WorldWideScience

Sample records for vaid ks viisavabadus

  1. Eesti viisavabadus USAga saab kinnituse / Allar Viivik

    Index Scriptorium Estoniae

    Viivik, Allar

    2008-01-01

    USA sisejulgeoleku minister Michael Chertoff ja siseminister Jüri Pihl allkirjastavad Tallinnas siseministeeriumis viisavabadusmemorandumi. USAga viisavabaduse kehtestamisest rääkis ka president Toomas Hendrik Ilves Strasbourg'is kohtumisel Euroopa Komisjoni presidendi Jose Manuel Barrosoga. Vabariigi Presidendi töövisiit Strasbourgi 11.-12.03.2008

  2. Bushi visiidi kasu Eestile : viisavabadus ja õhuruumi turve / Holger Roonemaa

    Index Scriptorium Estoniae

    Roonemaa, Holger

    2006-01-01

    Peaminister Andrus Ansip tõstatas kohtumisel USA presidendi George W. Bushiga viisavabaduse ja õhuturbe teema. G. W. Bushi ja Mart Laari kohtumisest. Vt. samas: Bush mõtleb oma poliitilisele pärandile; Bush kohtus Iraagis vigastada saanuga; Politseinik Purik: Bush oli fantastiliselt kihvt; Mati Raidma: Bush oli Eesti asjadega hästi kursis; Lisad: Bush oli hea suhtluspartner; Mis president Bushile Eestis meeldis? Vt. samas lk. 6-7 Anneli Ammas. Kohtumine maailma tähtsaima mehega ehk reportaaž turvamulli seest

  3. Eesti saab tõenäoliselt USA-lt pooletoobise viisavabaduse / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2008-01-01

    Algasid läbirääkimised USA-ga viisavabaduse saavutamiseks. USA eksperdid tulevad hindama Eesti riigipiiri pidavust, koostatakse vastastikuse arusaamise memorandum. Tõenäoliselt hakkab Eesti puhul kehtima teistsugune süsteem kui on praegu 27 riigil, kellel on USA-ga viisavabadus ja kellest 15 on EL-i nn vanad riigid. USA sisejulgeoleku ministeeriumi asekantsleri Richard Barthi seisukohti. Vt. samas: Eesti näide võib tekitada vastuolulist reaktsiooni

  4. Vaid üks on taevas / Kaire Maimets-Volt

    Index Scriptorium Estoniae

    Maimets, Kaire, 1977-

    2006-01-01

    Mängufilmist "Taevas" ("Heaven") : režissöör Tom Tykwer, stsenaristid Krzysztof Piesiewicz ja Krzysztof Kieslowski, peaosas Cate Blanchett : Saksamaa - Itaalia - USA - Prantsusmaa - Suurbritannia 2002. Originaalmuusika Tom Tykwer, valmismuusika Arvo Pärt ("Aliinale", "Peegel peeglis", "Variatsioonid Arinushka tervenemise puhul"). Esilinastus 6. II 2002 Berliini rahvusvahelisel filmifestivalil. Artikli lõpus Tom Tykwerist ja tema filmograafia

  5. "lase vaid olla..." : [luuletused] / Stuart, pseud.

    Index Scriptorium Estoniae

    Stuart,, pseud.

    2002-01-01

    Autorist lk 134, ka foto. Sisu: "lase vaid olla..." ; "kas seistes on..." ; "hommikuvalguse kajas..." ; "ajal on augud..." ; "malemängu ja kohvi lõhn..." ; L' homme avec l'horloge ; "pargipingil istudes..." ; "yhel õhtul..."

  6. Measurements of the branching fractions for D+→KS0KS0K+, KS0KS0π+ and D0→KS0KS0, KS0KS0KS0

    Directory of Open Access Journals (Sweden)

    M. Ablikim

    2017-02-01

    Full Text Available By analyzing 2.93fb−1 of data taken at the ψ(3770 resonance peak with the BESIII detector, we measure the branching fractions for the hadronic decays D+→KS0KS0K+, D+→KS0KS0π+, D0→KS0KS0 and D0→KS0KS0KS0. They are determined to be B(D+→KS0KS0K+=(2.54±0.05stat.±0.12sys.×10−3, B(D+→KS0KS0π+=(2.70±0.05stat.±0.12sys.×10−3, B(D0→KS0KS0=(1.67±0.11stat.±0.11sys.×10−4 and B(D0→KS0KS0KS0=(7.21±0.33stat.±0.44sys.×10−4, where the second one is measured for the first time and the others are measured with significantly improved precision over the previous measurements.

  7. Reisijal vaid üks pretensioon - tahaks kauem sõita! / Tõnis Lepp

    Index Scriptorium Estoniae

    Lepp, Tõnis

    2000-01-01

    Eesti esimesest reisihelikopterist ja regulaarsest liiklusest kopteriliinil Tallinna ja Helsingi vahel. Vestlus Copterline Tallinna kopteriterminali direktoriga. Summary: From Tallinn to Helsinki by helicopter. Lk. 46

  8. Gnoosis ei olnud üks ristiusu vorm, vaid omaette religioon / Aija Sakova

    Index Scriptorium Estoniae

    Sakova, Aija, 1980-

    2009-01-01

    Dissertatsioonist: Lahe, Jaan. Gnosis und Judentum : Alttestamentliche und jüdische Motive in der gnostischen Literatur und das Ursprungsproblem der Gnosis. Tartu : Tartu Ülikooli Kirjastus, 2009. (Dissertationes theologiae Universitatis Tartuensis ; 15)

  9. Ahtme tehas teeb vaguneid vaid omanikule / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2004-01-01

    Ahtmes asuv AS UVZ & AVR koostetehas on siiani tootnud tsisternvaguneid vaid AS-ile AVR Transservice, vagunite suurimaks kasutajaks on tõusmas naftatransiidile spetsialiseeruv AS Onako Eesti Grupp. Vt. samas: Oma töölistele valmivad kortermajad; Keedetud vähid ja Anne Veski

  10. Geomagnetic Kn, Ks, Km Indices

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A full description of the indices Kn, Ks, Km is given in a monography,"Indices Kn, Ks et Km, 1964-1967", edited in 1968 by the Centre National de la Recherche...

  11. ks rist on lõunas ja üks nael on põhjas..." : [luuletused] / Indrek Hirv

    Index Scriptorium Estoniae

    Hirv, Indrek, 1956-

    1998-01-01

    Sisu: "üks rist on lõunas ja üks nael on põhjas..." ; "ei tohi tulerauda panna käest..." ; "Jäänd maanteetolmus talla alla jaks..." ; "kui kevadvihm toob paine vahtrajuurde..." ; "mu kire narrimütsi voodrikoes..." ; "on linnud need - või päevad - juba kadund..." ; "su uneraskus kord mu rinda rõhus..." ; "öö hingeõhust surm saab sigivaks..." ; "ja viimaks lõpp on meistri maisel varal..." ; "kord soendas mind su huulte külmavärin..." ; "kraelõkmeil sädelevaid ruune varjas..." ; "kui kauged tuled puhub surnuks eha..." ; "pea korraks - köielkõndijat ei lööda..." ; "vaid sina suudad anda mängujulgu..." ; "mu elu see on kala elu veeta..." ; "ma võppun unes suudeldes su nime..." ; "öö läbi minu huulte kohal hingad..." ; "mu pehkind süda pressib puruks juuri..." ; "kord peeglis mille möödund elu laenab..." ; "kui taevas vabastab end raskeist rimbust..." ; "mu peegelpilt on pisut pikem must..." ; "Ma kordan, aiva kordan nagu narr..." ; "on siiski usutav mu siiras vale..." ; "Me tulime, kui Tartu suuri haudu..." ; "Kui rünnakrelva terastule kadu..." ; "ei tohi tulerauda panna käest..." ; "kui kuuli pähe saanud lipnik lipus..." ; "kui jalust rabab pöörangute räigus..." ; "Mu vaese elu ööde vaikiv lõhn..." ; "kui linnuteede kruusa langeb ingel..." ; "tean seni kui lapseea taevad..." ; "On mõni lahkund suurde vaikimisse..." ; Sonett III ; Sonett IV ; Tertsiin IV ; Tertsiin VI ; Tertsiin VIII

  12. De BoKs Voorbij

    NARCIS (Netherlands)

    Marian Adriaansen

    2012-01-01

    Er is veel energie gestoken in het ontwikkelen van een BoKS voor de HBO-V. Deze wordt in alle opleidingen min of meer toegepast. Het uitgangspunt is dat een gemeenschappelijk kennisdomein voor een HBO-V opleiding wenselijk is om als basis te kunnen dienen voor de inhoud van een curriculum. Hiermee

  13. Dvikamienių vardų su kamienu vaid- raidos bruožai lietuvių kalboje

    Directory of Open Access Journals (Sweden)

    Daiva Sinkevičiūtė

    2014-11-01

    Full Text Available Tiriant dvikamienius vardus su kamienu vaid- buvo nustatyta, kad šie vardai šaltiniuose užrašome ne tik įprastai <vaid->, , bet , ir kartais , . Iš onimų analizės išaiškėjo, kad dalis onomastikos literatūroje minimų vardų su vaid- yra sukurti pagal kitus onimus. Patikimi kamieno vaid-, užrašyto <vaid->, , vardai yra Sùvaidas, Vaĩd(iginas, Vaĩd(iminas, Vaĩd(ivilas ir Vaĩdvinas. Remiantis mintimi, kad vaid- medialė /ai/ užrašoma , ar kartais teigtina, kad vaid- vardai yra ir asmenvardžiai su antraisiais kamienais but-, gaud-, gint-, jot-, mint-, vain- ir pirmaisiais kamienais do- ir gel-. Tokius /ai/ užrašymus , anksčiau patvirtino ir dvikamienių vardų su pirmuoju kamienu vaiš- užrašymai. Kiti kamieno vaid- variantai gali būti : jo asmenvardžiai turi antruosius kamienus kant- ir gin-, bei : jo asmenvardžiai turi antruosius kamienus gin- ir vil-.

  14. Liimpuidu konkurentsitihedal turul jääb ellu vaid tugevaim / Annely Allik

    Index Scriptorium Estoniae

    Allik, Annely

    2005-01-01

    Võrumaa ettevõtete TOP 50 3. koht. Liimpuitu tootva ettevõtte GM Panels OÜ juhataja Urmas Lillepalu sõnul jäävad tiheda konkurentsi tingimustes ellu vaid need, kes suudavad efektiivselt toota. Diagramm: GM Panelsi kasum suurenes üheksa korda. Vt. samas: Roland Luks. Edu aluseks õiged otsused

  15. Uus materjal laseb valgust läbi vaid ühtpidi / Arko Olesk

    Index Scriptorium Estoniae

    Olesk, Arko, 1981-

    2014-01-01

    Eestis läbi viidud katsetega on selgunud nähtus, mis võib leida kasutust tuleviku elektroonikaseadmetes - magnet- ja elektriväljaga on võimalik panna materjali läbi laskma vaid ühest suunast tulevat valgust

  16. Liitmine pole võimalus, vaid suisa kohustus / Värner Lootsmann

    Index Scriptorium Estoniae

    Lootsmann, Värner, 1945-

    2008-01-01

    Harju maavanema Värner Lootsmanni arvates on haldusreformi juures küsimus vaid selles, kuivõrd peab välja selgitama omavalitsuse ja selle elanike tahet ning mil määral sellega arvestama. Kommenteerivad: Siim Kiisler, Kajar Lember, Marek Strandberg, Peep Aru, Kalvi Kõva. Vt. samas: Keskerakonna volikogu avaldus

  17. Elu pole seal, kus on kool, vaid kool on seal, kus on elu / Toomas Reinpõld

    Index Scriptorium Estoniae

    Reinpõld, Toomas, 1960-

    2004-01-01

    Tänapäeval hoiab elu maal vaid töökohtade olemasolu ja normaalset toimetulekut võimaldav sissetulek. Lapsed tulevad maale tagasi siis, kui sinna asuksid elama noored inimesed. Maakoolide sulgemisest

  18. Üks vapper Jodie / Jaanus Noormets

    Index Scriptorium Estoniae

    Noormets, Jaanus

    2007-01-01

    Mängufilm "Üks vapper naine" ("The Brave One") : režissöör Neil Jordan : peaosas Jodie Foster : Ameerika Ühendriigid - Austraalia 2007. Lisatud nimekiri "Jodie Fosteri menukamad filmid Põhja-Ameerikas"

  19. Torma ringtallist jäid vaid müürid / Bianca Mikovitš

    Index Scriptorium Estoniae

    Mikovitš, Bianca

    2011-01-01

    Pärast 29. aprillil 2011 toimunud tulekahju jäid Torma mõisa muinsuskaitse all olevast ringtallist järele vaid müürid. Muinsuskaitseameti Jõgevamaa vaneminspektori Sille Raidvere hinnangul päästaks Torma ringtalli lõplikust hävingust hoone müüride kiire konserveerimine, mis annaks edaspidiseks võimaluse tallihoone taastada

  20. FIAT-i juht : maailma jääb alles vaid kuus suurt autotootjat / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2008-01-01

    FIAT-i tegevjuhi Sergio Marchionne hinnangul jääb kriisi lõpuks alles üks Ameerika, üks Saksa, üks Prantsuse, üks Hiina ja üks võimalik üleeuroopaline autotootja. Analüütik Jürgen Pieperi hinnangul on kõige haavatavamad FIAT, BMW ja PSA/Peugeot-Citroen, alles jäävad VW, Renault-Nissan ja Daimler

  1. Renewed Activity from KS 1947+300

    Science.gov (United States)

    Finger, Mark H.; Wilson-Hodge, Colleen A.; Jenke, Peter A.; GBM Pulsar Team

    2014-05-01

    Pulsations from the transient Be/X-ray pulsar KS 1947+300 are currently being detected with Fermi/GBM. The pulsations were first detected in the data of May 2.0-4.0 at a frequency of 53.2979(4) mHz, with a pulsed flux of 7 +/- 1 mCrab in the 12-50 keV band. The last outburst of this source began in early October 2013 (ATel #5438, ATel #5441).

  2. Search for K_S K_S in J/psi and psi(2S) decays

    CERN Document Server

    Bai, J Z; Bian, J G; Cai, X; Chang, J F; Chen, H F; Chen, H S; Chen, H X; Chen, J; Chen, J C; Jun Chen; Chen, M L; Chen, Y B; Chi, S P; Chu, Y P; Cui, X Z; Dai, H L; Dai, Y S; Deng, Z Y; Dong, L Y; Du, S X; Du, Z Z; Fang, J; Fang, S S; Fu, C D; Fu, H Y; Fu, L P; Gao, C S; Gao, M L; Gao, Y N; Gong, M Y; Gong, W X; Gu, S D; Guo, Y N; Guo, Y Q; Guo, Z J; Han, S W; Harris, F A; He, J; He, K L; He, M; He, X; Heng, Y K; Hu, H M; Hu, T; Huang, G S; Huang, L; Huang, X P; Ji, X B; Jia, Q Y; Jiang, C H; Jiang, X S; Jin, D P; Jin, S; Jin, Y; Lai, Y F; Li, F; Li, G; Li, H H; Li, J; Li, J C; Li, Q J; Li, R B; Li, R Y; Li, S M; Li, W; Li, W G; Li, X L; Li, X Q; Li, X S; Liang, Y F; Liao, H B; Liu, C X; Fang Liu; Liu, F; Liu, H M; Liu, J B; Liu, J P; Liu, R G; Liu, Y; Liu, Z A; Liu, Z X; Lu, G R; Lu, F; Lu, J G; Luo, C L; Luo, X L; Ma, F C; Ma, J M; Ma, L L; Ma, X Y; Mao, Z P; Meng, X C; Mo, X H; Nie, J; Nie, Z D; Olsen, S L; Peng, H P; Qi, N D; Qian, C D; Qin, H; Qiu, J F; Ren, Z Y; Rong, G; Shan, L Y; Shang, L; Shen, D L; Shen, X Y; Sheng, H Y; Shi, F; Shi, X; Song, L W; Sun, H S; Sun, S S; Sun, Y Z; Sun, Z J; Tang, X; Tao, N; Tian, Y R; Tong, G L; Varner, G S; Wang, D Y; Wang, J Z; Wang, L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S Z; Wang, W F; Wang, Y F; Wang, Z; Wang, Z Y; Wei, C L; Wu, N; Wu, Y M; Xia, X M; Xie, X X; Xin, B; Xu, G F; Xu, H; Xu, Y; Xue, S T; Yan, M L; Yan, W B; Yang, F; Yang, H X; Yang, J; Yang, S D; Yang, Y X; Yi, L H; Yi, Z Y; Ye, M; Ye, M H; Ye, Y X; Yu, C S; Yu, G W; Yuan, C Z; Yuan, J M; Yuan, Y; Yue, Q; Zang, S L; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H Y; Zhang, J; Zhang, J M; Zhang, J Y; Zhang, J W; Zhang, L S; Zhang, Q J; Zhang, S Q; Zhang Xiao Min; Zhang, X Y; Zhang, Z; Zhang, Y J; Zhang, Y Y; Zhang, Z P; Zhang, Z Q; Zhao, D X; Zhao, J B; Zhao, J W; Zhao, P P; Zhao, W R; Zhao, X J; Zhao, Y B; Zhao, Z G; Zheng, H Q; Zheng, J P; Zheng, L S; Zheng, Z P; Zhong, X C; Zhou, B Q; Zhou, G M; Zhou, L; Zhou, N F; Zhu, K J; Zhu, Q M; Zhu, Y; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, B A; Zou, B S

    2004-01-01

    The CP violating processes J/psi-->K_S K_S and psi(2S)-->K_S K_S are searched for using samples of 58 million J/psi and 14 million psi(2S) events collected with the Beijing Spectrometer at the Beijing Electron Positron Collider. No signal is observed, and upper limits on the decay branching ratios are determined to be BR(J/psi-->K_S K_S) K_S K_S) < 4.6x10^{-6} at the 95% confidence level.

  3. Observation of KsKs resonances in deep inelastic scattering at HERA

    CERN Document Server

    Abe, T; Adamczyk, L; Adamus, M; Adler, V; Aghuzumtsyan, G; Antonioli, P; Antonov, A; Arneodo, M; Bailey, D S; Bamberger, A; Barakbaev, A N; Barbagli, G; Barbi, M; Bari, G; Barreiro, F; Bartsch, D; Basile, M; Bauerdick, L A T; Behrens, U; Bell, M; Bellagamba, L; Benen, A; Bertolin, A; Bhadra, S; Bloch, I; Bodmann, B; Bold, T; Boos, E G; Borras, K; Boscherini, D; Brock, I; Brook, N H; Brugnera, R; Brümmer, N; Bruni, A; Bruni, G; Bussey, P J; Butterworth, J M; Bylsma, B; Caldwell, A; Capua, M; Cara Romeo, G; Carli, T; Carlin, R; Catterall, C D; Chekanov, S; Chiochia, V; Chwastowski, J; Ciborowski, J; Ciesielski, R; Cifarelli, Luisa; Cindolo, F; Cloth, P; Cole, J E; Collins-Tooth, C; Contin, A; Cooper-Sarkar, A M; Coppola, N; Cormack, C; Corradi, M; Corriveau, F; Cottrell, A; D'Agostini, Giulio; Dal Corso, F; Danilov, P; Dannheim, D; De Pasquale, S; Dementiev, R K; Derrick, M; Deshpande, Abhay A; Devenish, R C E; Dhawan, S; Dolgoshein, B A; Doyle, A T; Drews, G; Durkin, L S; Dusini, S; Eisenberg, Y; Ermolov, P F; Eskreys, Andrzej; Ferrando, J; Ferrero, M I; Figiel, J; Filges, D; Foster, B; Foudas, C; Fourletov, S; Fourletova, J; Fricke, U; Fusayasu, T; Gabareen, A; Gallo, E; Garfagnini, A; Geiser, A; Genta, C; Gialas, I; Giusti, P; Gladilin, L K; Gladkov, D; Glasman, C; Gliga, S; Goers, S; Golubkov, Yu A; Goncalo, R; González, O; Göttlicher, P; Grabowska-Bold, I; Grijpink, S; Grzelak, G; Gutsche, O; Gwenlan, C; Haas, T; Hain, W; Hall-Wilton, R; Hamatsu, R; Hamilton, J; Hanlon, S; Hart, J C; Hartmann, H; Hartner, G; Hartner, G F; Heaphy, E A; Heath, G P; Heath, H F; Helbich, M; Heusch, C A; Hilger, E; Hillert, S; Hirose, T; Hochman, D; Holm, U; Iacobucci, G; Iga, Y; Inuzuka, M; Irrgang, P; Jakob, H P; Jones, T W; Kagawa, S; Kahle, B; Kaji, H; Kananov, S; Kappes, A; Kataoka, Y; Yamazaki, M; Katkov, I I; Katz, U F; Kcira, D; Khein, L A; Kim, J Y; Kim, Y K; Kind, O; Kisielewska, D; Kitamura, S; Klimek, K; Koffeman, E; Kohno, T; Kooijman, P; Koop, T; Korzhav, I A; Kotanski, A; Kötz, U; Kowal, A M; Kowal, M; Kowalski, H; Kowalski, T; Krakauer, D; Kramberger, G; Kreisel, A; Krumnack, N; Kuze, M; Kuzmin, V A; Labarga, L; Labes, H; Lainesse, J; Lammers, S; Lee, J H; Lee, S W; Lelas, D; Levchenko, B B; Levman, G M; Levy, A; Li, L; Lightwood, M S; Lim, H; Lim, I T; Limentani, S; Ling, T Y; Liu, X; Löhr, B; Lohrmann, E; Loizides, J H; Long, K R; Longhin, A; Lukina, O Yu; Lupi, A; Luzniak, P; Maddox, E; Magill, S; Mankel, R; Margotti, A; Marini, G; Martin, J F; Mastroberardino, A; Matsuzawa, K; Mattingly, M C K; McCubbin, N A; Mellado, B; Melzer-Pellmann, I A; Menary, S R; Metlica, F; Meyer, U; Milite, M; Mirea, A; Monaco, V; Montanari, A; Moritz, M; Musgrave, B; Nagano, K; Nania, R; Nguyen, C N; Nigro, A; Ning, Y; Nishimura, T; Notz, D; Nowak, R J; Oh, B Y; Olkiewicz, K; Pac, M Y; Padhi, S; Paganis, S; Palmonari, F; Parenti, A; Park, I H; Patel, S; Paul, E; Pavel, N; Pawlak, J M; Pelfer, P G; Pellegrino, A; Pesci, A; Petrucci, M C; Piotrzkowski, K; Plucinsky, P P; Pokrovskiy, N S; Polini, A; Posocco, M; Proskuryakov, A S; Przybycien, M B; Rautenberg, J; Raval, A; Reeder, D D; Ren, Z; Renner, R; Repond, J; Riveline, U; Karshon, M; Robins, S; Rodrigues, E; Rosin, M; Rurua, L; Ruspa, M; Sacchi, R; Salehi, H; Sartorelli, G; Savin, A A; Saxon, D H; Schagen, S; Schioppa, M; Schlenstedt, S; Schmidke, W B; Schneekloth, U; Sciulli, F; Scott, J; Selonke, F; Shcheglova, L M; Skillicorn, I O; Slominski, W; Smith, W H; Soares, M; Solano, A; Son, D; Sosnovtsev, V V; Stairs, D G; Stanco, L; Standage, J; Stifutkin, A; Stoesslein, U; Stonjek, S; Stopa, P; Straub, P B; Suchkov, S; Susinno, G; Suszycki, L; Sutton, M R; Sztuk, J; Szuba, D; Szuba, J; Tandler, J; Tapper, A D; Tapper, R J; Tassi, E; Tawara, T; Terron, J; Tiecke, H G; Tokushuku, K; Tsurugai, T; Turcato, M; Tymieniecka, T; Ukleja, A; Ukleja, J; Vázquez, M; Velthuis, J J; Vlasov, N N; Voss, K C; Walczak, R; Walsh, R; Wang, M; Weber, A; Wessoleck, H; West, B J; Whitmore, J J; Wick, K; Wiggers, L; Wills, H H; Wing, M; Wolf, G; Yamada, S; Yamashita, T; Yoshida, R; Youngman, C; Zawiejski, L; Zeuner, W; Zhautykov, B O; Zichichi, A; Ziegler, A; Zotkin, S A; De Wolf, E; Del Peso, J

    2004-01-01

    Inclusive KsKs production in deep inelastic ep scattering at HERA has been studied with the ZEUS detector using an integrated luminosity of 120 pb-1. Two states are observed at masses of 1537 (+9)(-8) MeV and 1726 +- 7 MeV, as well as an enhancement around 1300 MeV. The state at 1537 MeV is consistent with the well established f2'(1525). The state at 1726 MeV may be the glueball candidate f0(1710).

  4. n Ks =βPe logKs=logβ+nlogPe

    African Journals Online (AJOL)

    Temporal variability also affects results from different field techniques of measuring Ks (Bagarello and Sgroi, 2007) in addition to inherent soil properties that affect macro aggregates, soil fauna and tillage operations. (Feuntes et al., 2004). Also, both laboratory and field techniques have been found to give variable results.

  5. Varem olin ma mänginud kooliteatris vaid puud / Jaanus Kulli

    Index Scriptorium Estoniae

    Kulli, Jaanus, 1955-

    2008-01-01

    Allfilm koos Saksa, Soome ja Iiri partneritega alustas Tallinnas action-mängufilmi "Kid & Killer" võtteid (režissöör ja üks stsenariste Hannu Salonen, stsenaristid Mart Kivastik ja Katrin Laur, operaator Rein Kotov, peaprodutsent Piret Tibbo-Hudgins). Ühte peaossa valiti Westholmi gümnaasiumi õpilane Mart Müürisepp

  6. A Measurement of the $K_{s}$ Lifetime

    CERN Document Server

    Lai, A; Batley, J Richard; Bevan, A; Dosanjh, R S; Gershon, T J; Hay, B; Kalmus, George Ernest; Lazzeroni, C; Munday, D J; Needham, M D; Olaiya, E; Parker, M A; White, T O; Wotton, S A; Barr, Giles David; Bocquet, G; Ceccucci, Augusto; Çuhadar-Dönszelmann, T; Cundy, Donald C; D'Agostini, Giulio; Doble, Niels T; Falaleev, V P; Funk, W; Gatignon, L; Gonidec, A; Gorini, B; Govi, G; Grafström, P; Kubischta, Werner; Lacourt, A; Lenti, M; Luitz, S; Matheys, J P; Mikulec, I; Norton, Alan Robert; Palestini, S; Panzer-Steindel, B; Schinzel, D; Tatishvili, G T; Taureg, Hans; Velasco, M; Vossnack, O; Wahl, H; Cheshkov, C; Gaponenko, A N; Khristov, P Z; Kekelidze, V D; Madigozhin, D T; Molokanova, N A; Potrebenikov, Yu K; Tkachev, A L; Zinchenko, A I; Knowles, I; Martin, V; Parsons, H; Sacco, R; Walker, A; Contalbrigo, M; Dalpiaz, Pietro; Duclos, J; Frabetti, P L; Gianoli, A; Martini, M; Petrucci, F; Savrié, M; Scarpa, M; Bizzeti, A; Calvetti, M; Collazuol, G; Graziani, G; Iacopini, E; Martelli, F; Veltri, M; Becker, H G; Blümer, H; Coward, D; Eppard, M; Fox, H; Hirstius, A; Holtz, K; Kalter, A; Kleinknecht, K; Koch, U; Köpke, L; Lopes da Silva, P; Marouelli, P; Pellmann, I A; Peters, A; Schmidt, S A; Schönharting, V; Schué, Yu; Wanke, R; Winhart, A; Wittgen, M; Chollet, J C; Crépé, S; Fayard, Louis; Iconomidou-Fayard, L; Ocariz, J; Unal, G; Wingerter-Seez, I; Anzivino, Giuseppina; Cenci, P; Imbergamo, E; Lubrano, P; Mestvirishvili, A; Nappi, A; Pepé, M; Piccini, M; Bertanza, L; Bigi, A; Calafiura, P; Carosi, R; Casali, R; Cerri, C; Cirilli, M; Costantini, F; Fantechi, R; Giudici, Sergio; Mannelli, I; Pierazzini, G M; Sozzi, M; Chèze, J B; Cogan, J; De Beer, M; Debu, P; Derue, F; Formica, A; Granier de Cassagnac, R; Mazzucato, E; Peyaud, B; Turlay, René; Vallage, B; Augustin, I; Bender, M; Holder, M; Maier, A; Ziolkowski, M; Arcidiacono, R; Biino, C; Cartiglia, N; Guida, R; Marchetto, F; Menichetti, E; Pastrone, N; Nassalski, J P; Rondio, Ewa; Szleper, M; Wislicki, W; Wronka, S; Dibon, Heinz; Fischer, G; Jeitler, Manfred; Markytan, Manfred; Neuhofer, Günther; Pernicka, Manfred; Taurok, Anton; Widhalm, L

    2002-01-01

    A measurement of the $\\KS$ lifetime is presented using data recorded by the NA48 experiment at the CERN-SPS during 1998 and 1999. The $\\KS$ lifetime is derived from the ratio of decay time distributions in simultaneous, collinear $\\KS$ and $\\KL$ beams, giving a result which is approximately independent of the detector acceptance and with reduced systematic errors. The result obtained is $\\tauS=(0.89598 \\pm 0.00048 \\pm 0.00051)\\E{-10}$\\,s, where the first error is statistical and the second systematic.

  7. 77 FR 42625 - Modification of VOR Federal Airways V-10, V-12, and V-508 in the Vicinity of Olathe, KS

    Science.gov (United States)

    2012-07-20

    ..., CO; Garden City, KS; Dodge City, KS; Hutchinson, KS; Emporia, KS; INT Emporia 063 and Napoleon, MO... (described by the intersection of Topeka, KS, and Kansas City, MO, navigation aid radials). Ending V-508 at... City, KS; Hays, KS; Salina, KS; INT Salina 082 and Manhattan, KS, 207 radials; Manhattan; INT Manhattan...

  8. New ISR Cross Section Results on KS KL pi0 and KS KL pi0 pi0 From BABAR

    CERN Document Server

    ,

    2016-01-01

    We present preliminary measurements of the cross sections for e+e- --> KS KL pi0 and KS KL pi0 pi0 obtained using the technique of Initial State Radiation with 469 fb^-1 of e+e- collision data collected with the BABAR detector at or near the Upsilon(4S) resonance. The resonant substructure of KS KL pi0 is investigated, and branching fractions for the decays of the charmonium resonances J/psi and psi(2S) into these final states are measured.

  9. 76 FR 13966 - Television Broadcasting Services; Topeka, KS

    Science.gov (United States)

    2011-03-15

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Topeka, KS AGENCY: Federal Communications... 73 Television, Television broadcasting. Federal Communications Commission. Barbara A. Kreisman, Chief...

  10. INTEGRAL reports renewed activity from KS 1741-293

    DEFF Research Database (Denmark)

    Chenevez, Jérôme; Kuulkers, E.; Alfonso-Garzón, J.

    2010-01-01

    The low-mass X-ray binary and burster source KS 1741-293 has been detected during recent INTEGRAL Galactic bulge (see ATel #438) observations by the JEM-X instrument. On February 25, 2010, between UTC 13:04 and 14:08, KS 1741-293 was detected at a 3-10 keV flux of 9 +/- 4 mCrab, and an upper limi...

  11. 17KS12000 Motor Grain Structural Integrity Analysis

    Science.gov (United States)

    1981-03-01

    l7KS12000. Lars de !’analyse finale, trois conditions de chargement furent considerees: la contraction thermique , !’acceleration au lancement, et la mise...to be adapted as a third- stage motor to.the Terrier/Black Brant V sounding rocket vehicle. The projected missions required that the motor contain...because the 17KS12000 is a third- stage motor left unpressurized during acceleration; pressur- ization would of course induce a hydrostatic compression

  12. Ilves ja Bush - üks rantšopidajast president kutsus teise külla / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2007-01-01

    USA presidendi George W. Bushi kohtumisest president Toomas Hendrik Ilvesega. Kõne all oli viisavabadus ja NATO küberkaitsekeskuse loomine Eestisse. G.W. Bush avaldas kaastunnet Afganistanis hukkunud Eesti sõdurite omastele. Riigikogu liikmete Marko Mihkelsoni ja Sven Mikseri kommentaarid presidentide kohtumisele. Vt. samas: Esimene riigipea pärjaga. T.H. Ilves asetas pärja kommunismiohvrite mälestusmärgile, mille president G.W. Bush avas 12. juunil 2007. Vabariigi President töövisiidil Ameerika Ühendriikides 25.-26.06.2007

  13. Kadriorus asub Eesti üks kallimaid maale / Pekka Erelt

    Index Scriptorium Estoniae

    Erelt, Pekka, 1965-

    2009-01-01

    Kadrioru Kunstimuuseumi kogusse kuuluvast 16. saj. õlimaalist "Rahavahetajate ja kaubitsejate väljaajamine templist", mida on peetud Hieronymus Boschi tööks. Analoogne maal müüdi Sotheby'se oksjonil 5,4 miljoni krooni eest

  14. MSD grant läks Narva / MSD Teaduskeskus

    Index Scriptorium Estoniae

    2010-01-01

    MSD (Merck Sharpe & Dohme) regionaalsete grantide komitee kuulutas välja konkursi võitja, selleks osutus Narva MTÜ Rehabilitatsioonikeskus "Sind ei jäeta üksi". 2,4 mln kroonine grant on mõeldud noortele HIV-i ja narkootikumide alaseks ennetustööks Ida-Virumaal

  15. Meat Processing and Garden City, KS: Boom and Bust

    Science.gov (United States)

    Broadway, Michael J.; Stull, Donald D.

    2006-01-01

    In December 1980, the world's largest beef processing plant opened 10 miles west of Garden City, KS. Three years later another beef plant opened on Garden City's eastern edge. Full employment in the surrounding region meant that most of the 4000 workers needed to run these plants had to come from elsewhere--and they did. Garden City grew by…

  16. Ainult üks õppekava korraga / Raivo Juurak

    Index Scriptorium Estoniae

    Juurak, Raivo, 1949-

    2004-01-01

    Tallinnas toimus osavõturohka õppekavakonverents. Tartu Ülikooli õppekava arenduskeskuse juhataja Ain Tõnisson ja BIT-i alternatiivse õppekava üks koostajaid Urve Läänemets püüdsid tõestada oma õppekava üldosa paremust

  17. Ultradeep KS Imaging in the GOODS-N

    Science.gov (United States)

    Wang, Wei-Hao; Cowie, Lennox L.; Barger, Amy J.; Keenan, Ryan C.; Ting, Hsiao-Chiang

    2010-03-01

    We present an ultradeep KS -band image that covers 0.5 × 0.5 deg2 centered on the Great Observatories Origins Deep Survey-North (GOODS-N). The image reaches a 5σ depth of K_{S,AB}=24.45 in the GOODS-N region, which is as deep as the GOODS-N Spitzer Infrared Array Camera (IRAC) 3.6 μm image. We present a new method of constructing IRAC catalogs that uses the higher spatial resolution KS image and catalog as priors and iteratively subtracts fluxes from the IRAC images to estimate the IRAC fluxes. Our iterative method is different from the χ2 approach adopted by other groups. We verified our results using data taken in two different epochs of observations, as well as by comparing our colors with the colors of stars and with the colors derived from model spectral energy distributions of galaxies at various redshifts. We make available to the community our WIRCam KS -band image and catalog (94,951 objects in 0.25 deg2), the Interactive Data Language pipeline used for reducing the WIRCam images, and our IRAC 3.6-8.0 μm catalog (16,950 objects in 0.06 deg2 at 3.6 μm). With this improved KS and IRAC catalog and a large spectroscopic sample from our previous work, we study the color-magnitude and color-color diagrams of galaxies. We compare the effectiveness of using KS and IRAC colors to select active galactic nuclei and galaxies at various redshifts. We also study a color selection of z = 0.65-1.2 galaxies using the KS , 3.6 μm, and 4.5 μm bands. Based on observations obtained at the Canada-France-Hawaii Telescope (CFHT), which is operated by the National Research Council of Canada, the Institut National des Sciences de l'Univers of the Centre National de la Recherche Scientifique of France, and the University of Hawaii.

