 34-35. Vt. ka: http://www.maksumaksjad.ee/modules/smartsection/item.php?itemid=144 ; http://www.maksumaksjad.ee/modules/smartsection/item.php?itemid=142.

  17. Moraalset lõivu maksmata on raske äri ajada / Priit Jõgi

    Index Scriptorium Estoniae

    Jõgi, Priit, 1970-

    2003-01-01

    Autor arutleb ettevõtjate ning poliitikute sidemete üle Eestis ning leiab, et parteide toetamisele ettevõtete poolt tuleks seada teatavad piirangud, parteide rahastamise keelamise asemel tuleks see muuta läbipaistvamaks.

  18. Muusikamaailm : "Euroopa muusikakuu" Baselis. Leif Ove Andsnes Londonis. Konkursipreemiaid. Monte Pederson lahkunud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Novembrikuus elab šveitsi linn Basel "Euroopa muusikakuu" tähe all. Noor norra pianist Leif Ove Andsnes kutsuti Londonisse esinema. Konkursipreemiaid erinevatel konkurssidelt. Suri ameerika laulja Monte Pederson

  19. Esileedi Evelin Ilves läheb Kaleviga kommisõtta / Priit Pullerits ; kommenteerinud Monika Heinrand

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2009-01-01

    Liikuvat eluviisi ja tervislikku toitumist propageeriv proua Evelin Ilves on otsustanud alustada võitlust transrasvhappeid sisaldavate toiduainete vastu. Proua E. Ilves koostas nimekirja maiustustetootja Kalevi kommidest, mis märgistuse järgi sisaldavad transrasvu. Arvamust avaldavad Kalevi turundus- ja müügidirektor Monika Heinrand, kirjanik Andrus Kivirähk, koduperenaine Kadi Tarand, Tallinna Tehnikaülikooli toiduainete instituudi direktor professor Raivo Vokk. Vastukajad artiklile vt. Postimees 30. sept. 2009, lk. 15: Petrone, Epp. Poes tuleb tähelepanelik olla; Tuiksoo, Ester. Hoidkem Eesti toitu ja toiduainetetööstust; Õhtuleht 3. okt. 2009, lk. 7: Kerge, Rainer. Mahetomat tapab!; Eesti Päevaleht 5. okt. 2009, lk. 2: Teemägi, Tiina. Aasta turundustegu; Pehme, Sirli. Transrasvu tuleb vältida; Õhtuleht 5. okt. 2009, lk. 8: Kummardus Evelinile!; Rulluisud ja transrasvad; Terviseleht 6. okt. 2009, lk. 2: Laane, Aleksander. Solaariumid ja transrasvad; Postimees 13. okt. 2009, lk. 12-13: Strider, Roy. Kellele on transrasvad kasulikud?; Kambek, Liis. Transrasvhapped on üleilmne probleem; Postimees 17. okt. 2009, lk. 14: Kuusk, Hendrik. Toidupoes ei müüda mürgikokteile; Õhtuleht 24. okt. 2009, lk. 9: Levin, Adik. Igaühel on õigus toituda tervislikult; Eesti Päevaleht 27. okt. 2009, lk. 3: Trisberg, Aet. Luubiga poodi; Postimees : AK 5. dets. 2009, lk. 12 karikatuur transrasvade teemal

  20. Kriminaalõiguse professor Jaan Sootak toetab Rein Langi ideed / Andrus Karnau, Priit Rajalo

    Index Scriptorium Estoniae

    Karnau, Andrus

    2006-01-01

    Justiitsmnisteeriumis valmivast seadusemuudatusest seoses pedofiilide isikuandmete avalikustamisega. Lisatud Rein Langi vastused Postimees Online lugejate küsimustele: Lang tahab pedofiilid avalikkuse ette tirida. Intervjuu täistekst: http://www.postimees.ee

  1. Kui euro saab saatuslikuks / Paul Krugman ; tõlkinud Priit Simson

    Index Scriptorium Estoniae

    Krugman, Paul, 1953-

    2010-01-01

    USA majandusprofessori hinnangul ei ole eelarvedistsipliin Euroopa hädade kogu põhjus, ka mitte Kreekas. Tegelik põhjus peitub poliitilises eliidis, mis survestas Euroopat eurole üle minema oluliselt varem, kui Euroopa selliseks katsetuseks valmis oli. Kriisi keskmes asetseb euro paindumatus, mitte eelarvedefitsiidini viiv kulutamine

  2. Imemaade sportlased lisasid suusavõistlustele värvi ja elevust / priit Pullerits, Raigo Pajula

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 28. veebr., lk. 13. Ligi pool tundi Veerpalule kaotanud Tai ja Costa Rica murdmaasuusatajad ammutasid olümpiamängudelt rahulolu ja rõõmustasid finishisse jõudmise üle

  3. Muusikamaailm : Drottningholmi lossifestival. Jorma Panula juubeliks. Kaks kompositsioonipreemiat. Soomlased ja eestlased promenaadikontsertidel / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    31.05-2.09 toimuvast Drottningholmi lossiteatri festivalist. J. Panula 70. juubeli kontserdist "Meister ja õpipoisid" 9. augustil Helsingi Finlandiatalos. Tänavuse Ernst von Siemensi fondi preemia sai elutöö eest M. Kagel, toetuspreemia noorema põlve heliloojatele pälvisid A. R. Thomas, H. Kyburz ja A. L. Scartazzini. Grawemeyer 2000 Music Prize'i laureaat on T. Ades orkestriteose "Asyla" eest, lühidalt Grawemeyeri preemiast. Kontserdifestivalist "Promenaadisari" Londoni Royal Albert Hallis, eesti ja soome muusikute osalemisest festivalil

  4. Kasvuvisioon 2018 - Eesti riigi järgmine juhtimisülesanne / Priit Põldoja

    Index Scriptorium Estoniae

    Põldoja, Priit, 1969-

    2010-01-01

    Ettevõtja hinnagul peab Eesti riigil olema aktiivne ettekujutus, kuidas positiivselt eristuda ja kuhu edasi liikuda. Arengufondi initsiatiiv Eesti kasvuvisiooni loomisel peaks leidma ühel või teisel viisil tee Eesti otsustajate tegevuskavva

  5. IT Pealinnas oled sa õnnelik: meie-aasta / Priit Kongo, Aune Past

    Index Scriptorium Estoniae

    Kongo, Priit

    2016-01-01

    2015. aasta Eesti Suhtekorralduse Auhinna konkursil pälvis sisekommunikatsiooni preemia Net Group projekti eest "IT-pealinnas oled sa õnnelik: meie-aasta", mille eesmärgiks oli ettevõtte kui hea tööandja maine kujundamine. Žürii hinnangul oli tegemist loomingulise ja oskusliku lähenemisega sisekommunikatsioonile, millega ettevõte suutis loomulikul viisil kaasata oma töötajad firma tegevustesse ja kogukondadesse

  6. Muusikamaailm. Maailmaesiettekanne Krimmis. Herderi preemiad 2002. Opera Metz 250. Günter Wand 90 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Krimmis leiab aset Alemdar Karamanovi sümfoonia "Täideläinu" maailma esiettekanne. Johann Gottfried Herderi muusikapreemia sai nimekas rumeenia helilooja Aurel Stroe. Opera Metz Prantsusmaal tähistab oma 250ndat aastapäeva mitmete uuslavastustega. Dirigent Günter Wand tähistab 90ndat juubelit

  7. Inimloetav ja masinloetav : mõistete analüüs / Priit Parmakson

    Index Scriptorium Estoniae

    Parmakson, Priit

    2011-01-01

    Infoühiskonnas on iseloomulik struktuuristatud, masintöötlemisele orienteeritud teabe osakaalu kasv, mille ilming on ka Eesti avalikus sektoris mitmes valdkonnas käsil olev sellesuunaline IT töö

  8. Uudised : Õhtu Metropolitan Operas. Järvi Michigani ülikooli audoktoriks / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    "Klassikaraadio" vahendab 25. dets. otseülekande New Yorgist Metropolitan Operast, kus tuleb ettekandele W.A. Mozarti ooper "Figaro pulm". 19. dets. nimetati N. Järvi Michigani ülikooli audoktoriks

  9. Maa ja taevas = Heaven and Earth / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2013-01-01

    Soome telekommunikatsiooniettevõtte Nokia edust. Eesti maismaast üle viiekümne protsendi moodustavad metsad, mis on üks suurimaid väärtusi tänapäeva maailmas. Et leida oma Nokia, tuleb mõnikord istuda lennukisse ja tõusta pilvepiirile, et sealt alla vaadata

  10. Uudised : Neeme Järvi plaadistusplaanid. Muusikamehi Kuusalu-Kolga mailt. Concerto Grosso suvest / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    N. Järvi plaadiprojektidest Göteborgi SO-ga firmadele Deutsche Grammophon ja Bis. 25. aug. Kolgas toimunud kodupärimuskonverentsist "Kuulsaid muusikamehi Kuusalu-Kolga mailt". Kontserdiagentuuri Concerto Grosso lõppenud kontserdisarjast "Eesti mõisad 2001"

  11. Autoritaarse kapitalismi pealetung / Timothy Garton Ash ; tõlk. Priit Simson

    Index Scriptorium Estoniae

    Garton Ash, Timothy, 1955-

    2008-01-01

    Autor on seisukohal, et 8. augustil teatasid oma naasmisest ajalooareenile kaks suurriiki: Venemaa ja Hiina. Nad on esitanud väljakutse läänele ning esindavad alternatiivseid versioone autoritaarsest kapitalismist või kapitalistlikust autoritarismist

  12. Euroopa tõehetk / Timothy Garton Ash ; tõlkinud Priit Simson

    Index Scriptorium Estoniae

    Garton Ash, Timothy, 1955-

    2009-01-01

    Käsitledes kriisi Euroopas, sh. Ida- ja Kesk-Euroopa riikides, ütleb autor, et Euroopa projekti tulevik on küsimärgi all. Edasiminekuks vajab Euroopa praktilist konstruktsiooni, selle saavutamine sõltub globaalsetest jõududest, Euroopa juhtide tasemest ning rahvuslike valijate võimaldatud tegevusruumist ja usaldusest

  13. Dopinguainete tuvastamine sai ootamatu tagasilöögi / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2008-01-01

    Vt. ka Postimees : na russkom jazõke 30. mai, lk. 18. Rootsi teadlased on avastanud, et keelatud ainete nimekirja kuuluvat testosterooni, mille süstimine tugevdab lihaseid ning suurendab treeningukoormuste talumise võimet, pole sugugi võimalik kõigi sportlaste organismis avastada

  14. Vanity Fair peab Skype'i töötajaid veidrikeks / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2005-01-01

    Üldhuviajakirja Vanity Fair septembrinumber kirjeldab Skype'i Tallinnas asuva tehnilise peakorteri töötajaskonda paadunud tehnoloogianohikuina, keda iseloomustab ebakindel ja kobav sotsiaalne käitumine

  15. Muusikamaailm : "Windrose" Ruhrimaal. Mauricio Kagel 70. Aasta 2001 ooperitipud. Garcia Navarro lahkunud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Ruhri piirkonna kuues linnas leiab aset Euroopa festival "Windrose". Hispaania helilooja, dirigent ja professor Mauricio Kagel tähistas oma 70. sünnipäeva. Ajakiri Opernwelt tegi kriitikute hulgas küsitluse selgitamaks läinud aasta paremaid saavutusi ooperi vallas. 60aastasena suri Madridis hispaania ooperidirigent Garcia Navarro

  16. Tallink kaalub müüki pandud Silja Line'i ostu / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2005-01-01

    Soome Silja Oy AB omanikfirma Sea Containers otsustas 2. novembril Silja Line'i müüki panna, kuna laevafirma kasumlikkus on järsult vähenenud. Tallink Grupi finantsdirektori Janek Stalmeistri sõnul on Tallinki võimalikku ostuhuvi Silja Line'i vastu vara veel kommenteerida. Lisa: Silja laevad

  17. Clinton lubas isiklikult aidata Eesti üle Euroliidu läve / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2002-01-01

    USA ekspresident Bill Clinton lubas isiklikult kaasa aidata, et iirlased ütleksid rahvahääletusel Nizza lepingule jah-sõna. Vt. samas küsimusele, kuidas peaks Eesti reageerima Clintoni ettepanekule vastavad Lennart Meri, Siim Kallas, Mart Laar, Gunnar Hololei. Parlamendisaadik

  18. Muusikamaailm : Rahvusvahelised festivalid juunis. New Yorgi Filharmoonikud Euroopas. Suri Oskar Czerwenka / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Rahvusvahelistest festivalidest juunis : Aldeburghi festivalist Inglismaal, Salzburg Whitsun Baroque Festivalist, Bathi festivalist, Spoleto festivalist Charlestonis USAs, San Francisco festivalist. New Yorgi Filharmoonikute Euroopa-turneest. Lühidalt O. Czerwenka tegevusest