  18. 77 FR 9876 - Proposed Modification of VOR Federal Airways V-10, V-12, and V-508 in the Vicinity of Olathe, KS

    Science.gov (United States)

    2012-02-21

    ... route segments in the vicinity of Olathe, KS, between Emporia, KS, and Napoleon, MO, unchanged. To... descriptions would replace the ``Johnson County, KS'' reference with ``INT Emporia 063 (T)/055 (M) and Napoleon... City, KS; Dodge City, KS; Hutchinson, KS; Emporia, KS; INT Emporia 063 (T)/055 (M) and Napoleon, MO...

  19. Ericsson Euroopas üks suuremaid teadus- ja arendustööle kulutajaid / Annika Matson

    Index Scriptorium Estoniae

    Matson, Annika, 1976-

    2004-01-01

    USA majandusajakiri BusinessWeek koostas kolm edetabelit firmadest, mis kulutavad enim raha teadus- ja arendustööks. Edetabeli kohaselt investeerib Ericsson Euroopa telekommunikatsioonitehnoloogia firmadest enim teadus- ja arendustööks. Diagramm

  20. Hepatotoxicity Induced by "the 3Ks": Kava, Kratom and Khat.

    Science.gov (United States)

    Pantano, Flaminia; Tittarelli, Roberta; Mannocchi, Giulio; Zaami, Simona; Ricci, Serafino; Giorgetti, Raffaele; Terranova, Daniela; Busardò, Francesco P; Marinelli, Enrico

    2016-04-16

    The 3Ks (kava, kratom and khat) are herbals that can potentially induce liver injuries. On the one hand, growing controversial data have been reported about the hepatotoxicity of kratom, while, on the other hand, even though kava and khat hepatotoxicity has been investigated, the hepatotoxic effects are still not clear. Chronic recreational use of kratom has been associated with rare instances of acute liver injury. Several studies and case reports have suggested that khat is hepatotoxic, leading to deranged liver enzymes and also histopathological evidence of acute hepatocellular degeneration. Numerous reports of severe hepatotoxicity potentially induced by kava have also been highlighted, both in the USA and Europe. The aim of this review is to focus on the different patterns and the mechanisms of hepatotoxicity induced by "the 3Ks", while trying to clarify the numerous aspects that still need to be addressed.

  1. Search for K_S K_L in psi'' decays

    CERN Document Server

    Ablikim, M; Ban, Y; Bian, J G; Cai, X; Chang, J F; Chen, H F; Chen, H S; Chen, H X; Chen, J C; Chen, M L; Chen, Y B; Chi, S P; Chu, Y P; Cui, X Z; Dai, H L; Dai, Y S; Deng, Z Y; Dong, L Y; Du, S X; Du, Z Z; Fang, J; Fang, S S; Fu, C D; Fu, H Y; Gao, C S; Gao, Y N; Gong, M Y; Gong, W X; Gu, S D; Guo, Y N; Guo, Y Q; He, K L; He, M; He, X; Heng, Y K; Hu, H M; Hu, T; Huang, G S; Huang, L; Huang, X P; Ji, X B; Jia, Q Y; Jiang, C H; Jiang, X S; Jin, D P; Jin, S; Jin, Y; Lai, Y F; Li, F; Li, G; Li, H H; Li, J; Li, J C; Li, Q J; Li, R B; Li, R Y; Li, S M; Li, W G; Li, X L; Li, X Q; Li, X S; Liang, Y F; Liao, H B; Liu, C X; Liu, F; Liu, H M; Liu, J B; Liu, J P; Liu, R G; Liu, Z A; Liu, Z X; Lu, F; Lu, G R; Lu, J G; Luo, C L; Luo, X L; Ma, F C; Ma, J M; Ma, L L; Ma, Q M; Ma, X Y; Mao, Z P; Mo, X H; Nie, J; Nie, Z D; Peng, H P; Qi, N D; Qian, C D; Qin, H; Qiu, J F; Ren, Z Y; Rong, G; Shan, L Y; Shang, L; Shen, D L; Shen, X Y; Sheng, H Y; Shi, F; Shi, X; Sun, H S; Sun, S S; Sun, Y Z; Sun, Z J; Tang, X; Tao, N; Tian, Y R; Tong, G L; Wang, D Y; Wang, J Z; Wang, K; Wang, L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S Z; Wang, W F; Wang, Y F; Wang, Z; Wang, Z Y; Wei, C L; Wei, D H; Wu, N; Wu, Y M; Xia, X M; Xie, X X; Xin, B; Xu, G F; Xu, H; Xu, Y; Xue, S T; Yan, M L; Yang, F; Yang, H X; Yang, J; Yang, S D; Yang, Y X; Ye, M; Ye, M H; Ye, Y X; Yi, L H; Yi, Z Y; Yu, C S; Yu, G W; Yuan, C Z; Yuan, J M; Yuan, Y; Yue, Q; Zang, S L; Zeng, Yu; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H Y; Zhang, J; Zhang, J Y; Zhang, J W; Zhang, L S; Zhang, Q J; Zhang, S Q; Zhang Xiao Min; Zhang, X Y; Zhang, Y J; Zhang, Y Y; Zhang, Z P; Zhang, Z Q; Zhao, D X; Zhao, J B; Zhao, J W; Zhao, M G; Zhao, P P; Zhao, W R; Zhao, X J; Zhao, Y B; Zhao, Z G; Zheng, H Q; Zheng, J P; Zheng, L S; Zheng, Z P; Zhong, X C; Zhou, B Q; Zhou, G M; Zhou, L; Zhou, N F; Zhu, K J; Zhu, Q M; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, B A; Zou, B S

    2004-01-01

    K_S K_L from psi'' decays is searched for using the psi'' data collected by BESII at BEPC, the upper limit of the branching fraction is determined to be B(psi''--> K_S K_L) K_S K_L and psi'-->K_S K_L.

  2. Eestil viisavabadus USAga alates 17. novembrist

    Index Scriptorium Estoniae

    2008-01-01

    Ameerika Ühendriikide sisejulgeoleku minister Michael Chertoff tegi teatavaks, et Eesti, Ungari, Läti, Leedu, Tšehhi, Slovakkia ja Lõuna-Korea liituvad 17. novembril 2008 USA viisavabadusprogrammiga. Michael Chertoff kohtus 29. oktoobril 2008 Tallinnas Eesti peaministri Andrus Ansipi ja välisminister Urmas Paetiga. President Toomas Hendrik Ilves andis M. Chertoffi auks Kadriorus piduliku õhtusöögi

  3. Penelitian penentuan konstanta saturasi (Ks pada rbc unit

    Directory of Open Access Journals (Sweden)

    Prayitno Prayitno

    1992-04-01

    Full Text Available Kinetic of Rotating Biological Contractor have been investigated by manu researchers. In general the model emploued either saturation kinetic (following Monod equation or first order kinetic to describe substrate removal. In this experiment, saturation kinetic model was used to find out the saturation constant of the RBC unit. The influent fed into the unit was synthetic waste water with glucose as organic carbon sources. The flow was maintained constant at 20.4 1/d and COD influent resulted the saturation constant (Ks 11.17 mg/I with 20 hours of detention time.

  4. Search for C P Violation and Measurement of the Branching Fraction in the Decay D0→KS0KS0

    Science.gov (United States)

    Dash, N.; Bahinipati, S.; Bhardwaj, V.; Trabelsi, K.; Adachi, I.; Aihara, H.; Al Said, S.; Asner, D. M.; Aulchenko, V.; Aushev, T.; Ayad, R.; Babu, V.; Badhrees, I.; Bakich, A. M.; Bansal, V.; Barberio, E.; Bhuyan, B.; Biswal, J.; Bobrov, A.; Bondar, A.; Bonvicini, G.; Bozek, A.; Bračko, M.; Breibeck, F.; Browder, T. E.; Červenkov, D.; Chang, M.-C.; Chekelian, V.; Chen, A.; Cheon, B. G.; Chilikin, K.; Cho, K.; Choi, Y.; Cinabro, D.; Di Carlo, S.; Doležal, Z.; Drásal, Z.; Dutta, D.; Eidelman, S.; Epifanov, D.; Farhat, H.; Fast, J. E.; Ferber, T.; Fulsom, B. G.; Gaur, V.; Gabyshev, N.; Garmash, A.; Gillard, R.; Goldenzweig, P.; Haba, J.; Hara, T.; Hayasaka, K.; Hayashii, H.; Hedges, M. T.; Hou, W.-S.; Iijima, T.; Inami, K.; Ishikawa, A.; Itoh, R.; Iwasaki, Y.; Jacobs, W. W.; Jaegle, I.; Jeon, H. B.; Jin, Y.; Joffe, D.; Joo, K. K.; Julius, T.; Kahn, J.; Kaliyar, A. B.; Karyan, G.; Katrenko, P.; Kawasaki, T.; Kiesling, C.; Kim, D. Y.; Kim, H. J.; Kim, J. B.; Kim, K. T.; Kim, M. J.; Kim, S. H.; Kim, Y. J.; Kinoshita, K.; Kodyš, P.; Korpar, S.; Kotchetkov, D.; Križan, P.; Krokovny, P.; Kuhr, T.; Kulasiri, R.; Kumar, R.; Kumita, T.; Kuzmin, A.; Kwon, Y.-J.; Lange, J. S.; Lee, I. S.; Li, C. H.; Li, L.; Li, Y.; Li Gioi, L.; Libby, J.; Liventsev, D.; Lubej, M.; Luo, T.; Masuda, M.; Matvienko, D.; Merola, M.; Miyabayashi, K.; Miyata, H.; Mizuk, R.; Mohanty, G. B.; Mohanty, S.; Moon, H. K.; Mori, T.; Mussa, R.; Nakano, E.; Nakao, M.; Nanut, T.; Nath, K. J.; Natkaniec, Z.; Nayak, M.; Niiyama, M.; Nisar, N. K.; Nishida, S.; Ogawa, S.; Okuno, S.; Ono, H.; Pakhlov, P.; Pakhlova, G.; Pal, B.; Pardi, S.; Park, C.-S.; Park, H.; Paul, S.; Pedlar, T. K.; Pesántez, L.; Pestotnik, R.; Piilonen, L. E.; Prasanth, K.; Ritter, M.; Rostomyan, A.; Sahoo, H.; Sakai, Y.; Sandilya, S.; Santelj, L.; Sanuki, T.; Sato, Y.; Savinov, V.; Schneider, O.; Schnell, G.; Schwanda, C.; Schwartz, A. J.; Seino, Y.; Senyo, K.; Sevior, M. E.; Shebalin, V.; Shen, C. P.; Shibata, T.-A.; Shiu, J.-G.; Shwartz, B.; Simon, F.; Sokolov, A.; Solovieva, E.; Starič, M.; Strube, J. F.; Stypula, J.; Sumisawa, K.; Sumiyoshi, T.; Takizawa, M.; Tamponi, U.; Tanida, K.; Tenchini, F.; Uchida, M.; Uglov, T.; Unno, Y.; Uno, S.; Urquijo, P.; Usov, Y.; Van Hulse, C.; Varner, G.; Vorobyev, V.; Vossen, A.; Waheed, E.; Wang, C. H.; Wang, M.-Z.; Wang, P.; Watanabe, M.; Watanabe, Y.; Widmann, E.; Williams, K. M.; Won, E.; Yamashita, Y.; Ye, H.; Yelton, J.; Yook, Y.; Yuan, C. Z.; Yusa, Y.; Zhang, Z. P.; Zhilich, V.; Zhukova, V.; Zhulanov, V.; Zupanc, A.; Belle Collaboration

    2017-10-01

    We report a study of the decay D0→KS0KS0 using 921 fb-1 of data collected at or near the ϒ (4 S ) and ϒ (5 S ) resonances with the Belle detector at the KEKB asymmetric energy e+e- collider. The measured time-integrated C P asymmetry is AC P(D0→KS0KS0)=(-0.02 ±1.53 ±0.02 ±0.17 )% , and the branching fraction is B (D0→KS0KS0) =(1.321 ±0.023 ±0.036 ±0.044 )×10-4 , where the first uncertainty is statistical, the second is systematic, and the third is due to the normalization mode (D0→KS0π0). These results are significantly more precise than previous measurements available for this mode. The AC P measurement is consistent with the standard model expectation.

  5. Miks tohib Eesti Vabariigi juubeliks teha filme vaid enne 1940. a ilmunud kirjandusteoste põhjal? / Meelis Muhu ; interv. Margit Tõnson

    Index Scriptorium Estoniae

    Muhu, Meelis

    2007-01-01

    Kultuuriministeeriumi poolt väljakuulutavava mängufilmide stsenaariumikonkursi üks tingimusi on, et stsenaarium võiks põhineda enne 1940. aastat ilmunud kirjandusteosel. Kultuuriministeeriumi filminõunik põhjendab

  6. Üks küsimus : kuidas peaksime reageerima sellistesse teadetesse / Urmas Reinsalu , Urmas Paet

    Index Scriptorium Estoniae

    Reinsalu, Urmas, 1975-

    2014-01-01

    USA eksvälisminister Hillary Clinton ütles, et Venemaa presidendil Vladimir Putinil on ettekääne Balti riikidesse tungimiseks."Põhjendust, mida Putin Krimmis kasutab - et need on etnilised venelased ja venekeelsed, et nad on alati olnud Venemaa osa - võib laiendada mitte üksnes Ukraina teistele osadele, vaid ka Eesti, Leedu, Läti ja Transnistria osadele," ütles Clinton. Küsimusele "Kuidas peaksime reageerima sellistesse teadetesse?" vastavad kaitseminister Urmas Reinsalu ja välisminister Urmas Paet

  7. Observation of the rare decays $K_{s} \\to \\pi^{0} \\mu^{+} \\mu^{-}$

    CERN Document Server

    Batley, J Richard; Lazzeroni, C; Munday, D J; Patel, M; Slater, M W; AWotton, S; Arcidiacono, R; Bocquet, G; Ceccucci, A; Cundy, Donald C; Doble, Niels T; Falaleev, V; Gatignon, L; Gonidec, A; Grafström, P; Kubischta, Werner; Marchetto, F; Mikulec, I; Norton, A; Panzer-Steindel, B; Rubin, P; Wahl, H; Monnier, E; Swallow, E; Winston, R; Goudzovski, E; Gurev, D; Khristov, P Z; Kekelidze, Vladimir D; Kozhuharov, V; Litov, L; Madigozhin, D T; Molokanova, N A; Potrebenikov, Yu K; Stoynev, S; Zinchenko, A I; Sacco, R; Walker, A; Baldini, W; Dalpiaz, Pietro; Duclos, J; Frabetti, P L; Gianoli, A; Martini, M; Petrucci, F; Scarpa, M; Savrié, M; Bizzeti, A; Calvetti, M; Graziani, G; Iacopini, E; Lenti, M; Martelli, F; Ruggiero, G; Veltri, M; Behler, M; Eppard, K; Eppard, M; Hirstius, A; Kleinknecht, K; Koch, U; Masetti, L; Marouelli, P; Moosbrugger, U; Morales-Morales, C; Peters, A; Wanke, R; Winhart, A; Dabrowski, A; Fonseca-Martin, T; Szleper, M; Velasco, M; Anzivino, Giuseppina; Cenci, P; Imbergamo, E; Lamanna, G; Lubrano, P; Michetti, A; Nappi, A; Pepé, M; Petrucci, M C; Piccini, M; Valdata, M; Cerri, C; Collazuol, G; Costantini, F; Fantechi, R; Fiorini, Luca; Giudici, Sergio; Mannelli, I; Pierazzini, G M; Sozzi, M; Cheshkov, C; Chèze, J B; De Beer, M; Debu, P; Gouge, G; Marel, Gérard; Mazzucato, E; Peyaud, B; Vallage, B; Holder, M; Maier, A; Ziolkowski, M; Biino, C; Cartiglia, N; Clemencic, M; Goy-Lopez, S; Menichetti, E; Pastrone, N; Wislicki, W; Dibon, Heinz; Jeitler, Manfred; Markytan, Manfred; Neuhofer, G; Widhalm, L

    2004-01-01

    A search for the decay Ks -> pi0 mu+ mu- has been made by the NA48/1 Colaboration at the CERN SPS accelerator. The data were collected during 2002 with a high intensity Ks beam. Six events were found with a background expectation of 0.22^+0.18_0.11 events. Using a vector matrix element and unit form factor, the measured branching ratio is B(Ks -> pi0 mu+ mu-) = [2.9^+1.5_1.2(stat) +- 0.2 (syst)] x 10^9.

  8. Search for a narrow baryonic state decaying to pKS0 and p‾KS0 in deep inelastic scattering at HERA

    Directory of Open Access Journals (Sweden)

    H. Abramowicz

    2016-08-01

    Full Text Available A search for a narrow baryonic state in the pKS0 and p‾KS0 system has been performed in ep collisions at HERA with the ZEUS detector using an integrated luminosity of 358pb−1 taken in 2003–2007. The search was performed with deep inelastic scattering events at an ep centre-of-mass energy of 318GeV for exchanged photon virtuality, Q2, between 20 and 100GeV2. Contrary to evidence presented for such a state around 1.52 GeV in a previous ZEUS analysis using a sample of 121 pb−1 taken in 1996–2000, no resonance peak was found in the p(p‾KS0 invariant-mass distribution in the range 1.45–1.7 GeV. Upper limits on the production cross section are set.

  9. Legal Careers in the Office of Regional Counsel in Lenexa, KS (EPA Region 7)

    Science.gov (United States)

    Legal Careers in the Office of Regional Counsel in Lenexa, KS (EPA Region 7). Specific experience with the Resource Conservation and Recovery Act (RCRA), the Federal Insecticide, Fungicide and Rodenticide Act (FIFRA), the Toxic Substances Control Act (TSCA

  10. Search for the K(S) --> e+e- decay with the KLOE detector at DAFNE

    CERN Document Server

    Ambrosino, F; Antonelli, M; Archilli, F; Bacci, C; Beltrame, P; Bencivenni, G; Bertolucci, S; Bini, C; Bloise, C; Bocchetta, S; Bocci, V; Bossi, F; Branchini, P; Caloi, R; Campana, P; Capon, G; Capussela, T; Ceradini, F; Chi, S; Chiefari, G; Ciambrone, P; De Lucia, E; De Santis, A; De Simone, P; De Zorzi, G; Denig, A; Di Domenico, A; Di Donato, C; Di Falco, S; Di Micco, B; Doria, A; Dreucci, M; Felici, G; Ferrari, A; Ferrer, M L; Finocchiaro, G; Fiore, S; Forti, C; Franzini, P; Gatti, C; Gauzzi, P; Giovannella, S; Gorini, E; Graziani, E; Incagli, M; Kluge, W; Kulikov, V; Lacava, F; Lanfranchi, G; Lee-Franzini, J; Leone, D; Martini, M; Massarotti, P; Mei, W; Meola, S; Miscetti, S; Moulson, M; Müller, S; Murtas, F; Napolitano, M; Nguyen, F; Palutan, M; Pasqualucci, E; Passeri, A; Patera, V; Perfetto, F; Primavera, M; Santangelo, P; Saracino, G; Sciascia, B; Sciubba, A; Scuri, F; Sfiligoi, I; Spadaro, T; Testa, M; Tortora, L; Valente, P; Valeriani, B; Venanzoni, G; Versaci, R; Xu, G

    2007-01-01

    We present results of a direct search for the decay KS --> e+e- with the KLOE detector, obtained with a sample of e+e- --> phi --> KSKL events produced at DAFNE, the Frascati phi-factory, for an integrated luminosity of 1.3fb-1. The Standard Model prediction for this decay is BR(KS --> e+e-) = 1.6*10^-15. The search has been performed tagging the KS decays by simultaneous detection of a KL interaction in the calorimeter. Background rejection has been optimized by using both kinematic cuts and particle identification. At the end of the analysis chain we find BR(KS --> e+e-) < 2.1*10^-8 at 90% CL, which improves by a factor of ~7 on the previous best result, obtained by CPLEAR experiment.

  11. [Marie Heiberg. Üks naine kurbade silmadega] / Marko Mägi

    Index Scriptorium Estoniae

    Mägi, Marko

    2010-01-01

    Arvustus: Heiberg, Marie. Üks naine kurbade silmadega : Eesti luuletaja Marie Heibergi õnne ja valu, rõõmu ja mure lugu kirjades / [koostajad Iivi Lepik, Kirsten Simmo]. Tallinn : Eesti Teatri- ja Muusikamuuseum : SE & JS, 2010

  12. High-quality genome sequence of the radioresistant bacterium Deinococcus ficus KS 0460

    OpenAIRE

    Matrosova, Vera Y.; Gaidamakova, Elena K.; Makarova, Kira S.; Grichenko, Olga; Klimenkova, Polina; Volpe, Robert P.; Tkavc, Rok; Ertem, G?zen; Conze, Isabel H.; Brambilla, Evelyne; Huntemann, Marcel; Clum, Alicia; Pillay, Manoj; Palaniappan, Krishnaveni; Varghese, Neha

    2017-01-01

    The genetic platforms of Deinococcus species remain the only systems in which massive ionizing radiation (IR)-induced genome damage can be investigated in vivo at exposures commensurate with cellular survival. We report the whole genome sequence of the extremely IR-resistant rod-shaped bacterium Deinococcus ficus KS 0460 and its phenotypic characterization. Deinococcus ficus KS 0460 has been studied since 1987, first under the name Deinobacter grandis, then Deinococcus grandis. The D. ficus K...

  13. A new limit on the CP violating decay KS -> 3pi0 with the KLOE experiment

    CERN Document Server

    Babusci, D; Balwierz-Pytko, I; Bencivenni, G; Bini, C; Bloise, C; Bossi, F; Branchini, P; Budano, A; Balkestahl, L Caldeira; Capon, G; Ceradini, F; Ciambrone, P; Curciarello, F; Czerwinski, E; Dane, E; De Leo, V; De Lucia, E; De Robertis, G; De Santis, A; Di Domenico, A; Di Donato, C; Di Salvo, R; Domenici, D; Erriquez, O; Fanizzi, G; Fantini, A; Felici, G; Fiore, S; Franzini, P; Gauzzi, P; Giardina, G; Giovannella, S; Gonnella, F; Graziani, E; Happacher, F; Heijkenskjold, L; Hoistad, B; Iafolla, L; Jacewicz, M; Johansson, T; Kacprzak, K; Kupsc, A; Lee-Franzini, J; Leverington, B; Loddo, F; Loffredo, S; Mandaglio, G; Martemianov, M; Martini, M; Mascolo, M; Messi, R; Miscetti, S; Morello, G; Moricciani, D; Moskal, P; Nguyen, F; Passeri, A; Patera, V; Longhi, I Prado; Ranieri, A; Redmer, C F; Santangelo, P; Sarra, I; Schioppa, M; Sciascia, B; Silarski, M; Taccini, C; Tortora, L; Venanzoni, G; Wislicki, W; Wolke, M; Zdebik, J

    2013-01-01

    We have carried out a new direct search for the CP violating decay KS -> 3pi0 with 1.7 fb^-1 of e+e- collisions collected by the KLOE detector at the phi-factory DAFNE. We have searched for this decay in a sample of about 5.9 x 10^8 KS KL events tagging the KS by means of the KL interaction in the calorimeter and requiring six prompt photons. With respect to our previous search, the analysis has been improved by increasing of a factor four the tagged sample and by a more effective background rejection of fake KS tags and spurious clusters. We find no candidates in data and simulated background samples, while we expect 0.12 standard model events. Normalizing to the number of KS -> 2pi0 events in the same sample, we set the upper limit on BR(KS -> 3pi0 < 2.6 x 10^-8 at 90% C.L., five times lower than the previous limit. We also set the upper limit on the eta_000 parameter, |eta_000 | < 0.0088 at 90% C.L., improving by a factor two the latest direct measurement.

  14. Pirita kooli juures valmib aasta lõpul spordihall : Pealinna rahakott avaneb tänavu vaid kolmele linnakoolile / Mari Rebane

    Index Scriptorium Estoniae

    Rebane, Mari

    2003-01-01

    Järgmise aasta alguses valmib Pirita majandusgümnaasiumi juurdeehitus, kus paikneb võimla koos kõigi vajalike sporditarvetega. Pirita majandusgümnaasium on üks kolmest koolist, mis tänavu linnalt raha saavad

  15. Biochemical, antimicrobial and molecular characterization of a noncytotoxic bacteriocin produced by Lactobacillus plantarum ST71KS.

    Science.gov (United States)

    Martinez, Rafael Chacon Ruiz; Wachsman, Monica; Torres, Nicolas Ignacio; LeBlanc, Jean Guy; Todorov, Svetoslav Dimitrov; Franco, Bernadette Dora Gombossy de Melo

    2013-06-01

    Lactobacillus (Lb.) plantarum ST71KS was isolated from homemade goat feta cheese and identified using biochemical and molecular biology techniques. As shown by Tricine-SDS-PAGE, this lactic acid bacterium produces a bacteriocin (ST71KS) with an estimated molecular weight of 5.0 kDa. Bacteriocin ST71KS was not affected by the presence of α-amylase, catalase and remained stable in a wide range of pH and after treatment with Triton X-100, Triton X-114, Tween 20, Tween 80, NaCl, SDS, urea and EDTA. This bacteriocin also remained active after being heated at 100 °C for 2 h and even after 20 min at 121 °C; however, it was inactivated by proteolitic enzymes. Production of bacteriocin ST71KS reached 6400 AU/mL during stationary growth phase of Lb. plantarum cultivated in MRS at 30 °C and 37 °C. Bacteriocin ST71KS displayed a bactericidal effect against Listeria monocytogenes strains 603 and 607 and did not adsorb to the producer cells. Lb. plantarum ST71KS harbors two bacteriocin genes with homology to plantaricin S and pediocin PA-1. These characteristics indicate that bacteriocin ST71KS is a class IIa bacteriocin. The peptide presented no toxic effect when tested in vitro with kidney Vero cells, indicating safe technological application to control L. monocytogenes in foods. Copyright © 2013 Elsevier Ltd. All rights reserved.

  16. High-quality genome sequence of the radioresistant bacterium Deinococcus ficus KS 0460.

    Science.gov (United States)

    Matrosova, Vera Y; Gaidamakova, Elena K; Makarova, Kira S; Grichenko, Olga; Klimenkova, Polina; Volpe, Robert P; Tkavc, Rok; Ertem, Gözen; Conze, Isabel H; Brambilla, Evelyne; Huntemann, Marcel; Clum, Alicia; Pillay, Manoj; Palaniappan, Krishnaveni; Varghese, Neha; Mikhailova, Natalia; Stamatis, Dimitrios; Reddy, Tbk; Daum, Chris; Shapiro, Nicole; Ivanova, Natalia; Kyrpides, Nikos; Woyke, Tanja; Daligault, Hajnalka; Davenport, Karen; Erkkila, Tracy; Goodwin, Lynne A; Gu, Wei; Munk, Christine; Teshima, Hazuki; Xu, Yan; Chain, Patrick; Woolbert, Michael; Gunde-Cimerman, Nina; Wolf, Yuri I; Grebenc, Tine; Gostinčar, Cene; Daly, Michael J

    2017-01-01

    The genetic platforms of Deinococcus species remain the only systems in which massive ionizing radiation (IR)-induced genome damage can be investigated in vivo at exposures commensurate with cellular survival. We report the whole genome sequence of the extremely IR-resistant rod-shaped bacterium Deinococcus ficus KS 0460 and its phenotypic characterization. Deinococcus ficus KS 0460 has been studied since 1987, first under the name Deinobacter grandis, then Deinococcus grandis. The D. ficus KS 0460 genome consists of a 4.019 Mbp sequence (69.7% GC content and 3894 predicted genes) divided into six genome partitions, five of which are confirmed to be circular. Circularity was determined manually by mate pair linkage. Approximately 76% of the predicted proteins contained identifiable Pfam domains and 72% were assigned to COGs. Of all D. ficus KS 0460 proteins, 79% and 70% had homologues in Deinococcus radiodurans ATCC BAA-816 and Deinococcus geothermalis DSM 11300, respectively. The most striking differences between D. ficus KS 0460 and D. radiodurans BAA-816 identified by the comparison of the KEGG pathways were as follows: (i) D. ficus lacks nine enzymes of purine degradation present in D. radiodurans, and (ii) D. ficus contains eight enzymes involved in nitrogen metabolism, including nitrate and nitrite reductases, that D. radiodurans lacks. Moreover, genes previously considered to be important to IR resistance are missing in D. ficus KS 0460, namely, for the Mn-transporter nramp, and proteins DdrF, DdrJ and DdrK, all of which are also missing in Deinococcus deserti. Otherwise, D. ficus KS 0460 exemplifies the Deinococcus lineage.

  17. The X-Ray Binary KS 1731{260: Possible Analogy with Her X-1

    Directory of Open Access Journals (Sweden)

    Vojtěch Šimon

    2014-12-01

    Full Text Available The X-ray binary with the neutron star (NS, KS 1731-260, displays superorbital cycle similar to that in Her X-1. The accretion disk had the memory of the cycle-length even when this modulation sometimes disappeared in the main outburst of KS 1731-260, and during anomalous low state in Her X-1. The disk still existed during such seasons. Although irradiation of the disk by X-rays is a viable explanation for the disk precession and warping (see model of Foulkes et al., the mechanisms which give rise to the observed X-ray modulation are quite dierent for each of these systems. Variable absorption can explain this cycle only in Her X-1. We propose a variable mass accretion rate onto the NS in KS 1731-260 due to a highly variable impact of the inflowing mass stream with the changing phase of the cycle.

  18. LHCb: Measurement of the time-dependent CP asymmetry in $B^{0} \\rightarrow J/\\psi K_S^0$

    CERN Multimedia

    Szilard, D

    2012-01-01

    The LHCb is one of the LHC experiments, specially designed to study CP violation and rare decays of b-quark. In this scenario, the decay $B^{0} \\rightarrow J/\\psi K_S^0$ is a well-known mode to study CP violation. The final state is the same for both CP eigenstates $B^0$ and $\\overline{B^0}$, which enables the interference through the b-quark oscillations.The CKM angle $\\beta$ can be extracted from the above decay. The time dependent decay rate asymmetry can be written as: $$ \\mathcal{A}_{J/\\psi K_S^0} (t) = S_{J/\\psi K_S^0} \\sin(\\Delta m_d t) - C_{J/\\psi K_S^0} \\cos( \\Delta m_d t) $$ where, in the standard model, the parameters $S_{J/\\psi K_S^0}$ and $C_{J/\\psi K_S^0}$ are connected to the CKM angle $\\beta$ through: $$S_{J/\\psi K_S^0} = \\sin 2 \\beta \\, \\rm{ and } \\, C_{J/\\psi K_S^0} = 0 $$ Here we report the time-dependent analysis in the $B^{0} \\rightarrow J/\\psi (\\mu^{+} \\mu^{-}) K_S^0 (\\pi^{+} \\pi^{-})$ decays. Using the $1fb^{-1}$ of integrated luminosity data collected in 2011 at LHCb operat...

  19. K/S two-point-boundary-value problems. [for orbital trajectory optimization

    Science.gov (United States)

    Jezewski, D. J.

    1976-01-01

    A method for developing the missing general K/S (Kustaanheimo/Stiefel) boundary conditions is presented, with use of the formalism of optimal control theory. As an illustrative example, the method is applied to the K/S Lambert problem to derive the missing terminal condition. The necessary equations are developed for a solution to this problem with the generalized eccentric anomaly, E, as the independent variable. This formulation, requiring the solution of only one nonlinear, well-behaved equation in one unknown, E, results in considerable simplification of the problem.

  20. Atomistic study on the FCC/BCC interface structure with {112}KS orientation

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Keonwook [Los Alamos National Laboratory; Beyerlein, Irene [Los Alamos National Laboratory

    2011-09-23

    In this study, atomistic simulation is used to explore the atomic interface structure, the intrinsic defect network, and mechanism of twin formation from the {112}KS Cu-Nb interface. The interface structure of different material systems AI-Fe and AI-Nb are also compared with Cu-Nb interface.

  1. 75 FR 65404 - Security Savings Bank, FSB; Olathe, KS; Notice of Appointment of Receiver

    Science.gov (United States)

    2010-10-22

    ... Office of Thrift Supervision Security Savings Bank, FSB; Olathe, KS; Notice of Appointment of Receiver Notice is hereby given that, pursuant to the authority contained in section 5(d)(2) of the Home Owners... Corporation as sole Receiver for Security Savings Bank, FSB, Olathe, Kansas (OTS No. 06084), on October 15...

  2. The Ks-band Tully–Fisher Relation–A Determination of the Hubble ...

    Indian Academy of Sciences (India)

    The value of Hubble parameter (H0) is determined using the morphologically type dependent Ks-band Tully–Fisher Relation (K-TFR). The slope and zero point are determined using 36 calibrator galaxies with ScI morphology. Calibration distances are adopted from direct Cepheid distances, and group or companion ...

  3. Lihtsalt üks vihmane suvepäev / Robert Lepikson

    Index Scriptorium Estoniae

    Lepikson, Robert, 1952-2006

    2004-01-01

    Viimasest võimutülist Võru linnas; Märt Raski valimisest Riigikohtu esimeheks; Res Publica liikmete omavahelistest suhetest pärast europarlamendi valimistel lüüasaamist; seaduseelnõust, mille üks punkt lubab möödasõidul piirkiirust ületada

  4. Translation, cultural adaptation and validation of the Kidney Disease Knowledge Survey (KiKS) to Spanish

    Science.gov (United States)

    Mota-Anaya, Evelin; Yumpo-Cárdenas, Daniel; Alva-Bravo, Edmundo; Wright Nunes, Julie A.; Mayta-Tristán, Percy

    2016-01-01

    Introduction Chronic kidney disease (CKD) affects 50 million people globally. Several studies show the importance of implementing interventions that enhance patients' knowledge about their disease. In 2011, the Kidney Disease Knowledge Survey (KiKS) was developed, a questionnaire that assesses the specific knowledge about CKD in pre-dialysis patients. Objective To translate to Spanish, culturally adapt and validate the questionnaire KiKS in a population of patients with pre-dialysis CKD. Methods The translation and cultural adaptation of KiKS was performed. Subsequently, its validity and reliability were determined. The validity was evaluated by construct validity; and the reliability by its internal consistency and its intra-observer reliability (test-retest). Results A good internal consistency was found (Kuder-Richardson = 0.85). Regarding intra-observer reliability, the intraclass correlation coefficient with a value of 0.78 (95% CI: 0.5–1.0) indicated a good reproducibility; the mean difference of −1.1 test-retest S.D. 6.0 (p = 0.369) confirm this. Conclusions The Spanish version of KiKS is acceptable and equivalent to the original version and has good reliability, validity and reproducibility. Therefore, it could be used in a population of culturally similar patients with pre-dialysis CKD. PMID:27513762

  5. K.S. micro-implant placement guide | Sharma | Annals of Medical ...

    African Journals Online (AJOL)

    Many techniques have been used to facilitate safe placement of interradicular miniscrews. Brass Wires or metallic markers are easy to place in the interproximal spaces, but because their relative positions may be inconsistent in different radio -graphic views, they are not always accurate. K.S. micro implant placement guide ...

  6. Mereväe uusim miinijahtija on tööks valmis / Holger Roonemaa

    Index Scriptorium Estoniae

    Roonemaa, Holger

    2007-01-01

    Pidulikust tseremooniast, mille käigus kaitseminister Jaak Aaviksoo andis miinijahtija Admiral Cowan komandörile üle sertifikaadi, mis tähendab, et laev on tööks valmis. Teine uus miinijahtija saabub Eestisse 2008. aastal, kolmas 2009. aastal

  7. The Ks-band Tully–Fisher Relation – A Determination of the Hubble ...

    Indian Academy of Sciences (India)

    Abstract. The value of Hubble parameter (H0) is determined using the morphologically type dependent Ks-band Tully–Fisher Relation (K-TFR). The slope and zero point are determined using 36 calibrator galaxies with. ScI morphology. Calibration distances are adopted from direct Cepheid dis- tances, and group or ...