  19. Tšetšeenid, Leivo ja Austria / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2004-01-01

    Eesti, Läti, Leedu ja Austria siseministrid esitasid ühise idee rajada Ukrainasse tšetšeeni põgenikele pagulaslaager. Autor selgitab, mis huvid võisid olla Eesti ja Austria siseministritel sellise idee esitamisel

  20. Kes on šõuilma tuntuimad (pool)eestlased? / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2009-01-01

    Eesti päritolu maailmas tuntud meelelahutusmaailmas osalejatest (Mena Suvari, Ornella Muti, Miliza Korjus, Kalev Mark Kostabi, Edmund Valtman, Erika Eleniak, Alar Kivilo, Ants Robert Kristian Luuk, Sonny Arahanga jt)

  1. Eksminister Aavo Mölder hoiab põllumajandust kõige kiuste elus / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2005-01-01

    Ekspõllumajandusministri Aavo Möldri poolt juhitavast AS-ist Tartu Agro. Lisa: Kohalikud kuningad: Aavo Mölder. Kommenteerivad AS-i Tartu Agro nõukogu esimees Mart Avarmaa ja OÜ Haage Agro juhatuse liige Andres Härm

  2. Postimehe pidulõunal ilmus Eesti otsustajaile ähvardav Trooja hobune / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2007-01-01

    Radisson SAS hotellis toimunud Postimehe traditsioonilise arvamusliidrite lõunasöögi teemaks oli "Postimees 150 - Kui kauaks eesti meest?" President Toomas Hendrik Ilvese ja Euroopa Kontrollikoja liikme Kersti Kaljulaiu mõtteid. Küsimusele "Millega teeb eesti mees endale liiga?" vastavad kirjanik Kadri Kõusaar, ettevõtja Rein Kilk, näitleja Peeter Oja, poliitik Evelyn Sepp. Küsimusele "Kas teie erakonnal on plaanis veel enne valimisi tõsiselt käsitleda Euroopa Liidu (EL) teemat, mille unarussejätmisele president viitas?" vastavad Isamaa ja Res Publica Liidu kaasesimees Tõnis Lukas, Eestimaa Roheliste eestkõneleja Marek Strandberg, Sotsiaaldemokraatliku Erakonna esimees Ivari Padar, Riigikogu Keskerakonna fraktsiooni esimees Ain Seppik, Riigikogu Rahvaliidu fraktsiooni esimees Jaanus Männik. Vt. samas: Piirivalvurid Aafrikasse. President Toomas Hendrik Ilvese sõnul võiks Eesti piirivalve patrullida Aafrika ja Kanaari saarte vahelistel vetel. Ilmunud ka: Postimees : na russkom jazõke 10. jaan. 2007, lk. 2-3

  3. Muusikamaailm : Festival "Ultima" Oslos. Kaks juubilari šveitsist. Honeckil juba kaks orkestrit / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Nüüdismuusikafestivalist "Ultima" Oslos. šveitsi muusikategelased Tibor Varga ja Rudolf Kelterborn tähistasid juubelit. Noorel austria dirigendi Manfred Honeck'i juhatada on kaks orkestrit- Rootsi Raadio Sümfooniaorkester ja Oslo Filharmoonia Orkester

  4. Kristjan Järvi juhatab Pärdi maailmaesiettekannet Viinis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2008-01-01

    Arvo Pärdi teose "Stabat Mater" segakoori- ja keelpilliorkestriversiooni maailmaesiettekandest 12. juunil Viinis ja dirigent Kristjan Järvi tegemistest. Bariton Lauri Vasar laulmas Hans Werner Henze ooperis "Phaedra" Berliinis, Brüsselis ja Viinis

  5. Kalle Lasn: telekanalid andku eetriaega inimestele tänavalt / interv. Priit Simson

    Index Scriptorium Estoniae

    Lasn, Kalle, 1942-

    2004-01-01

    Kanadas tegutseva Eesti päritolu tarbimiskriitiku Kalle Lasniga valmivast raamatust "Design Anarchy", tema võitlusest vaimse keskkonna puhastumise eest ja suurfirmade pähemäärimiskunsti vastu. Kalle Lasnist

  6. 3D-animatsii na stroitelnom rõnke - eto elitnõi tovar / Priit Rum

    Index Scriptorium Estoniae

    Rum, Priit

    2006-01-01

    Praegu on 3D-visualisatsioonide põhilisteks tellijateks kinnisvaraarendajad ja arhitektuuribürood. Kommenteerivad Agor Eiskop, Indrek Tiigi, Margus Triibmann, Piret Piirsoo, Merle Väli. Ill.: Fahle maja, Allika t. 12 korterelamu ja Merirahu elamurajoon Tallinnas

  7. Uudised : Gennadi Tanieli autorikontsert. Tallinna XII barokifestival. Tubina ühing koguneb / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    21. jaan. toimus sarjas "Eesti heliloojad talveaias" G. Tanieli autorikontsert. 1.-11. veebr. toimuvast Tallinna XII Barokkfestivalist. 27. jaan. toimub EMAs Rahvusvahelise Eduard Tubina Ühingu esimene aastakoosolek, koosoleku päevakorrast

  8. Elisabeth Rehn : parem on ise hakkama saada / Elisabeth Rehn ; interv. Priit Simson

    Index Scriptorium Estoniae

    Rehn, Elisabeth, 1935-

    2008-01-01

    Soome endine kaitseminister on seisukohal, et Soome oleks pidanud NATO-ga ühinema tükk aega tagasi. Ta toetab NATO-t jätkuvalt, kuid ei tunne end samasuguse NATO entusiastina nagu 5 või 7 aastat tagasi

  9. Uudised : Chopini millenniumigala. Tosina kontserdiga Ameerikasse. New York Times Paavo Järvist / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    30. jaan. Estonia kontserdisaalis F. Chopini loomingule pühendatud kontserdist, esinesid ka Narva noorte pianistide konkursi võitjad. Kammerkoori ja -orkestri Ameerika-turneest, kontsertide kavast Ameerikas. Seoses P. Järvi määramisega Cincinnati SO muusikadirektoriks avaldas The New York Times 26. jaan. asjakohase artikli

  10. Cthulhu Fhtagn! 10 teost, mida kindlasti kuulata / Stijn Van Cauter ; interv. Priit Kenkmann

    Index Scriptorium Estoniae

    Van Cauter, Stijn

    2007-01-01

    Küsimustele doom-metali alazhanrist funeral-doomist vastavad belgia muusik Stijn Van Cauter, Taani muusik Nortt ja soome bändi Thergothoni juhtfiguur Niko "Scorpio" Sirkiä. Doom-muusikaga heliplaatidest

  11. Muusikamaailm : Boulezi juubelipäev. Süüdistusfilm natsidele. Hooajapool Washingtoni Ooperis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    P. Boulezi 75. juubeli puhul toimuvatest muusikasündmustest Londonis. E. Weissweileri dokumentaalfilmist, mis räägib natsi-Saksamaa muusikaröövidest, mille käigus konfiskeeriti pille, varastati ja hävitati helitöid. P. Domingo tegevusest Washington Opera juhina, dirigendina ja solistina

  12. Terror põrkub EL-i ja Vahemere ühisrindega / Priit Kivi

    Index Scriptorium Estoniae

    Kivi, Priit

    2005-01-01

    Hispaanias Barcelona tippkohtumisel jõudsid Euroopa Liit ja Vahemeremaad kompromissini terrorismivastases võitluses, lisaks arutati ebaseadusliku sisserände ohjeldamist, Euro-Vahemere vabakaubandustsooni loomist aastaks 2010, võimalusi majanduskoostöö suurendamiseks, kaubanduse liberaliseerimiseks ning kodanikuühiskonna rolli tugevdamist hariduse ja kultuurivahetuse kaudu. Kohtumisest võttis osa ka Eesti peaminister Andrus Ansip. Lisa: Euromed

  13. Muusikamaailm : "Passioon 2000" Stuttgardis. Ojai festivalilt. Boulez dirigeerib ka Edinburghis. Placido Domingo Helsingis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Stuttgardi Rahvusvahelisel Bachi Akadeemia korraldataval Euroopa muusikafestivalil ettekandele tulevatest "tänapäevastest passioonidest". Ojai muusikafestivalist Jaapanis. P. Boulezi 75. sünnipäevale pühendatud kontserdisari "Boulez 2000" jõudis ka Edinburghi festivalile. P. Domingo kontserdist Helsingi olümpiastaadionil, K. Mattila kontserdist Helsingi Areenal

  14. Indrek Kasela, Hamlet ärimaailmas / Indrek Kasela ; intervjueerinud Priit Pullerits ; kommenteerinud Maarja Neilvelt

    Index Scriptorium Estoniae

    Kasela, Indrek, 1971-

    2010-01-01

    Ettevõtja, kino Sõprus taasavaja ning Premia börsile viija Indrek Kasela oma tegevusest fondihaldurina, New Yorgi ülikoolis saadud kogemustest, Eesti ühiskonnakorralduses vaja minevatest muutustest

  15. Dramaatiline Stockholmi mööblimess / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2006-01-01

    Põhjamaade mööbli- ja valgustimess 8.-12. veebr. Stockholmi messikeskuses Älvsjös. Eestit esindasid Standard, Borg jt. Disainer Veiko Liis esitles laserlõigatud vineerlauda "Piloot". Avatud oli Greenhouse ehk sõltumatute disainerite ja kunstikoolide osakond, kus osales Eesti Kunstiakadeemia sisearhitektuuriosakonna üliõpilaste loodud toolidega

  16. Muusikamaailm : Klaverifestival Luzernis. Rahvusvahelistel konkurssidel. Ooperiharuldus Huddersfieldi festivalil. Strausside kontsert ka Helsingisse / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Klaverifestivalist Luzernis. Weimaris toimunud Liszti nim. pianistide konkursi võitjatest, Hannoveris toimunud Joseph Joachimi viiuldajate konkursi võitjatest. Huddersfieldi festivalil etendus C. Vivier' ooper "Kopernikus". Helsingi Messikeskuse Amfisaalis hakatakse korraldama pidulikke uusaastakontserte sarnaselt Viinile, kontserdist 1. jaan. 2001//Labeque, Katia ja Marielle - kanada klaveriduo//Jacques Loussier trio - dzhässtrio//Sibeliuse Akadeemia Sümfooniaorkester

  17. Õpetajate miinimumpalk tõuseb pea veerandi võrra / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2005-01-01

    Haridus- ja teadusministeeriumi teatel tõuseb alates 2006. aastast õpetajapalga alammäär 23 protsendi võrra. Riigikogu liikme Helmer Jõgi hinnangul võib õpetajate alampalga piirmäära tõus tekitada väiksemates omavalitsustes sotsiaalseid pingeid, kuna tekitab liiga suuri palgalõhesid. Tabel: Õpetajate miinimumpalk (bruto)

  18. Ameerika unelm kanti maha, uut pole / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2005-01-01

    Ameerika Ühendriike ja Euroopat ootab ees eesmärkide muutmise aeg, leiab autor analüüsides kirjanik Jeremy Rifkini Euroopa Parlamendi debatil levitatud visioone Euroopa unelmast ja Euroopa Komisjoni esitatud sõnumeid

  19. Briti kuninganna Elizabeth II Eesti-visiidil lasub saladuseloor / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 30. jaan. lk. 2-3. Buckinghami palee teatas 25. jaanuaril, et Briti kuninganna Elizabeth II tuleb koos oma abikaasa Edinburghi hertsogi prints Philipiga oktoobris riigivisiidile Eestisse, Lätti ja Leetu. Lisa: Kõrged külalised

  20. Hispaania elab majanduskriisi ajal paremini, kui võiks arvata / Priit Kivi

    Index Scriptorium Estoniae

    Kivi, Priit

    2010-01-01

    Hispaania peaminister Jose Luis Rodriguez Zapatero lubas pikendada töötuabiraha maksmist 6 kuult 12 kuuni, kohalikes omavalitsustes on mitmesugused stardipaketid väikeettevõtluse käivitamiseks. Hispaanlaste kulutused majandpidamisele on vähenenud vaid 5% ja nn. halbade laenude osa pankade laenuportfellis on samuti 5%. Meetmetest turismi edendamiseks, töötute ametlikust ja mitteametlikust arvust

  1. Uffe Ellemann-Jensen : ärge liialdage hirmudega / Uffe Ellemann-Jensen ; interv. Priit Simson

    Index Scriptorium Estoniae

    Ellemann-Jensen, Uffe, 1941-

    2008-01-01

    Intervjuu endise Taani välisministriga, kes vastab küsimustele, mis puudutavad ülemaailmset finantskriisi ja maailmapoliitikat. Tema sõnul viib finantskriis maailma võimusuhete struktuurinihkeni. Vt. samas: Eluloolist

  2. Ivar Põllu: üritan jääda naiivseks / intervjueerinud Priit Simson

    Index Scriptorium Estoniae

    Põllu, Ivar, 1974-

    2011-01-01

    Tartu Uue Teatri juht Ivar Põllu oma sünnikohast Tootsist, endast, oma tulevikuplaanidest, Eesti teatritest, kultuuri rahastamisest Eestis, Tartu Uuest Teatrist ja selle tulevikust, tahtmisest teha sellist teatrit, mida tahaks ise näha jm. Ivar Põllu sai tänavu algupärase dramaturgia auhinna etenduse "Ird, K." eest, Tartu Uus Teater sai sõnalavastuste eriauhinna

  3. Muusikamaailm : IMC preemia Oscar Petersonile. Kammermuusika Kuhmos. Bachi festival Leipzigis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    O. Peterson pälvis tänavuse Rahvusvahelise Muusikanõukogu preemia (International Music Council/UNESCO Music Prize). 16.-30. juulini toimuvast Kuhmo kammermuusikafestivalist Soomes. Leipzigis toimuvast Bachi-festivalist

  4. Väikesed suured mehed / Joseph Nye ; tõlk. Priit Simson

    Index Scriptorium Estoniae

    Nye, Joseph

    2008-01-01

    Autor väljendab mõtet, et ühiskonnad, mis tuginevad nn, kangelasjuhtidele, arendavad kodanikuühiskonda ja sotsiaalset kapitali liiga aeglaselt, et olla võimelised juhtima tänapäeva võrgustunud maailma ning ei tule toime infoühiskonna väljakutsetega

  5. Na shou tantsa muzhtshinõ gotovõ pokazat superklass / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2006-01-01

    11. juunil Rakveres toimuvast esimesest Eesti meeste tantsupeost, mille idee autor, üldjuht ja lavastaja on tantsuõpetaja Maie Orav. Lisaks Rakvere Teatri direktori Indrek Saare ja Tallinna vangla direktori Toomas Malva arvamused tantsupeost

  6. Emmaste kell pälvis üleilmset tähelepanu / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2001-01-01

    Lugu Emmaste kiriku kellast jõudis Associated Pressi kaudu paljudesse maailma infokanalitesse. Kalifornia firma Critical Mass Films kavatseb vändata mängufilmi Hiiumaal Emmaste kiriku kella peitmise loost II Maailmasõja ja järgnenud okupatsiooni ajal. Kella peitmise ja leidmise loo pani kirja AP Balti korrespondent M. Tarm

  7. Muusikamaailm : Algab Turu festival. Festivalidelt mujalt. Götz Friedrich 70. Suri Pavel Eckstin / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Turu muusikafestivali esinejatest, kavast. Festivalidest : "Mostly Mozart Festival" New Yorgis, Aspeni, Bregenzi, Verbier' festivalid, Glyndebourne'i ooperifestival, Salzburgi, Bayreuthi festivalid. Lühidalt G. Friedrichi tegevusest. Lühidalt P. Ecksteini tegevusest

  8. Postimehe ajakirjanik käis Norras saladokumentide järel / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2011-01-01

    Ajaleht Postimees hakkab avaldama Norra ajalehe Aftonposten toimetusest saadud USA diplomaatide koostatud konfidentsiaalseid ettekandeid, mida Wikileaks oli varem näidanud vaid maailma viiele juhtivale ajalehele

  9. Eesti-Soome tandem pistab sportlastele pihku suusa-Ferrarid / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2008-01-01

    Kunagine Soome murdmaasuusataja Marko Kantaneva ja eestlanna Terje Muuli loodavad innovatiivsete Sträp-keppidega järgmise kümnendi jooksul vallutada viiendiku maailmaturust. Lisaks: Vana ja uus käerihm. Spordikeppide turg

  10. Priit Pärna edu sillutab teed Oscari-maailma / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2000-01-01

    Ameerika Ühendriikide suurimal animafilmifestivalil The World Animation Celebration sai Pärna joonisfilm esimese preemia 15-30-minutiliste filmide kategoorias. Ka filmikriitik Jaan Ruusi arvamusi sel puhul

  11. Muusikamaailm : Wien Modern 2001. "Taanit avastamas". Malcolm Arnold 80. Halina Czerny-Stefanska lahkunud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    28.Xئ26.XI Wienis toimuvast nüüdismuusikafestivalist "Wien Modern". Birminghami Symphony Hallis korraldati kolmenädalane kontserdisari "Discover Denmark". Inglise helilooja, trompetisti ja dirigendi Malcolm Arnoldi 80. sünniaastapäevale pühendatud üritustest. Suri nimekas poola pianist Halina Czerny-Stefanska

  12. XX sajandi klassika sarjad kogu maailmas menukad / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2005-01-01

    15. okt. ilmub Eesti Päevalehe XX saj. klassikasarja avaraamat Umberto Eco "Roosi nimi", teise raamatuna ilmub V. Nabokovi "Lolita". Vt. vastukaja: Sergei Stadnikov. Humanitaaria klassika jätkuvast avaldamisest, Eesti Päevaleht : Arkaadia, 14. okt., lk. 18

  13. Faktooringuleping : [bakalaureusetöö] / Priit Vuks ; Õigusinstituut ; juhendaja: Margus Kingisepp

    Index Scriptorium Estoniae

    Vuks, Priit

    2000-01-01

    Faktooringu ajalugu (USA, Euroopa, Aasia), faktooringu mõiste ja käsitlus Eesti õigusaktides, faktooringuleping, vähemtuntud liigid (kommertsfaktooring, kauba finantseerimine, vahendusfaktooring), rahvusvaheline faktooring

  14. Estonian companies forced to cooperate / Mikk Salu ; commented by Priit Tamm, Jüri Riives

    Index Scriptorium Estoniae

    Salu, Mikk, 1975-

    2009-01-01

    Kuigi ettevõtete omavaheline koostöö aitab kaasa majanduse konkurentsivõime tõstmisele, ei ole koostöö Eesti ettevõtete vahel veel piisav. Swedbanki, audiitorfirma Ernst & Young Balticu ning Eesti Masinatööstuse Liidu juhtide kommentaarid

  15. Muusikamaailm : Wien Modern 2000. Muusikateater Huddersfieldis. Sibeliuse konkurss Helsingis. Penderecki uus teos Tokyos / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Nüüdismuusikafestivalist "Wien Modern" 28. okt.-26. nov. Muusikalavastustest Huddersfieldi kaasaegse muusika festivalil. VIII Sibeliuse nim. rahvusvahelisest viiuldajate konkursist. 30. nov. toimus Tokyos K. Penderecki teose "Concerto grosso per tre violoncelli ed orchestra"

  16. Muusikamaailm : Erik Bergman 90. Esiettekannete sadu Baselis. Toblachi preemia Kent Naganole / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Põhjanaabrite suurkuju Erik Bergmani 90. sünnipäev möödus 24.XI. Baselis toimuval muusikafestivalil "Euroopa muusikakuu"on jätkunud festivali tellimusteoste esiettekannete rida. Gustav Mahleri nimelise heliplaadipreemia sai Saksa Sümfooniaorkestri dirigent Kent Nagano

  17. Briti kaitseminister: kärped saavad olla vaid ajutised / Liam Fox ; intervjueerinud Priit Simson

    Index Scriptorium Estoniae

    Fox, Liam, 1961-

    2011-01-01

    Intervjuu Eestit külastanud Suurbritannia kaitseministriga. Ministri sõnul on vastutustundetu ühineda NATO-ga ning muudkui lõigata kaitse-eelarvet ja riigi panust sõltumata rahalistest tingimustest. Suurbritannia sõjalistest investeeringutest, kaitsele "ehituskivi põhimõttel" lähenemisest

  18. Saku ja A. Le Coq võitsid väiketootjailt turgu / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2005-01-01

    Ilmunud ka: Postimees : na russkom jazõke 14. nov., lk 4. Kui selle aasta esimese üheksa kuuga AS-i Saku Õlletehas ja AS-i A. Le Coqi Tartu Õlletehas turuosa kasvas, siis väikeste õlletootjate - AS-i Viru Õlu, AS-i Pärnu Õlu, AS-i Nigula Õlu ja AS-i Sillamäe Õlletehas - turuosad kahanesid või jäid samale tasemele. Suuremate õlletehaste esindajate sõnul peaksid väikesed õlletehased keskenduma pigem spetsiifiliste nishiõllede tootmisele. Tabel: Saku püsib liidrikohal

  19. 30 aastat pärast diktatuuri hukku pole rahu Hispaaniasse naasnud / Priit Kivi

    Index Scriptorium Estoniae

    Kivi, Priit

    2005-01-01

    Ilmunud ka: Postimees : na russkom jazõke Ajal. Postimees : na russkom jazõke lüh. 21. nov., lk 11. Hispaania paremäärmuslased süüdistavad sotsialistlikku valitsust riigi tahtlikus lõhkumises. Franco-kummardajate terava vastuseisu on pälvinud valitsuse toetus samasooliste abielule, Kataloonia iseseisvuspüüdluste toetamine ning planeeritav õppekava, mis vähendab usuõpetuse tähtsust koolides. Lisa: Kindral Francisco Franco

  20. STS-õpetus ja traditsiooniline füüsikaõpetus / Priit Reiska

    Index Scriptorium Estoniae

    Reiska, Priit, 1970-

    2000-01-01

    Rahvusvahelisest uurimisprojektist, mis viidi läbi Tallinna Pedagoogikaülikooli ja Kieli Ülikooli koostööna, võrdlemaks teadmiste omandamist SATIS-õpetuse ja traditsioonilise õpetusega. Eesti ja Saksamaa õpilaste teadmiste erinevused

  1. Muusikamaailm : Uusooperid homme Savonlinnas. Uus suvemuusika Kleves. "Jane Eyre" Cheltenhamis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Savonlinna ooperifestivalil toimub kolme soome uusooperi maailmaesiettekanne. Saksamaal Kleves toimuvatest kontsertetendustest "Muusika Euroopa aedades". Cheltenhami muusikafestivalil toimus M. Berkeley ooperi "Jane Eyre" maailmaesiettekanne

  2. Viimsi koolimaja / Raul Järg, Illimar Truverk, Priit Pent...[jt.

    Index Scriptorium Estoniae

    2006-01-01

    II korruse plaan, 3 värv. välis- ja 4 sisevaadet; projekteerija: Agabus, Endjärv, Truverk Arhitektid OÜ; arhitektid: R. Järg, I. Truverk, P. Pent, E. Endjärv; konstruktor: Civen OÜ; maastikuprojekt: Ülle Grishakov; akustiline projekt: Malle Jaanisoo

  3. Kaasaegse kuluarvestuse arenguteed Eestis / Kertu Lääts, Priit Peets

    Index Scriptorium Estoniae

    Lääts, Kertu, 1972-

    2003-01-01

    Ettevõtte kulude arvestamise puudulikkus on aluseks mitmesuguste probleemide tekkimisele ettevõtte juhtimisel, kuna otsustamiseks tarvilik informatsioon ei peegelda reaalset pilti ettevõtte majandustegevusest ja ressursside kasutusest, leiavad autorid. Skeem. Tabel

  4. Muusikamaailm : Kevadfestivalide sadu Euroopas. Theodorakis kultuuriolümpiale / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Euroopa kultuurifestivalidest: Viini pidunädalad (10. V - 16. VI), Firenze Maggio Musicale Fiorentino (11. V - 6. VII), "Praha kevad", Wiesbadeni maifestival (27. IV - 1. VI), Münchenis VIII rahvusvahelise uue muusikateatri biennaal (27. IV - 11. V). Kreeke helilooja Mikis Theodorakis loob olümpiale muusikat

  5. Uudised : Kaljuste avas festivali Amsterdamis. Rene Eespere "Ritus" Euroraadios. "Lucretia teotamise" kontsertettekanne / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    7. nov. juhatas T.Kaljuste Amsterdamis festivali "New Spirituality in Music" avakontserti, 10. nov. anti talle üle Robert Edleri auhind. Euroopa kooride rahvusvahelisel raadiokonkursil "Let The Peoples Sing 1999" finaalis esitas taani kammerkoor R. Eespere teose "Ritus". 18. nov. toimub Vanemuise kontserdimajas B.Britteni ooperi "Lucretia teotamine" kontsertettekanne, mis on teose esiettekanne Eestis. 26.-28. nov. toimub EMAs 33. Balti muusikateaduse konverents "Muusikateadus Baltimaades"

  6. Uudised : ERSO musitseeris Hispaanias. Tobiase muusika Londonis. Rahvusooper Belgiasse / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    ERSO esines 29. juulil Galicia rahvusvahelisel muusikafestivalil Hispaanias. Londonis toimuval kontserdimuusika festivalil "Promenaadikontserdid" kõlas 29. juulil N. Järvi juhatusel R. Tobiase koorimuusika. 9. augustil sõidab Estonia ooperitrupp Belgiasse, kus antakse kuu jooksul 11 Bizet" "Carmeni" etendust

  7. Dicty_cDB: VSJ109 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ffrkinprdirwsmvy rriykntttdvsakkkarktkkfernivgasleviqqkraqkpevkqaaaeqakreikek kkaaakkaapkk*mik*tldhycfkkk---...ffrkinprdirws mvyrriykntttdvsakkkarktkkfernivgasleviqqkraqkpevkqaaaeqakrei kekkkaaakkaapkk*xik*twxh Homology