  8. Amplitude analysis of the D+ -> K-S(0)pi + (0)(pi) Dalitz plot

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Braun, S.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, Y.; Fava, L.; Feng, C. Q.; Fu, C. D.; Fuks, O.; Gao, Q.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, T.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, L.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Kloss, B.; Kopf, B.; Kornicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leyhe, M.; Li, C. H.; Li, Cheng; Li, Cui; Li, D.; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, Q. J.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Lin, D. X.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, K.; Liu, K. Y.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, G. R.; Lu, H. J.; Lu, H. L.; Lu, J. G.; Lu, X. R.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Moeini, H.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Qin, N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ripka, M.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, W. M.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Werner, M.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, N.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zang, S. L.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. B.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.

    2014-01-01

    We perform an analysis of the D+ -> K-S(0)pi + (0)(pi) Dalitz plot using a data set of 2.92 fb(-1) of e(+) e(-) collisions at the (3770) mass accumulated by the BESIII experiment, in which 166694 candidate events are selected with a background of 15.1%. The Dalitz plot is found to be well

  9. Kuldlõvi läks Veneetsias Saksa paviljonile / Harry Liivrand

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    2001-01-01

    49. Veneetsia biennaali peapreemia Kuldlõvi läks Saksa paviljonile, kus eksponeeritakse Gregor Schneideri environment'i nn. surnud maja teemal. Kuldlõvi elutöö eest anti Ameerika skulptorile Richard Serrale ning tema kaasmaalasele maalikunstnik Cy Twomblyle

  10. Updated branching fraction measurements of B-(s)(0) -> K(S)(0)h(+)h'(-) decays

    NARCIS (Netherlands)

    Dufour, L.; Mulder, M; Onderwater, C. J. G.; Pellegrino, A.; Tolk, S.; van Veghel, M.

    2017-01-01

    The charmless three-body decays B-(s)(0) -> K(S)(0)h(+)h '(-) (where h((')) - pi, K) are analysed using a sample of pp collision data recorded by the LHCb experiment, corresponding to an integrated luminosity of 3 fb(-1). The branching fractions are measured relative to that of the B-0 -> K-S(0)

  11. Detection of secondary eclipses of WASP-10b and Qatar-1b in the Ks band and the correlation between Ks-band temperature and stellar activity.

    Science.gov (United States)

    Cruz, Patricia; Barrado, David; Lillo-Box, Jorge; Diaz, Marcos; López-Morales, Mercedes; Birkby, Jayne; Fortney, Jonathan J.; Hodgkin, Simon

    2017-10-01

    The Calar Alto Secondary Eclipse study was a program dedicated to observe secondary eclipses in the near-IR of two known close-orbiting exoplanets around K-dwarfs: WASP-10b and Qatar-1b. Such observations reveal hints on the orbital configuration of the system and on the thermal emission of the exoplanet, which allows the study of the brightness temperature of its atmosphere. The observations were performed at the Calar Alto Observatory (Spain). We used the OMEGA2000 instrument (Ks band) at the 3.5m telescope. The data was acquired with the telescope strongly defocused. The differential light curve was corrected from systematic effects using the Principal Component Analysis (PCA) technique. The final light curve was fitted using an occultation model to find the eclipse depth and a possible phase shift by performing a MCMC analysis. The observations have revealed a secondary eclipse of WASP-10b with depth of 0.137%, and a depth of 0.196% for Qatar-1b. The observed phase offset from expected mid-eclipse was of -0.0028 for WASP-10b, and of -0.0079 for Qatar-1b. These measured offsets led to a value for |ecosω| of 0.0044 for the WASP-10b system, leading to a derived eccentricity which was too small to be of any significance. For Qatar-1b, we have derived a |ecosω| of 0.0123, however, this last result needs to be confirmed with more data. The estimated Ks-band brightness temperatures are of 1647 K and 1885 K for WASP-10b and Qatar-1b, respectively. We also found an empirical correlation between the (R'HK) activity index of planet hosts and the Ks-band brightness temperature of exoplanets, considering a small number of systems.

  12. PÖFFi võit läks Türki, "Sügisballil" läks hästi / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2007-01-01

    Lõppes 11. Pimedate Ööde Filmifestival. EurAsia programmi grand prix läks Türgi filmile "Takva", parim režissöör on Aleksandr Sokurov ("Aleksandra"), parima naisnäitleja auhinna sai Maarja Jakobson ("Sügisball"), parima meesnäitleja auhinna sai Zdenek Sverak ("Tühjad pudelid"). Parim Eesti film on "Sügisball", mis üldse sai festivalil kuus auhinda. Lisaks nimekiri "Pimedate Ööde filmifestival jagas auhindu" ja lühiintervjuu "3 küsimust" Veiko Õunpuult

  13. Observation of the rare decay $K_S \\rightarrow \\pi^0 \\mathrm{e}^+\\mathrm{e}^-$

    CERN Document Server

    Batley, J Richard; Lazzeroni, C; Munday, D J; Patel, M; Slater, M W; Wotton, S A; Arcidiacono, R; Bocquet, G; Ceccucci, Augusto; Cundy, Donald C; Doble, Niels T; Falaleev, V P; Gatignon, L; Gonidec, A; Grafström, P; Kubischta, Werner; Marchetto, F; Mikulec, I; Norton, A; Panzer-Steindel, B; Rubin, P; Wahl, H; Goudzovski, E; Gurev, D; Khristov, P Z; Kekelidze, V D; Litov, L; Madigozhin, D T; Molokanova, N A; Potrebenikov, Yu K; Stoynev, S; Zinchenko, A I; Monnier, E; Swallow, E C; Winston, R; Sacco, R; Walker, A; Baldini, W; Dalpiaz, Pietro; Frabetti, P L; Gianoli, A; Martini, M; Petrucci, F; Scarpa, M; Savrié, M; Bizzeti, A; Calvetti, M; Collazuol, G; Graziani, G; Iacopini, E; Lenti, M; Martelli, F; Ruggiero, G; Veltri, M; Behler, M; Eppard, K; Eppard, M; Hirstius, A; Kleinknecht, K; Koch, U; Masetti, L; Marouelli, P; Moosbrugger, U; Morales-Morales, C; Peters, A; Wanke, R; Winhart, A; Dabrowski, A; Fonseca-Martin, T; Goy-Lopez, S; Velasco, M; Anzivino, Giuseppina; Cenci, P; Imbergamo, E; Lamanna, G; Lubrano, P; Michetti, A; Nappi, A; Pepé, M; Petrucci, M C; Piccini, M; Valdata, M; Cerri, C; Costantini, F; Fantechi, R; Fiorini, Luca; Giudici, Sergio; Mannelli, I; Pierazzini, G M; Sozzi, M; Cheshkov, C; Chèze, J B; De Beer, M; Debu, P; Gouge, G; Marel, Gérard; Mazzucato, E; Peyaud, B; Vallage, B; Holder, M; Maier, A; Ziolkowski, M; Biino, C; Cartiglia, N; Clemencic, M; Menichetti, E; Pastrone, N; Wislicki, W; Dibon, Heinz; Jeitler, Manfred; Markytan, Manfred; Neuhofer, Günther; Widhalm, L

    2003-01-01

    A search for the decay K_S -> pi0e+e- has been made by the NA48/1 experiment at the CERN SPS accelerator. Using data collected during 89 days in 2002 with a high-intensity K_S beam, 7 events were found with a background of 0.15 events. The branching fraction BR(K_S -> pi0e+e-, m_ee > 0.165GeV/c2) = (3.0^+1.5_1.2(stat) +- 0.2(syst)) x 10^-9 has been measured. Using a vector matrix element and a form factor equal to one, the measurement gives BR(K_S -> pi0e+e-) = (5.8^2.9_2.4) x 10^-9.

  14. Inclusive production of charged hadrons and $K_{s}^{0}$ mesons in photon-photon collisions

    CERN Document Server

    Ackerstaff, K.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bobinski, M.; Bock, P.; Bohme, J.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Ciocca, C.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Davis, R.; De Jong, S.; del Pozo, L.A.; De Roeck, A.; Desch, K.; Dienes, B.; Dixit, M.S.; Doucet, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Estabrooks, P.G.; Etzion, E.; Evans, H.G.; Fabbri, F.; Fanfani, A.; Fanti, M.; Faust, A.A.; Fiedler, F.; Fierro, M.; Fischer, H.M.; Fleck, I.; Folman, R.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Geich-Gimbel, C.; Geralis, T.; Giacomelli, G.; Giacomelli, P.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Hargrove, C.K.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Hocker, James Andrew; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Imrie, D.C.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jimack, M.; Joly, A.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kyberd, P.; Lafferty, G.D.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Lawson, I.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lefebvre, E.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Lui, D.; Macchiolo, A.; Macpherson, A.; Mannelli, M.; Marcellini, S.; Markopoulos, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Poli, B.; Polok, J.; Przybycien, M.; Rembser, C.; Rick, H.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schieck, J.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schorner, T.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Sproston, M.; Stahl, A.; Stephens, K.; Steuerer, J.; Stoll, K.; Strom, David M.; Strohmer, R.; Tafirout, R.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Torrence, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Van Kooten, Rick J.; Vannerem, P.; Verzocchi, M.; Vikas, P.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wiesler, T.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.

    1999-01-01

    The production of charged hadrons and K_s mesons in the collisions of quasi-real photons has been measured using the OPAL detector at LEP. The data were taken at e+e- centre-of-mass energies of 161 and 172 GeV. The differential cross-sections as a function of the transverse momentum and the pseudorapidity of the charged hadrons and K_s mesons have been compared to the leading order Monte Carlo simulations of PHOJET and PYTHIA and to perturbative next-to-leading order (NLO) QCD calculations. The distributions have been measured in the range 10-125 GeV of the hadronic invariant mass W. By comparing the transverse momentum distribution of charged hadrons measured in gamma-gamma interactions with gamma-proton and meson-proton data we find evidence for hard photon interactions in addition to the purely hadronic photon interactions.

  15. Measurement of CP Asymmetry in B0 to Ks pi0 pi0 Decays

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, S; Alam, M S; Albert, J; Aleksan, R; Allen, M T; Allison, J; Altenburg, D D; Andreotti, M; Angelini, C; Anulli, F; Arnaud, N; Asgeirsson, D J; Aston, D; Azzolini, V; Baak, M A; Back, J J; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Battaglia, M; Bauer, J M; Bechtle, P; Beck, T W; Behera, P K; Bellini, F; Ben-Haim, E; Benelli, G; Berger, N; Bernard, D; Berryhill, J W; Bettarini, S; Bettoni, D; Bevan, A J; Bhuyan, B; Bianchi, F; Biasini, M; Biesiada, J; Blanc, F; Blaylock, G; Blinov, V E; Bloom, P C; Blount, N L; Bomben, M; Bondioli, M; Bonneaud, G R; Bosisio, L; Boutigny, D; Boyd, J T; Bozzi, C; Brandt, T; Brau, J E; Briand, H; Brown, D N; Bruinsma, M; Brunet, S; Buchanan, C; Bugg, W; Bukin, A D; Bula, R; Burchat, P R; Burke, J P; Button-Shafer, J; Buzzo, A; Bóna, M; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Carpinelli, M; Cartaro, C; Castelli, G; Cavallo, N; Cavoto, G; Cenci, R; Chai, X; Chaisanguanthum, K S; Chao, M; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, C; Chen, E; Chen, J C; Chen, S; Chen, X; Chen, X R; Cheng, C H; Chia, Y M; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Coleman, J P; Contri, R; Convery, M R; Corwin, L A; Cossutti, F; Cottingham, W N; Covarelli, R; Cowan, G; Cowan, R; Crawley, H B; Cremaldi, L; Cunha, A; Curry, S; Côté, D; D'Orazio, A; Dahmes, B; Dallapiccola, C; Dasu, S; Dauncey, P D; David, P; Davier, M; Davis, C L; De Nardo, Gallieno; De Sangro, R; Del Amo-Sánchez, P; Del Buono, L; Del Re, D; Della Ricca, G; Denig, A G; Di Lodovico, F; Di Marco, E; Dingfelder, J C; Dong, L; Dorfan, J; Druzhinin, V P; Dubitzky, R S; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W; Dvoretskii, A; Ebert, M; Eckhart, E A; Eckmann, R; Edgar, C L; Edwards, A J; Eigen, G; Eisner, A M; Elmer, P; Emery, S; Ernst, J A; Escalier, M; Eschenburg, V; Eschrich, I; Eyges, V; Fabozzi, F; Faccini, R; Fang, F; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flacco, C J; Flack, R L; Flächer, H U; Flood, K T; Ford, W T; Forster, I J; Forti, F; Foulkes, S D; Franek, B; Frey, R; Fritsch, M; Fry, J R; Fulsom, B G; Gabathuler, E; Gaidot, A; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Gaz, A; George, K A; Giorgi, M A; Gladney, L; Glanzman, T; Godang, R; Golubev, V B; Gowdy, S J; Gradl, W; Graham, M T; Graugès-Pous, E; Grenier, P; Gritsan, A V; Grosdidier, G; Groysman, Y; Haire, M; Halyo, V; Hamano, K; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hartfiel, B L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hill, E J; Hirschauer, J F; Hitlin, D G; Hollar, J J; Hong, T M; Honscheid, K; Hopkins, D A; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Höcker, A; Igonkina, O; Innes, W R; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jain, V; Jasper, H; Jawahery, A; Jessop, C P; Kadyk, J A; Kagan, H; Karyotakis, Yu; Kass, R; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Klose, V; Knecht, N S; Koch, H; Kolb, J A; Kolomensky, Yu G; Kovalskyi, D; Kowalewski, R V; Kozanecki, W; Kreisel, A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; La Vaissière, C de; Lacker, H M; Lae, C K; Lafferty, G D; Lanceri, L; Lange, D J; Lankford, A J; Latham, T E; Latour, E; Lau, Y P; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Lewandowski, B; Li Gioi, L; Li, S; Li, X; Lista, L; Liu, F; Liu, H; LoSecco, J M; Lockman, W S; Lombardo, V; Long, O; Lopes-Pegna, D; Lopez-March, N; Lou, X C; Lu, M; Luitz, S; Lund, P; Luppi, E; Lusiani, A; Lutz, A M; Lynch, G; Lynch, H L; Lü, C; Lüth, V; MacFarlane, D B; Macri, M M; Mader, W F; Majewski, S A; Malcles, J; Mallik, U; Mancinelli, G; Mandelkern, M A; Marchiori, G; Margoni, M; Marks, J; Marsiske, H; Martin, E C; Martínez-Vidal, F; Mattison, T S; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Mclachlin, S E; Meadows, B T; Mellado, B; Menges, W; Merkel, J; Messner, R; Meyer, N T; Meyer, W T; Mir, L M; Mishra, K; Mohanty, G B; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morganti, M; Morganti, S; Morii, M; Morris, J P; Muheim, F; Müller, D R; Nagel, M; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Negrini, M; Neri, N; Nicholson, H; Nikolich, M B; Nogowski, R; Nugent, I M; O'Grady, C P; Ocariz, J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Oyanguren, A; Ozcan, V E; Paar, H P; Pacetti, S; Palano, A; Palombo, F; Pan, B; Pan, Y; Panduro-Vazquez, W; Paoloni, E; Paolucci, P; Pappagallo, M; Park, W; Passaggio, S; Patel, P M; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Pelliccioni, M; Perazzo, A; Perl, M; Peruzzi, I M; Peters, K; Petersen, B A; Petrella, A; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Piredda, G; Playfer, S; Poireau, V; Polci, F; Pompili, A; Porter, F C; Posocco, M; Potter, C T; Prell, S; Prencipe, E; Prepost, R; Pripstein, M; Prudent, X; Pruvot, S; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rahmat, R; Rama, M; Ratcliff, B N; Raven, G; Regensburger, J J; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roberts, D A; Robertson, A I; Robertson, S H; Robutti, E; Rodier, S; Roe, N A; Ronan, M T; Roney, J M; Rong, G; Roodman, A; Rosenberg, E I; Rotondo, M; Roudeau, P; Rubin, A E; Röthel, W; Sacco, R; Saeed, M A; Saleem, M; Salnikov, A A; Salvati, E; Salvatore, F; Sanders, D A; Santroni, A; Saremi, S; Schalk, T; Schenk, S; Schilling, C J; Schindler, R H; Schofield, K C; Schott, G; Schröder, T; Schröder, H; Schubert, J; Schubert, K R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Serrano, J; Sharma, V; Shen, B C; Sherwood, D J; Simard, M; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Yu I; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Sokoloff, M D; Solodov, E P; Sordini, V; Spaan, B; Spanier, S M; Spitznagel, M; Steinke, M; Stelzer, J; Stocchi, A; Stoker, D P; Stroili, R; Strom, D; Strube, J; Stugu, B; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; Suzuki, K; Swain, S K; Tackmann, K; Taras, P; Taylor, F; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Thiebaux, C; Thompson, J M; Tisserand, V; Todyshev, K Yu; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Ulmer, K A; Uwer, U; Van Bakel, N; Vasseur, G; Vavra, J; Verderi, M; Lo Vetere, M; Viaud, F B; Vitale, L; Voci, C; Voena, C; Volk, A; Wacker, K; Wagner, A P; Wagner, S R; Waldi, R; Walker, D; Walsh, J J; Wang, P; Wang, W F; Wappler, F R; Watson, A T; Weaver, M; Wenzel, W A; West, T J; Wilden, L; Williams, D C; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winklmeier, F; Winstrom, L O; Wisniewski, W J; Wittgen, M; Wong, Q K; Wormser, G; Wren, A C; Wright, D H; Wright, D M; Wu, J; Wu, S L; Wulsin, H W; Xie, Y; Yamamoto, R K; Yarritu, A K; Ye, S; Yi, J I; Yi, K; Young, C C; Yu, Z; Yéche, C; Zain, S B; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Ziegler, V; Zito, M; Çuhadar-Dönszelmann, T

    2007-01-01

    We present a measurement of the time-dependent CP asymmetry for the neutral B-meson decay into the CP = +1 final state Ks pi0 pi0, with Ks -> pi+ pi-. We use a sample of approximately 227 million B-meson pairs recorded at the Upsilon(4S) resonance with the BABAR detector at the PEP-II B-Factory at SLAC. From an unbinned maximum likelihood fit we extract the mixing-induced CP-violation parameter S = 0.72 +/- 0.71 +/- 0.08 and the direct CP-violation parameter C = 0.23 +/- 0.52 +/- 0.13, where the first uncertainty is statistical and the second systematic.

  16. Üks uks Eesti ja Jaapani vahel : köitekunst kohtub animatsiooniga / Maarja Undusk

    Index Scriptorium Estoniae

    Undusk, Maarja

    2003-01-01

    Eestis viibiv jaapanlanna Maya Yonesho (sünd. 1965) hakkab tegema stipendiaadifilmi "Üks uks". Raamat-uksed teevad valmis eesti nahakunstnikud Külli Grünbach, Rene Haljasmäe, Pille Kivihall, Helen Maran-Poll, Lennart Mänd, Tiina Piisang, Jane Rannamets ja Maarja Undusk. Filmi muusika autor Sven Grünberg. M. Yonesho juhendas nahakunstnik Kadri Halliku diplomitööd

  17. Renewed activity of the Be/X-ray binary KS 1947+300

    Science.gov (United States)

    Finger, Mark H.; Jenke, Peter A.; Wilson-Hodge, Colleen A.

    2015-02-01

    Pulsation from KS 1947+300 is currently being detected in the 12 to 50 keV band with the Fermi/GBM NaI detectors. The pulsation was first detected in the data of January 31.0 - February 2.0 with a frequency of 53.29766(18) mHz, after barycenter correction and accounting for orbital motion using the orbital parameters of Galloway, Morgan & Levine, 2004.

  18. Search for the decay $K_{s} \\to \\pi^{0}\\gamma\\gamma$

    CERN Document Server

    Lai, A; Batley, J Richard; Bevan, A; Dosanjh, R S; Gershon, T J; Kalmus, George Ernest; Munday, D J; Olaiya, E; Parker, M A; White, T; Wotton, S A; Barr, Giles David; Bocquet, G; Ceccucci, Augusto; Çuhadar-Dönszelmann, T; Cundy, Donald C; Doble, Niels T; Falaleev, V P; Gatignon, L; Gonidec, A; Gorini, B; Govi, G; Grafström, P; Kubischta, Werner; Lacourt, A; Lenti, M; Norton, Alan Robert; Palestini, S; Panzer-Steindel, B; Tatishvili, G T; Taureg, Hans; Velasco, M; Wahl, H; Cheshkov, C; Khristov, P Z; Kekelidze, V D; Madigozhin, D T; Molokanova, N A; Potrebenikov, Yu K; Tkachev, A L; Zinchenko, A I; Knowles, I; Lazzeroni, C; Martin, V; Sacco, R; Walker, A; Contalbrigo, M; Dalpiaz, Pietro; Duclos, J; Frabetti, P L; Gianoli, A; Martini, M; Masetti, L; Petrucci, F; Savrié, M; Bizzeti, A; Calvetti, M; Collazuol, G; Graziani, G; Iacopini, E; Becker, H G; Eppard, M; Fox, H; Holtz, K; Kalter, A; Kleinknecht, K; Koch, U; Köpke, L; Lopes da Silva, P; Marouelli, P; Pellmann, I A; Peters, A; Renk, B; Schmidt, S A; Schönharting, V; Schué, Yu; Wanke, R; Winhart, A; Wittgen, M; Chollet, J C; Fayard, Louis; Iconomidou-Fayard, L; Ocariz, J; Unal, G; Wingerter-Seez, I; Anzivino, Giuseppina; Cenci, P; Imbergamo, E; Lubrano, P; Mestvirishvili, A; Nappi, A; Pepé, M; Piccini, M; Carosi, R; Casali, R; Cerri, C; Cirilli, M; Costantini, F; Fantechi, R; Giudici, Sergio; Mannelli, I; Pierazzini, G M; Sozzi, M; Chèze, J B; Cogan, J; De Beer, M; Debu, P; Formica, A; Granier de Cassagnac, R; Mazzucato, E; Peyaud, B; Turlay, René; Vallage, B; Holder, M; Maier, A; Ziolkowski, M; Arcidiacono, R; Biino, C; Cartiglia, N; Guida, R; Marchetto, F; Menichetti, E; Pastrone, N; Nassalski, J P; Rondio, Ewa; Szleper, M; Wislicki, W; Wronka, S; Dibon, Heinz; Fischer, G; Jeitler, Manfred; Markytan, Manfred; Mikulec, I; Neuhofer, Günther; Pernicka, Manfred; Taurok, Anton; Widhalm, L

    2003-01-01

    A search for the decay $K_S\\to\\pi^0\\gamma\\gamma$ has been made using the NA48 detector at the CERN SPS. Using data collected in 1999 during a 40-hour run with a high-intensity $K_S$ beam, an upper limit for the branching ratio $BR(K_S\\to\\pi^0\\gamma\\gamma, z\\ge 0.2)<3.3\\times\

  19. MoKS teistes koostööprojektides / John Grzinich

    Index Scriptorium Estoniae

    Grzinich, John

    2005-01-01

    13. III Genfis toimunud helikunstiüritusest "VernalFLUX / Kevadvool", millest Eestist võtsid osa MoKS'i koordinaatorid John Grzinich ja Evelyn Müürsepp, nende performance'ist "Maaheli. Unustatud unistused". Uuest organisatsioonist Claudmirror, mis on välja andnud seitse CD-ROM-i, nende seas John Grzinichi CD-ROM-i "Võrdsed ja kauged jooned"

  20. Measurement of the $B_s^0\\to J/\\psi K_S^0$ branching fraction

    CERN Document Server

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Miglioranzi, S; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voss, H; Waldi, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2012-01-01

    The $B_s^0\\to J/\\psi K_S^0$ branching fraction is measured in a data sample corresponding to 0.41$fb^{-1}$ of integrated luminosity collected with the LHCb detector at the LHC. This channel is sensitive to the penguin contributions affecting the sin2$\\beta$ measurement from $B^0\\to J/\\psi K_S^0$ The time-integrated branching fraction is measured to be $BF(B_s^0\\to J/\\psi K_S^0)=(1.83\\pm0.28)\\times10^{-5}$. This is the most precise measurement to date.

  1. Structural basis of slow activation gating in the cardiac IKs channel complex

    DEFF Research Database (Denmark)

    Strutz-Seebohm, Nathalie; Pusch, Michael; Wolf, Steffen

    2011-01-01

    Accessory ß-subunits of the KCNE gene family modulate the function of various cation channel a-subunits by the formation of heteromultimers. Among the most dramatic changes of biophysical properties of a voltage-gated channel by KCNEs are the effects of KCNE1 on KCNQ1 channels. KCNQ1 and KCNE1...... are believed to form nativeI(Ks) channels. Here, we characterize molecular determinants of KCNE1 interaction with KCNQ1 channels by scanning mutagenesis, double mutant cycle analysis, and molecular dynamics simulations. Our findings suggest that KCNE1 binds to the outer face of the KCNQ1 channel pore domain...... of the voltage sensor domain S4 of KCNQ1 in a putative pre-open channel state. Formation of this state may induce slow activation gating, the pivotal characteristic of native cardiac I(Ks) channels. This new KCNQ1-KCNE1 model may become useful for dynamic modeling of disease-associated mutant I(Ks) channels....

  2. The effects of multiple features of alternatively spliced exons on the KA/KS ratio test

    Directory of Open Access Journals (Sweden)

    Chen Feng-Chi

    2006-05-01

    Full Text Available Abstract Background The evolution of alternatively spliced exons (ASEs is of primary interest because these exons are suggested to be a major source of functional diversity of proteins. Many exon features have been suggested to affect the evolution of ASEs. However, previous studies have relied on the KA/KS ratio test without taking into consideration information sufficiency (i.e., exon length > 75 bp, cross-species divergence > 5% of the studied exons, leading to potentially biased interpretations. Furthermore, which exon feature dominates the results of the KA/KS ratio test and whether multiple exon features have additive effects have remained unexplored. Results In this study, we collect two different datasets for analysis – the ASE dataset (which includes lineage-specific ASEs and conserved ASEs and the ACE dataset (which includes only conserved ASEs. We first show that information sufficiency can significantly affect the interpretation of relationship between exons features and the KA/KS ratio test results. After discarding exons with insufficient information, we use a Boolean method to analyze the relationship between test results and four exon features (namely length, protein domain overlapping, inclusion level, and exonic splicing enhancer (ESE frequency for the ASE dataset. We demonstrate that length and protein domain overlapping are dominant factors, and they have similar impacts on test results of ASEs. In addition, despite the weak impacts of inclusion level and ESE motif frequency when considered individually, combination of these two factors still have minor additive effects on test results. However, the ACE dataset shows a slightly different result in that inclusion level has a marginally significant effect on test results. Lineage-specific ASEs may have contributed to the difference. Overall, in both ASEs and ACEs, protein domain overlapping is the most dominant exon feature while ESE frequency is the weakest one in affecting

  3. A phase 1b study of humanized KS-interleukin-2 (huKS-IL2) immunocytokine with cyclophosphamide in patients with EpCAM-positive advanced solid tumors.

    Science.gov (United States)

    Connor, Joseph P; Cristea, Mihaela C; Lewis, Nancy L; Lewis, Lionel D; Komarnitsky, Philip B; Mattiacci, Maria R; Felder, Mildred; Stewart, Sarah; Harter, Josephine; Henslee-Downey, Jean; Kramer, Daniel; Neugebauer, Roland; Stupp, Roger

    2013-01-15

    Humanized KS-interleukin-2 (huKS-IL2), an immunocytokine with specificity for epithelial cell adhesion molecule (EpCAM), has demonstrated favorable tolerability and immunologic activity as a single agent. Phase 1b study in patients with EpCAM-positive advanced solid tumors to determine the maximum tolerated dose (MTD) and safety profile of huKS-IL2 in combination with low-dose cyclophosphamide. Treatment consisted of cyclophosphamide (300 mg/m2 on day 1), and escalating doses of huKS-IL2 (0.5-4.0 mg/m2 IV continuous infusion over 4 hours) on days 2, 3, and 4 of each 21-day cycle. Safety, pharmacokinetic profile, immunogenicity, anti-tumor and biologic activity were evaluated. Twenty-seven patients were treated for up to 6 cycles; 26 were evaluable for response. The MTD of huKS-IL2 in combination with 300 mg/m2 cyclophosphamide was 3.0 mg/m2. At higher doses, myelosuppression was dose-limiting. Transient lymphopenia was the most common grade 3/4 adverse event (AE). Other significant AEs included hypotension, hypophosphatemia, and increase in serum creatinine. All patients recovered from these AEs. The huKS-IL2 exposure was dose-dependent, but not dose-proportional, accumulation was negligible, and elimination half-life and systemic clearance were independent of dose and time. Most patients had a transient immune response to huKS-IL2. Immunologic activity was observed at all doses. Ten patients (38%) had stable disease as best response, lasting for ≥ 4 cycles in 3 patients. The combination of huKS-IL2 with low-dose cyclophosphamide was well tolerated. Although no objective responses were observed, the combination showed evidence of immunologic activity and 3 patients showed stable disease for ≥ 4 cycles.

  4. Reflection of the Geomagnetic Activity Occurring in the Earth's Northern and Southern Hemisphere (KM, KN, KS Indices)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA National Centers for Environmental Information (formerly National Geophysical Data Center) receives on a monthly basis, the KM, KN, KS indices from Institue...

  5. Measurement of the Branching Fraction and Time-Dependent CP Asymmetry in the Decay B0->D*+D*-Ks

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Del, P; Amo Sanchez; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo, M; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del, L; Buono; La Vaissière, C de; Hamon, O; Hartfiel, B L; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Gladney, L; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Mihályi, A; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H

    2006-01-01

    We study the decay B0->D*+D*-Ks using (230 +/- 2) x 10^{6} BBbar pairs collected by the Babar detector at the PEP-II B factory. We measure a branching fraction B(B0->D*+D*-Ks)=(4.4\\pm0.4\\pm0.7)\\times 10^{-3} and find evidence for the decay B0->D*- D+_{s1}(2536) with a statistical significance of $4.6 \\sigma$. A time-dependent CP asymmetry analysis is also performed to study the possible resonant contributions to B0->D*+D*-Ks and the sign of cos2beta . Our measurement indicates that there is a sizable resonant contribution to the decay B0->D*+D*-Ks from a unknown $D^+_{s1}$ state with large width, and that cos2beta is positive at the 94 % confidence level under certain theoretical assumptions.

  6. Olevik, üks ajavorm = Preesens, eräs aikaluokka : [luuletused] / Riina Katajavuori ; tlk. Eeva Park

    Index Scriptorium Estoniae

    Katajavuori, Riina

    2004-01-01

    Sisu: Olevik, üks ajavorm = Preesens, eräs aikaluokka; Ääretus = Äärettömyys; "Tühjendasin korterit ..." = "Tyhjensin asunnon ..."; Üheksakümmend üks = Yhdeksänkymmentäyksi; Sinule, kes oskab = Sinulle, joka osaat; "Mina söön paprikat, mis ei ole ..." = "Mina syön paprikan, joka ei ole ..."

  7. Measurement of the branching fraction and charge asymmetry for the decay Ks->pi e nu with the KLOE detector

    CERN Document Server

    Ambrosino, F; Antonelli, M; Bacci, C; Beltrame, P; Bencivenni, G; Bertolucci, Sergio; Bini, C; Bloise, C; Bocci, V; Bossi, F; Bowring, D; Branchini, P; Caloi, R; Campana, P; Capon, G; Capussela, T; Ceradini, F; Chi, S; Chiefari, G; Ciambrone, P; Conetti, S; De Lucia, E; De Santis, A; De Simone, P; De Zorzi, G; Dell'Agnello, S; Denig, A; Di Domenico, A; Di Donato, C; Di Falco, S; Di Micco, B; Doria, A; Dreucci, M; Felici, G; Ferrari, A; Ferrer, M L; Finocchiaro, G; Fiore, S; Forti, C; Franzini, P; Gatti, C; Gauzzi, P; Giovannella, S; Gorini, E; Graziani, E; Incagli, M; Kluge, W; Kulikov, V; Lacava, F; Lanfranchi, G; Lee-Franzini, J; Leone, D; Martini, M; Massarotti, P; Mei, W; Meola, S; Miscetti, S; Moulson, M; Murtas, F; Müller, S; Napolitano, M; Nguyen, F; Palutan, M; Pasqualucci, E; Passeri, A; Patera, V; Perfetto, F; Pontecorvo, L; Primavera, M; Santangelo, P; Santovetti, E; Saracino, G; Sciascia, B; Sciubba, A; Scuri, F; Sfiligoi, I; Spadaro, T; Testa, M; Tortora, L; Valente, P; Valeriani, B; Venanzoni, G; Veneziano, Stefano; Ventura, A; Versaci, R; Xu, G

    2006-01-01

    Among some 400 million KsKl pairs produced in e+e- annihilations at DAFNE, about 6500 each of Ks->pi+e-nubar and Ks->pi-e+nu decays have been observed with the KLOE detector. From these, BR(Ks->pienu)=(7.046+-0.091)10-4 is obtained, improving the accuracy on the BR by a factor of four and providing the most precise test of the DeltaS=DeltaQ rule. From the partial width Gamma(Ks->pienu), f+(K0)Vus=0.2162+-0.0014 is obtained, in good agreement with unitarity of the quark-mixing matrix. The lepton charge asymmetry is AS=(1.5+-10)10-3, which is compatible with the corresponding asymmetry from semileptonic Kl decays as expected from CPT invariance. The form-factor slope in the linear approximation is found to agree with recent measurements from semileptonic Kl and K+ decays. These are the first measurements of the charge asymmetry and form-factor slope for semileptonic Ks decays.

  8. Search for the decay $K_{s} \\to \\pi^{0}e^{+}e^{-}$

    CERN Document Server

    Lai, A; Batley, J Richard; Bevan, A; Dosanjh, R S; Gershon, T J; Hay, B; Kalmus, George Ernest; Munday, D J; Olaiya, E; Parker, M A; White, T O; Wotton, S A; Barr, Giles David; Bocquet, G; Ceccucci, Augusto; Çuhadar-Dönszelmann, T; Cundy, Donald C; Doble, Niels T; Falaleev, V P; Gatignon, L; Gonidec, A; Gorini, B; Govi, G; Grafström, P; Kubischta, Werner; Lacourt, A; Lenti, M; Norton, Alan Robert; Palestini, S; Panzer-Steindel, B; Tatishvili, G T; Taureg, Hans; Velasco, M; Wahl, H; Cheshkov, C; Gaponenko, A N; Khristov, P Z; Kekelidze, V D; Madigozhin, D T; Molokanova, N A; Potrebenikov, Yu K; Tkachev, A L; Zinchenko, A I; Knowles, I; Lazzeroni, C; Martin, V; Sacco, R; Walker, A; Contalbrigo, M; Dalpiaz, Pietro; Duclos, J; Frabetti, P L; Gianoli, A; Martini, M; Petrucci, F; Savrié, M; Bizzeti, A; Calvetti, M; Collazuol, G; Graziani, G; Iacopini, E; Becker, H G; Eppard, M; Fox, H; Holtz, K; Kalter, A; Kleinknecht, K; Koch, U; Köpke, L; Lopes da Silva, P; Marouelli, P; Pellmann, I A; Peters, A; Renk, B; Schmidt, S A; Schönharting, V; Schué, Yu; Wanke, R; Winhart, A; Wittgen, M; Chollet, J C; Fayard, Louis; Iconomidou-Fayard, L; Ocariz, J; Unal, G; Wingerter-Seez, I; Anzivino, Giuseppina; Cenci, P; Imbergamo, E; Lubrano, P; Mestvirishvili, A; Nappi, A; Pepé, M; Piccini, M; Carosi, R; Casali, R; Cerri, C; Cirilli, M; Costantini, F; Fantechi, R; Giudici, Sergio; Mannelli, I; Pierazzini, G M; Sozzi, M; Chèze, J B; Cogan, J; De Beer, M; Debu, P; Formica, A; Granier de Cassagnac, R; Mazzucato, E; Peyaud, B; Turlay, René; Vallage, B; Holder, M; Maier, A; Ziolkowski, M; Arcidiacono, R; Biino, C; Cartiglia, N; Guida, R; Marchetto, F; Menichetti, E; Pastrone, N; Nassalski, J P; Rondio, Ewa; Szleper, M; Wislicki, W; Wronka, S; Dibon, Heinz; Fischer, G; Jeitler, Manfred; Markytan, Manfred; Mikulec, I; Neuhofer, Günther; Pernicka, Manfred; Taurok, Anton; Widhalm, L

    2001-01-01

    A search for the decay $\\kspiee$ has been made using the NA48 detector at the CERN SPS. Using data collected in 1999 during a 40-hour run with a high-intensity $\\ks$ beam, an upper limit for the branching fraction ${\\rm B}(\\kspiee) < 1.4 \\times 10^{-7}$ at 90\\% confidence level has been obtained. %Extrapolating this limit to the full phase-space %assuming the matrix element %model described above~\\cite{bib:ambrosio}, %we find an upper limit of %${\\cal B}(\\kspiee) < 6.5 \\times 10^{-8}$ %at 90\\% confidence level has been obtained.