  8. Miks lootusrikkalt tehtud plaanid nurjuvad? / Anneli Lorenz, Jakob Kübarsepp, Kätlin Tiigi, Mikk Kasesalk ; küsitlenud Anna-Liisa Mets

    Index Scriptorium Estoniae

    2014-01-01

    Õpingute poolelijätmise põhjusi analüüsivad Eesti Maaülikooli õppeosakonna juhataja Anneli Lorenz, TTÜ õppeprorektor Jakob Kübarsepp, TTÜ Üliõpilaskonna juhatuse liige Kätlin Tiigi ja Tallinn Ülikooli karjäärinõustaja Mikk Kasesalk

  9. Miks tohib Eesti Vabariigi juubeliks teha filme vaid enne 1940. a ilmunud kirjandusteoste põhjal? / Meelis Muhu ; interv. Margit Tõnson

    Index Scriptorium Estoniae

    Muhu, Meelis

    2007-01-01

    Kultuuriministeeriumi poolt väljakuulutavava mängufilmide stsenaariumikonkursi üks tingimusi on, et stsenaarium võiks põhineda enne 1940. aastat ilmunud kirjandusteosel. Kultuuriministeeriumi filminõunik põhjendab

  10. Miks on tühjad tähistajad poliitikas olulised? / Ernesto Laclau ; tõlk. Jüri Lipping

    Index Scriptorium Estoniae

    Laclau, Ernesto

    2002-01-01

    Filosoofiline arutelu "tühjade tähistajate" ühiskondlikust tootmisest. Hegemoonia. Hegemoonia ja demokraatia. Artikli lõpus Jüri Lippingu ülevaade Ernesto Laclau ja Chantal Mouffe teosest "Hegemony and Socialist Strategy"

  11. Eluasemelaenu lepingupoolte huvide kaitse - abinõude kriitika ja lahendused : [bakalaureusetöö] / Susann Mikli ; Tartu Ülikool, õigusteaduskond ; juhendaja: Irene Kull

    Index Scriptorium Estoniae

    Mikli, Susann, 1988-

    2010-01-01

    Eluasemelaenu lepingust ja täitmise tagamisest, krediidiandja ja krediidisaaja positsioonist eluasemelaenulepingu sõlmimisel, eluasemelaenu tagamise probleemi lahendustest Euroopa riikides, lahendusvõimalustest Eesti õiguses

  12. Miks kogukondlased ei lähe maale elama? = Why don't community members move to the country? / Tõnu Laigu

    Index Scriptorium Estoniae

    Laigu, Tõnu, 1956-

    2013-01-01

    Linnakogukondadest, kogukondlaste ideedest, vaadetest, kogukondlikust eetikast. "Kus on piir oma unistuste elluviimise ning teiste linnakodanike tegevusse sekkumise vahel? Kui õhuke on piir elanike huvide eest seismise ja poliitilise hüppelaua vahel?", küsib arhitekt Tõnu Laigu

  13. Mälestus laulvast revolutsioonist / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2008-01-01

    Rets. rmt. : Vesilind, Priit J. The Singing Revolution : how culture saved a nation / by Priit Vesilind with James and Maureen Tusty, based on their film "The Singing Revolution". Tallinn : Varrak, 2008

  14. Aasta filmi nominendid

    Index Scriptorium Estoniae

    2008-01-01

    Eesti Filmiajakirjanike Ühing (EFÜ) nimetas 2008.a. filmi auhinna nominendid : Mait Laasi "Aja meistrid", Priit ja Olga Pärna "Elu ilma Gabriella Ferrita", Kadri Kõusaare "Magnus", Priit Pääsukese "Must Peeter", Marko Raadi "Toomiku film"

  15. Kiä kaetas eläjit, kas susi? / Jan Rahman

    Index Scriptorium Estoniae

    Rahman, Jan

    2005-01-01

    Filmidest : "Hunt" Autor-režissöör Priit Valkna. Allfilm : ETV, 2003 ; "Kaetajad" Autor-režissöör Priit Valkna. Allfilm, 2004.Kaetamise ja libahundiks jooksmise juhtumist Võrumaa Luutsniku külas

  16. Kursilased rikastavad kunsti olümpiamänge / Raimu Hanson

    Index Scriptorium Estoniae

    Hanson, Raimu, 1957-

    2007-01-01

    Veneetsia biennaalil esindas Eestit Marko Mäetamm installatiivse projektiga "Loser's Paradise". Kursi koolkonna näitusel Veneetsia kunstigaleriis III Millennio eksponeeritakse Peeter Alliku graafikat, Albert Gulgi joonistusi, Ilmar Kruusamäe, Priit Pajose ja Priit Pangsepa maale

  17. Takogo ne videl jeshtsho nikto : teatralnoe leto 2001 / Eteri Kekelidze

    Index Scriptorium Estoniae

    Kekelidze, Eteri, 1944-

    2001-01-01

    Ka Priit Pedajasega lavastusest "Lõikuspeo tantsud" Pjotr Fomenko Meistriklassis (Moskva) ja intervjuu Priit Pedajasega (lk. 49-50). Pjotr Fomenko Meistriklass, Ülemaailmne teatriolümpiaad ja A. Tsehhovi nim. rahvusvaheline teatrifestival Moskvas

  18. "Frank ja Wendy" rikub jõulud ja võtab söögiisu / Astrid Kannel

    Index Scriptorium Estoniae

    Kannel, Astrid, 1967-

    2004-01-01

    Animafilm "Frank ja Wendy" : autor David Snowman = Priit Pärn, Ülo Pikkov, Priit Tender ja Kaspar Jancis : Eesti Joonisfilm 2004. Kõik autorid vastavad midagi artikli autori provotseerivatele küsimustele

  19. Hõbetuvi kaenlas, Big Apple kiviga visata / Tiit Merisalu

    Index Scriptorium Estoniae

    Merisalu, Tiit

    1997-01-01

    Leipzigi 40. rahvusvahelisest tõsielu- ja animafilmide festivalist, kus konkursiprogrammis oli ka Priit Tenderi "Gravitatsioon" ning panoraamis Mark Soosaare "Lõpetamata lugu "Estoniast"", Riho Undi "Tagasi Euroopasse" ja Priit Pärna klipp "State of Dependence"

  20. Muusikamaailm : Esiettekannetest rikas aprill. Bachi passioonid Moskvas. MacMillani löökpillikontserdi edu / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Heliloojate teoste esiettekannetest aprillis 2000. Bachi aasta tähistamisest Moskvas ئ 85aastase vaheaja järel kõlas vene koorilt Bachi "Mattheuse passioon". J. MacMillani löökpillikontsert "Veni, veni, Emmanuel" on kõlanud enam kui 200 korda 27 riigis tuntud dirigentide juhatusel

  1. Muusikamaailm : Bachi orel Leipzigis valmis. XX sajandi ooperid laval. Huddersfieldi festivalil. "Liszt ja Bach" Weimaris / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Lepzigi Thomaskirches taastati Bachi-aegne barokkorel. Flandria Ooperis, Hamburgi Riigiooperis ja Brüsseli Thétre de la Monnaie's lavastuvatest XX saj. heliloojate ooperitest. 16.-26. nov. toimuvast Huddersfieldi kaasaegse muusika festivalist Inglismaal. Festivalist "Liszt ja Bach" Weimaris

  2. Muusikamaailm : Rostropovitsh Shostakovitshiga Madridis. Melbourne'i orkester Euroopas. Weilli aasta ka Ameerikas. Klaverifestival Manchesteris / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    D. Shostakovitshi ooperi "Mtsenski maakonna leedi Macbeth" esmalavastusest Madridi Teatro Realis M. Rostropovitshi dirigeerimisel. Melbourne'i orkestri kontserdireisist Euroopasse. K. Weilli 100. sünniaastapäeva üritustest USAs. Manchesteris toimuvast klaverimuusikafestivalist

  3. Muusikamaailm : Philadelphia Orkester Euroopas. Lloyd Webber La Scalasse? Algas Glyndebourne'i ooperifestival. Kolm kompositsioonipreemiat / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Philadelphia Orchestra 100. aastapäevale pühendatud Euroopa turneest. Milano La Scala plaanitavast uuslavastuste sarjast "Mõistes XX sajandit ئ sisse elades XXI sajandisse", kus oleks kesksel kohal nelja elava helilooja lavateosed XX sajandist. Glyndebourne'i ooperifestivalist Inglismaal, A. Davise tegevusest. Kolme kompositsioonipreemia kätteandmisest : Salzburgi Osterfestspiele kompositsioonipreemia, Teatro Lirico Sperimentale kammerooperi konkursi preemia ja fondi Stiftung Christoph Delz kompositsioonikonkursi preemia

  4. Muusikamaailm : Viini pidunädalad algavad. Kammermuusika Wittenis. Ooper shostakovitshist. Erland von Koch ئ 90 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Festivalist "Wiener Festwochen" 12.05-18.06. Saksamaal toimunud nüüdismuusikafestivalist "Tage für Neue Kammermusik Witten". Leipzigi Ooperis tuli maailmaesiettekandele L. Lombardi ooper "Dmitri", mis räägib D. shostakovitshi elust. E. von Kochi tegevusest

  5. Muusikamaailm : 15. ooperifestival Wexfordis. Tshellopidu algas Frankfurdis. Vilniuse "Gaida" lõppes eile. Konkursilt Besanqonis. Ernest Bour lahkunud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    15. ooperifestivalist Wexfordis. Frankfurdis toimunud Kronbergi tshellofestivali pidulikust avakontserdist. Vilniuse uue muusika festivalist "Gaida". Konkursilt Besanqonis. Suri nimekas prantsuse dirigent Ernest Bour

  6. Uudised : Viis ameerika tipporkestrit Kölnis. Schuberti konkurss Grazis. "Kreeka passioon" Londonis. Riccardo Muti tuleb New Yorki? / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Kölni uue muusika triennaalist, sealsetest esinejatest. IV rahvusvahelisest konkursist "Franz Schubert und die Musik der Moderne". B. Martinu ooperi "Kreeka passioon" esietendusest Londoni Kuninglikus Ooperis. R. Mutist võib aastal 2002 saada New Yorgi Filharmoonia Orkestri peadirigent

  7. Muusikamaailm : shostakovitshi päevad Glasgow's. Harvaesitatavad ooperid Wexfordis. Festival Hernes. BBC orkester kolis Barbicani / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    D. Shostakovitshi 25. surma-aastapäevale pühendatud mälestusüritusest Inglismaal. Wexfordi ooperifestivalist Iirimaal. Saksa festivalist Tage Alter Musik Herne (9.-12. nov.). BBC SO uueks alaliseks kontserdipaigaks sai Barbican Hall Londonis, pidulikust avakontserdist

  8. Muusikamaailm : Pierre Boulezi juubel. "Musik der Zeit" Kölnis. Hollandlastel taas uusooper. Tenor Carlo Cossutta surnud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    P. Boulezi 75. sünnipäevale pühendatud üritustest Londoni Barbican Centeris. 28.-30. jaan. Kölnis toimuvast uue muusika festivalist. 22. jaan. esietendus Amsterdamis G. Jansseni uusooper "Hier". C. Cossutta lauljategevusest

  9. Uudised : Neeme Järvi San Franciscos. Tõnis Mägi Moskvas. TMKK Norras ja Ungaris / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    N. Järvi juhatab San Francisco Ooperis Rimski-Korsakovi ooperit "Tsaari mõrsja", esietendus 11. sept. T. Mägi esines 1. sept. Eesti Suursaatkonnas Moskvas. TMKK Kammerkoori kontsertreisidest Norrasse ja Ungarisse

  10. Muusikamaailm : Hooaja algus Kuninglikus Ooperis. Gian Carlo Menotti Helsingis. Messiaeni ooper heliplaadil. Salzburgi festivali ette Ruzicka / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Londoni Royal Opera House avati 1. dets. galaõhtuga pärast 2 aastat kestnud ümberehitusi. Seoses oma ooperi "Konsul" uuslavastusega Soome Rahvusooperis viibis Helsingis C. G. Menotti. O. Messiaeni ainus ooper "Püha Franciscus Assisist" jõudis heliplaadile. Salzburgi festivali kunstiliseks juhiks aastast 2001 valiti P. Ruzicka

  11. Muusikamaailm : Hooaja algus New Yorgis. Beethoveni festival Bonnis. "Praemium Imperiale" laureaadid. Viiuldaja Isaac Stern lahkunud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    New Yorgi FO ja Metropolitan Opera hooaja algusest. Festivalist "Internationales Beethovenfest" 21. sept.-9. okt. Bonnis. Jaapani kunstipreemia "Praemium Imperiale" pälvis teiste seas ka O. Coleman. Lühidalt I. Sternist

  12. Muusikamaailm : Barenboimi festival Berliinis. Lihavõtteaegu Luzernis, Viinis, Salzburgis, Hamburgis ja Londonis. Soome ooper 150 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Wagneri ooperite "Festtage" Berliinis. Lihavõtteaegu toimunud kontsertidest Luzernis, Viinis, Salzburgis, Hamburgis ja Londonis. Soome ooperiloo esimesest ooperist Fredrik Paciuse "Kuningas Karli jahiretk" sünnist on möödunud 150

  13. Hollywoodi sõltumatud filmid sünnivad salaja / Priit Jürjens ; interv. Gert Kiiler

    Index Scriptorium Estoniae

    Jürjens, Priit, 1976-

    2006-01-01

    Intervjuu Viljandis sündinud ja USAs elava režissööriga (Brad Jurjens) tema esimese täispika mängufilmi "Pangarööv" ("The Bank Job") valmimise puhul. P. Jürjens on ka filmi stsenarist, produtsent ja üks peaosalisi

  14. Väärtpaberituru õiguslik reguleerimine : [bakalaureusetöö] / Priit Pahapill ; Tartu Ülikool, õigusteaduskond ; juhendaja: Leon Glikman

    Index Scriptorium Estoniae

    Pahapill, Priit

    1996-01-01

    Väärtpaberituru õiguslikust reguleerimisest üldiselt, väärtpaberiturg ja selle osalised, väärtpaberi mõiste ja liigid, väärtpaberiturg ja selle liigid, väärtpaberituru osalised, väärtpaberite emissioon, väärtpaberituru järelevalve, tüüpilisi vaidlusi USA arbitraazhikohtu praktika põhjal

  15. Valuation of private companies by Estonian private equity and venture capitalists / Priit Sander, Margus Kõomägi

    Index Scriptorium Estoniae

    Sander, Priit, 1973-

    2007-01-01

    Eraettevõtete hindamine Eesti era- ja riskiinvestorite poolt. Riskikapitali hinnakujundamise meetodid. Tabelid: Venture capital valuation issues; Venture capital pricing issues and return. Skeem: The venture capital valuation process in Estonia

  16. Muusikamaailm : Festival Stockholmis. Sada aastat "Finlandiat". Millenniumimuusika New Yorgis. Maazel loobub ametist Münchenis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    6.-13. nov. toimub Stockholmis heliloojate festival, mis tutvustab uuemat rootsi ja välismaist muusikat. Soomes tähistatakse 100 aasta möödumist J. Sibeliuse teose "Finlandia" sünnist. New Yorgi Filharmoonikud ja dir. K. Masur esitavad kontserdisarjas "Messages for the Millennium" tellimusteoseid kaasaja heliloojatelt. L. Maazel loobus dirigenditööst

  17. Muusikamaailm : Aasta valitud Opernweltis. John Adamsi uus jõuluoratoorium. Händeli "Alceste" Londonis. Elliott Carter 92 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Ajakiri Opernwelt valis aasta parima laulja, lavastaja ja etenduse. J. Adamsi "Jõuluoratooriumi" esiettekandest 15. dets. Pariisis. Händeli oratooriumi "Alceste" lavastusest Londoni Kuninglikus Ooperis. E. Carteri viimastest teostest

  18. Muusikamaailm : Sibeliuse preemia laureaat on Ligeti. Uusooperid Turus, Milanos, Barcelonas. Aasta dirigent on Daniel Barenboim / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Wihuri fondi Sibeliuse preemia sai G. Ligeti. Uusooperitest Turu toomkirikus, Milano La Scala ja Barcelona Gran Teatre del Liceu laval. D. Barenboim pälvis heliplaadipreemia Echo Klassik koos aasta dirigendi 2000 tiitliga

  19. Muusikamaailm : Last Night of the Proms Londonis. Kent Nagano Berliinis. Uusooper Petr Ebenilt. Preemiaid mitmelt poolt / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Kontserdifestivali London Proms viimase nädala kontsertidest. K. Nagano alustas septembris tööd uuel peadirigendi kohal Saksamaal. P. Ebeni esikooperist "Jeremias". Preemiaid muusikutele : International Society for the Performing Arts preemia, Astuuria printsi preemia Hispaaniast, Zwickau linna R. Schumanni nim. preemia, Gottfried von Herderi nim. preemia

  20. Muusikamaailm : "Musica Nova" avataktid Helsingis. "Towards the Millennium" lõpusirgel. "Sõda ja rahu" kuulsatel lavadel / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    3.-11. märtsini Heslingis toimuvast uue muusika festivalist "Musica nova". S. Rattle"i kümme aastat tagasi algatatud kontserdiseeriast "Towards the Millennium". S. Prokofjevi ooperi "Sõda ja rahu" taaslavastustest Pariisis ja Peterburis

  1. Muusikamaailm : "Musica Nova" Helsingis. Revueltase tähtpäeva-aasta. Pendereckile elutööauhind / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Helsingi uue muusika festivalist "Musica Nova" 3.-11. märtsini. Möödus sajand S. Revueltase sünnist, tähtpäeva üritustest USAs. MIDEMi muusikamess Cannes'is andis viiendat korda välja eriauhinna väljapaistvale kaasaja heliloojale ئ seekord K. Pendereckile

  2. Muusikamaail. "Musica nova" Helsingis. Händeli festival Karlsruhes. Ooperikonkurss algas. Preemiaid ja tunnustusi. Ka Parmas uus ooperimaja. / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Soomes toimuvast uue muusika festivalist. Händeli festivalist Karlsruhes. Üle-euroopalisest noorte ooperilauljate konkursist. Ooperilaulja Doris Soffel sai Rootsi riigilt Kuningliku Põhjatähe ordeni. Sebastian Baumgarten sai ooperi "Tosca" eest noore režissööri preemia. Parmas valmis uus ooperimaja

  3. Muusikamaailm : Elliott Carter ikka veel loomishoos. Maris Jansons lahkub Oslost. Aaron Copland ئ 100. Menukas "Fidelio" Helsingis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    E. Carteri uudisteoste esiettekannetest. M. Jansons lahkus Oslo Filharmoonia Orkestri peadirigendi kohalt. A. Coplandi 100. sünniaastapäeva tähistamisest Ameerikas ja Euroopas. Beethoveni ooperi "Fidelio" lavastusest Soome Rahvusooperis

  4. Eesti saab 2018. aasta Londoni raamatumessil erilise tähelepanu osaliseks / Jacks Thomas ; intervjueerinud Priit Hõbemägi

    Index Scriptorium Estoniae

    Thomas, Jacks

    2017-01-01

    Intervjuu Euroopa ühe suurima, Londoni raamatumessi direktori Jacks Thomasiga, kes külastas Tallinna, et teha ettevalmistusi järgmiseks aastaks, kui Eesti koos teiste Baltimaadega on messi peakülaline

  5. Muusikamaailm : Dresdeni festivali juubel. Penderecki esimene klaverikontsert. Karajani festival Baden-Badenis. Aurel Stroe 70 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Dresdeni muusikafestival toimub 25. korda. Penderecki esimese klaverikontserdi maailmaesiettekanne sai teoks New Yorgis. Ameerikas on maikuus mitmel korral üles astunud Gidon Kremer. Karajani festivalist Baden-Badenis. Rumeenia helilooja Aurel Stroe sai 70.aastaseks

  6. Muusikamaailm : Hooaja algus Metis. Oktoober saksakeelses muusikateatris. Briti sügisfestivalid. Goethe-sari Bonni ooperimajas / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Metropolitan Opera 27. sept. alanud uue hooaja lavastustest. Ooperilavastustest ja ooperite maailmaesiettekannetest erinevates muusikateatrites Saksamaal ja Austrias oktoobris. Winsori muusikafestivalist (18.09-2.10) Kagu-Inglismaal, Swebis Edela-Inglismaal toimuvast muusikafestivalist (1.-22.10), kus tutvustatakse R.V.Williamsi muusikat, Norfolki ja Norwichi ühisfestivalist (1.-17.10). Bonni Opernhaus koostöös siinse Beethoveni festivaliga toob ettekandele teoseid, mis seotud Goethe "Faustiga"

  7. Muusikamaailm. Thessalonikis oma ooperimaja. Haitink Dresdenisse kauemaks. Juubilar Anna TomovaئSintov. Marius Flothuis lahkunud. Konkursipreemiaid / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Thessalonikis on nüüd uus ooperimaja. Bernard Haitink jääb Dresdenisse kauemaks. Laulja Anna TomovaئSintov sai 60. aastaseks. Suri tunnustatud ja mitmekülgne muusikategelane Marius Flothuis. Konkursipreemiatest

  8. Muusikamaailm : Milano La Scala sulgeb uksed. Schönberg ja Kandinsky. Preemiaid ja tunnustusi. Witold Szalonek lahkunud. / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Milano La Scala suletakse kaheks aastaks ümberehituseks ja renoveerimiseks. Moskvas toimub näitus ja kontserdisari "Schönberg ja Kandinsky ئ maalikunst ja muusika dialoogis". Erinevaid preemiaid ja tunnustusi saanud muusikad. 74aastasena suri Berliinis nimekas poola helilooja, pianist ja pedagoog Witold Szalonek

  9. Muusikamaailm : Suur klaveripidu Ruhrimaal. Kissingeni festival tippudega. Sulasoli 80. aastapäev. Richard Rodgers 100 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    6. juuni-17. augustini Ruhrimaal toimuvast klaverifestivalist. Bad Kissingenis toimuvatest suvepidustustest. Soome Lauljate ja Mängijate Liit tähistab asutamise 80. aastapäeva. Helilooja Richard Rodgersi sünnist möödub 100 aastat

  10. Muusikamaailm : Weimari Riigikapell 400. Korngoldi mälestuspäevad Brnos. Ooperietendus taas Indias. Uusooperid laval Euroopas / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Weimari Riigikapell tähistab oma 400. aastapäeva. Brnos tähistatakse mitmete muusikasündmustega helilooja Erich Wolfgang Korngoldi mälestuspäevasid. New Delhi Siri Forti auditooriumis kõlab üle hulga aja ooper. Euroopa eri linnades toimuvatest ooperite uusalvastustest

  11. Uudised : EFK kontserdid Hollandis. "Joonase lähetamine" Kölnis. Eesti muusika Jaapanis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    12. apr. algas EFK kontserditurnee Hollandis. 14. ja 15. apr. toimub Kölni Filharmoonia saalis R. Tobiase oratooriumi "Joonase lähetamine" ettekanne. Plaadifirma Warner Classic andis Jaapanis välja kolm CD-plaati eesti muusikaga L. Väinmaa esituses

  12. Eesti mees tegi Hollywoodis Johann Urbiga täispika madinafilmi / Priit Jürjens ; interv. Triin Tael

    Index Scriptorium Estoniae

    Jürjens, Priit, 1976-

    2007-01-01

    Intervjuu Eestist pärit USAs elava režissööriga (Brad Jurjens) tema esimese täispika mängufilmi "Pangarööv" ("The Bank Job") tegemisest. P. Jürjens on ka filmi stsenarist, produtsent ja üks peaosalisi

  13. Muusikamaailm : Kaija Saariaho uusooper Salzburgis. Rossini festival Pesaros. Bachi arhiivile uus juhataja. Noorte kunstikohtumised Bayreuthis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    K. Saariaho uusooperi "Kauge armastus" ("L'Amour de loin") maailmaesiettekandest 15. aug. Salzburgi festivalil, lühidalt ooperist. Rossini ooperifestivalist Pesaros Itaalias. C. Wolff asub 1. jaanuarist 2001 Leipzigi Bachi-Arhiivi juhataja kohale. Bayreuthis toimuvast noortefestivalist "Internationales Jugendfestspieltreffen"

  14. Uudised : Eesti muusikud Iisraelis. Eri Klas ja RAM Tamperes. EK loomenõukogu esimeheks Eri Klas / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    5.-9. jaan. Iisraelis toimunud neljal kontserdil soleerisid P. Lill ja M. Palm, The Israel Sinfoniettat dirigeeris E. Klas. 28. jaan. tähistas Tampere Linnaorkester kontserdiga Tampere-talos oma 70. aastapäeva peadirigent E. Klasi juhatusel ja RAMi kaastegevusel. 31. jaan. toimus kultuuriministeeriumis Eesti Kontserdi loomenõukogu uue koosseisu 1. koosolek, kus nõukogu esimeheks valiti E. Klas

  15. Muusikamaailm : Euroopa kultuurilinnad 2002. Monserrat Caballe taas laval. Murray Perahia Beethooveniga. Kurt Sanderling lõpetab tegevuse / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Euroopa kultuurilinnades 2002 ئ Salamancas ja Brügges toimuvatest muusikasündmustest. Monserrat Caballe tegi comebacki ooperilavale. PianistMurray Perahia kavandab kõigi Beethooveni klaverikontsertide ettekande. 89aastane Kurt Sanderling otsustas lõpetada tegevdirigendi karjääri

  16. Rahvusvaheline koostöö saab tänu jalgpallile uued mõõtmed / Priit Raju

    Index Scriptorium Estoniae

    Raju, Priit

    2007-01-01

    6. juunil 2007 aset leidnud Eesti-Inglismaa jalgpalli valikmängu ajal käisid Tallinnas patrullimas ka ehtsad Briti politseinikud. Vt. samas: Margus Kotter. Kui õppida, siis õppida maailma parimailt