  9. Veneetsia Kuldlõvi läks Magdaleena õdedele / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2002-01-01

    Veneetsia 59. rahvusvahelise filmifestivali peaauhinna võitis Peter Mullan'i mängufilm "Magdaleena õed" ("The Magdalene Sisters"). Žürii grand prix läks Venemaa-Prantsusmaa koostööfilmile - Andrei Kontšalovski "Lollide maja" (ka "Hullumaja", "Dom durakov"), kus üht peaosa mängib Narva harrastusnäitleja Stas Varkki. Parim naisnäitleja on Julianne Moore ja meesnäitleja Stefano Accorsi. Lisatud auhinnasaajate nimekiri

  10. Study of KS semileptonic decays and CPT test with the KLOE detector

    CERN Document Server

    Kamińska, Daria

    2015-01-01

    Study of semileptonic decays of neutral kaons allows to perform a test of discrete symmetries, as well as basic principles of the Standard Model. In this paper a general review on dependency between charge asymmetry constructed for semileptonic decays of short- and long-lived kaons and CPT symmetry is given. The current status of determination of charge asymmetry for short-lived kaon, obtained by reconstruction of about 10^5 KS -> pen decays collected at DAFNE with the KLOE detector is also reviewed.

  11. Verification of three-dimensional neutron kinetics model of TRAP-KS code regarding reactivity variations

    Energy Technology Data Exchange (ETDEWEB)

    Uvakin, Maxim A.; Alekhin, Grigory V.; Bykov, Mikhail A.; Zaitsev, Sergei I. [EDO ' GIDROPRESS' , Moscow Region, Podolsk (Russian Federation)

    2016-09-15

    This work deals with TRAP-KS code verification. TRAP-KS is used for coupled neutron and thermo-hydraulic process calculations of VVER reactors. The three-dimensional neutron kinetics model enables consideration of space effects, which are produced by energy field and feedback parameters variations. This feature has to be investigated especially for asymmetrical multiplying variations of core properties, power fluctuations and strong local perturbation insertion. The presented work consists of three test definitions. First, an asymmetrical control rod (CR) ejection during power operation is defined. This process leads to fast reactivity insertion with short-time power spike. As second task xenon oscillations are considered. Here, small negative reactivity insertion leads to power decreasing and induces space oscillations of xenon concentration. In the late phase, these oscillations are suppressed by external actions. As last test, an international code comparison for a hypothetical main steam line break (V1000CT-2, task 2) was performed. This scenario is interesting for asymmetrical positive reactivity insertion by decreasing coolant temperature in the affected loop.

  12. NuSTAR Discovery of a Cyclotron Line in KS 1947+300

    Science.gov (United States)

    Furst, Felix; Pottschmidt, Katja; Wilms, Jorn; Kennea, Jamie; Bachetti, Matteo; Bellm, Eric; Boggs, Steven E.; Chakrabarty, Deepto; Christensen, Finn E.; Craig, William W.; hide

    2014-01-01

    We present a spectral analysis of three simultaneous Nuclear Spectroscopy Telescope Array and Swift/XRT observations of the transient Be-neutron star binary KS 1947+300 taken during its outburst in 2013/2014. These broadband observations were supported by Swift/XRTmonitoring snapshots every three days, which we use to study the evolution of the spectrum over the outburst.We find strong changes of the power-law photon index, which shows a weak trend of softening with increasing X-ray flux. The neutron star shows very strong pulsations with a period of P ˜ [almost equal to] 18.8 s. The 0.8-79 keV broadband spectrum can be described by a power law with an exponential cutoff and a blackbody component at low energies. During the second observation we detect a cyclotron resonant scattering feature at 12.5 keV, which is absent in the phase-averaged spectra of observations 1 and 3. Pulse phase-resolved spectroscopy reveals that the strength of the feature changes strongly with pulse phase and is most prominent during the broad minimum of the pulse profile. At the same phases the line also becomes visible in the first and third observation at the same energy. This discovery implies that KS 1947+300 has a magnetic field strength of B ˜ [almost equal to] 1.1 × 1012(1 + z) G, which is at the lower end of known cyclotron line sources.

  13. Radiofrequency ablation combined with KS-IL2 immunocytokine (EMD 273066) results in an enhanced antitumor effect against murine colon adenocarcinoma.

    Science.gov (United States)

    Johnson, Erik E; Yamane, Brett H; Buhtoiarov, Ilia N; Lum, Hillary D; Rakhmilevich, Alexander L; Mahvi, David M; Gillies, Stephen D; Sondel, Paul M

    2009-08-01

    Radiofrequency ablation (RFA) is a common treatment modality for surgically unresectable tumors. However, there is a high rate of both local and systemic recurrence. In this preclinical study, we sought to enhance the antitumor effect of RFA by combining it with huKS-IL2 immunocytokine [tumor-specific monoclonal antibody fused to interleukin-2 (IL2)] in mice bearing CT26-KS colon adenocarcinoma. Mice were treated with RFA, huKS-IL2 via intratumoral injection, or combination therapy. Treatment of mice bearing s.c. tumors with RFA and huKS-IL2 resulted in significantly greater tumor growth suppression and enhanced survival compared with mice treated with RFA or huKS-IL2 alone. When subtherapeutic regimens of RFA or huKS-IL2 were used, tumors progressed in all treated mice. In contrast, the combination of RFA and immunocytokine resulted in complete tumor resolution in 50% of mice. Treatment of a tumor with RFA and intratumoral huKS-IL2 also showed antitumor effects against a distant untreated tumor. Tumor-free mice after treatment with RFA and huKS-IL2 showed immunologic memory based on their ability to reject subsequent challenges of CT26-KS and the more aggressive parental CT26 tumors. Flow cytometry analysis of tumor-reactive T cells from mice with complete tumor resolution showed that treatment with RFA and huKS-IL2 resulted in a greater proportion of cytokine-producing CD4 T cells and CD8 T cells compared with mice treated with RFA or huKS-IL2 alone. These results show that the addition of huKS-IL2 to RFA significantly enhances the antitumor response in this murine model, resulting in complete tumor resolution and induction of immunologic memory.

  14. Measuring KS0K± interactions using Pb–Pb collisions at sNN=2.76 TeV

    Directory of Open Access Journals (Sweden)

    S. Acharya

    2017-11-01

    Full Text Available We present the first ever measurements of femtoscopic correlations between the KS0 and K± particles. The analysis was performed on the data from Pb–Pb collisions at sNN=2.76 TeV measured by the ALICE experiment. The observed femtoscopic correlations are consistent with final-state interactions proceeding via the a0(980 resonance. The extracted kaon source radius and correlation strength parameters for KS0K− are found to be equal within the experimental uncertainties to those for KS0K+. Comparing the results of the present study with those from published identical-kaon femtoscopic studies by ALICE, mass and coupling parameters for the a0 resonance are tested. Our results are also compatible with the interpretation of the a0 having a tetraquark structure instead of that of a diquark.

  15. Study of DsJ (*) + mesons decaying to D∗ +KS 0 and D*0K+ final states

    NARCIS (Netherlands)

    The LHCb collaboration, LHCb collaboration; Aaij, R.; Abellán Beteta, C.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; Everse, LA; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J.E.; Appleby, R. B.; Aquines Gutierrez, O.; Archilli, F.; d’Argent, P.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Battista, V.; Bay, A.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Bel, L. J.; Bellee, V.; Belloli, N.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Bettler, M-O.; Van Beuzekom, Martin; Bifani, S.; Billoir, P.; Bird, T.D.; Birnkraut, A.; Bizzeti, A.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borisyak, M.; Borsato, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Braun, S.; Britsch, M.; Britton, T.; Brodzicka, J.; Brook, N. H.; Buchanan, E.; Burr, C.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Calvo Gomez, M.; Campana, P.; Campora Perez, D.; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carniti, P.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cassina, L.; Castillo Garcia, L.; Cattaneo, M.; Cauet, Ch; Cavallero, G.; Cenci, R.; Charles, M.; Charpentier, Ph; Chefdeville, M.; Chen, S.; Cheung, S-F.; Chiapolini, N.; Chrzaszcz, M.; Cid Vidal, X.; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogoni, V.; Cojocariu, L.; Collazuol, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A.; Cruz Torres, M.; Cunliffe, S.; Currie, C.R.; D’Ambrosio, C.; Dall’Occo, E.; Dalseno, J.; David, P. N.Y.; Davis, A.; De Aguiar Francisco, O.; De Bruyn, K.; De Capua, S.; De Cian, M.; de Miranda, J. M.; Paula, L.E.; De Simone, P.; Dean, C-T.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Déléage, N.; Demmer, M.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Di Ruscio, F.; Dijkstra, H.; Donleavy, S.; Dordei, F.; Dorigo, M.; Dosil Suárez, A.; Dovbnya, A.; Dreimanis, K.; Dufour, L.; Dujany, G.; Dungs, K.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, H. M.; Evans, T. M.; Fabianska, M.; Falabella, A.; Färber, C.; Farley, N.; Farry, S.; Fay, R.; Ferguson, D.; Fernandez Albor, V.; Ferrari, F.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fleuret, F.; Fohl, K.; Fol, P.; Fontana, Mark; Fontanelli, F.; Forshaw, D. C.; Forty, R.; Frank, M.; Frei, C.; Frosini, M.; Fu, J.; Furfaro, E.; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Gao, Y.; García Pardiñas, J.; Garra Tico, J.; Garrido, L.; Gascon, D.; Carvalho-Gaspar, M.; Gauld, Rhorry; Gavardi, L.; Gazzoni, G.; Gerick, D.; Gersabeck, E.; Gersabeck, M.; Gershon, T. J.; Ghez, Ph; Gianì, S.; Gibson, V.; Girard, O. G.; Giubega, L.; Gligorov, V. V.; Göbel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.Q.; Gotti, C.; Grabalosa Gándara, M.; Graciani Diaz, R.; Granado Cardoso, L. A.; Graugés, E.; Graverini, E.; Graziani, G.; Grecu, A.; Greening, E.; Griffith, P.; Grillo, L.; Grünberg, O.; Gui, B.; Gushchin, E.; Guz, Yu; Gys, T.; Hadavizadeh, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Han, X.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; He, J.; Head, T.; Heijne, V.; Heister, A.J.G.A.M.; Hennessy, K.; Henrard, P.; Henry, L.; Hernando Morata, J. A.; van Herwijnen, E.; Heß, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hulsbergen, W.; Humair, T.; Hushchyn, M.; Hussain, N.; Hutchcroft, D. E.; Hynds, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jaeger, A.; Jalocha, J.; Jans, E.; Jawahery, A.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Karodia, S.; Kecke, M.; Kelsey, M. H.; Kenyon, I. R.; Kenzie, M.; Ketel, T.; Khairullin, E.; Khanji, B.; Khurewathanakul, C.; Kirn, T.; Klaver, S.M.; Klimaszewski, K.; Kochebina, O.; Kolpin, M.; Komarov, I.; Koopman, R. F.; Koppenburg, P.; Kozeiha, M.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krokovny, P.; Kruse, F.; Krzemien, W.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kuonen, A. K.; Kurek, K.; Kvaratskheliya, T.; Lacarrere, D.; Lafferty, G. D.; Lai, A.; Lambert, D.M.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T. E.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J. P.; Lefèvre, R.; Leflat, A.; Lefrançois, J.; Lemos Cid, E.; Leroy, O.; Lesiak, T.; Leverington, B.; Li, Y.; Likhomanenko, T.; Liles, M.; Lindner, R.; Linn, S.C.; Lionetto, F.; Liu, B.; Liu, X.; Loh, D.; Longstaff, I.; Lopes, J. H.; Lucchesi, D.; Lucio Martinez, M.; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Lusiani, A.; Machefert, F.; Maciuc, F.; Maev, O.; Maguire, K.; Malde, S.; Malinin, A.; Manca, G.; Mancinelli, G.; Manning, P.; Mapelli, A.; Maratas, J.; Marchand, J. F.; Marconi, U.; Marin Benito, C.; Marino, P.; Marks, J.; Martellotti, G.; Martin, M.; Martinelli-Boneschi, F.; Martinez-Santos, D.; Martinez-Vidal, F.; Martins Tostes, D.; Massacrier, L. M.; Massafferri, A.; Matev, R.; Mathad, A.; Mathe, Z.; Matteuzzi, C.; Mauri, A.; Maurin, B.; Mazurov, A.; McCann, M.; McCarthy, J.; Mcnab, A.; McNulty, R.; Meadows, B. T.; Meier, F.; Meissner, M.; Melnychuk, D.; Merk, M.; Michielin, E.; Milanes, D. A.; Minard, M. N.; Mitzel, D. S.; Molina Rodriguez, J.; Monroy, I. A.; Monteil, S.; Morandin, M.; Morawski, P.; Mordà, A.; Morello, M. J.; Moron, J.; Morris, A. B.; Mountain, R.; Muheim, F.; Müller, D.; Müller, J.; Müller, Karl; von Müller, L.; Mussini, M.; Muster, B.; Naik, P.; Nakada, T.; Nandakumar, R.; Nandi, A.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A. D.; Nguyen, T. D.; Nguyen-Mau, C.; Niess, V.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; O’Hanlon, D. P.; Oblakowska-Mucha, A.; Obraztsov, V.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Onderwater, C. J.G.; Osorio Rodrigues, B.; Otalora Goicochea, J. M.; Otto, E.A.; Owen, R.P.; Oyanguren, A.; Palano, A.; Palombo, F.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Pappalardo, L.L.; Pappenheimer, C.; Parker, W.S; Parkes, C.; Passaleva, G.; Patel, G. D.; Patel, M.; Patrignani, C.; Pearce, D.A.; Pellegrino, A.; Penso, G.; Pepe Altarelli, M.; Perazzini, S.; Perret, P.; Pescatore, L.; Petridis, K.; Petrolini, A.; Petruzzo, M.; Picatoste Olloqui, E.; Pietrzyk, B.; Pikies, M.; Pinci, D.; Pistone, A.; Piucci, A.; Playfer, S.; Plo Casasus, M.; Poikela, T.; Polci, F.; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Price, M. E.; Price, J.D.; Prisciandaro, J.; Pritchard, C.A.; Prouve, C.; Pugatch, V.; Puig Navarro, A.; Punzi, G.; Qian, Y.W.; Quagliani, R.; Rachwal, B.; Rademacker, J. H.; Rama, M.; Ramos Pernas, M.; Rangel, M. S.; Raniuk, I.; Rauschmayr, N.; Raven, G.; Redi, F.; Reichert, S.; dos Reis, A. C.; Renaudin, V.; Ricciardi, S.; Richards, Jennifer S; Rihl, M.; Rinnert, K.; Rives Molina, V.; Robbe, P.; Rodrigues, A. B.; Rodrigues, L.E.T.; Rodriguez Lopez, J. A.; Rodriguez Perez, P.; Roiser, S.; Romanovsky, V.; Romero Vidal, A.; Ronayne, J. W.; Rotondo, M.; Ruf, T.; Ruiz Valls, P.; Saborido Silva, J. J.; Sagidova, N.; Saitta, B.; Salustino Guimaraes, V.; Sanchez Mayordomo, C.; Sanmartin Sedes, B.; Santacesaria, R.; Santamarina Rios, C.; Santimaria, M.; Santovetti, E.; Sarti, A.; Satriano, C.; Satta, A.; Saunders, D. M.; Savrina, D.; Schael, S.; Schiller, M.; Schindler, R. H.; Schlupp, M.; Schmelling, M.; Schmelzer, T.; Schmidt, B.; Schneider, O.; Schopper, A.; Schubiger, M.; Schune, M. H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Semennikov, A.; Sergi, A; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Siddi, B. G.; Silva Coutinho, R.; Silva de Oliveira, L.; Simi, G.; Sirendi, M.; Skidmore, N.; Skwarnicki, T.; Smith, E.; Smith, E.; Smith, I. T.; Smith, J; Smith, M.; Snoek, H.; Sokoloff, M. D.; Soler, F. J. P.; Soomro, F.; de Souza, D.K.; Souza De Paula, B.; Spaan, B.; Spradlin, P.; Sridharan, S.; Stagni, F.; Stahl, M.; Stahl, S.; Stefkova, S.; Steinkamp, O.; Stenyakin, O.; Stevenson-Moore, P.; Stoica, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Sun, L.; Sutcliffe, W.; Swientek, K.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szumlak, T.; T’Jampens, S.; Tayduganov, A.; Tekampe, T.; Tellarini, G.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M. N.; Todd, Jim; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tourneur, S.; Trabelsi, K.; Traill, M.; Tran, N.T.M.T.; Tresch, M.; Trisovic, A.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vacca, C.; Vagnoni, V.; Valenti, G.; Vallier, A.; Vazquez Gomez, R.; Vazquez Regueiro, P.; Vázquez Sierra, C.; Vecchi, S.; van Veghel-Plandsoen, M.M.; Velthuis, M.J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Viaud, B.; Vieira, D.; Vieites Diaz, M.; Vilasis-Cardona, X.; Volkov, V.; Vollhardt, A.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voß, C.; de Vries, J. A.; Waldi, R.; Wallace, C.; Wallace, R.; Walsh, John; Wang, J.; Ward, D. R.; Watson, N. K.; Websdale, D.; Weiden, A.; Whitehead, M.; Wicht, J.; Wilkinson, G.; Wilkinson, M.; Williams, M.; Williams, M.P.; Williams, M.; Williams, T.; Wilson, James F; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wraight, K.; Wright, S.J.; Wyllie, K.; Xie, Y.; Xu, Z.; Yang, Z.; Yu, J.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhang, L.; Zhang, Y.; Zhelezov, A.; Zhokhov, A.; Zhong, L.; Zhukov, V.; Zucchelli, S.

    2016-01-01

    Abstract: A search is performed for DsJ (*) + mesons in the reactions pp → D∗ +KS 0X and pp → D*0K+X using data collected at centre-of-mass energies of 7 and 8 TeV with the LHCb detector. For the D∗ +KS 0 final state, the decays D*+ → D0π+ with D0 → K−π+ and D0 → K−π+π+π− are used. For D*0K+, the

  16. NuSTAR discovery of a cyclotron line in KS 1947+300

    DEFF Research Database (Denmark)

    Fürst, Felix; Pottschmidt, Katja; Wilms, Jörn

    2014-01-01

    days, which we use to study the evolution of the spectrum over the outburst. We find strong changes of the power-law photon index, which shows a weak trend of softening with increasing X-ray flux. The neutron star shows very strong pulsations with a period of P ≈ 18.8 s. The 0.8-79 keV broadband......-resolved spectroscopy reveals that the strength of the feature changes strongly with pulse phase and is most prominent during the broad minimum of the pulse profile. At the same phases the line also becomes visible in the first and third observation at the same energy. This discovery implies that KS 1947+300 has...

  17. Cannes'i filmifestivali Kuldne Palmioks läks Ken Loachile

    Index Scriptorium Estoniae

    2006-01-01

    Cannes'i filmifestivali võitjad. Kuldse Palmioksa võitis Ken Loachi mängufilm "Tuul, mis sasib odrapõldu" ("The Wind That Shakes the Barley"), Grand Prix' sai prantslase Bruno Dumonti film "Flandria" ("Flandres"), parim režissöör oli Alejandro Gonzalez Inarritu filmi eest "Paabel" ("Babel"), parima naisnäitleja auhinna sai grupp näitlejannasid Pedro Almodovari filmist "Tagasipöördumine" ("Volver") ja meesnäitleja auhinna sai samuti grupp näitlejaid prantsuse filmist "Kuulsuse päevad" ("Indigenes"). Žürii eriauhind läks Andrea Arnoldi filmile "Punane tänav" ("Red Road")

  18. Production of KS0, K*±(892) and ϕ0(1020) in minimum bias events and KS0 and Λ0 in jets in pp¯ collisions at s=1.96TeV

    Science.gov (United States)

    Aaltonen, T.; Albrow, M.; Amerio, S.; Amidei, D.; Anastassov, A.; Annovi, A.; Antos, J.; Apollinari, G.; Appel, J. A.; Arisawa, T.; Artikov, A.; Asaadi, J.; Ashmanskas, W.; Auerbach, B.; Aurisano, A.; Azfar, F.; Badgett, W.; Bae, T.; Barbaro-Galtieri, A.; Barnes, V. E.; Barnett, B. A.; Barria, P.; Bartos, P.; Bauce, M.; Bedeschi, F.; Behari, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Beretvas, A.; Bhatti, A.; Bland, K. R.; Blumenfeld, B.; Bocci, A.; Bodek, A.; Bortoletto, D.; Boudreau, J.; Boveia, A.; Brigliadori, L.; Bromberg, C.; Brucken, E.; Budagov, J.; Budd, H. S.; Burkett, K.; Busetto, G.; Bussey, P.; Butti, P.; Buzatu, A.; Calamba, A.; Camarda, S.; Campanelli, M.; Canelli, F.; Carls, B.; Carlsmith, D.; Carosi, R.; Carrillo, S.; Casal, B.; Casarsa, M.; Castro, A.; Catastini, P.; Cauz, D.; Cavaliere, V.; Cavalli-Sforza, M.; Cerri, A.; Cerrito, L.; Chen, Y. C.; Chertok, M.; Chiarelli, G.; Chlachidze, G.; Cho, K.; Chokheli, D.; Clark, A.; Clarke, C.; Convery, M. E.; Conway, J.; Corbo, M.; Cordelli, M.; Cox, C. A.; Cox, D. J.; Cremonesi, M.; Cruz, D.; Cuevas, J.; Culbertson, R.; d'Ascenzo, N.; Datta, M.; de Barbaro, P.; Demortier, L.; Deninno, M.; D'Errico, M.; Devoto, F.; Di Canto, A.; Di Ruzza, B.; Dittmann, J. R.; Donati, S.; D'Onofrio, M.; Dorigo, M.; Driutti, A.; Ebina, K.; Edgar, R.; Elagin, A.; Erbacher, R.; Errede, S.; Esham, B.; Farrington, S.; Fernández Ramos, J. P.; Field, R.; Flanagan, G.; Forrest, R.; Franklin, M.; Freeman, J. C.; Frisch, H.; Funakoshi, Y.; Galloni, C.; Garfinkel, A. F.; Garosi, P.; Gerberich, H.; Gerchtein, E.; Giagu, S.; Giakoumopoulou, V.; Gibson, K.; Ginsburg, C. M.; Giokaris, N.; Giromini, P.; Giurgiu, G.; Glagolev, V.; Glenzinski, D.; Gold, M.; Goldin, D.; Golossanov, A.; Gomez, G.; Gomez-Ceballos, G.; Goncharov, M.; González López, O.; Gorelov, I.; Goshaw, A. T.; Goulianos, K.; Gramellini, E.; Grinstein, S.; Grosso-Pilcher, C.; Group, R. C.; Guimaraes da Costa, J.; Hahn, S. R.; Han, J. Y.; Happacher, F.; Hara, K.; Hare, M.; Harr, R. F.; Harrington-Taber, T.; Hatakeyama, K.; Hays, C.; Heinrich, J.; Herndon, M.; Hocker, A.; Hong, Z.; Hopkins, W.; Hou, S.; Hughes, R. E.; Husemann, U.; Hussein, M.; Huston, J.; Introzzi, G.; Iori, M.; Ivanov, A.; James, E.; Jang, D.; Jayatilaka, B.; Jeon, E. J.; Jindariani, S.; Jones, M.; Joo, K. K.; Jun, S. Y.; Junk, T. R.; Kambeitz, M.; Kamon, T.; Karchin, P. E.; Kasmi, A.; Kato, Y.; Ketchum, W.; Keung, J.; Kilminster, B.; Kim, D. H.; Kim, H. S.; Kim, J. E.; Kim, M. J.; Kim, S. H.; Kim, S. B.; Kim, Y. J.; Kim, Y. K.; Kimura, N.; Kirby, M.; Knoepfel, K.; Kondo, K.; Kong, D. J.; Konigsberg, J.; Kotwal, A. V.; Kreps, M.; Kroll, J.; Kruse, M.; Kuhr, T.; Kurata, M.; Laasanen, A. T.; Lammel, S.; Lancaster, M.; Lannon, K.; Latino, G.; Lee, H. S.; Lee, J. S.; Leo, S.; Leone, S.; Lewis, J. D.; Limosani, A.; Lipeles, E.; Lister, A.; Liu, H.; Liu, Q.; Liu, T.; Lockwitz, S.; Loginov, A.; Lucchesi, D.; Lucà, A.; Lueck, J.; Lujan, P.; Lukens, P.; Lungu, G.; Lys, J.; Lysak, R.; Madrak, R.; Maestro, P.; Malik, S.; Manca, G.; Manousakis-Katsikakis, A.; Marchese, L.; Margaroli, F.; Marino, P.; Martínez, M.; Matera, K.; Mattson, M. E.; Mazzacane, A.; Mazzanti, P.; McNulty, R.; Mehta, A.; Mehtala, P.; Mesropian, C.; Miao, T.; Mietlicki, D.; Mitra, A.; Miyake, H.; Moed, S.; Moggi, N.; Moon, C. S.; Moore, R.; Morello, M. J.; Mukherjee, A.; Muller, Th.; Murat, P.; Mussini, M.; Nachtman, J.; Nagai, Y.; Naganoma, J.; Nakano, I.; Napier, A.; Nett, J.; Neu, C.; Nigmanov, T.; Nodulman, L.; Noh, S. Y.; Norniella, O.; Oakes, L.; Oh, S. H.; Oh, Y. D.; Oksuzian, I.; Okusawa, T.; Orava, R.; Ortolan, L.; Pagliarone, C.; Palencia, E.; Palni, P.; Papadimitriou, V.; Parker, W.; Pauletta, G.; Paulini, M.; Paus, C.; Phillips, T. J.; Piacentino, G.; Pianori, E.; Pilot, J.; Pitts, K.; Plager, C.; Pondrom, L.; Poprocki, S.; Potamianos, K.; Pranko, A.; Prokoshin, F.; Ptohos, F.; Punzi, G.; Ranjan, N.; Redondo Fernández, I.; Renton, P.; Rescigno, M.; Rimondi, F.; Ristori, L.; Robson, A.; Rodriguez, T.; Rolli, S.; Ronzani, M.; Roser, R.; Rosner, J. L.; Ruffini, F.; Ruiz, A.; Russ, J.; Rusu, V.; Sakumoto, W. K.; Sakurai, Y.; Santi, L.; Sato, K.; Saveliev, V.; Savoy-Navarro, A.; Schlabach, P.; Schmidt, E. E.; Schwarz, T.; Scodellaro, L.; Scuri, F.; Seidel, S.; Seiya, Y.; Semenov, A.; Sforza, F.; Shalhout, S. Z.; Shears, T.; Shepard, P. F.; Shimojima, M.; Shochet, M.; Shreyber-Tecker, I.; Simonenko, A.; Sliwa, K.; Smith, J. R.; Snider, F. D.; Song, H.; Sorin, V.; St. Denis, R.; Stancari, M.; Stentz, D.; Strologas, J.; Sudo, Y.; Sukhanov, A.; Suslov, I.; Takemasa, K.; Takeuchi, Y.; Tang, J.; Tecchio, M.; Teng, P. K.; Thom, J.; Thomson, E.; Thukral, V.; Toback, D.; Tokar, S.; Tollefson, K.; Tomura, T.; Torre, S.; Torretta, D.; Totaro, P.; Trovato, M.; Ukegawa, F.; Uozumi, S.; Vázquez, F.; Velev, G.; Vellidis, C.; Vernieri, C.; Vidal, M.; Vilar, R.; Vizán, J.; Vogel, M.; Volpi, G.; Wagner, P.; Wallny, R.; Wang, C.; Wang, S. M.; Waters, D.; Wester, W. C., III; Whiteson, D.; Wicklund, A. B.; Wilbur, S.; Williams, H. H.; Wilson, J. S.; Wilson, P.; Winer, B. L.; Wittich, P.; Wolbers, S.; Wolfe, H.; Wright, T.; Wu, X.; Wu, Z.; Yamamoto, K.; Yamato, D.; Yang, T.; Yang, U. K.; Yang, Y. C.; Yao, W.-M.; Yeh, G. P.; Yi, K.; Yoh, J.; Yorita, K.; Yoshida, T.; Yu, G. B.; Yu, I.; Zanetti, A. M.; Zeng, Y.; Zhou, C.; Zucchelli, S.

    2013-11-01

    We report measurements of the inclusive transverse momentum (pT) distribution of centrally produced KS0, K⋆±(892), and ϕ0(1020) mesons up to pT=10GeV/c in minimum bias events, and KS0 and Λ0 particles up to pT=20GeV/c in jets with transverse energy between 25 and 160 GeV in pp¯ collisions. The data were taken with the CDF II detector at the Fermilab Tevatron at s=1.96TeV. We find that as pT increases, the pT slopes of the three mesons (KS0, K⋆±, and ϕ) are similar. And using our previous Λ0 results from minimum bias events, we show that the ratio of Λ0 to KS0 as a function of pT in minimum bias events becomes similar to the fairly constant ratio in jets at pT˜5GeV/c. This suggests that the particles with pT≳5GeV/c in minimum bias events are from “soft” jets, and that the pT slope of particles in jets is insensitive to light quark flavor (u, d, or s) and to the number of valence quarks. We also find that for pT≲4GeV relatively more Λ0 baryons are produced in minimum bias events than in jets.

  19. Updated Cross Section Measurement of $e^+ e^- \\to K^+ K^- J/\\psi$ and $K_S^0K_S^0J/\\psi$ via Initial State Radiation at Belle

    CERN Document Server

    Shen, C P; Wang, P; Abdesselam, A; Adachi, I; Aihara, H; Said, S Al; Asner, D M; Aulchenko, V; Aushev, T; Ayad, R; Bakich, A M; Bala, A; Bobrov, A; Bonvicini, G; Bozek, A; Bračko, M; Browder, T E; Chekelian, V; Chen, A; Cheon, B G; Chilikin, K; Chistov, R; Cho, K; Chobanova, V; Choi, S -K; Choi, Y; Cinabro, D; Dalseno, J; Danilov, M; Doležal, Z; Drutskoy, A; Dutta, D; Eidelman, S; Epifanov, D; Farhat, H; Fast, J E; Ferber, T; Frey, A; Gaur, V; Ganguly, S; Gillard, R; Glattauer, R; Goh, Y M; Golob, B; Haba, J; Hayasaka, K; Hayashii, H; He, X H; Hoshi, Y; Hou, W -S; Hsiung, Y B; Hyun, H J; Iijima, T; Ishikawa, A; Itoh, R; Iwasaki, Y; Joffe, D; Julius, T; Kang, J H; Kato, E; Kawasaki, T; Kiesling, C; Kim, D Y; Kim, H J; Kim, J B; Kim, J H; Kim, K T; Kim, M J; Kim, Y J; Kinoshita, K; Ko, B R; Kodyš, P; Korpar, S; Križan, P; Krokovny, P; Kuzmin, A; Kwon, Y -J; Lee, S -H; Li, J; Gioi, L Li; Libby, J; Liu, C; Liu, Z Q; Lukin, P; Matvienko, D; Miyabayashi, K; Miyata, H; Mizuk, R; Moll, A; Mussa, R; Nagasaka, Y; Nakano, E; Nakao, M; Natkaniec, Z; Nayak, M; Nedelkovska, E; Nisar, N K; Nishida, S; Nitoh, O; Okuno, S; Park, C W; Park, H; Pedlar, T K; Pestotnik, R; Petrič, M; Piilonen, L E; Ritter, M; Röhrken, M; Rostomyan, A; Ryu, S; Saito, T; Sakai, Y; Sanuki, T; Sato, Y; Schneider, O; Schnell, G; Semmler, D; Senyo, K; Seon, O; Sevior, M E; Shapkin, M; Shebalin, V; Shibata, T -A; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Sohn, Y -S; Sokolov, A; Solovieva, E; Stanič, S; Starič, M; Steder, M; Sumiyoshi, T; Tamponi, U; Tatishvili, G; Teramoto, Y; Uchida, M; Unno, Y; Uno, S; Urquijo, P; Usov, Y; Van Hulse, C; Vanhoefer, P; Varner, G; Vorobyev, V; Wagner, M N; Wang, C H; Watanabe, M; Watanabe, Y; Williams, K M; Won, E; Yamamoto, H; Yamashita, Y; Yashchenko, S; Yook, Y; Zhang, C C; Zhang, Z P; Zhulanov, V; Zupanc, A

    2014-01-01

    The cross sections of the processes $e^+ e^- \\to K^+ K^- J/\\psi$ and $K_S^0K_S^0J/\\psi$ are measured via initial state radiation at center-of-mass energies between the threshold and 6.0~GeV using a data sample of 980~fb$^{-1}$ collected with the Belle detector on or near the $\\Upsilon(nS)$ resonances, where $n=$1, 2, ..., 5. The cross sections for $e^+ e^- \\to K^+ K^- J/\\psi$ are at a few pb level and the average cross section for $e^+ e^- \\to K_S^0K_S^0J/\\psi$ is $1.8\\pm 0.6 (\\rm stat.)\\pm 0.3 (\\rm syst.)$~pb between 4.4 and 5.2~GeV. All of them are consistent with previously published results with improved precision. A search for resonant structures and associated intermediate states in the cross section of the process $e^+ e^- \\to K^+ K^- J/\\psi$ is performed.

  20. Veritasu Inguššias : üks tapmise ja sugulaste kättemaksu lugu / Jaanus Piirsalu

    Index Scriptorium Estoniae

    Piirsalu, Jaanus, 1973-

    2008-01-01

    31. augustil tapeti Nazranis Inguššia üks opositsiooniliidritest Magomed Jevlojev. Mõrvatu isa Jahja Jevlojevi sõnul ei rakendata tapmise organiseerijatele ja täidesaatjatele veritasu juhul, kui tapja saab kohtus karistatud. Vt. samas: Veritasu traditsioon näeb ette ka lepitamisvõimalust

  1. Molluscs and Echinoderms from Palaeolithic deposits in the Rock Shelter of Ksâr'akil, Lebanon

    NARCIS (Netherlands)

    Regteren, van C.O.

    1962-01-01

    INTRODUCTION The palaeolithic deposits of the rock shelter of Ksâr'Akil in the Antelias valley have been excavated by a group of American Jesuits in the years 1937-1938 and 1947-1948. Recently the fossil bones from these deposits were reported upon by my colleague Hooijer (1961). When he received

  2. Tallinna-Tartu liinil jääb käima üks rong / Hindrek Riikoja

    Index Scriptorium Estoniae

    Riikoja, Hindrek

    2001-01-01

    Teede- ja sideminister Toivo Jürgenson ning Edelaraudtee juhatuse esimees Henn Ruubel allkirjastasid reisijateveo lepingu, mille järgi jääb Tallinna-Tartu liinil käima üks rong päevas. Uued bussiliinid

  3. 77 FR 31831 - Designation for the Topeka, KS; Cedar Rapids, IA; Minot, ND; and Cincinnati, OH Areas

    Science.gov (United States)

    2012-05-30

    ... Grain Inspection, Packers and Stockyards Administration Designation for the Topeka, KS; Cedar Rapids, IA; Minot, ND; and Cincinnati, OH Areas AGENCY: Grain Inspection, Packers and Stockyards Administration....S.C. 71-87k. Alan R. Christian, Acting Administrator, Grain Inspection, Packers and Stockyards...

  4. Improved limit on the branching fraction of the rare decay K-S(0) -> mu(+)mu(-)

    NARCIS (Netherlands)

    Dufour, L.; Mulder, M; Onderwater, C. J. G.; Pellegrino, A.; Tolk, S.; van Veghel, M.