  17. Muusikamaailm : Baden-Badeni suvefestival. Festivalid lõppevad, hooajad algavad. Moskva Suur Teater muutumas. Põhjala ballett "Baldur" / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    1.-13. sept. toimuvast Baden-Badeni muusikafestivalist, sealsest uuest kontserdimajast Festspielhaus. Muusikafestivalidest ئ Montreux' Voice&Music Festival; Schleswig-Holsteini festival; Salzburgi festival; London Proms; festival "Mostly Mozart" New Yorgis; Sydney Olympic Art Festival. Hooaja avaetendustest Hollandi, Edinburghi, Los Angelese Ooperis ja Opera de Lausanne'is. Moskva Suure Teatri uutest juhtidest. Uue balleti "Baldur" esietendustest Põhjamaade tänavustes kultuuripealinnades Reykjavikis, Bergenis ja Helsingis

  18. Muusikamaailm : "Represseeritud muusika" Moskvas. György Kurtagi festival Londonis. Junge Deutshe Philarmonie kevad. Herbert Wernicke lahkunud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Moskvas toimuvast festivalist "Represseeritud muusika". Londonis toimuvast György Kurtagi festivalist. Saksa orkestri Junge Deutshe Philarmonie kevadesinemistest. Suri saksa ooperilavastaja Herbert Wernicke

  19. Sloveenia on juba aasta pärast valmis Euroopa Liiduga liituma / Janez Potocnik ; interv. Priit Rajalo

    Index Scriptorium Estoniae

    Potočnik, Janez, 1958-

    2001-01-01

    Sloveenia Vabariigi ja Euroopa Liidu vaheliste liitumiskõneluste Sloveenia-poolne pealäbirääkija Janekz Potocnik leiab, et Sloveenia ja Eesti peavad kuuluma EL-i esimesse laienemisringi. Sloveenia Vabariigi kaart. Janez Potocniki eluloolisi andmeid

  20. Võimumängud Põhja-Eestis aastail 1219-1238 : ajaloolis-sotsioloogilisi aspekte / Tyge Anderson, Priit Raudkivi

    Index Scriptorium Estoniae

    Anderson, Tyge

    2008-01-01

    Michael Manni ühiskondliku võimu teoorist, keskaegse riigi tekkest. Analüüsitud on perioodi 1219-1238 Põhja-Eestis, mil siin põrkusid Saksa ja Taani vallutus, mis kandsid endas kaht erinevat domineerimisfilosoofiat

  1. Yaşar Yakiş: see on Kairo 2011, mitte Teheran 1979 / intervjueerinud Priit Simson

    Index Scriptorium Estoniae

    Yakiş, Yaşar

    2011-01-01

    Intervjuu Türgi endise peaministri ja Egiptuse-suursaadikuga Egiptuse rahutuste taustast, president Hosni Mubarakist, asepresident Omar Suleimanist, Muslimi Vennaskonnast, sõjaväe positisioonist Egiptuses. Tema arvates on Egiptus jõudnud punkti, kust tagasipöördumist ei ole, kuid see uus ei tarvitse muutuda vastupidiseks võrreldes praeguse režiimiga

  2. Muusikamaailm : Wiesbadeni maifestival. Olukord Royal Operas rahuneb. Uus ooper Houstonis. Grame"i festival Lyonis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Saksamaal toimuvast Wiesbadeni maifestivalist. Muutustest Londoni Kuninglikus Ooperiteatris. T. Machoveri ooperi "Resurrection" maailmaesiettekandest Houstoni Grand Operas. Grame'i uue muusika festivalist Lyonis

  3. Penderecki loominguplaanid. Chicago Sümfooniaorkester Berliinis. Andre Previn juubilarina. Walton Grönroos on surnud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Helilooja teoste esitustest, plaadistustest, uudisteostest. Orkester andis oma Euroopa-reisi olulisemad kontserdid Berliini Riigiooperi kevadfestivalil. Muusik sai 70-aastaseks. Tegevusest, loomingust. Lühidalt laulja elust ja tegevusest

  4. Muusikamaailm : Festivalid Prahas ja Westfalias. Populaarne saksa uusooper. Royal Festival Hall ئ 50. Kaks preemiat Soome. Austusavaldus Mahlerile / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Festivalist "Praha kevad" Tšehhis, festivalist Westfälische Musikfest Saksamaal. M. Trojahni ooperist "Enrico". Londoni Royal Festival Hall tähistab avamise 50. aastapäeva. 34. Chicago filmi- ja videofestivalil võitis peapreemia soome dokumentaalfilm "Jean Sibelius ئ naturally". H. Wallen võitis Stuttgardi kammerduode konkursi. Jihlava konservatooriumile Moraavias anti G. Mahleri nimi

  5. Muusikamaailm : Lihavõttefestivalid ja -muusika. Harrison Birtwistle'i uus ooper. Tampere biennaal tänavu / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Lihavõttefestivalidest Salzburgis (Osterfestspiele), Luzernis, Kölnis ja Helsingis. Kölnis tuli 14. ja 15. apr. ettekandele R. Tobiase "Joonase lähetamine". Berliinis toimus H. Birtwistle'i ooperi "Viimne õhtusöömaaeg" maailmaesiettekanne. Soome Heliloojate Liidu korraldatud soome uue muusika biennaalist 12.-16. apr. Tamperes

  6. Muusikamaailm : Philadelphiasse tuleb Eschenbach. Menotti taas Washingtonis. Monteverdi festival Pariisis. Esietendused New Yorgis ja Milanos / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    C. Eschenbach määrati PO järgmiseks peadirigendiks aastast 2003, dirigendi senisest tegevusest. G.C.Menotti lavastab Washingtoni Ooperis oma ooperit "Konsul". Pariisi Champs Elysees' teatris toimuvast Monteverdi ooperite festivalist. Esietendustest ئ Busoni "Doktor Faust" New Yorgi Metropolitan Operas ja Bellini "La sonnambula" Milano La Scalas

  7. Muusikamaailm : Berliini Filharmoonikud Beethoveniga. Kurtagi festival Gütersloh's. Uus soome ooper. Glyndebourne Opera New Yorgis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Berliini Filharmoonikute Beethoveni festivalist Roomas, Viinis ja Berliinis. Kurtagi festivalist Gütersloh's Saksamaal 16.-18. veebr.Helsingis esietendus 8. veebr. K.Aho kammerooper "Enne kui me kõik oleme hukkunud". Glyndebourne'i Touring Opera tutvustab kuulsa ooperifestivali lavastusi New Yorgis

  8. Muusikamaailm : New Yorki tuleb Maazel. Kiri ei lahku veel lavalt. Kennedy Centeri autasud. Opera Internationali ankeet / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    L.Maazel valiti NY Filharmoonikute uueks peadirigendiks alates 2002.a., dirigendi praegustest tegemistest. K.Te Kanawa jätkab lauljategevust. Washingtoni Kennedy nim. kunstikeskuse aasta autasudest. Muusikaajakiri Opera Internationali lugejad valisid 20. saj. suurimad ooperilauljad, dirigendid ja lavastajad

  9. Uudised : Olari Elts peadirigendiks Riiga. Kitarriöö uudisteosega. Täna algab kirikufestival / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    O. Elts allkirjastas 30. juulil lepingu, millega ta saab Läti RSO peadirigendiks. Duo Bagger-Varts esines festivalil "Klaaspärlimäng", esiettekandele tuli J. Räätsa teos "Fragment". IX rahvusvahelisest kirikumuusika festivalist

  10. Muusikamaailm : "Let the Peoples Sing 1999". Bruckneri päevad Viinis. Festival Huddersfieldis. Kolmelt pianistide konkursilt / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Rahvusvahelise raadiokonkursi "Let the Peoples Sing" võitjatest. A. Bruckneri 175. sünniaastapäeva puhul toimunud Bruckneri päevadest Viinis. Kaasaegse muusika festivalist Huddersfieldist. Pianistide konkurssidest - Dino Ciani nim. konkursist Milanos, 7. Schuberti-nim. konkursist Dortmundis ja Ferruccio Busoni nim. konkursist Itaalias Bolzanos

  11. Muusika. Arvo Volmer juhatab "Toscat". Balti projekt BBCs. Nigulistesse tuleb Jaapan. Diplomaatiliselt Kadrioru lossist. "Jazzkaare" kevadhooaeg" / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Arvo Volmer juhatab Oulu Linnateatris Puccini "Toscat". Eestis viibis BBC töögrupp, et ette valmistada suurprojekti tutvustamaks riikide kultuuri. Nigulistes esinevad kontserdisarja "Diplomaatilised noodid" raames jaapani muusikud. Kadrioru lossis toimunud ungari vanamuusikaansambli Affetti Musicali Budapest kontserdist. "Jazzkaare" kevadhooajast

  12. Heauskne omandamine kinnisasjaõiguses : [bakalaureusetöö] / Kris Tammistu ; Tartu Ülikool, õigusteaduskond ; juhendaja: Priit Kama

    Index Scriptorium Estoniae

    Tammistu, Kris

    2006-01-01

    Heausksuse põhimõte kehtivas õiguses, kinnistusraamatusüsteem, heauskse omandamise kaitse eesmärk ja põhjendatus, kinnistusraamatusse kantud andmete heausksuse kaitse, tehingulisuse põhimõte, ajaline moment, omandamise objekt, eeldused

  13. Riigi (majandus)poliitika mõju väärtpaberite hindade kujunemisele / Otto Karma, Priit Sander

    Index Scriptorium Estoniae

    Karma, Otto

    2003-01-01

    Matemaatilise mudeli tuletamisest, mis võimaldab kajastada riigi (majandus)poliitika mõju investorite poolt väärtpaberisse investeerimiseks nõutava tegeliku tulunormi suurusele. Selline mudel võimaldaks prognoosida erinevate (majandus)poliitiliste otsuste mõju väärtpaberite hindade arengule. Tabel: Väärtpaberiinvesteeringuga seotud kulud Eestis. Graafikud

  14. Uudised : Preemia Ivo Kuusele. MDB püsib konkurentsis. Veljo Tormise autoriõhtu / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    4. apr. anti Estonia talveaias üle Harju maavalitsuse preemia I. Kuusele. 1999. a. kuulutati Saksamaal välja konkurss leidmaks uusi ideid infotehnoloogia vallas, mille tulemusena arendas kirjastus "edition 49" välja mahuka muusika andmebaasi 'Musicians Data Base'. Heliloojate Liidu korraldatud aruandeliste loominguõhtute reas tutvustas oma 1989.-1996. a. teoseid V. Tormis

  15. Muusikamaailm : Peadirigent Kurt Masuri austamine. Sallineni uusooper Helsingis. Haydni päevad Eisenstadtis. Kultuuripreemia autokontsernile / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    K. Masuri astumist Londoni Filharmoonikute peadirigendiks tähistati kontserdiga Royal Festival Hallis. Lühidalt dirigendi senisest tegevusest. 15. sept. toimus Soome Rahvusooperis A. Sallineni ooperi "Kuningas Lear" maailmaesiettekanne, teistest esietendustest Soome Rahvusooperis. 7.-17. sept. toimunud Eisenstadti pidupäevadest Saksamaal, kus oli esiplaanil Haydni looming. Euroopa Kultuurifondi Pro Europa kultuuripreemia 2000 sai autokontsern Daimler-Chrysler pikaajalise kultuuriprogrammide toetamise eest

  16. 5 põhjust mängida golfi / Ülli Plink

    Index Scriptorium Estoniae

    Plink, Ülli, 1973-

    2012-01-01

    Vestlusest pro ehk golfiõpetaja Valdek Apivalaga golfi kasulikusest tervisele ja harrastamise võimalustest Eestis. Golfiklubide Niitvälja Golf, Otepää Golfikeskus, Jõelähtme Golfikeskus, Saaremaa Golfikeskus, Suuresta Golf, Citygolf ning Stockmanni kaubamajas asuva golfikeskuse Weir Golf Studio tutvustused

  17. Avangardistid Moskvas / Mari Sobolev

    Index Scriptorium Estoniae

    Sobolev, Mari, 1968-

    2000-01-01

    Valdek Alberi ja Taave Tuutma videoinstallatsioonist "Think different" näitusel "Salon 2000" Moskva Kunstnike Keskmajas 16.-26. III. Kuraator Mari Sobolev. Eesti väljapaneku vastukajast ja Jüri Arrakust, kelle maalid olid näitusel "Balti meistrid", ajalehes "Kommersant". Moskva kunstinäitustest.

  18. Omavalitsusjuhid Riigikontrolli urgitsemist ei karda / Erik Kalda

    Index Scriptorium Estoniae

    Kalda, Erik, 1969-

    2005-01-01

    Ilmunud ka: Severnoje 18. märts lk. 1,4. Poberezhje Iisaku vallavanem Avo Kiir, Kohtla-Järve linnapea Jevgeni Solovjov, Narva linnavolikogu esimees Mihhail Stalnuhhin, Jõhvi linnapea Aavo Keerme, Ida-Viru omavalitsuste liidu tegevdirektor Urve Erikson ja Sillamäe volikogu esimees Valdek Murd kommenteerivad valitsuses heakskiidu leidnud Riigikontrolli volituste laiendamist

  19. Elluäratatud kauged ajad lasteraamatutes / Krista Kumberg

    Index Scriptorium Estoniae

    Kumberg, Krista, 1959-

    2006-01-01

    Arvustus: Hainsalu Lemmiko, vanema poeg : üks lugu muinasaja lõpult / Lehte Hainsalu ; [pildid joonistanud ja kujundanud Valdek Alber]. [Tallinn] : Maalehe Raamat, 2005 ; Timmas, Eduard H. Samsu-Sin. Esimene osa, Tema noorus ja seiklused Babylonis : [romaan] / [rootsi keelest tõlkinud Allar Sooneste. Tallinn : Canopus, 2005

  20. Low-tech-video ehk naivistide, amatööride ja videokunstnike audiovisuaalne kunst / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2001-01-01

    Varajasest videokunstist ja videokunstist muutunud kontekstis. Vene kunstniku Oleg Mavromatti videotest "Võbljadki" ja "Roheline elevandike". Rael Arteli, Valdek Alberi, Kristin Kalamehe ja Allan Tõnissoo töödest. Trash-videost. Marko Siguse videotest-filmidest. Taave Tuutma, Mari Sobolevi, Hanno Soansi ja Katrin Kivimaa planeeritud aktsioonide dokumentatsioonidest. Ilmunud ka kogumikus "Ekraan kui membraan". Tartu, 2007, lk. 195-198

  1. Arno Rossman: "Paksu nahata põled poliitikas kiiresti läbi" / Arno Rossman ; interv. Erik Gamzejev

    Index Scriptorium Estoniae

    Rossman, Arno, 1954-

    2006-01-01

    Ilmunud ka: Severnoje Poberezhje Ilmunud ka: Severnoje Poberezhje : Subbota 4. nov. lk. 3. Keskkonnaministri nõunik oma tööst ning tulevastest parlamendivalimistest. Lisa: Arno Rossman. Arvamust avaldavad Ida-Virumaa omavalitsuste liidu tegevdirektor Urve Erikson ja Ida-Viru spordiliidu esimees Valdek Murd

  2. Kas ja millistel tingimustel on õpetaja füüsiline sekkumine koolis õigustatud? / Hendrik Agur, Urve Krause, Kairit Seenmaa ... [jt.

    Index Scriptorium Estoniae

    2009-01-01

    Küsimusele vastavad: Gustav Adolfi Gümnaasiumi direktor Hendrik Agur, Pärnu Kuninga tänava Põhikooli direktor Urve Krause, Tallinna Ristiku Põhikooli õppealajuhataja Kairit Seenmaa, Kiili Gümnaasiumi direktor Mihkel Rebane ja Eesti Lastevanemate Liidu juhatuse liige Valdek Rohtma

  3. Reis ümber maailma. Tamroni reisifoto 2015 / Jürgen Veerme

    Index Scriptorium Estoniae

    Veerme, Jürgen

    2015-01-01

    Snap.ee pildipangas toimunud fotovõistlus "Tamroni reisifoto 2015". I koht: Valdek Udris "Yuanyangi riisiterrassid, põlvkondade ja sajandite elustiil". II koht: Alvar Küüt "Mina reisin kodumaal". III koht: Triin Leesmann "Päikeseloojang Luangwa jõel"

  4. Ja teevad filme / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    1999-01-01

    Eesti Joonisfilmi uued tööd esilinastusid 13.mail : "Viola" : režissöör Priit Tender, "Armastuse võimalikkusest" : režissöör, stsenarist ja operaator Janno Põldma, "Lotte" : režissöörid Heiki Ernits, Janno Põldma ja Priit Pärn ja reklaamfilm "Remix" : režissöör Priit Pärn

  5. F-hoone julge kombinatsioon / Liivi Tamm

    Index Scriptorium Estoniae

    Tamm, Liivi, 1978-

    2011-01-01

    F-hoone kohvik Tallinnas Telliskivi Loomelinnakus. Idee autoriteks, sisearhitektideks ja koha omanikeks on Jaagup Jalakas, Peeter Jalakas, Ville Jehe, Priit Juurmann, Steve Heinlo, Indrek Unt, Yoko Alender

  6. Teledokumentalistika hiilgusest ja viletsusest / Maria Ulfsak

    Index Scriptorium Estoniae

    Ulfsak, Maria, 1981-

    2004-01-01

    Leedu teleprogrammide ja -filmide festivalil "Amber arch" ("Merevaigust arkaad") võitis peapreemia Priit Valkna dokumentaalfilm "Hunt", mille tootis Allfilm ETV "Eesti lugude" dokumentaalsarja. Ka teistest festivali filmidest

  7. EXPO paviljon Shanghais = EXPO pavilion in Shanghai / Illimar Truverk ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    Truverk, Illimar, 1967-

    2011-01-01

    Shanghai EXPO Eesti paviljonist. Arhitektid: Illimar Truverk, Priit Hamer (Allianss Arhitektid), sisearhitektid: Andres Labi, Janno Roos (Ruumilabor), loovjuht: Ionel Lehari (Identity), graafiline disainer: Kristjan Paljasma (Identity)

  8. Kavatsedes kaminat / Tiina Kolk

    Index Scriptorium Estoniae

    Kolk, Tiina

    2007-01-01

    AET Arhitektide arhitekt Priit Hamer kaminate paigaldamisest, avatud koldega kaminast, klaasuksega ahjust, õhkkütte- ehk malmsüdamega kaminast, gaasikaminast ja valmiskaminatest, kamina sobitumisest ruumikujundusega

  9. Price rules in airline marketing / Elina Krauja-Veide, Marina Jõgi, Toms Andersons...[jt.

    Index Scriptorium Estoniae

    2004-01-01

    Lennukompaniide Air Baltic, Estonian Air, British Airways ja Lithuanian Airlines turundusjuhid olukorrast Baltimaade lennundusturul ja lennufirmade turundustegevusest. Kommenteerivad Priit Kivik, Ilona Kbejan, Julia Brjuhanova. Tabel

  10. Poliitikud tajuvad politsei õiguste laiendamises ohtu / Erik Rand, Mirko Ojakivi

    Index Scriptorium Estoniae

    Rand, Erik

    2008-01-01

    Seaduseelnõust, mis annab politseile rohkem õigusi massirahutuste ohjeldamiseks. Lisatud siseministeeriumi korrakaitse ja kriminaalpoliitika büroo juhataja kt Priit Heinsoo selgitused: kuritarvituste eest tuleb kaitsta

  11. Miks? Ehk jätkuks sellele, millest tol õhtul rääkisime = Why? Or to continue from where we left off the other night / Kadri Klementi

    Index Scriptorium Estoniae

    Klementi, Kadri

    2011-01-01

    Külalistoimetaja Kadri Klementi Eesti arhitektuuri ajakirja "Maja" 2011. aasta kolmandast numbrist "Maja taga", mille teemaks on asjad arhitektuuri ümber. Number on pühendatud Linnalabori viiendale sünnipäevale. Graafiline disain: Kaarel Nõmmik, Indrek Sirkel

  12. [Bakalaureuse-, magistri- ja doktorikraadiga töötute osast Eesti töötute seas. Miks ei leia kõrgharidusega, teaduskraadiga inimesed rakendust?] / Krista Loogma, Maris Mälzer, Hardo Aasmäe

    Index Scriptorium Estoniae

    Loogma, Krista, 1946-

    2010-01-01

    Küsimusele vastavad Tallinna Ülikooli kasvatusteaduste instituudi haridusuuringute keskuse juhataja Krista Loogma, Eesti üliõpilaskondade liidu juhatuse esimees Maris Mälzer ja majandusgeograaf Hardo Aasmäe

  13. Miks õpite eesti koolis ja kui hästi olete seal toime tulnud? / Daniil Savitski, Débora Brotous Alcázar, Maria Fessai, Julianna Vasilišin...[jt.

    Index Scriptorium Estoniae

    2007-01-01

    Küsimusele vastavad Tallinna 32. Keskkooli 11. klassi õpilane Daniil Savitski, Tartu Kivilinna Gümnaasiumi 9. klassi õpilane Débora Brotous Alcázar, Tartu Descartes'i Lütseumi 12. klassi õpilane Maria Fessai, Tartu Kivilinna Gümnaasiumi 3. klassi õpilane Maria Dolores Pérez Toribios ja Viljandi Paalalinna Gümnaasiumi 11. klassi õpilane Julianna Vasilišin

  14. Muusikamaailm : Uusooper täna Houstonis. Budapesti kevadfestivalil. Müncheni linna muusikapreemia. Lauljate "Orfeo" Hannoveris. Oslo saab uue ooperimaja / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    G. Floydi ooperite "Cold Sassy Tree" ja "Susannah" lavastustest Houstonis USAs. Budapesti kevadfestivalil toimub P. Eötvösi ooperi "Kolm õde" esmalavastus Ungaris. Tänavu pälvis Müncheni linna muusikapreemia Müncheni Kammerorkester. Rahvusvahelise lauljate konkursi "Orfeo 2000" võitjatest. Oslo uus ooperimaja valmib kava kohaselt 2007. aastal

  15. Muusikamaailm : "Väike Bayreuth" Berliinis. Metropolitan Opera hooaeg lõppemas. "Millenniumi" teosed Londonis. Viini Filharmoonikute kolmas auliige. Leiti Beethoveni kiri / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Dirigendi algatatud festivalist Berliinis, kus pannakse pearõhk Wagneri ooperite ettekandele. New Yorgi Metropolitan Opera kevadhooaja 1999 viimastest etendustest. Londonis Royal Festival Hallis toimus R.Caustoni teose "Millennium Scenes" maailmaesiettekanne. J.Taveneri teosest "Fall and resurrection". Orkester valis oma kolmandaks auliikmeks A.Brendeli. Baseli ülikool sai enda valdusse Beethoveni kirja Nikolaus Zmeskallile 1816. aastast

  16. Muusikamaailm : Glyndebourne'i ooperifestival hoos. Shtshedrin ja Olli Mustonen koostöös. Shostakovitshi-festival Chicagos. Nelipühafestival Herbert von Karajanile / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Inglismaal toimuvast Glyndebourne'i ooperifestivalist. R.Shtshedrin kirjutas oma 5. klaverikontserdi O. Mustonenile. M. Rostropovitsh dirigeerib Shostakovitshi-festivalil 9 erinevat kontserdikava Chicagos. Saksamaal Baden-Badenis lõppes 2 nädalat kestnud festival "Herbert von Karajan Pfingstfestspiele"

  17. Muusikamaailm : Dresdeni festival pühendub Hispaaniale. Händeli festival Göttingenis. Siemensi preemia Arditti kvartetile. Metropolitan Opera Orchestra Euroopas. Haydni festival Inglismaal / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    21.05-6.06 toimuvast Dresdeni muusikafestivalist. Händelipidustuste tippsündmuseks on helilooja harvaesitatava ooperi "Arianna in Creta" ettekanne. Ernst von Siemensi Fondi tänavuse preemia pälvis Arditti Quartet. Metropolitan Opera Orchestra Euroopa-ringreisist. 7.juunini kestvatest Haydni pidustustest Shropshire"is

  18. Uudised : Paavo Järvi debüüt Berliini Filharmoonikutega. Paul Mägi dirigeeris Helikonis. Arvo Volmer tegi Soomes aasta plaadi / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    P. Järvi ootamatust debüüdist Berliini Filharmoonikute ees ئ dirigent asendas haigestunud Daniel Barenboimi. Seoses Moskva ooperiteatri "Helikon" 10. aastapäevaga dirigeeris seal P. Mägi. Soome Yleisradio aasta plaadiks valiti Alba Recordsi poolt välja antud CD Leevi Madetoja sümfooniliste teostega, dirigent A. Volmer

  19. Muusikamaailm : Rostropovitshi suurprojekt. Festival "Arsenal Baroque" Metzis. "UltraSchall" Berliinis. Vermeuleni preemia 2000. Thielemann jääb Berliini. Henri Tomasi ئ 100 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    M. Rostropovitsh tõi publiku ette Shostakovitshi ooperi "Mtsenski maakonna leedi Macbeth". Festivalist Arsenal Baroque" Metzis. Rahvusvahelisest festivalist "UltraSchall" Berliinis. Matthijs Vermeuleni nim. preemia sai tänavu R. Rijnvos. C. Thielemann jääb Deutsche Operi muusikadirektoriks veel aastani 2007. Lühidalt H. Tomasist

  20. Muusikamaailm : Korsholmis Frans Helmersoni vaimus. Olga Neuwirthi uusooper. Manuel Rosenthal 95. Dvoraki ooper "Vanda" algkujul. Ka Henri Pousseuril juubel. Lionel Barti mälestuseks / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    27.06-4.07 toimuvast Korsholmi festivalist Rootsis. Viini festivalil toimus O. Neuwirthi ooperi "Bählamms Fest" maailmaesiettekanne. M. Rosenthali tegevusest. G. Albrechti algatusel toimus Kölnis A. Dvoraki vähetuntud ooperi "Vanda" maailmaesiettekanne originaalversioonis. H. Pousseuri tegevusest. Londonis suri 68-aastasena L. Bart