    2017-01-01

    A search for the decay K-S(0) -> mu+ mu- is performed, based on a data sample of proton- proton collisions corresponding to an integrated luminosity of 3 fb(-1), collected by the LHCb experiment at centre-of- mass energies of 7 and 8 TeV. The observed yield is consistent with the background- only

  5. Branching ratio measurement of $K_S\\to \\gamma \\gamma$ decay using a pure $\\ks$ beam in the KLOE detector

    CERN Document Server

    Ambrosino, F; Antonelli, M; Archilli, F; Bacci, C; Beltrame, P; Bencivenni, G; Bertolucci, S; Bini, C; Bloise, C; Bocchetta, S; Bocci, V; Bossi, F; Branchini, P; Caloi, R; Campana, P; Capon, G; Capussela, T; Ceradini, F; Chi, S; Chiefari, G; Ciambrone, P; De Lucia, E; De Santis, A; De Simone, P; De Zorzi, G; Denig, A; Di Domenico, A; Di Donato, C; Di Falco, S; Di Micco, B; Doria, A; Dreucci, M; Felici, G; Ferrari, A; Ferrer, M L; Finocchiaro, G; Fiore, S; Forti, C; Franzini, P; Gatti, C; Gauzzi, P; Giovannella, S; Gorini, E; Graziani, E; Incagli, M; Kluge, W; Kulikov, V; Lacava, F; Lanfranchi, G; Lee-Franzini, J; Leone, D; Martini, M; Massarotti, P; Mei, W; Meola, S; Miscetti, S; Moulson, M; Müller, S; Murtas, F; Napolitano, M; Nguyen, F; Palutan, M; Pasqualucci, E; Passeri, A; Patera, V; Perfetto, F; Primavera, M; Santangelo, P; Saracino, G; Sciascia, B; Sciubba, A; Scuri, F; Sfiligoi, I; Spadaro, T; Testa, M; Tortora, L; Valente, P; Valeriani, B; Venanzoni, G; Versaci, R; Xu, G

    2007-01-01

    We have analyzed 1.62 fb$^{-1}$ of $e^{+}e^{-}$ collisions at a center of mass energy $\\sim M_{\\phi}$ collected by the KLOE experiment at DA$\\Phi$NE. This sample corresponds to a production of $\\sim$ 1.7 billion of $\\ks$ $\\kl$ pairs which allowed us to search for the rare $K_S\\to \\gamma\\gamma$ decay. $K_S$ are tagged by the $K_L$ interaction in the calorimeter and the signal is searched for by requiring two additional prompt photons. Strong kinematic requirements reduce the initial 0.5$\\times 10^6$ events to 2300 candidates from which we extract a signal of 600 $\\pm$ 35 events. By normalizing to the $\\ks \\to 2 \\pi^0$ decays counted in the same sample, the measured value of BR($\\ks \\to \\gamma\\gamma$) is (2.27 $\\pm 0.13(stat.) ^{+0.03}_{-0.04} (syst.)) \\times 10^{-6}$, in agreement with $O(P^4)$ Chiral Perturbation Theory predictions.

  6. BoKS 1.0. : Een voorstel voor een body of knowlegde & skills van de communicatieve competentie

    NARCIS (Netherlands)

    Monique van Wijk; Cecilia van Dongen; Els van der Pool

    2010-01-01

    Sinds 2008 bestaat er een landelijke Body of Knowledge & Skills voor vijf domeinen binnen het hoger onderwijs, te weten Business Administration, Commerce, Communications, Economics en Laws (Hbo-raad 2008). De term Body of Knowledge & Skills (BoKS) staat voor het geheel van kennis, vaardigheden en

  7. 75 FR 41819 - Reorganization/Expansion of Foreign-Trade Zone 17 under Alternative Site Framework, Kansas City, KS

    Science.gov (United States)

    2010-07-19

    ... Foreign-Trade Zones Board Reorganization/Expansion of Foreign-Trade Zone 17 under Alternative Site Framework, Kansas City, KS Pursuant to its authority under the Foreign-Trade Zones Act of June 18, 1934, as... zones; Whereas, the Greater Kansas City Foreign-Trade Zone, Inc., grantee of Foreign-Trade Zone 17...

  8. 77 FR 20782 - Foreign-Trade Zone 161-Sedgwick County, KS; Application for Temporary/Interim Manufacturing...

    Science.gov (United States)

    2012-04-06

    ... Manufacturing Authority; Siemens Energy, Inc.; (Wind Turbine Nacelles and Hubs); Hutchinson, KS An application... authority to produce wind turbine nacelles and hubs (HTSUS 8412.80, 8412.90, 8502.31; duty rates: free, 2.5... to wind turbine nacelles and hubs (duty rate: free, 2.5%) for the foreign inputs noted above. In...

  9. Scaled momentum distributions for K-S(0) and Lambda/(Lambda)over-bar in DIS at HERA

    NARCIS (Netherlands)

    Abramowicz, H.; Abt, I.; Adamczyk, L.; Adamus, M.; Aggarwal, R.; Antonelli, S.; Antonioli, P.; Antonov, A.; Arneodo, M.; Aushev, V.; Aushev, Y.; Bachynska, O.; Bamberger, A.; Barakbaev, A. N.; Barbagli, G.; Bari, G.; Barreiro, F.; Bartosik, N.; Bartsch, D.; Basile, M.; Behnke, O.; Behr, J.; Behrens, U.; Bellagamba, L.; Bertolin, A.; Bhadra, S.; Bindi, M.; Blohm, C.; Bokhonov, V.; Bold, T.; Bondarenko, K.; Boos, E. G.; Borras, K.; Boscherini, D.; Brock, I.; Brownson, E.; Brugnera, R.; Bruemmer, N.; Bruni, A.; Bruni, G.; Brzozowska, B.; Bussey, P. J.; Bylsma, B.; Caldwell, A.; Capua, M.; Carlin, R.; Catterall, C. D.; Chekanov, S.; Chwastowski, J.; Ciborowski, J.; Ciesielski, R.; Cifarelli, L.; Cindolo, F.; Contin, A.; Cooper-Sarkar, A. M.; Coppola, N.; Corradi, M.; Corriveau, F.; Costa, M.; D'Agostini, G.; Dal Corso, F.; del Peso, J.; Dementiev, R. K.; De Pasquale, S.; Derrick, M.; Devenish, R. C. E.; Dobur, D.; Dolgoshein, B. A.; Dolinska, G.; Doyle, A. T.; Drugakov, V.; Durkin, L. S.; Dusini, S.; Eisenberg, Y.; Ermolov, P. F.; Eskreys, A.; Fazio, S.; Ferrando, J.; Ferrero, M. I.; Figiel, J.; Forrest, M.; Foster, B.; Gach, G.; Galas, A.; Gallo, E.; Garfagnini, A.; Geiser, A.; Gialas, I.; Gladilin, L. K.; Gladkov, D.; Glasman, C.; Gogota, O.; Golubkov, Yu. A.; Goettlicher, P.; Grabowska-Bold, I.; Grebenyuk, J.; Gregor, I.; Grigorescu, G.; Grzelak, G.; Gueta, O.; Guzik, M.; Gwenlan, C.; Haas, T.; Hain, W.; Hamatsu, R.; Hart, J. C.; Hartmann, H.; Hartner, G.; Hilger, E.; Hochman, D.; Hori, R.; Horton, K.; Huettmann, A.; Ibrahim, Z. A.; Iga, Y.; Ingbir, R.; Ishitsuka, M.; Jakob, H. -P.; Januschek, F.; Jones, T. W.; Juengst, M.; Kadenko, I.; Kahle, B.; Kananov, S.; Kanno, T.; Karshon, U.; Karstens, F.; Katkov, I. I.; Kaur, M.; Kaur, P.; Keramidas, A.; Khein, L. A.; Kim, J. Y.; Kisielewska, D.; Kitamura, S.; Klanner, R.; Klein, U.; Kooijman, P.; Korol, Ic.; Korzhavina, I. A.; Kotanski, A.; Koetz, U.; Kowalski, H.; Kuprash, O.; Kuze, M.; Lee, A.; Levchenko, B. B.; Libov, V.; Limentani, S.; Ling, T. Y.; Lisovyi, M.; Lobodzinska, E.; Lohmann, W.; Loehr, B.; Lohrmann, E.; Long, K. R.; Longhin, A.; Lontkovskyi, D.; Lukina, O. Yu.; Maeda, J.; Magill, S.; Makarenko, I.; Malka, J.; Mankel, R.; Margotti, A.; Marini, G.; Mastroberardino, A.; Mattingly, M. C. K.; Melzer-Pellmann, I. -A.; Mergelmeyer, S.; Miglioranzi, S.; Idris, F. Mohamad; Monaco, V.; Montanari, A.; Mujkic, K.; Musgrave, B.; Nagano, K.; Namsoo, T.; Nania, R.; Nigro, A.; Ning, Y.; Nobe, T.; Noor, U.; Notz, D.; Nowak, R. J.; Nuncio-Quiroz, A. E.; Oh, B. Y.; Okazaki, N.; Oliver, K.; Olkiewicz, K.; Onishchuk, Yu.; Papageorgiu, K.; Parenti, A.; Pawlak, J. M.; Pawlik, B.; Pelfer, P. G.; Pellegrino, A.; Perlanski, W.; Perrey, H.; Piotrzkowski, K.; Plucinski, P.; Pokrovskiy, N. S.; Polini, A.; Proskuryakov, A. S.; Przybycien, M.; Raval, A.; Reeder, D. D.; Reisert, B.; Ren, Z.; Repond, J.; Ri, Y. D.; Robertson, A.; Roloff, P.; Rubinsky, I.; Ruspa, M.; Sacchi, R.; Salii, A.; Samson, U.; Sartorelli, G.; Savin, A. A.; Saxon, D. H.; Schioppa, M.; Schlenstedt, S.; Schleper, P.; Schmidke, W. B.; Schneekloth, U.; Schoenberg, V.; Schoerner-Sadenius, T.; Schwartz, J.; Sciulli, F.; Shcheglova, L. M.; Shehzadi, R.; Singh, I.; Skillicorn, I. O.; Slominski, M.; Smith, W. H.; Sola, V.; Solano, A.; Son, D.; Sosnovtsev, V.; Spiridonov, A.; Stadie, H.; Stanco, L.; Stern, A.; Stewart, T. P.; Stifutkin, A.; Stopa, P.; Suchkov, S.; Susinno, G.; Suszycki, L.; Sztuk-Dambietz, J.; Szuba, D.; Szuba, J.; Tapper, A. D.; Tassi, E.; Terron, J.; Theedt, T.; Tiecke, H.; Tokushuku, K.; Tomalak, O.; Tomaszewska, J.; Tsurugai, T.; Turcato, M.; Tymieniecka, T.; Vazquez, M.; Verbytskyi, A.; Viazlo, O.; Vlasov, N. N.; Volynets, O.; Walczak, R.; Abdullah, W. A. T. Wan; Whitmore, J. J.; Wing, M.; Wlasenko, M.; Wolf, G.; Wolfe, H.; Wrona, K.; Yaguees-Molina, A. G.; Yamada, S.; Yamazaki, Y.; Yoshida, R.; Youngman, C.; Zarnecki, A. F.; Zawiejski, L.; Zenaiev, O.; Zeuner, W.; Zhautykov, B. O.; Zhmak, N.; Zichichi, A.; Zolkapli, Z.; Zolko, M.; Zotkin, D. S.

    Scaled momentum distributions for the strange hadrons K-S(0) and Lambda/(Lambda) over bar were measured in deep inelastic ep scattering with the ZEUS detector at HERA using an integrated luminosity of 330 pb(-1). The evolution of these distributions with h the photon virtuality, Q(2), was studied in

  10. [Kätlin Kätlin. Üks pole ühtegi = One is none] / Katrin Väli

    Index Scriptorium Estoniae

    Väli, Katrin, 1956-

    2008-01-01

    Tutvustus: Kätlin, Kätlin, pseud. Üks pole ühtegi = One is none / Kätlin Kätlin ; [tõlkijad Mika Keränen ja Marina Tervonen ; illustratsioonid: Hanneleele Kaldmaa. Tallinn : Positive Projects], 2008

  11. Efficiency of generation of optical centers in KS-4V and KU-1 quartz glasses at neutron and gamma irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Islamov, A.Kh.; Salikhbaev, U.S. [Institute of Nuclear Physics AS RUz, pos, Ulugbek, 100214 Tashkent (Uzbekistan); Ibragimova, E.M., E-mail: ibragimova@inp.uz [Institute of Nuclear Physics AS RUz, pos, Ulugbek, 100214 Tashkent (Uzbekistan); Nuritdinov, I.; Fayzullaev, B.S. [Institute of Nuclear Physics AS RUz, pos, Ulugbek, 100214 Tashkent (Uzbekistan); Vukolov, K.Yu.; Orlovskiy, I. [NRC “Kurchatov Institute”, Kurchatov sq.1, 123182 Moscow (Russian Federation)

    2013-11-15

    Pure quartz glasses of KS-4V and KU-1 types are candidates for optical plasma diagnostic system in ITER. The purpose of experiment was to study the efficiency of defect production in these glasses under irradiation with {sup 60}So γ-quanta (5.7 Gy/s) dose range of 10{sup 2}–10{sup 7} Gy and the fission reactor neutrons in the fluency range of 10{sup 20}–10{sup 23} n/m{sup 2} and gammas simulating the plasma influence. In KU-1 (1000 ppm OH) the accumulation kinetics of E′-(5.75 eV) and NBO-(1.9 eV) centers at γ-doses⩾5×10{sup 5} Gy and neutron fluencies <10{sup 21} n/m{sup 2} is faster, than that in KS-4V glasses (<0.1 ppm OH) that is caused by rupture of hydrogen bonds. At fluencies >10{sup 21} n/m{sup 2} the NBO accumulation kinetics is slower in KU-1 than in KS-4B, because highly mobile hydrogen atoms access to the generated NBO centers. In KS-4V irradiated to γ-doses10{sup 2}–5 × 10{sup 3} Gy a new unstable absorption band at 1.8 eV was found, which is caused by the glass synthesis conditions and alkali metal impurities. The transparency at 3.5–6.2 eV at fluencies 10{sup 20}–5 × 10{sup 21} n/m{sup 2} is higher in KS-4V than KU-1. However at fluencies >10{sup 21} n/m{sup 2} in KS-4V the photoluminescence band at 2.7 eV is more intensive and distorts a diagnosed signal. The transparency in 3.5–1.2 eV at fluencies >10{sup 21} n/m{sup 2} is higher in KU-1 than KS-4V.

  12. 78 FR 100 - Guidance for Industry and Food and Drug Administration Staff; Refuse To Accept Policy for 510(k)s...

    Science.gov (United States)

    2013-01-02

    ...; Refuse To Accept Policy for 510(k)s; Availability AGENCY: Food and Drug Administration, HHS. ACTION... entitled ``Refuse to Accept Policy for 510(k)s.'' The purpose of this document is to explain the procedures and criteria FDA intends to use in determining whether a 510(k) submission is administratively...

  13. Sediment and plankton lift off recirculations in strong synthetic turbulence (KS)

    Science.gov (United States)

    Redondo, Jose M.; Castilla, Roberto; Sekula, Emil; Furmanek, Petr

    2014-05-01

    The study of particle diffusion and of turbulent sedimentation is of great importance in many geophysical fields, such as in Environmental Science or Oceanography as well as in Bio-environmental and industrial processes. For a long time, the study of diffusion was numerically computed with random free paths, which gives Brownian behavior. (Richardson 1929). These stochastics methods have the objection that do not take into account the flow profile. On the other hand, there are many ways to simulate a fluid flow, but when this is turbulent our aim is to simulate the behaviour of neutral or heavy and inertial particles of biological or geological nature in a turbulent flow, in a simple way with a kinematically simulated model and to validate the results. We use the Kinematic Simulation (KS) model, also known as Synthetic Turbulence, suggested by Kraichnan (1966) and developed further by Castilla et al.(2007), Nicolleau et al.(2012). In this model, velocity field is generated through a Fourier series of random modes. The typical scales and the energy spectrum of the turbulence are inputs of the model. As we do not solve the flow in a discrete grid, but use a random predictive expression, we can simulate the flow at the smallest scales. In an unstratified flow, a KS flow field consists of a random, truncated Fourier representation in space and time, subject to constraints associated with incompressibility, and a prescribed initial energy spectrum. For stratified calculations, two further constraints are imposed, associated with the internal wave field in stratified flows, and the tendency of density variations to suppress vertical motion. With these model modifications, good agreement is found between KS and DNS with regard to the confinement in the vertical direction characteristic of stratified turbulence. Since stratifed flows exhibit this vertical confinement, KS in strictly two dimensions was considered as a first step to understanding dispersion within a

  14. Sequence Alterations of I(Ks Potassium Channel Genes in Kazakhstani Patients with Atrial Fibrillation

    Directory of Open Access Journals (Sweden)

    Ainur Akilzhanova

    2014-12-01

    Full Text Available Introduction. Atrial fibrillation (AF is the most common sustained arrhythmia, and it results in significant morbidity and mortality. However, the pathogenesis of AF remains unclear to date. Recently, more pieces of evidence indicated that AF is a multifactorial disease resulting from the interaction between environmental factors and genetics. Recent studies suggest that genetic mutation of the slow delayed rectifier potassium channel (I(Ks may underlie AF.Objective. To investigate sequence alterations of I(Ks potassium channel genes KCNQ1, KCNE1 and KCNE2 in Kazakhstani patients with atrial fibrillation.Methods. Genomic DNA of 69 cases with atrial fibrillation and 27 relatives were analyzed for mutations in all protein-coding exons and their flanking splice site regions of the genes KCNQ1 (NM_000218.2 and NM_181798.1, KCNE1 (NM_000219.2, and KCNE2 (NM_172201.1 using bidirectional sequencing on the ABI 3730xL DNA Analyzer (Applied Biosystems, Foster City, CA, USA.Results. In total, a disease-causing mutation was identified in 39 of the 69 (56.5% index cases. Of these, altered sequence variants in the KCNQ1 gene accounted for 14.5% of the mutations, whereas a KCNE1 mutation accounted for 43.5% of the mutations and KCNE2 mutation accounted for 1.4% of the mutations. The majority of the distinct mutations were found in a single case (80%, whereas 20% of the mutations were observed more than once. We found two sequence variants in KCNQ1 exon 13 (S546S G1638A and exon 16 (Y662Y, C1986T in ten patients (14.5%. In KCNE1 gene in exon 3 mutation, S59G A280G was observed in 30 of 69 patients (43.5% and KCNE2 exon 2 T10K C29A in 1 patient (1.4%. Genetic cascade screening of 27 relatives to the 69 index cases with an identified mutation revealed 26.9% mutation carriers  who were at risk of cardiac events such as syncope or sudden unexpected death.Conclusion. In this cohort of Kazakhstani index cases with AF, a disease-causing mutation was identified in

  15. K.S. Maniam, Jhumpa Lahiri, Shirley Lim: A Reflection of Culture and Identity

    Directory of Open Access Journals (Sweden)

    Hardev Kaur Jujar Singh

    2012-07-01

    Full Text Available “I do not want my house to be walled in on all sides and my windows to be stuffed. I want the culture of all lands to be blown about my house as freely as possible. But I refuse to be blown off my feet by any”—Mahatma Gandhi. With these sayings by Gandhiji, one will be able to understand why, even in a borderless world where the diffusion of races and culture happens all the time, and many would simply accept without restraint, the cultures and identity of their adopted land, there remain some writers who, despite being part of a new land, are still deeply influenced by their motherland and various aspects of life that are distinctive and peculiar to their motherland. The writers concerned in this paper are K.S Maniam, Shirley Lim and Jhumpa Lahiri. All these writers have nationalities not of their motherland, but somehow, their writings are usually immersed with the thoughts and culture of their motherland. In this study, we will examine the strong influences imbedded in these writers of the culture of their motherland despite being in their new land. We will also portray how some of the characters assimilate in their new land, whereas some still have a sense of belonging towards their motherland.

  16. Extended station blackout analyses of an APR1400 with MARS-KS

    Directory of Open Access Journals (Sweden)

    Kim Woongbae

    2016-01-01

    Full Text Available The Fukushima Daiichi nuclear power plant accident shows that natural disasters such as earthquakes and the subsequent tsunamis can cause station blackout for several days. The electric energy required for essential systems during a station blackout is provided from emergency backup batteries installed at the nuclear power plant. In South Korea, in the event of an extended station blackout, the life of these emergency backup batteries has recently been extended from 8 hours to 24 hours at Shin-Kori 5, 6, and APR1400 for design certification. For a battery life of 24 hours, available safety means system, equipment and procedures are studied and analyzed in their ability to cope with an extended station blackout. A sensitivity study of reactor coolant pump seal leakage is performed to verify how different seal leakages could affect the system. For simulating extended station blackout scenarios, the best estimate MARS-KS computer code was used. In this paper, an APR1400 RELAP5 input deck was developed for station blackout scenario to analyze operation strategy by manually depressurizing the reactor coolant system through the steam generator's secondary side. Additionally, a sensitivity study on reactor coolant pump seal leakage was carried out.

  17. Extended Station Blackout Analyses of an APR1400 with MARS-KS

    Energy Technology Data Exchange (ETDEWEB)

    Kim, WoongBae; Jang, HyungWook; Oh, Seungjong; Lee, Sangyong [KEPCO International Nuclear Graduate School, Ulsan (Korea, Republic of)

    2016-10-15

    The Fukushima Dai-ichi nuclear power plant accident shows that natural disasters such as earthquakes and the subsequent tsunamis can cause station blackout for several days. The electricity required for essential systems during a station blackout is provided from the emergency backup batteries installed at the nuclear power plant. In South Korea, in the event of an extended station blackout, the life of these emergency backup batteries has recently been extended from 8 hours to 24 hours at Shin-Kori 5, 6 and APR1400 for design certification. For a battery life of 24 hours, available safety means system, equipment and procedures are studied and analyzed in their ability to cope with an extended station blackout. A sensitivity study of reactor coolant pump seal leakage is performed to verify how different seal leakages could affect the system. For simulating of extended station blackout scenarios, the best estimate MARS-KS was used. In this paper, an APR1400 RELAP5 input deck was developed for station blackout scenario to analyze operation strategy by manually depressurizing the reactor coolant system through the steam generator's secondary side. Additionally, a sensitivity study was performed on reactor coolant pump seal leakage.

  18. Measurement of CP-violation asymmetries in D0 to Ks pi+ pi-

    CERN Document Server

    Aaltonen, T.

    2012-01-01

    We report a measurement of time-integrated CP-violation asymmetries in the resonant substructure of the three-body decay D0 to Ks pi+ pi- using CDF II data corresponding to 6.0 invfb of integrated luminosity from Tevatron ppbar collisions at sqrt(s) = 1.96 TeV. The charm mesons used in this analysis come from D*+(2010) to D0 pi+ and D*-(2010) to D0bar pi-, where the production flavor of the charm meson is determined by the charge of the accompanying pion. We apply a Dalitz-amplitude analysis for the description of the dynamic decay structure and use two complementary approaches, namely a full Dalitz-plot fit employing the isobar model for the contributing resonances and a model-independent bin-by-bin comparison of the D0 and D0bar Dalitz plots. We find no CP-violation effects and measure an asymmetry of ACP = (-0.05 +- 0.57 (stat) +- 0.54 (syst))% for the overall integrated CP-violation asymmetry, consistent with the standard model prediction.

  19. "Kuidas ma saan kirjutada ridagi?¡ Võib-olla oli kõik olnud vaid räige..."¡ : ¡ [luuletus] / Timo Lappalainen ; soome keelest tõlkinud Jan Kaus

    Index Scriptorium Estoniae

    Lappalainen, Timo

    2007-01-01

    Sisu: "Kuidas ma saan kirjutada ridagi? Võib-olla oli kõik olnud vaid räige..." ; "Siit võiks rahulikult minna edasi maailma tagahoovidesse, või vähemalt..." ; "Istun dominiiklaste kloostris potil, kui keegi tuleb ja kustutab valguse. Ma..." ; "Silitan surnukuuris isa pealage. Kokku tõmbunud külmkeha. Põskedel on..." ; "Kummel peaks rahustama. Keele peal on rohu lääge maitse. Täna olen ainult..." ; "Korraga tuleb paremal vastu Maardu tööstuspiirkond. Mürki sülgav..." ; "Kõndisin psühhiaatrite kabinetti üle läikimalöödud graniitpõranda..." ; "Ärkan täielikus pimeduses, peaasi, et pead ära ei löö. Masinate müdin on..." ; "Lauseid justkui oleks, kuid mis järjekorda neid panna. Suu on täis tõrva..." ; "Belgias eksid alati ära: varem või hiljem hakkad sõitma ringiratast. Mida..."

  20. The interaction between smoking status and highly active antiretroviral therapy (HAART) use on the risk of Kaposi's sarcoma (KS) in a cohort of HIV-infected men.

    Science.gov (United States)

    Luu, H N; Amirian, E S; Scheurer, M E

    2013-03-19

    Although the independent effects of smoking status and HAART are reported as lower risks against KS, their combined effects have not been explored. We examined whether there is an interaction between smoking status and HAART use on the risk of KS development in an on-going US cohort of HIV-infected men. Cox proportional hazards regression was used to analyse a total sample of 2736 participants of the Multicenter AIDS Cohort Study (MACS). We identified 530 incident KS cases with a total follow-up time of 26 594 person-years (incidence rate: 2.00 out of 100 person-years). Current smoking status and HAART use were independently associated with a lower risk of KS development (hazard ratio - HR=0.56, 95% CI: 0.35-0.90, P=0.02 and HR=0.27, 95% CI: 0.16-0.48, Psmoking status and HAART use on KS risk (HR=2.14, 95% CI: 0.97-4.73, Pinteraction=0.06). Lower effect of smoking was only present among those not on HAART (HR=0.57, 95% CI: 0.35-0.92, P=0.02). The inverse association of cigarette smoking on KS risk may be limited to those not on HAART. The biological mechanism of smoking in KS carcinogenesis should be elucidated.

  1. Observation of the CP-conserving $K_{S} \\rightarrow \\pi^{+}\\pi^{- }\\pi^{0}$ decay amplitude

    CERN Document Server

    Adler, R; Angelopoulos, Angelos; Aspostolakis, A; Aslanides, Elie; Backenstoss, Gerhard; Bee, C P; Behnke, O; Benelli, A; Bennet, J; Bertin, V; Bienlein, J K; Blanc, F; Bloch, P; Bula, C; Carlson, P J; Carroll, M; Carvalho, J; Cawley, E; Charalambous, S; Chardin, G; Chertok, M B; Cody, A; Danielsson, M; Dejardin, M; Derré, J; Dodgson, M; Duclos, J; Ealet, A; Eckart, B; Eleftheriadis, C; Evangelou, I; Faravel, L; Fassnacht, P; Faure, J L; Felder, C; Ferreira-Marques, R; Fetscher, W; Fidecaro, Maria; Filipcic, A; Francis, D; Fry, J; Fuglesang, C; Gabathuler, Erwin; Gamet, R; Garreta, D; Geralis, T; Gerber, H J; Go, A; Gumplinger, P; Guyot, C; Harrison, P F; Haselden, A; Hayman, P J; Henry-Coüannier, F; Heyes, W G; Hollander, R W; Hubert, E; Jansson, K; Johner, H U; Jon-And, K; Kettle, P R; Kochowski, Claude; Kokkas, P; Kreuger, R; Lawry, T; Le Gac, R; Leimgruber, F; Liolios, A; Machado, E; Maley, P; Mandic, I; Manthos, N; Marel, Gérard; Mikuz, M; Miller, J; Montanet, François; Nakada, Tatsuya; Onofre, A; Pagels, B; Papadopoulos, I M; Pavlopoulos, P; Pelucchi, F; Pinto da Cunha, J; Policarpo, Armando; Polivka, G; Postma, H; Rickenbach, R; Roberts, B L; Rozaki, E; Ruf, T; Sacks, L; Sakelliou, L; Sanders, P; Santoni, C; Sarigiannis, K; Schäfer, M; Schaller, L A; Schietinger, T; Schopper, A; Schune, P; Soares, A; Tauscher, Ludwig; Thibault, C; Touchard, F; Touramanis, C; Triantis, F A; Tröster, D A; Van Beveren, E; van Eijk, C W E; Varner, G S; Vlachos, S; Weber, P; Wigger, O; Witzig, C; Wolter, M; Yéche, C; Zavrtanik, D; Zimmerman, D

    1996-01-01

    The interference between CP-conserving $\\ks$ and $\\kl \\rightarrow \\threepi$ decay amplitudes was observed by studying the decay rate asymmetries between initial $\\ko$ and $\\kob$ separately for the phase space regions $E_{\\mbox{\\rm \\scriptsize CM}}(\\pi^+)> E_{\\mbox{\\rm \\scriptsize CM}}(\\pi^-)$ and $E_{\\mbox{\\rm \\scriptsize CM}}(\\pi^+)< E_{\\mbox{\\rm \\scriptsize CM}}(\\pi^-)$. For the parameter $\\lambda$ we found $\\mbox{\\rm Re}(\\lambda )=0.036\\pm0.010(\\mbox{\\rm stat.}) ^{+0.002}_{-0.003} (\\mbox{\\rm syst.)}$ and $\\mbox{Im}(\\lambda)$ consistent with zero, leading for the CP-conserving $\\ks \\rightarrow \\threepi$ decay, to a branching ratio $\\mbox{\\rm B} = \\left[4.1 ^{+2.5}_{-1.9 } (\\mbox{\\rm stat.}) ^{+0.5} _{-0.6} (\\mbox{\\rm syst.)}\\right] \\times 10^{-7}$.

  2. EPR study of gamma and neutron irradiation effects on KU1, KS-4V and Infrasil 301 silica glasses

    Energy Technology Data Exchange (ETDEWEB)

    Lagomacini, Juan C., E-mail: jc.lagomacini@uam.es [Dept. Fisica de Materiales, Universidad Autonoma de Madrid, E-28049 Madrid (Spain); Bravo, David [Dept. Fisica de Materiales, Universidad Autonoma de Madrid, E-28049 Madrid (Spain); Leon, Monica; Martin, Piedad; Ibarra, Angel [Materiales para Fusion, CIEMAT, Avda. Complutense 22, E-28040 Madrid (Spain); Martin, Agustin [Dept. Fisica e Instalaciones, ETS Arquitectura UPM, E-28040 Madrid (Spain); Lopez, Fernando J. [Dept. Fisica de Materiales, Universidad Autonoma de Madrid, E-28049 Madrid (Spain)

    2011-10-01

    Electron paramagnetic resonance (EPR) studies have been carried out on KU1 and KS-4V high purity quartz glasses and commercial silica Infrasil 301, irradiated with gamma rays up to a dose of 11.6 MGy and neutron fluences of 10{sup 21} and 10{sup 22} n/m{sup 2}. Gamma irradiations produce a much higher concentration of defect centres (mainly E', POR and NBOHC) for KU1 and I301 than for KS-4V silica. In contrast, neutron irradiation at the highest fluence produces similar concentrations in all silica types. These results agree to a good extent with those obtained in previous optical absorption measurements. Moreover, oxygen-related centres (POR and NBOHC) have been well characterized by means of electron paramagnetic resonance.

  3. Dalitz plot studies of D0 → KS0π+π− decays in a factorization approach

    Directory of Open Access Journals (Sweden)

    Leśniak Leonard

    2014-01-01

    Full Text Available A quasi two-body QCD factorization is used to study the D0 → KS0π+π− decays. The presently available high-statistics Dalitz plot data of this process measured by the Belle and BABAR Collaborations are analyzed together with the τ− → KS0π−ντ decay data. The total experimental branching fraction is also included in the fits which show a very good overall agreement with the experimental Dalitz plot density distributions. The branching fractions of the dominant channels compare well with those of the isobar Belle or BABAR models. We show that the branching fractions corresponding to the annihilation amplitudes are significant.

  4. Convergence of Multiple MAP3Ks on MKK3 Identifies a Set of Novel Stress MAPK Modules

    KAUST Repository

    Colcombet, Jean

    2016-12-22

    Since its first description in 1995 and functional characterization 12 years later, plant MKK3-type MAP2Ks have emerged as important integrators in plant signaling. Although they have received less attention than the canonical stress-activated mitogen-activated protein kinases (MAPKs), several recent publications shed light on their important roles in plant adaptation to environmental conditions. Nevertheless, the MKK3-related literature is complicated. This review summarizes the current knowledge and discrepancies on MKK3 MAPK modules in plants and highlights the singular role of MKK3 in green plants. In the light of the latest data, we hypothesize a general model that all clade-III MAP3Ks converge on MKK3 and C-group MAPKs, thereby defining a set of novel MAPK modules which are activated by stresses and internal signals through the transcriptional regulation of MAP3K genes.

  5. XMM-Newton Observations of the Neutron Star X-Ray Transient KS 1731-260 in Quiescence

    NARCIS (Netherlands)

    Wijnands, Rudy; Guainazzi, Matteo; van der Klis, Michiel; Méndez, Mariano

    2002-01-01

    We report on XMM-Newton observations performed on 2001 September 13-14 of the neutron star X-ray transient KS 1731-260 in quiescence. The source was detected at an unabsorbed 0.5-10 keV flux of only (4-8)×10-14 ergs cm-2 s-1, depending on the model used to fit the data, which for a distance of 7 kpc

  6. Effect of Calcium and Boron Foliar Application on Fruit Quality in Asian Pear Cultivar ‘KS10’

    OpenAIRE

    K. Khalaj; Ahmadi, N; M. K. Souri

    2015-01-01

    Calcium and boron as plant nutritional elements play major roles in plant physiological processes including regulating various cell and plant functions. Considering the importance of both elements, this study was conducted during 2010-2011 in the Experimental Asian Pear Orchard at Faculty of Agriculture, Tarbiat Modares University. Different concentrations of calcium chloride (0, 0.5 and 0.7 percent) and acid boric (0 and 0.5 percent) were used as foliar spray of Asian pear cultivar "KS10" du...

  7. Orbital theory in terms of KS elements with luni-solar perturbations

    Science.gov (United States)

    Sellamuthu, Harishkumar; Sharma, Ram

    2016-07-01

    Precise orbit computation of Earth orbiting satellites is essential for efficient mission planning of planetary exploration, navigation and satellite geodesy. The third-body perturbations of the Sun and the Moon predominantly affect the satellite motion in the high altitude and elliptical orbits, where the effect of atmospheric drag is negligible. The physics of the luni-solar gravity effect on Earth satellites have been studied extensively over the years. The combined luni-solar gravitational attraction will induce a cumulative effect on the dynamics of satellite orbits, which mainly oscillates the perigee altitude. Though accurate orbital parameters are computed by numerical integration with respect to complex force models, analytical theories are highly valued for the manifold of solutions restricted to relatively simple force models. During close approach, the classical equations of motion in celestial mechanics are almost singular and they are unstable for long-term orbit propagation. A new singularity-free analytical theory in terms of KS (Kustaanheimo and Stiefel) regular elements with respect to luni-solar perturbation is developed. These equations are regular everywhere and eccentric anomaly is the independent variable. Plataforma Solar de Almería (PSA) algorithm and a Fourier series algorithm are used to compute the accurate positions of the Sun and the Moon, respectively. Numerical studies are carried out for wide range of initial parameters and the analytical solutions are found to be satisfactory when compared with numerically integrated values. The symmetrical nature of the equations allows only two of the nine equations to be solved for computing the state vectors and the time. Only a change in the initial conditions is required to solve the other equations. This theory will find multiple applications including on-board software packages and for mission analysis purposes.

  8. An Ultralow Leakage Synaptic Scaling Homeostatic Plasticity Circuit With Configurable Time Scales up to 100 ks.

    Science.gov (United States)

    Qiao, Ning; Bartolozzi, Chiara; Indiveri, Giacomo

    2017-12-01

    Homeostatic plasticity is a stabilizing mechanism commonly observed in real neural systems that allows neurons to maintain their activity around a functional operating point. This phenomenon can be used in neuromorphic systems to compensate for slowly changing conditions or chronic shifts in the system configuration. However, to avoid interference with other adaptation or learning processes active in the neuromorphic system, it is important that the homeostatic plasticity mechanism operates on time scales that are much longer than conventional synaptic plasticity ones. In this paper we present an ultralow leakage circuit, integrated into an automatic gain control scheme, that can implement the synaptic scaling homeostatic process over extremely long time scales. Synaptic scaling consists in globally scaling the synaptic weights of all synapses impinging onto a neuron maintaining their relative differences, to preserve the effects of learning. The scheme we propose controls the global gain of analog log-domain synapse circuits to keep the neuron's average firing rate constant around a set operating point, over extremely long time scales. To validate the proposed scheme, we implemented the ultralow leakage synaptic scaling homeostatic plasticity circuit in a standard 0.18 m complementary metal-oxide-semiconductor process, and integrated it in an array of dynamic synapses connected to an adaptive integrate and fire neuron. The circuit occupies a silicon area of 84  m 22 m and consumes approximately 10.8 nW with a 1.8 V supply voltage. We present experimental results from the homeostatic circuit and demonstrate how it can be configured to exhibit time scales of up to 100 ks, thanks to a controllable leakage current that can be scaled down to 0.45 aA (2.8 electrons per second).

  9. First observation of the decay $B_{s}^{0} \\to K_{S}^{0} K^{*}(892)^{0}$

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casanova Mohr, Raimon; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Ruscio, Francesco; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fohl, Klaus; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gazzoni, Giulio; Geraci, Angelo; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Matthieu, Kecke; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Ninci, Daniele; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skillicorn, Ian; Skwarnicki, Tomasz; Smith, Edmund; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Sterpka, Christopher Francis; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Tekampe, Tobias; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wiedner, Dirk; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang

    2016-01-04

    A search for $B_{(s)}^{0} \\to K_{S}^{0} K^{*}(892)^{0}$ decays is performed using $pp$ collision data, corresponding to an integrated luminosity of $1.0~\\text{fb}^{-1}$, collected with the LHCb detector at a centre-of-mass energy of $7~\\text{TeV}$. The $B_{s}^{0} \\to K_{S}^{0} K^{*}(892)^{0}$ decay is observed for the first time, with a significance of 7.1 standard deviations. The branching fraction is measured to be \\begin{equation*} \\mathcal{B}(B_{s}^{0} \\to \\bar{K}^{0} K^{*}(892)^{0}) + \\mathcal{B}(B_{s}^{0} \\to K^{0} \\bar{K}^{*}(892)^{0}) = (16.4 \\pm 3.4 \\pm 2.3) \\times 10^{-6},\\\\ \\end{equation*} where the first uncertainty is statistical and the second is systematic. No evidence is found for the decay $B^{0} \\to K_{S}^{0} K^{*}(892)^{0}$ and an upper limit is set on the branching fraction, $\\mathcal{B}(B^{0} \\to \\bar{K}^{0} K^{*}(892)^{0}) + \\mathcal{B}(B^{0} \\to K^{0} \\bar{K}^{*}(892)^{0}) < 0.96 \\ \\times 10^{-6}, $ at $90\\,\\% $ confidence level. All results are consistent with Standard Model pr...

  10. ROSAT and follow-up infrared observations of the X-ray burster KS 1731-260

    Science.gov (United States)

    Barret, Didier; Motch, Christian; Predehl, Peter

    1998-01-01

    We report on the ROSAT HRI (High Resolution Imager) observation of the X-ray burster KS 1731-260. The observation was split in two parts; the first took place in 1995, March 16 lasting for ~ 1 kilosecond and the second one between September 3rd and 14th, 1996 for about 5 kiloseconds. In both observations, KS 1731-260 was clearly detected with a count rate of 0.82 and 7.9ctss respectively. From the first observation we found that the X-ray source is located at a position alpha = 17() h 34() mn 13.5() s and delta = -26() deg 05' 16.8'' (equinox 2000) with an associated error radius of 10.1 arcsec (90% confidence level combining the attitude and centroid uncertainties). The position derived from the second part of the observation is consistent with the previous one. The ROSAT HRI position rules out the two counterparts that have been proposed so far. Our CFHT J and H infrared imaging of the HRI error box reveals at least 13 possible candidates. As expected from a comparison with other X-ray bursters, the upper limits derived for the infrared brightness of KS 1731-260 imply the presence of a low mass companion for the neutron star. We also report on a refined spectral analysis of the PSPC data taken during the all sky survey in September 1990. These data, together with data recorded by TTM and PCA/RXTE indicate that the column density towards KS 1731-260 varies between ~ 1 to 6 x 10(22) H atoms cm(-2) ; thus suggesting that the source is characterized by variable intrinsic absorption. The change in the HRI count rate could be better explained by a change in the column density between the two observations rather than by a true source intensity variation. The numerous detections of the source since its discovery in 1988 together with its recent monitoring by the RXTE/ASM show that KS 1731-260 is a persistent source rather than a soft X-ray transient, as originally thought.

  11. LHCb: Search for CP violation in $B_0 \\to J/\\psi K_s^0$ decays with first LHCb data

    CERN Multimedia

    Santana Rangel, Murilo

    2011-01-01

    We report a measurement of the well-established CP violation in $B_0 \\to J/\\psi K_s^0$ decays. We perform a time-dependent analysis of the decays reconstructed in 35 pb $^{-1}$ of LHCb data that was taken in 2010. We measure the CP asymmetry parameter $S_{ J/\\psi K_s^0}$ , which is connected to the CKM angle $\\beta$ through $S_{ J/\\psi K_s^0}$ = sin2$\\beta$, neglecting CP violation in $B^0$-$ \\overline{B^0}$ mixing and decay. We find $S_{ J/\\psi K_s^0} $ = 0.53$^{+0.28}_{-0.29}$(stat) $\\pm$ 0.05(syst).

  12. L-Kuramoto-Sivashinsky SPDEs in one-to-three dimensions: L-KS kernel, sharp Hölder regularity, and Swift-Hohenberg law equivalence

    Science.gov (United States)

    Allouba, Hassan

    2015-12-01

    Generalizing the L-Kuramoto-Sivashinsky (L-KS) kernel from our earlier work, we give a novel explicit-kernel formulation useful for a large class of fourth order deterministic, stochastic, linear, and nonlinear PDEs in multispatial dimensions. These include pattern formation equations like the Swift-Hohenberg and many other prominent and new PDEs. We first establish existence, uniqueness, and sharp dimension-dependent spatio-temporal Hölder regularity for the canonical (zero drift) L-KS SPDE, driven by white noise on {R+×Rd}d=13. The spatio-temporal Hölder exponents are exactly the same as the striking ones we proved for our recently introduced Brownian-time Brownian motion (BTBM) stochastic integral equation, associated with time-fractional PDEs. The challenge here is that, unlike the positive BTBM density, the L-KS kernel is the Gaussian average of a modified, highly oscillatory, and complex Schrödinger propagator. We use a combination of harmonic and delicate analysis to get the necessary estimates. Second, attaching order parameters ε1 to the L-KS spatial operator and ε2 to the noise term, we show that the dimension-dependent critical ratio ε2 /ε1d/8 controls the limiting behavior of the L-KS SPDE, as ε1 ,ε2 ↘ 0; and we compare this behavior to that of the less regular second order heat SPDEs. Finally, we give a change-of-measure equivalence between the canonical L-KS SPDE and nonlinear L-KS SPDEs. In particular, we prove uniqueness in law for the Swift-Hohenberg and the law equivalence-and hence the same Hölder regularity-of the Swift-Hohenberg SPDE and the canonical L-KS SPDE on compacts in one-to-three dimensions.

  13. The Taiwan ECDFS Near-Infrared Survey: Ultra-deep J and KS Imaging in the Extended Chandra Deep Field-South

    Science.gov (United States)

    Hsieh, Bau-Ching; Wang, Wei-Hao; Hsieh, Chih-Chiang; Lin, Lihwai; Yan, Haojing; Lim, Jeremy; Ho, Paul T. P.

    2012-12-01

    We present ultra-deep J and KS imaging observations covering a 30' × 30' area of the Extended Chandra Deep Field-South (ECDFS) carried out by our Taiwan ECDFS Near-Infrared Survey (TENIS). The median 5σ limiting magnitudes for all detected objects in the ECDFS reach 24.5 and 23.9 mag (AB) for J and KS , respectively. In the inner 400 arcmin2 region where the sensitivity is more uniform, objects as faint as 25.6 and 25.0 mag are detected at 5σ. Thus, this is by far the deepest J and KS data sets available for the ECDFS. To combine TENIS with the Spitzer IRAC data for obtaining better spectral energy distributions of high-redshift objects, we developed a novel deconvolution technique (IRACLEAN) to accurately estimate the IRAC fluxes. IRACLEAN can minimize the effect of blending in the IRAC images caused by the large point-spread functions and reduce the confusion noise. We applied IRACLEAN to the images from the Spitzer IRAC/MUSYC Public Legacy in the ECDFS survey (SIMPLE) and generated a J+KS -selected multi-wavelength catalog including the photometry of both the TENIS near-infrared and the SIMPLE IRAC data. We publicly release the data products derived from this work, including the J and KS images and the J+KS -selected multi-wavelength catalog.

  14. Precision measurement of the ratio BR (KS →π+π-e+e-) / BR (KL →π+π-πD0)

    Science.gov (United States)

    Batley, J. R.; Kalmus, G. E.; Lazzeroni, C.; Munday, D. J.; Patel, M.; Slater, M. W.; Wotton, S. A.; Arcidiacono, R.; Bocquet, G.; Ceccucci, A.; Cundy, D.; Doble, N.; Falaleev, V.; Gatignon, L.; Gonidec, A.; Grafström, P.; Kubischta, W.; Marchetto, F.; Mikulec, I.; Norton, A.; Panzer-Steindel, B.; Rubin, P.; Wahl, H.; Goudzovski, E.; Hristov, P.; Kekelidze, V.; Kozhuharov, V.; Litov, L.; Madigozhin, D.; Molokanova, N.; Potrebenikov, Yu.; Stoynev, S.; Zinchenko, A.; Monnier, E.; Swallow, E. C.; Winston, R.; Sacco, R.; Walker, A.; Baldini, W.; Dalpiaz, P.; Frabetti, P. L.; Gianoli, A.; Martini, M.; Petrucci, F.; Savrié, M.; Scarpa, M.; Calvetti, M.; Collazuol, G.; Iacopini, E.; Ruggiero, G.; Bizzeti, A.; Lenti, M.; Veltri, M.; Behler, M.; Eppard, K.; Eppard, M.; Hirstius, A.; Kleinknecht, K.; Koch, U.; Marouelli, P.; Masetti, L.; Moosbrugger, U.; Morales Morales, C.; Peters, A.; Wanke, R.; Winhart, A.; Dabrowski, A.; Fonseca Martin, T.; Szleper, M.; Velasco, M.; Anzivino, G.; Imbergamo, E.; Lamanna, G.; Lubrano, P.; Michetti, A.; Nappi, A.; Piccini, M.; Valdata-Nappi, M.; Cenci, P.; Pepe, M.; Petrucci, M. C.; Cerri, C.; Fantechi, R.; Mannelli, I.; Costantini, F.; Fiorini, L.; Giudici, S.; Pierazzini, G.; Sozzi, M.; Cheshkov, C.; Chèze, J. B.; De Beer, M.; Debu, P.; Gouge, G.; Marel, G.; Mazzucato, E.; Peyaud, B.; Vallage, B.; Holder, M.; Maier, A.; Ziolkowski, M.; Biino, C.; Cartiglia, N.; Clemencic, M.; Lopez, S. Goy; Menichetti, E.; Pastrone, N.; Wislicki, W.; Dibon, H.; Jeitler, M.; Markytan, M.; Neuhofer, G.; Widhalm, L.; NA48/1 Collaboration

    2011-01-01

    The KS →π+π-e+e- decay mode was investigated using the data collected in 2002 by the NA48/1 Collaboration. With about 23 k KS →π+π-e+e- events and 59 k KL →π+π-πD0 normalization decays, the KS →π+π-e+e- branching ratio relative to the KL →π+π-πD0 one was determined to be BR (KS →π+π-e+e-) / BR (KL →π+π-πD0) = (3.28 ±0.06stat ±0.04syst) ×10-2. This result was used to set the upper limit |gE1 /gBR | < 3.0 at 90% CL on the presence, in the decay amplitude, of an E1 direct emission (gE1) term relative to the dominant inner bremsstrahlung (gBR) term. The CP-violating asymmetry Aϕ in the sin ϕcos ϕ distribution of KS →π+π-e+e- events, where ϕ is the angle between the π+π- and the e+e- decay planes in the kaon centre of mass, was found to be Aϕ = (- 0.4 ± 0.8)%, consistent with zero. These results are in good agreement with a description of the KS →π+π-e+e- decay amplitude dominated by the CP-even inner bremsstrahlung process.

  15. γ-MYN: a new algorithm for estimating Ka and Ks with consideration of variable substitution rates

    Directory of Open Access Journals (Sweden)

    Wang Da-Peng

    2009-06-01

    Full Text Available Abstract Background Over the past two decades, there have been several approximate methods that adopt different mutation models and used for estimating nonsynonymous and synonymous substitution rates (Ka and Ks based on protein-coding sequences across species or even different evolutionary lineages. Among them, MYN method (a Modified version of Yang-Nielsen method considers three major dynamic features of evolving DNA sequences–bias in transition/transversion rate, nucleotide frequency, and unequal transitional substitution but leaves out another important feature: unequal substitution rates among different sites or nucleotide positions. Results We incorporated a new feature for analyzing evolving DNA sequences–unequal substitution rates among different sites–into MYN method, and proposed a modified version, namely γ (gamma-MYN, based on an assumption that the evolutionary rate at each site follows a mode of γ-distribution. We applied γ-MYN to analyze the key estimator of selective pressure ω (Ka/Ks and other relevant parameters in comparison to two other related methods, YN and MYN, and found that neglecting the variation of substitution rates among different sites may lead to biased estimations of ω. Our new method appears to have minimal deviations when relevant parameters vary within normal ranges defined by empirical data. Conclusion Our results indicate that unequal substitution rates among different sites have variable influences on ω under different evolutionary rates while both transition/transversion rate ratio and unequal nucleotide frequencies affect Ka and Ks thus selective pressure ω. Reviewers This paper was reviewed by Kateryna Makova, David A. Liberles (nominated by David H Ardell, Zhaolei Zhang (nominated by Mark Gerstein, and Shamil Sunyaev.

  16. Economic Injury Levels for Aphis glycines Matsumura (Hemiptera: Aphididae) on the Soybean Aphid Tolerant KS4202 Soybean.

    Science.gov (United States)

    Marchi-Werle, Lia; Baldin, Edson L L; Fischer, Hillary D; Heng-Moss, Tiffany M; Hunt, Thomas E

    2017-10-01

    The soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae), is an invasive species from Asia that has been the major economic insect pest of soybeans, Glycine max (L.) Merrill, since 2000. While use of soybeans expressing antibiosis and antixenosis is a well-studied strategy to manage this pest, aphid-tolerant soybeans remain underexplored. This study examined the relationship between cumulative aphid-days (CAD) and yield loss in the tolerant soybean KS4202 during two growing seasons to determine the economic injury levels (EILs) for soybean aphids on KS4202. Soybean aphid infestations were initiated during the soybean reproductive stages. A range of CAD treatments (3,000-45,000 CADs) were applied during the growing seasons. Aphid populations reached 45,000 CAD in 2011 and 38,000 CAD in 2013 in plots that were not treated with insecticides. It was estimated that the population doubling time was 9.4 d. In infested plots, soybean yield was reduced by 1.4-13.3%, equivalent to a 3.1% yield loss for every 10,000 CAD. Overall, most CAD treatments did not affect yield parameters, although CAD > 39,000 caused a significant reduction in most yield parameters. The EILs calculated for KS4202 ranged from 526 to 2,050 aphids/plant, which were approximately 2.5-fold higher when compared to EILs previously calculated for susceptible soybean. The adoption of soybean aphid tolerant soybean with higher EILs may help mitigate treatment delay problems by lengthening the treatment lead-time and possibly reduce the number of insecticide applications. © The Author 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  17. Bounds on γ from CP violation measurements in B→π+π- and B→ψKS

    Science.gov (United States)

    Botella, F. J.; Silva, João P.

    2004-11-01

    We study the determination of γ from CP-violating observables in B→π+π- and B→ψKS. This determination requires theoretical input to one combination of hadronic parameters. We show that a mild assumption about this quantity may allow bounds to be placed on γ, but we stress the pernicious effects that an eightfold discrete ambiguity has on such an analysis. The bounds are discussed as a function of the direct (C) and interference (S) CP-violating observables obtained from time-dependent B→π+π- decays, and their behavior in the presence of new physics effects in B-B¯ mixing is studied.

  18. Model-independent measurement of the CKM angle $\\gamma$ using $B^0 \\to D K^{\\ast 0}$ decays with $D \\to K_{S}^{0} \\pi^{+} \\pi^{-}$ and $K_{S}^{0} K^{+} K^{-}$

    CERN Document Server

    Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hongming, Li; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusardi, Nicola; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Niess, Valentin; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefkova, Slavomira; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhong, Liang; Zhukov, Valery; Zucchelli, Stefano

    2016-06-21

    A binned Dalitz plot analysis of the decays $B^0 \\to D K^{\\ast 0}$, with $D \\to K_{S}^{0} \\pi^{+} \\pi^{-}$ and $D \\to K_{S}^{0} K^{+} K^{-}$, is performed to measure the observables $x_\\pm$ and $y_\\pm$, which are related to the CKM angle $\\gamma$ and the hadronic parameters of the decays. The $D$ decay strong phase variation over the Dalitz plot is taken from measurements performed at the CLEO-c experiment, making the analysis independent of the $D$ decay model. With a sample of proton-proton collision data, corresponding to an integrated luminosity of $3.0\\,\\rm{fb}^{-1}$, collected by the LHCb experiment, the values of the $CP$ violation parameters are found to be $x_+ = 0.05 \\pm 0.35 \\pm 0.02$, $x_-=-0.31\\pm 0.20 \\pm 0.04$, $y_+=-0.81\\pm 0.28\\pm 0.06$ and $y_-=0.31\\pm 0.21 \\pm 0.05$, where the first uncertainties are statistical and the second systematic. These observables correspond to values $\\gamma$ = $(71 \\pm 20)^\\circ$, $r_{B^0} = 0.56\\pm 0.17$ and $\\delta_{B^0} = (204\\,^{+21}_{-20})^\\circ$. The parame...

  19. Translation and validation of the new version of the Knee Society Score - The 2011 KS Score - into Brazilian Portuguese

    Directory of Open Access Journals (Sweden)

    Adriana Lucia Pastore e Silva

    Full Text Available ABSTRACT OBJECTIVE: Translation, cultural adaptation, and validation of the new version of the Knee Society Score - The 2011 KS Score - into Brazilian Portuguese and verification of its measurement properties, reproducibility, and validity. In 2012, the new version of the Knee Society Score was developed and validated. This scale comprises four separate subscales: (a objective knee score (seven items: 100 points; (b patient satisfaction score (five items: 40 points; (c patient expectations score (three items: 15 points; and (d functional activity score (19 items: 100 points. METHOD: A total of 90 patients aged 55-85 years were evaluated in a clinical cross-sectional study. The pre-operative translated version was applied to patients with TKA referral, and the post-operative translated version was applied to patients who underwent TKA. Each patient answered the same questionnaire twice and was evaluated by two experts in orthopedic knee surgery. Evaluations were performed pre-operatively and three, six, or 12 months post-operatively. The reliability of the questionnaire was evaluated using the intraclass correlation coefficient (ICC between the two applications. Internal consistency was evaluated using Cronbach's alpha. RESULTS: The ICC found no difference between the means of the pre-operative, three-month, and six-month post-operative evaluations between sub-scale items. CONCLUSION: The Brazilian Portuguese version of The 2011 KS Score is a valid and reliable instrument for objective and subjective evaluation of the functionality of Brazilian patients who undergo TKA and revision TKA.

  20. Observation and Spin-Parity Determination of the X(1835) in J/ψ→γK_{S}^{0}K_{S}^{0}η.

    Science.gov (United States)

    Ablikim, M; Achasov, M N; Ai, X C; Albayrak, O; Albrecht, M; Ambrose, D J; Amoroso, A; An, F F; An, Q; Bai, J Z; Ferroli, R Baldini; Ban, Y; Bennett, D W; Bennett, J V; Bertani, M; Bettoni, D; Bian, J M; Bianchi, F; Boger, E; Boyko, I; Briere, R A; Cai, H; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, H Y; Chen, J C; Chen, M L; Chen, S J; Chen, X; Chen, X R; Chen, Y B; Cheng, H P; Chu, X K; Cibinetto, G; Dai, H L; Dai, J P; Dbeyssi, A; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; De Mori, F; Ding, Y; Dong, C; Dong, J; Dong, L Y; Dong, M Y; Du, S X; Duan, P F; Eren, E E; Fan, J Z; Fang, J; Fang, S S; Fang, X; Fang, Y; Fava, L; Feldbauer, F; Felici, G; Feng, C Q; Fioravanti, E; Fritsch, M; Fu, C D; Gao, Q; Gao, X Y; Gao, Y; Gao, Z; Garzia, I; Geng, C; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, Y; Guo, Y P; Haddadi, Z; Hafner, A; Han, S; Han, Y L; Hao, X Q; Harris, F A; He, K L; He, Z Y; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Hu, Y; Huang, G M; Huang, G S; Huang, H P; Huang, J S; Huang, X T; Huang, Y; Hussain, T; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L L; Jiang, L W; Jiang, X S; Jiang, X Y; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Johansson, T; Julin, A; Kalantar-Nayestanaki, N; Kang, X L; Kang, X S; Kavatsyuk, M; Ke, B C; Kiese, P; Kliemt, R; Kloss, B; Kolcu, O B; Kopf, B; Kornicer, M; Kühn, W; Kupsc, A; Lange, J S; Lara, M; Larin, P; Leng, C; Li, C; Li, C H; Li, Cheng; Li, D M; Li, F; Li, G; Li, H B; Li, J C; Li, Jin; Li, K; Li, K; Li, Lei; Li, P R; Li, T; Li, W D; Li, W G; Li, X L; Li, X M; Li, X N; Li, X Q; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Lin, D X; Liu, B J; Liu, C X; Liu, F H; Liu, Fang; Liu, Feng; Liu, H B; Liu, H H; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, J Y; Liu, K; Liu, K; Liu, K Y; Liu, L D; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, X X; Liu, Y B; Liu, Z A; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H; Lou, X C; Lu, H J; Lu, J G; Lu, R Q; Lu, Y; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lv, M; Lyu, X R; Ma, F C; Ma, H L; Ma, L L; Ma, Q M; Ma, T; Ma, X N; Ma, X Y; Maas, F E; Maggiora, M; Mao, Y J; Mao, Z P; Marcello, S; Messchendorp, J G; Min, J; Min, T J; Mitchell, R E; Mo, X H; Mo, Y J; Morales, C Morales; Moriya, K; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nerling, F; Nikolaev, I B; Ning, Z; Nisar, S; Niu, S L; Niu, X Y; Olsen, S L; Ouyang, Q; Pacetti, S; Patteri, P; Pelizaeus, M; Peng, H P; Peters, K; Pettersson, J; Ping, J L; Ping, R G; Poling, R; Prasad, V; Pu, Y N; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, N; Qin, X S; Qin, Y; Qin, Z H; Qiu, J F; Rashid, K H; Redmer, C F; Ren, H L; Ripka, M; Rong, G; Rosner, Ch; Ruan, X D; Santoro, V; Sarantsev, A; Savrié, M; Schoenning, K; Schumann, S; Shan, W; Shao, M; Shen, C P; Shen, P X; Shen, X Y; Sheng, H Y; Song, W M; Song, X Y; Sosio, S; Spataro, S; Sun, G X; Sun, J F; Sun, S S; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Tiemens, M; Ullrich, M; Uman, I; Varner, G S; Wang, B; Wang, B L; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S G; Wang, W; Wang, X F; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z H; Wang, Z Y; Weber, T; Wei, D H; Wei, J B; Weidenkaff, P; Wen, S P; Wiedner, U; Wolke, M; Wu, L H; Wu, Z; Xia, L G; Xia, Y; Xiao, D; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, L; Xu, Q J; Xu, Q N; Xu, X P; Yan, L; Yan, W B; Yan, W C; Yan, Y H; Yang, H J; Yang, H X; Yang, L; Yang, Y; Yang, Y X; Ye, H; Ye, M; Ye, M H; Yin, J H; Yu, B X; Yu, C X; Yu, H W; Yu, J S; Yuan, C Z; Yuan, W L; Yuan, Y; Yuncu, A; Zafar, A A; Zallo, A; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J J; Zhang, J L; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, K; Zhang, L; Zhang, S H; Zhang, X Y; Zhang, Y; Zhang, Y N; Zhang, Y H; Zhang, Y T; Zhang, Yu; Zhang, Z H; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, J W; Zhao, J Y; Zhao, J Z; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, Q W; Zhao, S J; Zhao, T C; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, W J; Zheng, Y H; Zhong, B; Zhou, L; Zhou, Li; Zhou, X; Zhou, X K; Zhou, X R; Zhou, X Y; Zhu, K; Zhu, K J; Zhu, S; Zhu, X L; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, J; Zotti, L; Zou, B S; Zou, J H

    2015-08-28

    We report an observation of the process J/ψ→γX(1835)→γK_{S}^{0}K_{S}^{0}η at low K_{S}^{0}K_{S}^{0} mass with a statistical significance larger than 12.9σ using a data sample of 1.31×10^{9} J/ψ events collected with the BESIII detector. In this region of phase space the K_{S}^{0}K_{S}^{0} system is dominantly produced through the f_{0}(980). By performing a partial wave analysis, we determine the spin parity of the X(1835) to be J^{PC}=0^{-+}. The mass and width of the observed X(1835) are 1844±9(stat)_{-25}^{+16}(syst)  MeV/c^{2} and 192_{-17}^{+20}(stat)_{-43}^{+62}(syst)  MeV, respectively, which are consistent with the results obtained by BESIII in the channel J/ψ→γπ^{+}π^{-}η^{'}.

  1. Efficiency and midgut histopathological effect of the newly isolated Bacillus thuringiensis KS δ-endotoxins on the emergent pest Tuta absoluta.

    Science.gov (United States)

    Jamoussi, Kaïs; Sellami, Sameh; Nasfi, Zina; Krichen-Makni, Saloua; Tounsi, Slim

    2013-08-01

    Tuta absoluta (Povolny, 1994) is a devastating moth to the Solanaceae plants. It is a challenging pest to control, especially on tomatoes. In this work, we studied the entomopathogenic activity of the Cry-forming δ-endotoxins produced by Bacillus thuringiensis strain KS and B. thuringiensis kurstaki reference strain HD1 against T. absoluta. These strains carried the cry2, cry1Ab, cry1Aa / cry1Ac, and cry1I genes, and KS also carried a cry1C gene. The δ-endotoxins of KS were approximately twofold more toxic against the third instar larvae than those of HD1, as they showed lower 50% and 90% lethal concentrations (0.80 and 2.70 μg/cm² (δ-endotoxins/tomato leaf)) compared with those of HD1 (1.70 and 4.50 μg/cm²) (p endotoxins, yielding the active toxins of about 65 kDa and the protease-resistant core of about 58 kDa. Moreover, the histopathological effects of KS and HD1 δ-endotoxins on the larvae midgut consisted of an apical columnar cell vacuolization, microvillus damage, and epithelial cell disruption. These results showed that the KS strain could be a candidate for T. absoluta control.

  2. Üks kaame naine väikses kambris ... : [luuletused] / Gyula Illyés ; tlk. Sander Liivak, Ene Asu-Õunas

    Index Scriptorium Estoniae

    Illyés, Gyula

    2004-01-01

    Sisu: Üks kaame naine väikses kambris ... ; Sa ei saa pageda ; Purukslöödud vägi ; Mäe otsas puhkan ... ; Kodumaa kõrgel ; Magav naine ; Doleo, ergo surm ; Bart̤k ; Üks lause vägivallast ; Jalutuskäik varjuga ; Tuuline öö ; Liginev külm ; Viltune puri ; Näod ; Aovalgus ; Korraloomine ; Värdjate sünd ; Charoni vene ; Tõusul ; Leegihingaja ; Lähenev vaikus ; Teekond videvikul ; Pärg. Andmeid autori kohta lk. 87-88

  3. Status of the measurement of KS → πeν branching ratio and lepton charge asymmetry with the KLOE detector

    Directory of Open Access Journals (Sweden)

    Kamińska Daria

    2014-01-01

    Full Text Available We present the current status of the analysis of about 1.7 billion KS KL pair events collected at DAΦNE with the KLOE detector to determine the branching ratio of KS → πeν decay and the lepton charge asymmetry. This sample is ∼ 4 times larger in statistics than the one used in the previous most precise result, from KLOE as well, allowing us to improve the accuracy on the measurement and related tests of CPT symmetry and ∆S = ∆Q rule.

  4. Implementation of K-matrix formalism in the D0 -> K_s pi+ pi- amplitude model

    CERN Document Server

    Petrossian-Byrne, Rudin

    2014-01-01

    This report presents the work of a summer student project aimed at the implementation of a model for the decay amplitude of $D^0 \\rightarrow K_S \\pi^+ \\pi^-$ in the context of investigating mixing and CP violation in the charm sector. The analysis of this decay gives direct axis to the mixing parameters $x$ and $y$ which can be measured by fitting the model constructed to data. Decay dynamics are understood in terms of resonances, which can as a first aproximation be parametrised by Breit-Wigner curves, failing however to always respect unitarity. To avoid this problem the so-called K-matrix formalism with Production vector is implemented by the student as part of an alternative model making use of techniques from scattering theory. The implementation is done in the framework of a fitter written in CUDA designed to run on a GPU.

  5. Model-independent measurement of mixing parameters in $D^0 \\to K_S^0 \\pi^+ \\pi^-$ decays

    CERN Document Server

    Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Ruscio, Francesco; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fohl, Klaus; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Edmund; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefkova, Slavorima; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zucchelli, Stefano

    2016-04-06

    The first model-independent measurement of the charm mixing parameters in the decay $D^0 \\to K_S \\pi^+ \\pi^-$ is reported, using a sample of $pp$ collision data recorded by the LHCb experiment, corresponding to an integrated luminosity of 1.0 fb$^{-1}$ at a centre-of-mass energy of 7 TeV. The measured values are \\begin{eqnarray*} x &=& ( -0.86 \\pm 0.53 \\pm 0.17 ) \\times 10^{-2}, \\\\ y &=& ( +0.03 \\pm 0.46 \\pm 0.13 ) \\times 10^{-2}, \\end{eqnarray*} where the first uncertainties are statistical and include small contributions due to the external input for the strong phase measured by the CLEO collaboration, and the second uncertainties are systematic.

  6. C57BL/KsJ-db/db-ApcMin/+ Mice Exhibit an Increased Incidence of Intestinal Neoplasms

    Directory of Open Access Journals (Sweden)

    Yoshinobu Hirose

    2011-11-01

    Full Text Available The numbers of obese people and diabetic patients are ever increasing. Obesity and diabetes are high-risk conditions for chronic diseases, including certain types of cancer, such as colorectal cancer (CRC. The aim of this study was to develop a novel animal model in order to clarify the pathobiology of CRC development in obese and diabetic patients. We developed an animal model of obesity and colorectal cancer by breeding the C57BL/KsJ-db/db (db/db mouse, an animal model of obesity and type II diabetes, and the C57BL/6J-ApcMin/+ (Min/+ mouse, a model of familial adenomatous polyposis. At 15 weeks of age, the N9 backcross generation of C57BL/KsJ-db/db-ApcMin/+ (db/db-Min/+ mice developed an increased incidence and multiplicity of adenomas in the intestinal tract when compared to the db/m-Min/+ and m/m-Min/+ mice. Blood biochemical profile showed significant increases in insulin (8.3-fold to 11.7-fold, cholesterol (1.2-fold to 1.7-fold, and triglyceride (1.2-fold to 1.3-fold in the db/db-Min/+ mice, when compared to those of the db/m-Min/+ and m/m-Min/+ mice. Increases (1.4-fold to 2.6-fold in RNA levels of insulin-like growth factor (IGF-1, IRF-1R, and IGF-2 were also observed in the db/db-Min/+ mice. These results suggested that the IGFs, as well as hyperlipidemia and hyperinsulinemia, promoted adenoma formation in the db/db-Min/+ mice. Our results thus suggested that the db/db-Min/+ mice should be invaluable for studies on the pathogenesis of CRC in obese and diabetes patients and the therapy and prevention of CRC in these patients.

  7. New chronology for Ksâr 'Akil (Lebanon) supports Levantine route of modern human dispersal into Europe.

    Science.gov (United States)

    Bosch, Marjolein D; Mannino, Marcello A; Prendergast, Amy L; O'Connell, Tamsin C; Demarchi, Beatrice; Taylor, Sheila M; Niven, Laura; van der Plicht, Johannes; Hublin, Jean-Jacques

    2015-06-23

    Modern human dispersal into Europe is thought to have occurred with the start of the Upper Paleolithic around 50,000-40,000 y ago. The Levantine corridor hypothesis suggests that modern humans from Africa spread into Europe via the Levant. Ksâr 'Akil (Lebanon), with its deeply stratified Initial (IUP) and Early (EUP) Upper Paleolithic sequence containing modern human remains, has played an important part in the debate. The latest chronology for the site, based on AMS radiocarbon dates of shell ornaments, suggests that the appearance of the Levantine IUP is later than the start of the first Upper Paleolithic in Europe, thus questioning the Levantine corridor hypothesis. Here we report a series of AMS radiocarbon dates on the marine gastropod Phorcus turbinatus associated with modern human remains and IUP and EUP stone tools from Ksâr 'Akil. Our results, supported by an evaluation of individual sample integrity, place the EUP layer containing the skeleton known as "Egbert" between 43,200 and 42,900 cal B.P. and the IUP-associated modern human maxilla known as "Ethelruda" before ∼ 45,900 cal B.P. This chronology is in line with those of other Levantine IUP and EUP sites and demonstrates that the presence of modern humans associated with Upper Paleolithic toolkits in the Levant predates all modern human fossils from Europe. The age of the IUP-associated Ethelruda fossil is significant for the spread of modern humans carrying the IUP into Europe and suggests a rapid initial colonization of Europe by our species.