  1. Muusikamaailm : Brüsseli La Monnaie ئ 300. Uusooper San Franciscos. Sibeliuse nädal esiettekannetega. Cesare Valletti surnud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Brüsseli teater Theatre Royal de la Monnaie sai linnalt 300. juubeli kingituseks lisaruume, hooaja ooperiesiettekannetest teatris. J. Heggie ooperi "Dead man walking" maailmaesiettekandest San Francisco Ooperis. 30.sept.-8. okt. toimunud Sibeliuse nädalast Järvenpää-talos. Lühidalt C. Vallettist

  2. Muusikamaailm : Berliner Festwochen septembris. "Nibelungide sõrmus" Seattle'is. Festival San Sebastianis. "Arshak II" maailmaesietendus. Ivan Rebroff 70 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Festivalist Berliner Festwochen. Wagneri tetraloogia "Nibelungide sõrmus" etendustest USA festivalil "Seattle'i suveooper". Hispaanias San Sebastianis toimunud festivalist "Quincena Musical". T. Tshuhhadzhjani ooperi "Arshak II" maailmaesiettekandest San Francisco Ooperis. Lühidalt I. Rebroffist

  3. Muusikamaailm : Festivalil Schwetzingenis. Ellingtoni sajandi tähistamine. Linz saab uue ooperimaja. Isaac Stern viiulita Saksamaal. Muusikapäevad Luksemburgis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    30. apr.-7. juunini toimuvast muusikafestivalist Schwetzingenis. D. Ellingtoni 100. sünniaastapäeva tähistamisest maailmas. Valmis Linzi uue ooperimaja planeering. I. Stern juhatas kümnepäevast seminari Kölni Kõrgema Muusikakooli juures. Rahvusvahelise Nüüdismuusika Ühingu (ISCM) iga-aastased maailma muusikapäevad toimuvad 2000. aastal Luksemburgis

  4. Muusikamaailm : Lahkumiskingitus Udo Zimmermannile. Haitinki esimene "Tristan ja Isolde". Uusooper Garcia Lorca järgi. Schönbergi esietendus Viinis (!) / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    U. Zimmermann lahkub Leipzigi Ooperi juhi ja dirigendi kohalt ja asub Deutsche Operi etteotsa Berliinis. B. Haitink juhatab Londoni Kuninglikus Ooperis esmakordselt "Tristani ja Isolde" etendust. A. Reimanni uusooperist "Bernarda Alba maja". A. Schönbergi oratooriumi "Jakobsleiter" esietendusest Viini Riigiooperis

  5. Muusikamaailm : Tšehhi Filharmoonikud Ashkenazyga. Swansea festivali lõpetas Paavo Järvi. Steieri sügisfestivalilt. Ooperifestival Wexfordis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Tšehhi. Filh. Ork. kontserdireisist Inglismaale uue peadirigendi V.Ashkenazy juhatusel. Swansea sügisfestivalist Walesimaal. 23. okt. toimunud rahvusvahelisest Euroopa Ringhäälingute Liidu ooperiõhtu ülekandest Euroraadios. Uue muusika festivalist "Steirische Herbst" Austrias. Wexfordi ooperifestivalist Iirimaal/Tšehhi Filharmoonia Orkester//BBC Walesi Rahvusorkester//City of Birmingham Symphony Orchestra

  6. Uudised : ERSO puhkuselt tagasi. Arvo Pärdi uus teos. Elts debüteeris peadirigendina. Kalle Randalu ja Pärnu Linnaorkester / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    ERSO hooaja avakontsertidest. A. Pärdi uus teos "Nunc dimittis" tuleb esiettekandele 15. aug. Edinburgh'i festivalil. O. Elts debüteeris Läti RSO ees Riia rahvusvahelisel Rostropovitshi nim. tshellofestivalil. K. Randalu esines 7. aug. Pärnus

  7. Muusika : "Joonase lähetamine" Pariisis. Corelli Consort 10. Sibelius Seura Eesti visiit. Orel Tallinna Metodisti kirikule! Olde Hansa Musicus. / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    13. XII toimus Pariisi Champs Elysees' teatris Rudolf Tobiase oratooriumi "Joonase lähetamine" esiettekanne Prantsusmaal. Concerto Grosso alustab läbi hooaja kestvat kontserdisarja "Ajaloo ilu ئ Corelli Consort 10". 13. ja 14. XII viibis Tallinnas Soome Sibelius Seura delegatsioon. Heategevuslik kontserdisari kogub annetusi oreli muretsemiseks Tallinna Metodisti kirikule. Restoranis Olde Hansa musitseerisid moosekandid Tõnu Sepa juhendamisel ja tutvustasid oma uut CDd

  8. Muusikamaailm : "Armastuse ja surma müüt". Polar Music Prize"i laureaadid 2000. "Uue Muusika Maraton" Prahas. Kurt Weilli festival Londonis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Berliini Filharmoonikute kontserdisarjast "Armastuse ja surma müüt". Polar Music Prize"i 2000. a. laureaatidest. Nüüdismuusika festivalist "Uue Muusika Maraton" Prahas. Londonis toimunud K. Weilli festivalist, millega tähistati helilooja 100. sünniaastapäeva

  9. Muusikamaailm : Dresdeni festival alanud. Anne-Sophie Mutteri kontserdisari jätkub. Kahelt konkursilt. "Planeetidel" nüüd ka lõpuosa / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    28.05-12.06 toimuvast Dresdeni muusikafestivalist Saksamaal. A.-S. Mutteri menukast kontserdisarjast "Back to the future" 20. saj. viiulimuusikast. Festivali "Praha kevad" noorte interpreetide konkursi võitjatest. Dortmundi rahvusvahelise saksofonikonkursi võitjast. P. Domingo lauljate konkursist "Operalia 2000". C. Matthews kirjutas G. Holsti orkestrisüidile "Planeedid" juurde osa "Pluto", teose ettekandest Manchesteris Inglismaal

  10. Muusikamaailm : Bremeni festival alanud. Neeme Järvi Festivalil New Yorgis. Sydney ooperimaja juba korrastamisele. Promenaadikontertidel Londonis. Kaks preemiat. Luzernis alustati müütidega / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    14.08-24.10 toimuvast Bremeni festivalist Saksamaal. N.Järvi juhatas New Yorgi Lincoln Center"i festivalil festivaliorkestrit. Sydney ooperimaja kavandatatavst renoveerimisest. Londonis toimuvatest promenaadikontsertidest. UNESCO ja Rahvusvahelise Muusikanõukogu (IMC) tänavuse preemia laureaatideks valiti E. Nunes ja A. Kuazimov. 14.07-11.09 toimuvast Luzerni muusikafestivalist

  11. Muusikamaailm : Festival Edinburghis. Domingo lööb Caruso rekordi Metis. Pianistide paraad La Roque"is. Kuulsate festivalide lõpunädal / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Briti saarte rahvusvahelisest muusika ja kunstide festivalist Edinburghis 15.08-4.09. New Yorgi Metropolitan Operas teeb uue hooaja avaõhtul Leoncavallo "Pajatsites" kaasa ka P. Domingo. Prantsusmaal La Roque d"Antheronis toimunud tipp-pianistider festivalist 23.07-21.08. Lõppevatest festivalidest Bayreuthis, Salzburgis, Schleswig-Holsteinis ja Veronas

  12. Muusikamaailm : Soome orkestripäev Turus. Schubertiaad tänavu. Rahmaninovi festival Londonis. Unsuk Chini jätkuv menu. James Last 70 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Soome Sümfooniaorkestrite Ühenduse iga-aastasest orkestripäevast Turus. Schubertiaadist Saksamaal. Londonis toimuvast festivalist "Rediscovering the music of Rachmaninoff". U.Chini teoste ettekannetest Euroopas. Lühidalt J.Lasti tegevusest

  13. Mööbel vajab nišše ja ekspordiauke. Vallutamist ootab vana Euroopa / Ain Alvela ; kommenteerinud Ari Lustila, Heido Vitsur, Priit Tamm

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Olukorrast mööbliturul: edukamad on olnud korpusmööbliga tegelevad ettevõtted. Arvamust avaldavad ASi Suwem turundusjuht Mart Nilson ja OÜ Bellus Furnitur tootmisjuht Rolf Kristian Relander. Diagrammid

  14. Muusikamaailm : "Kevadpühitsus" sajandi teoseks. Nikolaus Harnoncourt"i juubel. Kent Nagano Deutsche Operisse. "Musica viva" Münchenis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Lääne-Euroopa populaarsete muusikaajakirjade "BBC Music Magazine" ja "Le Mond de la Musique" küsitluse põhjal osutus 20. saj. tähtsaimaks muusikateoseks I. Stravinski ballett "Kevadpühitsus". N. Harnoncourt tähistas 6. dets. 70. juubelit. Dirigendi tegevusest. K. Nagano kinnitati Berliini Deutsche Operi muusikadirektoriks aastast 2001. Dirigendi senisest tegevusest. Baieri Raadio korraldatava uue muusika sarja "Musica viva" kontsertidest

  15. Muusikamaailm : Hong Kong Arts Festival. "Haydni päevad" Viinis. "Ars Musica" Brüsselis. Martha Mödli mälestuseks / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    22. II - 19. III toimuvast Hong Kong Arts Festivalist. Viinis toimuvast muusikaüritusest "Haydn-Tage". 7. - 24.III Brüsselis toimuvast uue muusika festivalist"Ars Musica". Meenutatakse saksa ooperisopranit Martha Mödli

  16. Muusikamaailm : Schleswig-Holsteini festival 2001. Peter Sellars lavastab Bachi kantaate. Taas uus Soome ooper. Henze festival Londonis. Uus film Maria Callasest / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Schleswig-Holsteini suvisest muusikafestivalist 7.VII-2.IX 2001. a. New Yorgis tuli esiettekandele P. Sellarsi lavastatud etendus Bachi kantaatidest. Uue muusika festivalil "Musica Nova" Helsingis tuli esiettekandele T. Länsiö ooper "Sulka". H. W. Henze 75. juubelit tähistatakse Londonis festivaliga "Voices". F.Zeffirelli lavastab filmi M. Callasest

  17. Muusikamaailm. Magnus Lindbergi festivali jätk. Jonas Forsell taas ooperijuhiks. Marcello Panni uus ooper. György Kurtagile Sonningi preemia. Peter Gradenwitz lahkunud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Soome helilooja Magnus Lindbergi mitmeid teoseid esitatakse Inglismaal. Rootsi heliloojast Jonas Forsellist sai jaanuaris Kopenhaageni trupi Den Anden Opera kunstiline juht. Firenzes tuli esiettekandele Marcello Panni uus ooper "The Banquet ئ Talking about Love". Helilooja György Kurtag pälvis Taani 2003.a. Leonie Sonningi muusikapreemia. 91aastasena suri muusikateadlane Peter Gradenwitz

  18. Laiendatud kollektiivne litsents autoriõiguslikes ja autoriõigusega kaasnevates suhetes : [magistritöö] / Priit Kala ; Tartu Ülikool, õigusteaduskond ; juhendaja: Aleksei Kelli

    Index Scriptorium Estoniae

    Kala, Priit, 1975-

    2013-01-01

    Autoriõiguse ja autoriõigusega kaasnevate õiguste kollektiivsest teostamisest laiendatud kollektiivse litsentsi rakendamise eeldusena, laiendatud kollektiivse litsentsi olemusest, õiguste omajate õiguskaitsest, laiendatud kollektiivse litsentsi rakendatavusest

  19. Muusikamaailm : Muusikapäevad Kasselis. Hooaja algus Metropolitanis. Bachi austatakse ka Melbourne'is. Preemiaid mitmelt poolt. Clarence Myerscough lahkunud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Kasseli muusikapäevadest. New Yorgi Metropolitan Opera hooaja lavastustest. Melbourne'i oktoobrifestivalil on kesksel kohal Bach. Muusikapreemiatest ja nende saajatest ئ Schleswig-Holsteini festivali Hindemithi preemia, Alamsaksimaa Kultuuripreemia, Baieri teatripreemia. Lühidalt C. Myersist/Frankurdi Raadio Sümfooniaorkester

  20. Muusikamaailm. Festival "Ultraschall" Berliinis. Puccini nädal Helsingis. 94aastane Kurt Pahlen veel tegev. Dortmundile uus saal. Preemiaid ja tunnustusi. / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Jaanuari lõpus Berliinis toimuvast nüüdismuusikafestivalist "Ultraschall". Helsingis toimuvast Puccini nädalast. 94aastase muusikamaailma legendi Kurt Pahleni tegemistest. Dortmundis septembris avatavast uuest kontserdisaalist. Preemiatest ja tunnustustest muusikamaailmas