  8. Valitsus vaid tunnistas probleemi / Mai Treial

    Index Scriptorium Estoniae

    Treial, Mai, 1952-

    2001-01-01

    Ilmunud ka: Lääne Elu, 16. okt. 2001, lk. 4; Meie Maa, 17. okt. 2001, lk. 4; Virumaa Teataja, 18. okt. 2001, lk. 7; Järva Teataja, 20. okt. 2001, lk. 2; Koit, 18. okt. 2001, lk. 4; Võrumaa Teataja, 20. okt. 2001, lk. 2; Valgamaalane, 25. okt. 2001, lk. 2; Hiiu Leht, 26. okt. 2001, lk. 2; Pärnu Postimnees, 27. okt. 2001, lk. 2. Valitsus tunnistas probleemi, mis on seotud eakate pensionilisaga, kuid lahendusest loobus. Autor: ERL. Parlamendisaadik

  9. Astmeline tulumaks on vaid dekoratsioon / Villu Zirnask

    Index Scriptorium Estoniae

    Zirnask, Villu, 1966-

    2009-01-01

    OECD riikides on tulumaksu ülemised astmed enamasti üle 40%, kuid paljudes riikides võimaldavad erirežiimid teatud rühmadel maksta maksu madalama määra alusel. Rikaste inimeste maksustamise probleeme käsitlevast OECD raportist. Diagramm

  10. Ostetud saab vaid parim / Silvia Viidik

    Index Scriptorium Estoniae

    Viidik, Silvia, 1972-

    2010-01-01

    Maailma kaks suuremat kiibitootjat - Advanced Micro Devices ja Intel - alandasid oma kvartaliprognoose. Autor analüüsib, mis sellel turul toimub, ning ütleb, et enne tulemuste hooaega võiks infotehnoloogiasektorist huvitatud investor kaaluda pigem ettevõtteid, kes toodavad ka väga valivale kliendile sobivaid tooteid

  11. Haveli Invest pakub vaid majutust / Liina Leiten

    Index Scriptorium Estoniae

    Leiten, Liina

    2003-01-01

    Majutusasutuste TOP 40 1. koht. Metropoli hotelli haldava Haveli Invest OÜ tegevjuht Ruve Rääsk peab ettevõtte iseärasuseks võrreldes teiste majutusasutustega keskendumist majutusteenuse pakkumisele. Ülevaade hotelli kliendigruppidest, klienditeenindusest, asukoha eelistest ja tegevusplaanidest. Diagramm: Tänavu ootab Haveli Invest väiksemat kasumit

  12. Egiptus - seni vaid lubaduste maa / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2011-01-01

    Egiptuse president Hosni Mubarak on tagasi astunud ja võim on nüüd kõrgeima sõjanõukogu juhi Muhammad Hussain Tantawi käes, kes on lasknud juba rahva vastu ka füüsilist jõudu kasutada. Senisele võimueliidile on kehtestatud riigist lahkumise keeld, parlament on laiali saadetud ja põhiseaduse kehtivus on peatatud. Edaspidistest arenguvõimalustest ja mulluste parlamendivalimiste tulemustest

  13. Sõjas maksab vaid hetk / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2005-01-01

    1997.a. surnud USA režissööri Samuel Fulleri 1980.a. valminud sõjafilm "Võitmatu esimene diviis" ("Big Red One"), mis rekonstrueeriti 2004.a. autoriversioonile vastavamaks Richard Schickeli juhtimisel

  14. Comparison of NIRS0S Ks -band and S4G 3.6 micron data: Fourier amplitudes, force profiles and color maps

    Science.gov (United States)

    Salo, Heikki; Laurikainen, Eija

    2015-03-01

    Near-IR observations are considered to give an extinction-free view of the old stellar population in galaxies, thus ideal for the analysis of gravitational torques associated with bar and spiral structures. In the past, H or Ks band data have often been employed (Buta et al. 2010, Salo et al. 2010). S4G (Spitzer Survey of Stellar Structure in Galaxies, Sheth et al. 2010) provides new deep homogenious 3.6 and 4.5 micron data for over 2000 nearby galaxies, allowing to probe the bar and spiral properties over a wide range of morphological types and environments. Here we compare the Fourier-amplitude profiles derived from S4G data for about 50 early-type disk galaxies (SO and S0/a), with those from NIRSOS Ks data (Near-IR S0 Survey, Laurikainen et al. 2011). We also make detailed Ks -3.6 micron color maps. Interestingly, nuclear ring features stand up very clearly in these maps, indicating significantly different contributions of recent star formation in the Ks and 3.6 micron bands. However, the effect of these detailed differences on the overall force profiles is fairly small: this confirms that the S4G data can be confidently used for estimation of bar torques.

  15. Measurement of CP violation and constraints on the CKM angle γ in B±→DK± with D→KS0π+π− decays

    Directory of Open Access Journals (Sweden)

    R. Aaij

    2014-11-01

    where the first uncertainty is statistical, the second systematic and the third arises from the uncertainty of the D→KS0π+π− amplitude model. The value of γ is determined to be (84−42+49°, including all sources of uncertainty. Neutral D meson mixing is found to have negligible effect.

  16. Long QT mutations at the interface between KCNQ1 helix C and KCNE1 disrupt I(KS) regulation by PKA and PIP₂.

    Science.gov (United States)

    Dvir, Meidan; Strulovich, Roi; Sachyani, Dana; Ben-Tal Cohen, Inbal; Haitin, Yoni; Dessauer, Carmen; Pongs, Olaf; Kass, Robert; Hirsch, Joel A; Attali, Bernard

    2014-09-15

    KCNQ1 and KCNE1 co-assembly generates the I(KS) K(+) current, which is crucial to the cardiac action potential repolarization. Mutations in their corresponding genes cause long QT syndrome (LQT) and atrial fibrillation. The A-kinase anchor protein, yotiao (also known as AKAP9), brings the I(KS) channel complex together with signaling proteins to achieve regulation upon β1-adrenergic stimulation. Recently, we have shown that KCNQ1 helix C interacts with the KCNE1 distal C-terminus. We postulated that this interface is crucial for I(KS) channel modulation. Here, we examined the yet unknown molecular mechanisms of LQT mutations located at this intracellular intersubunit interface. All LQT mutations disrupted the internal KCNQ1-KCNE1 intersubunit interaction. LQT mutants in KCNQ1 helix C led to a decreased current density and a depolarizing shift of channel activation, mainly arising from impaired phosphatidylinositol-4,5-bisphosphate (PIP2) modulation. In the KCNE1 distal C-terminus, the LQT mutation P127T suppressed yotiao-dependent cAMP-mediated upregulation of the I(KS) current, which was caused by reduced KCNQ1 phosphorylation at S27. Thus, KCNQ1 helix C is important for channel modulation by PIP2, whereas the KCNE1 distal C-terminus appears essential for the regulation of IKS by yotiao-mediated PKA phosphorylation. © 2014. Published by The Company of Biologists Ltd.

  17. First observation of the decay $K_{S} \\to \\pi^{0}\\mu^{+}\\mu^{-}$ at the NA48 experiment at CERN

    CERN Document Server

    Fonseca, Martin Maria Teresa

    2005-01-01

    A search for the KS → π 0μ+μ− decay was performed by the NA48/1 Collaboration at the CERN SPS accelerator. Six events were found with a background expectation of 0.22+0.18-0.11 in the data collected in 2002 from the high-intensity K S run. The measured branching ratio is: BR( KS → π0μ+μ −) = [ 2.9+1.5- 1.2 (stat) ± 0.2(syst)] × 10−9, assuming that only vector currents contribute to the matrix element, and a unit form factor. Currently, this channel has the lowest branching ratio ever measured for KS decays. The understanding of the backgrounds and the development of an event selection that guaranteed a low background without killing the signal were the main challenges of this analysis. The determination of the KS → π0μ +μ− branching ratio was the missing piece to have a reliable Standard Model prediction for the CP violating KL → π0μ...

  18. Draft Genome Sequence of the Hydrocarbon-Degrading Bacterium Alcanivorax dieselolei KS-293 Isolated from Surface Seawater in the Eastern Mediterranean Sea

    KAUST Repository

    Barbato, Marta

    2015-12-10

    We report here the draft genome sequence of Alcanivorax dieselolei KS-293, a hydrocarbonoclastic bacterium isolated from the Mediterranean Sea, by supplying diesel oil as the sole carbon source. This strain contains multiple putative genes associated with hydrocarbon degradation pathways and that are highly similar to those described in A. dieselolei type strain B5.

  19. Low fertility awareness in United States reproductive-aged women and medical trainees: creation and validation of the Fertility & Infertility Treatment Knowledge Score (FIT-KS).

    Science.gov (United States)

    Kudesia, Rashmi; Chernyak, Elizabeth; McAvey, Beth

    2017-10-01

    To create, validate, and use a fertility awareness survey based on current U.S. Cross-sectional study. Not applicable. Phase 1 included U.S. women ages 18-45; phase 2 included female medical students and obstetrics and gynecology trainees at two urban academic programs. Survey including demographics, the Fertility & Infertility Treatment Knowledge Score (FIT-KS) instrument, and General Nutrition Knowledge Questionnaire. Knowledge of natural fertility and infertility treatments. The FIT-KS was validated through detailed item and validity analyses. In phase 1, 127 women participated; their median age was 31 years, and 43.7% had children. Their mean FIT-KS score was 16.2 ± 3.5 (55.9% correct). In phase 2, 118 medical trainees participated; their median age was 25 years, and 12.4% had children. Their mean FIT-KS score was 18.8 ± 2.1 (64.9% correct), with year of training correlating to a higher score (r=0.40). Participant awareness regarding lifestyle factors varied, but it was particularly low regarding the effects of lubricants. The majority underestimated the spontaneous miscarriage rate and overestimated the fecundability of 40-year-old women. There was general overestimation of success rates for assisted reproductive technologies, particularly among medical trainees. The FIT-KS is validated to current U.S. data for use in both general and medical populations as a quick assessment of fertility knowledge. The knowledge gaps demonstrated in this study correlate with national trends in delayed childbearing and time to initiate treatment. For medical trainees, these results raise concerns about the quality of fertility counseling they may be able to offer patients. Greater educational outreach must be undertaken to enhance fertility awareness. Copyright © 2017 American Society for Reproductive Medicine. Published by Elsevier Inc. All rights reserved.

  20. Tipptasemel infotehnoloogia, iidsete paleede ja kerjuste vabariik / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2005-01-01

    India majanduskasv oli 2003. aastal 8%, kuid sellest saavad osa vaid vähesed India elanikud. Põllumajanduse osakaalu vähenedes ei ole selle asemele tulnud mitte tööstus, vaid teenuste sektor. Riigi üks suurimaid probleeme on infrastruktuuri nõrkus. Andmeid kirjaoskuse, keskmise vanuse kohta. Lisa: Tata trügib sõiduautoturule

  1. Efficacy of imidacloprid + moxidectin and selamectin topical solutions against the KS1 Ctenocephalides felis flea strain infesting cats

    Directory of Open Access Journals (Sweden)

    Dryden Michael W

    2011-09-01

    Full Text Available Abstract Background Two studies were conducted to evaluate and compare the efficacy of imidacloprid + moxidectin and selamectin topical solutions against the KS1 flea strain infesting cats. In both studies the treatment groups were comprised of non-treated controls, 6% w/v selamectin (Revolution®; Pfizer Animal Health topical solution and 10% w/v imidacloprid + 1% w/v moxidectin (Advantage Multi® for Cats, Bayer Animal Health topical solution. All cats were infested with 100 fleas on Days -2, 7, 14, 21, and 28. The difference in the studies was that in study #1 efficacy evaluations were conducted at 24 and 48 hours post-treatment or post-infestation, and in study #2 evaluations were conducted at 12 and 24 hours. Results In study #1 imidacloprid + moxidectin and the selamectin formulation provided 99.8% and 99.0% efficacy at 24 hours post-treatment. On day 28, the 24 hour efficacy of the selamectin formulation dropped to 87.1%, whereas the imidacloprid + moxidectin formulation provided 98.9% efficacy. At the 48 hour assessments following the 28 day infestations, efficacy of the imidacloprid + moxidectin and selamectin formulations was 96.8% and 98.3% respectively. In study # 2 the efficacy of the imidacloprid + moxidectin and selamectin formulations 12 hours after treatment was 100% and 69.4%, respectively. On day 28, efficacy of the imidacloprid + moxidectin and selamectin formulations 12 hours after infestation was 90.2% and 57.3%, respectively. In study #2 both formulations provided high levels of efficacy at the 24 hour post-infestation assessments, with selamectin and imidacloprid + moxidectin providing 95.3% and 97.5% efficacy, following infestations on day 28. Conclusions At the 24 and 48 hour residual efficacy assessments, the imidacloprid + moxidectin and selamectin formulations were similarly highly efficacious. However, the imidacloprid + moxidectin formulation provided a significantly higher rate of flea kill against the KS1 flea

  2. Folk food and medicinal botanical knowledge among the last remaining Yörüks of the Balkans

    Directory of Open Access Journals (Sweden)

    Anely Nedelcheva

    2017-03-01

    Full Text Available The present study examines the current lifestyle of the last remaining Balkan Yörüks, a small and isolated group found within the Republic of Macedonia, and the modern representatives of an important portion of the Balkan nomads. The aim of this study was to document knowledge concerning local wild food plants and wild and cultivated medicinal plants, and to compare the Yörük ethnobotany with that of similar, more or less isolated ethnic groups occurring in the Balkan region (Macedonia, Bulgaria, Albania, and Turkey in order to assess how cultural adaptation processes may have affected Yörük plant folklore. We conducted this study by means of detailed, semi-structured interviews with 48 key informants. Sixty-seven plant taxa were recorded from 55 genera, based on the compilation of more than 150 reports relating to medicinal, food, forage, ornamental, and dye plants, as well as some elements relating to animals and minerals. Our field study data show several major ethnic boundary markers that contribute to the homogeneity of the community and also distinguish it sufficiently from the surrounding society: (i well-isolated locality; (ii local dialect and endogamy; (iii casual clothing worn by women; (iv ceremonial jewelry: a necklace of cloves (Syzygium aromaticum; (v Sempervivum marmoreum as an only ornamental plant which also has a medicinal use; and (vi Mentha spicata as the dominant culinary herb, which has a medicinal use too. Comparison of the collected ethnobotanical data with that of similar, more or less isolated ethnic groups in the Balkan region shows that overlapping taxa include mainly plants whose fresh fruit are used; both nuts as well as edible greens. These plants are simultaneously used for medicinal purposes too, as home remedies, but in very different ways to other ethnic groups. Yörüks represent a remarkable cultural group in the Balkans. This community has nomadic traditions, but nowadays the people have a settled

  3. Pitavastatin suppresses diethylnitrosamine-induced liver preneoplasms in male C57BL/KsJ-db/db obese mice

    Directory of Open Access Journals (Sweden)

    Kochi Takahiro

    2011-06-01

    Full Text Available Abstract Background Obesity and related metabolic abnormalities, including inflammation and lipid accumulation in the liver, play a role in liver carcinogenesis. Adipocytokine imbalances, such as decreased serum adiponectin levels, are also involved in obesity-related liver tumorigenesis. In the present study, we examined the effects of pitavastatin - a drug used for the treatment of hyperlipidemia - on the development of diethylnitrosamine (DEN-induced liver preneoplastic lesions in C57BL/KsJ-db/db (db/db obese mice. Methods Male db/db mice were administered tap water containing 40 ppm DEN for 2 weeks and were subsequently fed a diet containing 1 ppm or 10 ppm pitavastatin for 14 weeks. Results At sacrifice, feeding with 10 ppm pitavastatin significantly inhibited the development of hepatic premalignant lesions, foci of cellular alteration, as compared to that in the untreated group by inducing apoptosis, but inhibiting cell proliferation. Pitavastatin improved liver steatosis and activated the AMPK-α protein in the liver. It also decreased free fatty acid and aminotransferases levels, while increasing adiponectin levels in the serum. The serum levels of tumor necrosis factor (TNF-α and the expression of TNF-α and interleukin-6 mRNAs in the liver were decreased by pitavastatin treatment, suggesting attenuation of the chronic inflammation induced by excess fat deposition. Conclusions Pitavastatin is effective in inhibiting the early phase of obesity-related liver tumorigenesis and, therefore, may be useful in the chemoprevention of liver cancer in obese individuals.

  4. First model-independent Dalitz analysis of B→DK, D→KS0ππ decay

    Science.gov (United States)

    Negishi, K.; Ishikawa, A.; Yamamoto, H.; Abdesselam, A.; Adachi, I.; Aihara, H.; Al Said, A.; Asner, D. M.; Aulchenko, V.; Aushev, T.; Ayad, R.; Babu, V.; Badhrees, I.; Bahinipati, S.; Bakich, A. M.; Barberio, E.; Biswal, J.; Bonvicini, G.; Bozek, A.; Bračko, M.; Browder, T. E.; Chekelian, V.; Chen, A.; Cheon, B. G.; Chilikin, K.; Chistov, R.; Cho, K.; Chobanova, V.; Choi, S.-K.; Choi, Y.; Cinabro, D.; Dalseno, J.; Danilov, M.; Doležal, Z.; Drutskoy, A.; Dutta, D.; Eidelman, S.; Farhat, H.; Fast, J. E.; Ferber, T.; Fulsom, B. G.; Gaur, V.; Gabyshev, N.; Garmash, A.; Getzkow, D.; Gillard, R.; Glattauer, R.; Goh, Y. M.; Goldenzweig, P.; Golob, B.; Grzymkowska, O.; Haba, J.; Hara, T.; Hayasaka, K.; Hayashii, H.; He, X. H.; Horiguchi, T.; Hou, W.-S.; Iijima, T.; Inami, K.; Itoh, R.; Iwasaki, Y.; Jaegle, I.; Joffe, D.; Joo, K. K.; Julius, T.; Kang, K. H.; Kawasaki, T.; Kiesling, C.; Kim, D. Y.; Kim, J. B.; Kim, J. H.; Kim, K. T.; Kim, M. J.; Kim, S. H.; Kim, Y. J.; Kinoshita, K.; Ko, B. R.; Kodyš, P.; Korpar, S.; Križan, P.; Krokovny, P.; Kumita, T.; Kuzmin, A.; Kwon, Y.-J.; Lange, J. S.; Lee, I. S.; Lewis, P.; Li, Y.; LiGioi, L.; Libby, J.; Liventsev, D.; Lukin, P.; Masuda, M.; Matvienko, D.; Miyabayashi, K.; Miyata, H.; Mizuk, R.; Mohanty, G. B.; Moll, A.; Moon, H. K.; Mussa, R.; Nakao, M.; Nanut, T.; Natkaniec, Z.; Nayak, M.; Nisar, N. K.; Nishida, S.; Ogawa, S.; Okuno, S.; Onuki, Y.; Pakhlov, P.; Pakhlova, G.; Pal, B.; Park, C. W.; Park, H.; Pedlar, T. K.; Pesántez, L.; Pestotnik, R.; Petrič, M.; Piilonen, L. E.; Pulvermacher, C.; Ribežl, E.; Ritter, M.; Rostomyan, A.; Sakai, Y.; Sandilya, S.; Santelj, L.; Sanuki, T.; Sato, Y.; Savinov, V.; Schneider, O.; Schnell, G.; Schwanda, C.; Senyo, K.; Sevior, M. E.; Shebalin, V.; Shen, C. P.; Shibata, T.-A.; Shiu, J.-G.; Simon, F.; Sohn, Y.-S.; Solovieva, E.; Stanič, S.; Starič, M.; Steder, M.; Sumihama, M.; Sumiyoshi, T.; Tamponi, U.; Teramoto, Y.; Uchida, M.; Unno, Y.; Uno, S.; Urquijo, P.; Van Hulse, C.; Vanhoefer, P.; Varner, G.; Vinokurova, A.; Vossen, A.; Wagner, M. N.; Wang, C. H.; Wang, M.-Z.; Wang, P.; Wang, X. L.; Watanabe, M.; Watanabe, Y.; Wehle, S.; Williams, M. K.; Won, E.; Yamaoka, J.; Yamashita, Y.; Yashchenko, S.; Yelton, J.; Yook, Y.; Yuan, C. Z.; Yusa, Y.; Zhang, Z. P.; Zhilich, V.; Zhulanov, V.; Zupanc, A.

    2016-04-01

    We report a measurement of the amplitude ratio r_S of B^0 to D^0K^{ast 0} and B^0 to bar {D^0}K^{ast 0} decays with a Dalitz analysis of Dto K_S^0π ^+π ^- decays, for the first time using a model-independent method. We set an upper limit r_S < 0.87 at the 68% confidence level, using the full data sample of 711 fb^{-1} corresponding to 772× 10^6 Bbar {B} pairs collected at the Upsilon (4S) resonance with the Belle detector at the KEKB e^+e^- collider. This result is obtained from observables x_- = +0.4 ^{+1.0 +0.0}_{-0.6 -0.1} ± 0.0, y_- = -0.6 ^{+0.8 +0.1}_{-1.0 -0.0} ± 0.1, x_+ = +0.1 ^{+0.7 +0.0}_{-0.4 -0.1} ± 0.1, and y_+ = +0.3 ^{+0.5 +0.0}_{-0.8 -0.1} ± 0.1, where x_± = r_S cos (δ _S ± φ _3), y_± = r_S sin (δ _S ± φ _3), and φ _3 (δ _S) is the weak (strong) phase difference between B^0 to D^0K^{ast 0} and B^0 to bar {D^0}K^{ast 0}.

  5. Metformin suppresses diethylnitrosamine-induced liver tumorigenesis in obese and diabetic C57BL/KsJ-+Leprdb/+Leprdb mice.

    Directory of Open Access Journals (Sweden)

    Tomohiko Ohno

    Full Text Available Obesity and related metabolic disorders, such as diabetes mellitus, raise the risk of liver carcinogenesis. Metformin, which is widely used in the treatment of diabetes, ameliorates insulin sensitivity. Metformin is also thought to have antineoplastic activities and to reduce cancer risk. The present study examined the preventive effect of metformin on the development of diethylnitrosamine (DEN-induced liver tumorigenesis in C57BL/KsJ-+Leprdb/+Leprdb (db/db obese and diabetic mice. The mice were given a single injection of DEN at 2 weeks of age and subsequently received drinking water containing metformin for 20 weeks. Metformin administration significantly reduced the multiplicity of hepatic premalignant lesions and inhibited liver cell neoplasms. Metformin also markedly decreased serum levels of insulin and reduced insulin resistance, and inhibited phosphorylation of Akt, mammalian target of rapamycin (mTOR, and p70S6 in the liver. Furthermore, serum levels of leptin were decreased, while those of adiponectin were increased by metformin. These findings suggest that metformin prevents liver tumorigenesis by ameliorating insulin sensitivity, inhibiting the activation of Akt/mTOR/p70S6 signaling, and improving adipokine imbalance. Therefore, metformin may be a potent candidate for chemoprevention of liver tumorigenesis in patients with obesity or diabetes.

  6. Effect of Calcium and Boron Foliar Application on Fruit Quality in Asian Pear Cultivar ‘KS10’

    Directory of Open Access Journals (Sweden)

    K. Khalaj

    2015-03-01

    Full Text Available Calcium and boron as plant nutritional elements play major roles in plant physiological processes including regulating various cell and plant functions. Considering the importance of both elements, this study was conducted during 2010-2011 in the Experimental Asian Pear Orchard at Faculty of Agriculture, Tarbiat Modares University. Different concentrations of calcium chloride (0, 0.5 and 0.7 percent and acid boric (0 and 0.5 percent were used as foliar spray of Asian pear cultivar "KS10" during growing season. The results showed that foliar application of calcium and boron led to the improvement in physicochemical characteristics of pear fruits. Under treatment conditions, fruit tissue hardness increased, while total soluble solids decreased. Various concentrations of calcium resulted in decreasing fruit softening, although after 3-months' storage all treatments showed low fruit firmness. Total phenolic compounds decreased more significantly in control fruits compared to in fruits sprayed with calcium and/or boron during the storage. The highest and lowest levels of polyphenol oxidase activity were found in elements-sprayed fruits and non-sprayed ones respectively. In brief, calcium and boron application resulted in improving postharvest characteristics of Asian pear fruits and reducing internal browning symptoms.

  7. KaKs_Calculator 2.0: A Toolkit Incorporating Gamma-Series Methods and Sliding Window Strategies

    KAUST Repository

    Wang, Dapeng

    2010-05-05

    We present an integrated stand-alone software package named KaKs_Calculator 2.0 as an updated version. It incorporates 17 methods for the calculation of nonsynonymous and synonymous substitution rates; among them, we added our modified versions of several widely used methods as the gamma series including γ-NG, γ-LWL, γ-MLWL, γ-LPB, γ-MLPB, γ-YN and γ-MYN, which have been demonstrated to perform better under certain conditions than their original forms and are not implemented in the previous version. The package is readily used for the identification of positively selected sites based on a sliding window across the sequences of interests in 5\\' to 3\\' direction of protein-coding sequences, and have improved the overall performance on sequence analysis for evolution studies. A toolbox, including C++ and Java source code and executable files on both Windows and Linux platforms together with a user instruction, is downloadable from the website for academic purpose at https://sourceforge.net/projects/kakscalculator2/.

  8. Measurement of the neutral D meson mixing parameters in $D^0 \\rightarrow K_S \\pi^+\\pi^-$ decays.

    CERN Document Server

    Pilař, Tomas; Kreps, Michal; Charles, Matthew; Harrison, Paul

    A model-independent measurement of the charm mixing parameters $x_D$ and $y_D$ in the $D^0 \\rightarrow K_S \\pi^+\\pi^-$ decay mode is presented. The method uses ratios of yields in symmetric bins of the Dalitz plot and is binned in decay time. This is an alternative approach that does not require the knowledge of the phase-space model of the decay. It also preserves good sensitivity to $x_D$ and to the relative sign between $x_D$ and $y_D$. Charm mixing parameters are an important step to measuring CP violation in charm mixing. The measured values of the mixing parameters are $x_D = (1.89 \\pm 0.43 \\pm 0.21 \\pm 0.51) \\%$ and $y_D = (-2.59 \\pm 1.36 \\pm 1.13 \\pm 3.12) \\%$ where the uncertainties are statistical, systematic, and due to input parameters respectively.

  9. Unbundling key to LNG

    Index Scriptorium Estoniae

    2011-01-01

    11. veebruaril Vihulas toimunud Balti ministrite nõukogu peaministrite mitteametlikul kohtumisel väitis peaminister Andrus Ansip, et Balti riikidesse mahuks vaid üks, kuid väga efektiivne veeldatud gaasi terminal

  10. Noored said Tallinna volikokku / Tarmo Lausing

    Index Scriptorium Estoniae

    Lausing, Tarmo

    2005-01-01

    Ilmunud ka: Molodjozh Estonii 1. nov. lk. 4. Keskerakonna seitsmest noorest poliitikust said Tallinna volikogudesse sisse kuus otsemandaadiga ning vaid üks asendusliikmena. Kesk- ja Reformerakonna Tallinna linnavolikokku saanud noored saadikud

  11. Morten Kirckhoff / Morten Kirckhoff ; interv. Oksana Kostina

    Index Scriptorium Estoniae

    Kirckhoff, Morten

    2006-01-01

    Maailma üks hinnatumaid internetiturunduse gurusid ütleb, et tähtis pole mitte kulutada suuri summasid reklaamikampaaniatele, vaid uurida sihtrühma, et teada saada, kuidas selle tähelepanu äratada

  12. Toru ja selle sisu / Igor Gräzin, Aivar Kokk

    Index Scriptorium Estoniae

    Gräzin, Igor, 1952-

    2007-01-01

    Eesti gaasiturul puudub nii konkurents kui ka Eesti rahvuslikke huve arvestav ettevõte. Gaasi hinna probleemi üks lahendusi oleks autorite hinnangul gaasi otsene ostmine mitte Gazpromilt, vaid Kesk-Aasiast

  13. Reductive activation of the prodrug 1,2-bis(methylsulfonyl)-1-(2-chloroethyl)-2-[[1-(4-nitrophenyl)ethoxy]carbonyl]hydrazine (KS119) selectively occurs in oxygen-deficient cells and overcomes O(6)-alkylguanine-DNA alkyltransferase mediated KS119 tumor cell resistance.

    Science.gov (United States)

    Baumann, Raymond P; Penketh, Philip G; Ishiguro, Kimiko; Shyam, Krishnamurthy; Zhu, Yong L; Sartorelli, Alan C

    2010-06-01

    1,2-Bis(methylsulfonyl)-1-(2-chloroethyl)-2-[[1-(4-nitrophenyl)ethoxy]carbonyl]hydrazine (KS119) is a prodrug of the 1,2-bis(sulfonyl)hydrazine class of antineoplastic agents designed to exploit the oxygen-deficient regions of cancerous tissue. Thus, under reductive conditions in hypoxic cells this agent decomposes to produce the reactive intermediate 1,2-bis(methylsulfonyl)-1-(2-chloroethyl)hydrazine (90CE), which in turn generates products that alkylate the O(6)-position of guanine in DNA. Comparison of the cytotoxicity of KS119 in cultured cells lacking O(6)-alkylguanine-DNA alkyltransferase (AGT) to an agent such as Onrigin, which through base catalyzed activation produces the same critical DNA G-C cross-link lesions by the generation of 90CE, indicates that KS119 is substantially more potent than Onrigin under conditions of oxygen deficiency, despite being incompletely activated. In cell lines expressing relatively large amounts of AGT, the design of the prodrug KS119, which requires intracellular activation by reductase enzymes to produce a cytotoxic effect, results in an ability to overcome resistance derived from the expression of AGT. This appears to derive from the ability of a small portion of the chloroethylating species produced by the activation of KS119 to slip through the cellular protection afforded by AGT to generate the few DNA G-C cross-links that are required for tumor cell lethality. The findings also demonstrate that activation of KS119 under oxygen-deficient conditions is ubiquitous, occurring in all of the cell lines tested thus far, suggesting that the enzymes required for reductive activation of this agent are widely distributed in many different tumor types. 2010. Published by Elsevier Inc.

  14. INTEGRAL Galactic Bulge monitoring: transient activity from KS 1741-293, MXB 1730-335, and IGR J17498-2921

    DEFF Research Database (Denmark)

    Chenevez, Jérôme; Brandt, Søren; Kuulkers, E.

    2011-01-01

    As part of its regular monitoring of the Galactic Bulge (see ATel #438) INTEGRAL observed this region of the sky on September 13, 2011, between UTC 9:14:50 and 12:56:26. Both the JEM-X and the IBIS/ISGRI instruments detect the transient neutron star low-mass X-ray binary KS 1741-293 at the follow...

  15. Mācību rīks kursam "Mašīnorientētā programmēšana"

    OpenAIRE

    Ceiziņš, Kārlis

    2011-01-01

    Kvalifikācijas darbā „Mācību rīks kursam „Mašīnorientētā programmēšana”” aprakstīta ARMv5 platformai paredzēta assembler emulatora izstrāde. Rīks ir paredzēts, lai ļautu studentiem vieglāk izprast ARM platformu un tās darbības pamatprincipus, ļaujot lietotājiem gan izpildīt jau iepriekš sastādītas programmas, gan sastādīt jaunas. Rīks ir izstrādāts Delphi programmēšanas valodā. Izstrāde ir dokumentēta, un satur programmatūras prasību specifikāciju, prasību projektējumu un testēšanu....

  16. FLOODPLAIN, WYANDOTTE COUNTY, KS

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Floodplain Mapping/Redelineation study deliverables depict and quantify the flood risks for the study area. The primary risk classifications used are the...

  17. HYDROLOGY, HARVEYCOUNTY, KS USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydrology data include spatial datasets and data tables necessary for documenting the hydrologic procedures for estimating flood discharges for a flood insurance...

  18. Viisavabadus sai Bushi ja Ilvese kohtumise üheks peateemaks / Neeme Raud, Maili Kangur

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 26. juuni 2007, lk. 2. USA president George W. Bush ja Eesti president Toomas Hendrik Ilves rääkisid Valge Maja ovaalkabinetis toimunud kohtumisel viisaküsimustest, küberkaitsest, Eesti sõdurite panusest Iraagis ja Afganistanis. Presidendid sõid ühiselt lõunat, T.H. Ilves asetas pärja Washingtonis äsja avatud kommunismiohvrite mälestusmärgile ning kohtus ajalehe Washington Post toimetuse kolleegiumiga. Presidentide kohtumise kohta avaldavad arvamust Riigikogu liikmed Sven Mikser ja Keit Pentus. Vabariigi President töövisiidil Ameerika Ühendriikides 25.-26.06.2007

  19. Viisavabadus USA-ga läheneb vaidlustes / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2008-01-01

    USA soovib Eesti kodanike viisanõudest vabastamiseks kõrgendatud turvameetmeid. Viisavabadust taotlev Tšehhi sõlmis USA-ga vastastikuse mõistmise memorandumi, EL-i nn. vanad liikmesriigid ja Euroopa Komisjon süüdistavad USA-ga kahepoolsete lepingute sõlmijaid Euroopa ühtsuse lõhestamises. Lisa: Eesti sõlmib lepingu ilmselt märtsi keskel

  20. Insights into Nitrate-Reducing Fe(II) Oxidation Mechanisms through Analysis of Cell-Mineral Associations, Cell Encrustation, and Mineralogy in the Chemolithoautotrophic Enrichment Culture KS.

    Science.gov (United States)

    Nordhoff, M; Tominski, C; Halama, M; Byrne, J M; Obst, M; Kleindienst, S; Behrens, S; Kappler, A

    2017-07-01

    Most described nitrate-reducing Fe(II)-oxidizing bacteria (NRFeOB) are mixotrophic and depend on organic cosubstrates for growth. Encrustation of cells in Fe(III) minerals has been observed for mixotrophic NRFeOB but not for autotrophic phototrophic and microaerophilic Fe(II) oxidizers. So far, little is known about cell-mineral associations in the few existing autotrophic NRFeOB. Here, we investigate whether the designated autotrophic Fe(II)-oxidizing strain (closely related to Gallionella and Sideroxydans) or the heterotrophic nitrate reducers that are present in the autotrophic nitrate-reducing Fe(II)-oxidizing enrichment culture KS form mineral crusts during Fe(II) oxidation under autotrophic and mixotrophic conditions. In the mixed culture, we found no significant encrustation of any of the cells both during autotrophic oxidation of 8 to 10 mM Fe(II) coupled to nitrate reduction and during cultivation under mixotrophic conditions with 8 to 10 mM Fe(II), 5 mM acetate, and 4 mM nitrate, where higher numbers of heterotrophic nitrate reducers were present. Two pure cultures of heterotrophic nitrate reducers (Nocardioides and Rhodanobacter) isolated from culture KS were analyzed under mixotrophic growth conditions. We found green rust formation, no cell encrustation, and only a few mineral particles on some cell surfaces with 5 mM Fe(II) and some encrustation with 10 mM Fe(II). Our findings suggest that enzymatic, autotrophic Fe(II) oxidation coupled to nitrate reduction forms poorly crystalline Fe(III) oxyhydroxides and proceeds without cellular encrustation while indirect Fe(II) oxidation via heterotrophic nitrate-reduction-derived nitrite can lead to green rust as an intermediate mineral and significant cell encrustation. The extent of encrustation caused by indirect Fe(II) oxidation by reactive nitrogen species depends on Fe(II) concentrations and is probably negligible under environmental conditions in most habitats.IMPORTANCE Most described nitrate

  1. SHBG-C57BL/ksJ-db/db: A New Mouse Model to Study SHBG Expression and Regulation During Obesity Development.

    Science.gov (United States)

    Saéz-López, Cristina; Rivera-Giménez, Marta; Hernández, Cristina; Simó, Rafael; Selva, David M

    2015-12-01

    Low plasma sex hormone-binding globulin (SHBG) levels in overweight individuals are a biomarker for the metabolic syndrome and are predictive of type 2 diabetes and cardiovascular disease risk. There are no in vivo models to study SHBG expression and regulation during obesity development. The main reason for this is that the obesity-prone rodent models cannot be used to study this issue, because rodents, unlike humans, do not express the SHBG gene in their livers. We have developed a unique mouse model that expresses the human SHBG, and it develops obesity, by crossing the human SHBG transgenic mice with the C57BL/ksJ-db/db mice. The results obtained with the SHBG-C57BL/ksJ-db/db mouse model have allowed us to determine that the SHBG overexpression in the C57BL/ksJ-db/db reduced the body weight gain but did not change the metabolic profile of these mice. Moreover, we elucidated the molecular mechanisms and transcription factors causing the SHBG down-regulation during obesity development, which involved changes in liver hepatocyte nuclear factor 4α and peroxisome proliferator-activated receptor-γ mRNA and protein levels. Furthermore, these results were confirmed using human liver biopsies. Importantly, we also showed that this model resembles what occurs in human obese subjects, because plasma SHBG and total testosterone levels where reduced in obese mice when compared with lean mice. Future research using this unique mouse model will determine the role of SHBG in the development and progression of obesity, type 2 diabetes, or fatty liver disease.

  2. First observation of quantum interference in the process phi -> KS KL ->pi+pi-pi+pi-: a test of quantum mechanics and CPT symmetry

    CERN Document Server

    Ambrosino, F; Antonelli, M; Bacci, C; Beltrame, P; Bencivenni, G; Bertolucci, S; Bini, C; Bloise, C; Bocchetta, S; Bocci, V; Bossi, F; Bowring, D; Branchini, P; Caloi, R; Campana, P; Capon, G; Capussela, T; Ceradini, F; Chi, S; Chiefari, G; Ciambrone, P; Conetti, S; De Lucia, E; De Santis, A; De Simone, P; De Zorzi, G; Dell'Agnello, S; Denig, A; Di Domenico, A; Di Donato, C; Di Falco, S; Di Micco, B; Doria, A; Dreucci, M; Felici, G; Ferrari, A; Ferrer, M L; Finocchiaro, G; Fiore, S; Forti, C; Franzini, P; Gatti, C; Gauzzi, P; Giovannella, S; Gorini, E; Graziani, E; Incagli, M; Kluge, W; Kulikov, V; Lacava, F; Lanfranchi, G; Lee-Franzini, J; Leone, D; Martini, M; Massarotti, P; Mei, W; Meola, S; Miscetti, S; Moulson, M; Müller, S; Murtas, F; Napolitano, M; Nguyen, F; Palutan, M; Pasqualucci, E; Passeri, A; Patera, V; Perfetto, F; Pontecorvo, L; Primavera, M; Santangelo, P; Santovetti, E; Saracino, G; Sciascia, B; Sciubba, A; Scuri, F; Sfiligoi, I; Sibidanov, A L; Spadaro, T; Testa, M; Tortora, L; Valente, P; Valeriani, B; Venanzoni, G; Veneziano, Stefano; Ventura, A; Versaci, R; Xu, G

    2006-01-01

    We present the first observation of quantum interference in the process phi -> KS KL ->pi+pi-pi+pi-. This analysis is based on data collected with the KLOE detector at the e^+e^- collider DAFNE in 2001--2002 for an integrated luminosity of about 380pb^-1. Fits to the distribution of Delta t, the difference between the two kaon decay times, allow tests of the validity of quantum mechanics and CPT symmetry. No deviations from the expectations of quantum mechanics and CPT symmetry have been observed. New or improved limits on various decoherence and CPT violation parameters have been obtained

  3. Measurement of CP violation in the analysis of $B^{\\,0} \\to J/\\psi K_s$ decays with the 2010 LHCb data

    CERN Document Server

    Weits, Hartger

    2012-01-01

    This thesis describes a measurement of the time dependent decay rate asym- metry in $B^{\\,0} \\to J/\\psi K_s$ decays with the 2010 LHCb data sample. The found value for S is 0.881$^{+0.334}_{-0.301}$, which is compatible with the current world average. A Monte Carlo study has been performed to investigate the lifetime resolution model. Furthermore two Goodness-of-Fit tests applied to the analysis gave a statistical significance of p = 0.477 and p = 0.812.

  4. Observation of $\\Bm \\to D^{(*)+}_s K^- \\pi^-$ and $\\bar{B^0} \\to D_s^{+} \\KS \\pi^-$ and Search for $\\bar{B^0} \\to D_s^{*+} \\KS \\pi^-$ and $B^- \\to D^{(*)+}_s K^- K^-$

    CERN Document Server

    Aubert, B; Boutigny, D; Karyotakis, Yu; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Garra Tico, J; Graugès-Pous, E; López, L; Palano, A; Eigen, G; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes-Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Ronan, M T; Tackmann, K; Wenzel, W A; Del Amo-Sánchez, P; Hawkes, C M; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Khan, A; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Liu, F; Long, O; Shen, B C; Zhang, L; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Williams, D C; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Gabareen, A M; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Brandt, T; Klose, V; Kobel, M J; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Lombardo, V; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Santoro, V; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bequilleux, J; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Paramesvaran, S; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Zheng, Y; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; De Nardo, Gallieno; Fabozzi, F; Lista, L; Monorchio, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Benelli, G; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gagliardi, N; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Calderini, G; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Leruste, P; Malcles, J; Ocariz, J; Pérez, A; Gladney, L; Biasini, M; Covarelli, R; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Carpinelli, M; Cenci, R; Cervelli, A; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Biesiada, J; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Baracchini, E; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Renga, F; Voena, C; Ebert, M; Hartmann, T; Schröder, H; Waldi, R; Adye, T; Castelli, G; Franek, B; Olaiya, E O; Ricciardi, S; Röthel, W; Wilson, F F; Aleksan, R; Emery, S; Escalier, M; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, W; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dunwoodie, W; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Hast, C; Hrynóva, T; Innes, W R; Kaminski, J; Kelsey, M H; Kim, H; Kim, P; Kocian, M L; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ofte, I; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Wagner, A P; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Ruland, A M; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Pelliccioni, M; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Milanes, D A; Oyanguren, A; Albert, J; Banerjee, Sw; Bhuyan, B; Hamano, K; Kowalewski, R; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Ilic, J; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Dasu, S; Flood, K T; Hollar, J J; Kutter, P E; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Neal, H

    2007-01-01

    We report on our search for $B^- \\to D^{(*)+}_s K^- \\pi^-$, $\\bar{B^0} \\to D_s^{(*)+} \\KS \\pi^-$, and $B^- \\to D^{(*)+}_s K^- K^-$ decays in 383 million Upsilon(4S) \\to B \\bar{B}$ events collected by the BABAR detector at the PEP2 asymmetric-energy $B$-factory. The branching fractions are measured to be ${\\cal B}(B^- \\to D^+_s K^- \\pi^-) = (2.02 \\pm 0.13_{stat} \\pm 0.38_{syst}) \\times 10^{-4},$ ${\\cal B}(B^- \\to D^{*+}_s K^- \\pi^-)= (1.67 \\pm 0.16_{stat} \\pm 0.35_{syst}) \\times 10^{-4},$ ${\\cal B}(\\bar{B^0} \\to D_s^{+} \\KS \\pi^-)= (0.55 \\pm 0.13_{stat} \\pm 0.10_{syst}) \\times 10^{-4},$ and ${\\cal B}(B^- \\to D_s^{+} K^- K^-) = (0.11 \\pm 0.04_{stat} \\pm 0.02_{syst}) \\times 10^{-4}$. Upper limits at the 90% C.L. are set on ${\\cal B}(\\bar{B^0} \\to D_s^{*+} \\KS \\pi^-)< 0.55 \\times 10^{-4}$ and ${\\cal B}(B^- \\to D_s^{*+} K^- K^-) < 0.15 \\times 10^{-4}.$

  5. Ketide Synthase (KS) Domain Prediction and Analysis of Iterative Type II PKS Gene in Marine Sponge-Associated Actinobacteria Producing Biosurfactants and Antimicrobial Agents.

    Science.gov (United States)

    Selvin, Joseph; Sathiyanarayanan, Ganesan; Lipton, Anuj N; Al-Dhabi, Naif Abdullah; Valan Arasu, Mariadhas; Kiran, George S

    2016-01-01

    The important biological macromolecules, such as lipopeptide and glycolipid biosurfactant producing marine actinobacteria were analyzed and their potential linkage between type II polyketide synthase (PKS) genes was explored. A unique feature of type II PKS genes is their high amino acid (AA) sequence homology and conserved gene organization. These enzymes mediate the biosynthesis of polyketide natural products with enormous structural complexity and chemical nature by combinatorial use of various domains. Therefore, deciphering the order of AA sequence encoded by PKS domains tailored the chemical structure of polyketide analogs still remains a great challenge. The present work deals with an in vitro and in silico analysis of PKS type II genes from five actinobacterial species to correlate KS domain architecture and structural features. Our present analysis reveals the unique protein domain organization of iterative type II PKS and KS domain of marine actinobacteria. The findings of this study would have implications in metabolic pathway reconstruction and design of semi-synthetic genomes to achieve rational design of novel natural products.

  6. Charmed Baryon Spectroscopy and Search for $CP$ Violation in $D^0 \\to K_S^0\\,\\pi^+\\,\\pi^-$ at CDF

    Energy Technology Data Exchange (ETDEWEB)

    Wick, Felix [Karlsruhe Inst. of Technology (Germany)

    2011-10-28

    In this thesis two different analyses are presented, namely the measurements of the properties of $\\Lambda_c(2595)^+$, $\\Lambda_c(2625)^+$, $\\Sigma_c(2455)^{++,0}$, and $\\Sigma_c(2520)^{++,0}$ baryons as well as the search for $CP$ violation in the Dalitz plot of the decay $D^0 \\to K_S^0\\,\\pi^+\\,\\pi^-$. Both studies are performed using data corresponding to 5.2\\,\\invfb respective 6.0\\,\\invfb of integrated luminosity from $p\\bar{p}$ collisions at a center-of-mass energy of 1.96\\,TeV, collected with the CDF~II detector at the Fermilab Tevatron. The masses and decay widths of the mentioned charmed baryon resonances are measured with uncertainties comparable to the world averages for $\\Sigma_c$ states, and significantly smaller uncertainties than the world averages for excited $\\Lambda_c^+$ states. No hints for any $CP$ violating effects in the resonant substructure of $D^0 \\to K_S^0\\,\\pi^+\\,\\pi^-$ are found.

  7. Coupled perturbed HF/KS calculation of the dielectric constant of crystalline systems. The case of six members of the garnet family

    Science.gov (United States)

    Meyer, A.; Ferrero, M.; Valenzano, L.; Zicovich-Wilson, C. M.; Orlando, R.; Dovesi, R.

    2012-12-01

    The dielectric constant ɛ of pyrope (Mg3Al2(SiO4)3), grossular (Ca3Al2(SiO4)3), andradite (Ca3Fe2(SiO4)3), almandine (Fe3Al2(SiO4)3), spessartine (Mn3Al2(SiO4)3), and uvarovite (Ca3Cr2(SiO4)3) garnets has been calculated by using for the first time the CPHF/KS computational scheme recently implemented in the CRYSTAL code. Garnets are large unit cell (80 atoms in the primitive cell) highly symmetric (Ia3¯d space group) compounds of relevant importance in geology and mineralogy. An all electron Gaussian type Basis Set has been adopted for all atoms. For the four compound containing transition metal atoms the unrestricted formulation of the HF or KS equations has been used. The Basis Set effect has been explored, as well as the influence of the adopted functional, that ranges from LDA to HF through GGA (PBE) and hybrids PBE0 and B3LYP.

  8. Teeme ära! kampaania prügi vedeleb juba viis aastat elamute külje all : Tartus Raadil asuvast umbes 15 000 tonnist prügist on maha müüdud vaid tühine kogus puitu, ülejäänu saatus on lahtine / Virkko Lepassalu ; kommenteerib Peeter Eek

    Index Scriptorium Estoniae

    Lepassalu, Virkko, 1971-

    2013-01-01

    2008. a Teeme ära! talgute partner, prügikäitlusfirma Utileek läks pankrotti, jättes prügikorjetalgute prügilaamad koristamata Tartus Raadil ja Tallinna lähedal Viimsis. Keskkonnaministeerium, kes Utileegi teiste prügikäitlusfirmade hulgast oma Teeme ära! partneriks valis, ei soovi tellida platside puhastamist

  9. Measurement of $K_S^0$ and $K^{*0}$ in $p$$+$$p$, $d$$+$Au, and Cu$+$Cu collisions at $\\sqrt{s_{_{NN}}}=200$ GeV

    CERN Document Server

    Adare, A; Aidala, C; Ajitanand, N N; Akiba, Y; Akimoto, R; Al-Bataineh, H; Alexander, J; Alfred, M; Angerami, A; Aoki, K; Apadula, N; Aphecetche, L; Aramaki, Y; Armendariz, R; Aronson, S H; Asai, J; Asano, H; Atomssa, E T; Averbeck, R; Awes, T C; Azmoun, B; Babintsev, V; Bai, M; Baksay, G; Baksay, L; Baldisseri, A; Bandara, N S; Bannier, B; Barish, K N; Barnes, P D; Bassalleck, B; Basye, A T; Bathe, S; Batsouli, S; Baublis, V; Baumann, C; Bazilevsky, A; Beaumier, M; Beckman, S; Belikov, S; Belmont, R; Bennett, R; Berdnikov, A; Berdnikov, Y; Bhom, J H; Bickley, A A; Black, D; Blau, D S; Boissevain, J G; Bok, J; Bok, J S; Borel, H; Boyle, K; Brooks, M L; Bryslawskyj, J; Buesching, H; Bumazhnov, V; Bunce, G; Butsyk, S; Campbell, S; Caringi, A; Chang, B S; Charvet, J -L; Chen, C -H; Chernichenko, S; Chi, C Y; Chiba, J; Chiu, M; Choi, I J; Choi, J B; Choudhury, R K; Christiansen, P; Chujo, T; Chung, P; Churyn, A; Chvala, O; Cianciolo, V; Citron, Z; Cleven, C R; Cole, B A; Comets, M P; del Valle, Z Conesa; Connors, M; Constantin, P; Csanád, M; Csörgő, T; Dahms, T; Dairaku, S; Danchev, I; Das, K; Datta, A; Daugherity, M S; David, G; Dayananda, M K; Deaton, M B; DeBlasio, K; Dehmelt, K; Delagrange, H; Denisov, A; d'Enterria, D; Deshpande, A; Desmond, E J; Dharmawardane, K V; Dietzsch, O; Ding, L; Dion, A; Do, J H; Donadelli, M; Drapier, O; Drees, A; Drees, K A; Dubey, A K; Durham, J M; Durum, A; Dutta, D; Dzhordzhadze, V; D'Orazio, L; Edwards, S; Efremenko, Y V; Egdemir, J; Ellinghaus, F; Emam, W S; Engelmore, T; Enokizono, A; En'yo, H; Esumi, S; Eyser, K O; Fadem, B; Feege, N; Fields, D E; Finger, M; Jr., \\,; Fleuret, F; Fokin, S L; Fraenkel, Z; Frantz, J E; Franz, A; Frawley, A D; Fujiwara, K; Fukao, Y; Fusayasu, T; Gadrat, S; Gal, C; Gallus, P; Garg, P; Garishvili, I; Ge, H; Giordano, F; Glenn, A; Gong, H; Gonin, M; Gosset, J; Goto, Y; de Cassagnac, R Granier; Grau, N; Greene, S V; Grim, G; Perdekamp, M Grosse; Gu, Y; Gunji, T; Guragain, H; Gustafsson, H -Å; Hachiya, T; Henni, A Hadj; Haegemann, C; Haggerty, J S; Hahn, K I; Hamagaki, H; Hamblen, J; Han, R; Han, S Y; Hanks, J; Harada, H; Hartouni, E P; Haruna, K; Hasegawa, S; Haslum, E; Hayano, R; He, X; Heffner, M; Hemmick, T K; Hester, T; Hiejima, H; Hill, J C; Hobbs, R; Hohlmann, M; Hollis, R S; Holzmann, W; Homma, K; Hong, B; Horaguchi, T; Hornback, D; Hoshino, T; Huang, S; Ichihara, T; Ichimiya, R; Iinuma, H; Ikeda, Y; Imai, K; Imazu, Y; Inaba, M; Inoue, Y; Iordanova, A; Isenhower, D; Isenhower, L; Ishihara, M; Isobe, T; Issah, M; Isupov, A; Ivanischev, D; Ivanishchev, D; Iwanaga, Y; Jacak, B V; Jeon, S J; Jezghani, M; Jia, J; Jiang, X; Jin, J; Jinnouchi, O; Johnson, B M; Jones, T; Joo, E; Joo, K S; Jouan, D; Jumper, D S; Kajihara, F; Kametani, S; Kamihara, N; Kamin, J; Kaneta, M; Kang, J H; Kang, J S; Kanou, H; Kapustinsky, J; Karatsu, K; Kasai, M; Kawall, D; Kawashima, M; Kazantsev, A V; Kempel, T; Key, J A; Khachatryan, V; Khanzadeev, A; Kihara, K; Kijima, K M; Kikuchi, J; Kim, A; Kim, B I; Kim, C; Kim, D H; Kim, D J; Kim, E; Kim, E -J; Kim, H -J; Kim, M; Kim, Y -J; Kim, Y K; Kinney, E; Kiss, Á; Kistenev, E; Kiyomichi, A; Klatsky, J; Klay, J; Klein-Boesing, C; Kleinjan, D; Kline, P; Koblesky, T; Kochenda, L; Kochetkov, V; Kofarago, M; Komkov, B; Konno, M; Koster, J; Kotchetkov, D; Kotov, D; Kozlov, A; Král, A; Kravitz, A; Kubart, J; Kunde, G J; Kurihara, N; Kurita, K; Kurosawa, M; Kweon, M J; Kwon, Y; Kyle, G S; Lacey, R; Lai, Y S; Lajoie, J G; Lebedev, A; Lee, D M; Lee, J; Lee, K B; Lee, K S; Lee, M K; Lee, S H; Lee, T; Leitch, M J; Leite, M A L; Leitgab, M; Lenzi, B; Li, X; Lichtenwalner, P; Liebing, P; Lim, S H; Levy, L A Linden; Liška, T; Litvinenko, A; Liu, H; Liu, M X; Love, B; Lynch, D; Maguire, C F; Makdisi, Y I; Makek, M; Malakhov, A; Malik, M D; Manion, A; Manko, V I; Mannel, E; Mao, Y; Mašek, L; Masui, H; Matathias, F; McCumber, M; McGaughey, P L; McGlinchey, D; McKinney, C; Means, N; Meles, A; Mendoza, M; Meredith, B; Miake, Y; Mibe, T; Mignerey, A C; Mikeš, P; Miki, K; Miller, A J; Miller, T E; Milov, A; Mioduszewski, S; Mishra, D K; Mishra, M; Mitchell, J T; Mitrovski, M; Miyasaka, S; Mizuno, S; Mohanty, A K; Montuenga, P; Moon, H J; Moon, T; Morino, Y; Morreale, A; Morrison, D P; Moukhanova, T V; Mukhopadhyay, D; Murakami, T; Murata, J; Mwai, A; Nagamiya, S; Nagata, Y; Nagle, J L; Naglis, M; Nagy, M I; Nakagawa, I; Nakagomi, H; Nakamiya, Y; Nakamura, K R; Nakamura, T; Nakano, K; Nam, S; Nattrass, C; Netrakanti, P K; Newby, J; Nguyen, M; Nihashi, M; Niida, T; Norman, B E; Nouicer, R; Novitzky, N; Nyanin, A S; Oakley, C; O'Brien, E; Oda, S X; Ogilvie, C A; Ohnishi, H; Oka, M; Okada, K; Omiwade, O O; Onuki, Y; Koop, J D Orjuela; Oskarsson, A; Ouchida, M; Ozaki, H; Ozawa, K; Pak, R; Pal, D; Palounek, A P T; Pantuev, V; Papavassiliou, V; Park, I H; Park, J; Park, S; Park, S K; Park, W J; Pate, S F; Patel, L; Patel, M; Pei, H; Peng, J -C; Pereira, H; Perepelitsa, D V; Perera, G D N; Peresedov, V; Peressounko, D Yu; Perry, J; Petti, R; Pinkenburg, C; Pinson, R; Pisani, R P; Proissl, M; Purschke, M L; Purwar, A K; Qu, H; Rak, J; Rakotozafindrabe, A; Ravinovich, I; Read, K F; Rembeczki, S; Reuter, M; Reygers, K; Reynolds, D; Riabov, V; Riabov, Y; Richardson, E; Riveli, N; Roach, D; Roche, G; Rolnick, S D; Romana, A; Rosati, M; Rosen, C A; Rosendahl, S S E; Rosnet, P; Rowan, Z; Rubin, J G; Rukoyatkin, P; Ružička, P; Rykov, V L; Sahlmueller, B; Saito, N; Sakaguchi, T; Sakai, S; Sakashita, K; Sakata, H; Sako, H; Samsonov, V; Sano, S; Sarsour, M; Sato, S; Sato, T; Sawada, S; Schaefer, B; Schmoll, B K; Sedgwick, K; Seele, J; Seidl, R; Semenov, V; Sen, A; Seto, R; Sett, P; Sexton, A; Sharma, D; Shein, I; Shevel, A; Shibata, T -A; Shigaki, K; Shimomura, M; Shoji, K; Shukla, P; Sickles, A; Silva, C L; Silvermyr, D; Silvestre, C; Sim, K S; Singh, B K; Singh, C P; Singh, V; Skutnik, S; Slunečka, M; Soldatov, A; Soltz, R A; Sondheim, W E; Sorensen, S P; Sourikova, I V; Staley, F; Stankus, P W; Stenlund, E; Stepanov, M; Ster, A; Stoll, S P; Sugitate, T; Suire, C; Sukhanov, A; Sumita, T; Sun, J; Sziklai, J; Tabaru, T; Takagi, S; Takagui, E M; Takahara, A; Taketani, A; Tanabe, R; Tanaka, Y; Taneja, S; Tanida, K; Tannenbaum, M J; Tarafdar, S; Taranenko, A; Tarján, P; Themann, H; Thomas, D; Thomas, T L; Timilsina, A; Todoroki, T; Togawa, M; Toia, A; Tojo, J; Tomášek, L; Tomášek, M; Torii, H; Towell, M; Towell, R; Towell, R S; Tram, V-N; Tserruya, I; Tsuchimoto, Y; Vale, C; Valle, H; van Hecke, H W; Vargyas, M; Vazquez-Zambrano, E; Veicht, A; Velkovska, J; Vértesi, R; Vinogradov, A A; Virius, M; Vrba, V; Vznuzdaev, E; Wagner, M; Walker, D; Wang, X R; Watanabe, D; Watanabe, K; Watanabe, Y; Watanabe, Y S; Wei, F; Wei, R; Wessels, J; Whitaker, S; White, S N; Winter, D; Wolin, S; Woody, C L; Wright, R M; Wysocki, M; Xia, B; Xie, W; Xue, L; Yalcin, S; Yamaguchi, Y L; Yamaura, K; Yang, R; Yanovich, A; Yasin, Z; Ying, J; Yokkaichi, S; Yoon, I; You, Z; Young, G R; Younus, I; Yushmanov, I E; Zajc, W A; Zaudtke, O; Zelenski, A; Zhang, C; Zhou, S; Zimányi, J; Zolin, L

    2014-01-01

    The PHENIX experiment at the Relativistic Heavy Ion Collider has performed a systematic study of $K_S^0$ and $K^{*0}$ meson production at midrapidity in $p$$+$$p$, $d$$+$Au, and Cu$+$Cu collisions at $\\sqrt{s_{_{NN}}}=200$ GeV. The $K_S^0$ and $K^{*0}$ mesons are reconstructed via their $K_S^0 \\rightarrow \\pi^0(\\rightarrow \\gamma\\gamma)\\pi^0(\\rightarrow\\gamma\\gamma)$ and $K^{*0} \\rightarrow K^{\\pm}\\pi^{\\mp}$ decay modes, respectively. The measured transverse-momentum spectra are used to determine the nuclear modification factor of $K_S^0$ and $K^{*0}$ mesons in $d$$+$Au and Cu$+$Cu collisions at different centralities. In the $d$$+$Au collisions, the nuclear modification factor of $K_S^0$ and $K^{*0}$ mesons is almost constant as a function of transverse momentum and is consistent with unity showing that cold-nuclear-matter effects do not play a significant role in the measured kinematic range. In Cu$+$Cu collisions, within the uncertainties no nuclear modification is registered in peripheral collisions. In c...

  10. Study of the process e+e- → KS0 KL0 in the center-of-mass energy range 1004-1060 MeV with the CMD-3 detector at the VEPP-2000 e+e- collider

    Science.gov (United States)

    Kozyrev, E. A.; Solodov, E. P.; Amirkhanov, A. N.; Anisenkov, A. V.; Aulchenko, V. M.; Banzarov, V. S.; Bashtovoy, N. S.; Berkaev, D. E.; Bondar, A. E.; Bragin, A. V.; Eidelman, S. I.; Epifanov, D. A.; Epshteyn, L. B.; Erofeev, A. L.; Fedotovich, G. V.; Gayazov, S. E.; Grebenuk, A. A.; Gribanov, S. S.; Grigoriev, D. N.; Ignatov, F. V.; Ivanov, V. L.; Karpov, S. V.; Kasaev, A. S.; Kazanin, V. F.; Kirpotin, A. N.; Korobov, A. A.; Kovalenko, O. A.; Kozyrev, A. N.; Koop, I. A.; Krokovny, P. P.; Kuzmenko, A. E.; Kuzmin, A. S.; Logashenko, I. B.; Lukin, P. A.; Mikhailov, K. Yu.; Okhapkin, V. S.; Otboev, A. V.; Pestov, Yu. N.; Popov, A. S.; Razuvaev, G. P.; Ruban, A. A.; Ryskulov, N. M.; Ryzhenenkov, A. E.; Senchenko, A. I.; Shebalin, V. E.; Shemyakin, D. N.; Shwartz, B. A.; Shwartz, D. B.; Sibidanov, A. L.; Shatunov, P. Yu.; Shatunov, Yu. M.; Titov, V. M.; Talyshev, A. A.; Vorobiov, A. I.; Yudin, Yu. V.

    2016-09-01

    The e+e- → KS0 KL0 cross section has been measured in the center-of-mass energy range 1004-1060 MeV at 25 energy points using 6.1 ×105 events with KS0 →π+π- decay. The analysis is based on 5.9 pb-1 of an integrated luminosity collected with the CMD-3 detector at the VEPP-2000 e+e- collider. To obtain ϕ (1020) meson parameters the measured cross section is approximated according to the Vector Meson Dominance model as a sum of the ρ , ω , ϕ-like amplitudes and their excitations. This is the most precise measurement of the e+e- → KS0 KL0 cross section with a 1.8% systematic uncertainty.

  11. Narratiivsuse roll Hegeli filosoofilises süsteemis: üks täiendus "dialektilise" meetodi mittemetafüüsilise tõlgendamise juurde

    Directory of Open Access Journals (Sweden)

    Tõnu Viik

    2010-12-01

    Full Text Available Artikkel lähtub Hegeli filosoofilise süsteemi mittemetafüüsilisest tõlgendusest ja keskendub ühele aspektile Hegeli dialektilise meetodi juures, mille iseloomustamiseks oleks autori arvates kõige adekvaatsem kasutada narratiivi mõistet. Artikli tees on kokkuvõtlikult järgmine: Hegeli arvates ei ole filosoofiline tõde väljendatav ühe lause või propositsiooniga, vaid (1 see nõuab tervet väidete jada, kusjuures (2 mõistete määratlused selles väidete jadas peavad suutma teiseneda --- nii nagu kirjandusliku jutustuse käigus võivad teiseneda tegelaste iseloom ja arusaamine asjadest (eriti ilmne on see Bildungsroman'ile omase narratiivi puhul. Lisaks neile kahele omadusele on narratiivile iseloomulik talle omaste struktuurielementide (algus, keskpaik ja lõpp abil loodud (3 terviklikkus, mis võimaldab tal anda edasi sellist mõtet, mis ei sisaldu üheski narratiivi moodustavas lauses üksikult võetuna. Need kolm omadust võimaldavad Hegeli "dialektilisele" meetodile narratiiviteooria vahenditega uut valgust heita ja spekulatiivse tõe loomust paremini mõista.The paper discusses the nature of Hegel's dialectical method and criticizes its wide-spread interpretation according to the thesis-antithesis-synthesis formula. It is argued that there is no evidence of triadic structures in Hegel's works. Rather, the elements (usually defined as "moments", "formations" (Gestalten or "determinations" (Bestimmungen that make up the body of Hegel's texts, are organized as "series" (Reihen that form circles, in which, as Hegel maintains, the last element leads us back to the first. If synthesis means creating something new by using the initial elements then it is problematic whether anything becomes synthesized in Hegel texts. The paper argues against interpreting the every third element of the series (the moment of Becoming being the most obvious candidate in the Science of Logic or the end-points of the series (such as the final moment of

  12. Getting the Most from Working with Higher Education: A Review of Methods Used within a Participatory Design Activity Involving KS3 Special School Pupils and Undergraduate and Post-Graduate Industrial Design Students

    Science.gov (United States)

    Torrens, George Edward; Newton, Helen

    2013-01-01

    This paper provides education-based researchers and practitioners with the preferred research and design methods used by Higher Education Institute (HEI) students and Key Stage 3 (KS3) pupils applied within a participatory approach to a design activity. The outcomes were that both pupils and students found informal (unstructured) interview to be…

  13. Ketide Synthase (KS domain prediction and analysis of iterative type II PKS gene in marine sponge-associated actinobacteria producing biosurfactants and antimicrobial agents

    Directory of Open Access Journals (Sweden)

    George Seghal Kiran

    2016-02-01

    Full Text Available The important biological macromolecules such as lipopeptide and glycolipid biosurfactant producing marine actinobacteria were analyzed and their potential linkage between type II polyketide synthase (PKS genes was also explored. A unique feature of type II PKS genes is their high amino acid sequence homology and conserved gene organization. These enzymes mediate the biosynthesis of polyketide natural products with enormous structural complexity and chemical nature by combinatorial use of various domains. Therefore, deciphering the order of amino acid sequence encoded by PKS domains tailored the chemical structure of polyketide analogues still remains a great challenge. The present work deals with an in vitro and in silico analysis of PKS type II genes from five actinobacterial species with known PKS and metabolic products to correlate the domain architecture and structural features shared with known PKS proteins. Our present analysis reveals the unique protein domain organization of iterative type II PKS and KS domain of marine actinobacteria. The findings of this study would have implications in metabolic pathway reconstruction and design of semi-synthetic genomes to achieve rational design of novel natural products.

  14. First model-independent Dalitz analysis of $B^0 \\to DK^{*0}$, $D\\to K_S^0\\pi^+\\pi^-$ decay

    CERN Document Server

    Negishi, K; Yamamoto, H

    2015-01-01

    We report a measurement of the amplitude ratio $r_S$ of $B^0 \\to D^0K^{*0}$ and $B^0 \\to \\bar{D^0}K^{*0}$ decays with a Dalitz analysis of $D\\to K_S^0\\pi^+\\pi^-$ decays, for the first time using a model-independent method. We set an upper limit $r_S < 0.87$ at the 68\\% confidence level, using the full data sample of $772\\times10^6$ $B\\bar{B}$ pairs collected at the $\\Upsilon(4S)$ resonance with the Belle detector at the KEKB $e^+e^-$ collider. This result is obtained from observables $x_- = +0.4 ^{+1.0 +0.0}_{-0.6 -0.1} \\pm0.0$, $y_- = -0.6 ^{+0.8 +0.1}_{-1.0 -0.0} \\pm0.1$, $x_+ = +0.1 ^{+0.7 +0.0}_{-0.4 -0.1} \\pm0.1$ and $y_+ = +0.3 ^{+0.5 +0.0}_{-0.8 -0.1} \\pm0.1$, where $x_\\pm = r_S \\cos(\\delta_S \\pm \\phi_3)$, $y_\\pm = r_S \\sin(\\delta_S \\pm \\phi_3)$ and $\\phi_3~(\\delta_S)$ is the weak (strong) phase difference between $B^0 \\to D^0K^{*0}$ and $B^0 \\to \\bar{D^0}K^{*0}$.

  15. K(S)0 and Λ production in Pb-Pb collisions at √(s(NN))=2.76 TeV.

    Science.gov (United States)

    Abelev, B; Adam, J; Adamová, D; Adare, A M; Aggarwal, M M; Aglieri Rinella, G; Agnello, M; Agocs, A G; Agostinelli, A; Ahammed, Z; Ahmad, N; Ahmad Masoodi, A; Ahmed, I; Ahn, S U; Ahn, S A; Aimo, I; Aiola, S; Ajaz, M; Akindinov, A; Aleksandrov, D; Alessandro, B; Alexandre, D; Alici, A; Alkin, A; Alme, J; Alt, T; Altini, V; Altinpinar, S; Altsybeev, I; Alves Garcia Prado, C; Andrei, C; Andronic, A; Anguelov, V; Anielski, J; Antičić, T; Antinori, F; Antonioli, P; Aphecetche, L; Appelshäuser, H; Arbor, N; Arcelli, S; Armesto, N; Arnaldi, R; Aronsson, T; Arsene, I C; Arslandok, M; Augustinus, A; Averbeck, R; Awes, T C; Azmi, M D; Bach, M; Badalà, A; Baek, Y W; Bailhache, R; Bairathi, V; Bala, R; Baldisseri, A; Baltasar Dos Santos Pedrosa, F; Bán, J; Baral, R C; Barbera, R; Barile, F; Barnaföldi, G G; Barnby, L S; Barret, V; Bartke, J; Basile, M; Bastid, N; Basu, S; Bathen, B; Batigne, G; Batyunya, B; Batzing, P C; Baumann, C; Bearden, I G; Beck, H; Behera, N K; Belikov, I; Bellini, F; Bellwied, R; Belmont-Moreno, E; Bencedi, G; Beole, S; Berceanu, I; Bercuci, A; Berdnikov, Y; Berenyi, D; Bergognon, A A E; Bertens, R A; Berzano, D; Betev, L; Bhasin, A; Bhati, A K; Bhom, J; Bianchi, L; Bianchi, N; Bielčík, J; Bielčíková, J; Bilandzic, A; Bjelogrlic, S; Blanco, F; Blanco, F; Blau, D; Blume, C; Bock, F; Bogdanov, A; Bøggild, H; Bogolyubsky, M; Boldizsár, L; Bombara, M; Book, J; Borel, H; Borissov, A; Bornschein, J; Botje, M; Botta, E; Böttger, S; Braun-Munzinger, P; Bregant, M; Breitner, T; Broker, T A; Browning, T A; Broz, M; Brun, R; Bruna, E; Bruno, G E; Budnikov, D; Buesching, H; Bufalino, S; Buncic, P; Busch, O; Buthelezi, Z; Caffarri, D; Cai, X; Caines, H; Caliva, A; Calvo Villar, E; Camerini, P; Canoa Roman, V; Cara Romeo, G; Carena, F; Carena, W; Carminati, F; Casanova Díaz, A; Castillo Castellanos, J; Casula, E A R; Catanescu, V; Cavicchioli, C; Ceballos Sanchez, C; Cepila, J; Cerello, P; Chang, B; Chapeland, S; Charvet, J L; Chattopadhyay, S; Chattopadhyay, S; Cherney, M; Cheshkov, C; Cheynis, B; Chibante Barroso, V; Chinellato, D D; Chochula, P; Chojnacki, M; Choudhury, S; Christakoglou, P; Christensen, C H; Christiansen, P; Chujo, T; Chung, S U; Cicalo, C; Cifarelli, L; Cindolo, F; Cleymans, J; Colamaria, F; Colella, D; Collu, A; Colocci, M; Conesa Balbastre, G; Conesa del Valle, Z; Connors, M E; Contin, G; Contreras, J G; Cormier, T M; Corrales Morales, Y; Cortese, P; Cortés Maldonado, I; Cosentino, M R; Costa, F; Crochet, P; Cruz Albino, R; Cuautle, E; Cunqueiro, L; Dainese, A; Dang, R; Danu, A; Das, K; Das, D; Das, I; Dash, A; Dash, S; De, S; Delagrange, H; Deloff, A; Dénes, E; Deppman, A; D'Erasmo, G; de Barros, G O V; De Caro, A; de Cataldo, G; de Cuveland, J; De Falco, A; De Gruttola, D; De Marco, N; De Pasquale, S; de Rooij, R; Diaz Corchero, M A; Dietel, T; Divià, R; Di Bari, D; Di Giglio, C; Di Liberto, S; Di Mauro, A; Di Nezza, P; Djuvsland, Ø; Dobrin, A; Dobrowolski, T; Dönigus, B; Dordic, O; Dubey, A K; Dubla, A; Ducroux, L; Dupieux, P; Dutta Majumdar, A K; Elia, D; Emschermann, D; Engel, H; Erazmus, B; Erdal, H A; Eschweiler, D; Espagnon, B; Estienne, M; Esumi, S; Evans, D; Evdokimov, S; Eyyubova, G; Fabris, D; Faivre, J; Falchieri, D; Fantoni, A; Fasel, M; Fehlker, D; Feldkamp, L; Felea, D; Feliciello, A; Feofilov, G; Ferencei, J; Fernández Téllez, A; Ferreiro, E G; Ferretti, A; Festanti, A; Figiel, J; Figueredo, M A S; Filchagin, S; Finogeev, D; Fionda, F M; Fiore, E M; Floratos, E; Floris, M; Foertsch, S; Foka, P; Fokin, S; Fragiacomo, E; Francescon, A; Frankenfeld, U; Fuchs, U; Furget, C; Fusco Girard, M; Gaardhøje, J J; Gagliardi, M; Gago, A; Gallio, M; Gangadharan, D R; Ganoti, P; Garabatos, C; Garcia-Solis, E; Gargiulo, C; Garishvili, I; Gerhard, J; Germain, M; Gheata, A; Gheata, M; Ghidini, B; Ghosh, P; Gianotti, P; Giubellino, P; Gladysz-Dziadus, E; Glässel, P; Goerlich, L; Gomez, R; González-Zamora, P; Gorbunov, S; Gotovac, S; Graczykowski, L K; Grajcarek, R; Grelli, A; Grigoras, C; Grigoras, A; Grigoriev, V; Grigoryan, A; Grigoryan, S; Grinyov, B; Grion, N; Grosse-Oetringhaus, J F; Grossiord, J-Y; Grosso, R; Guber, F; Guernane, R; Guerzoni, B; Guilbaud, M; Gulbrandsen, K; Gulkanyan, H; Gunji, T; Gupta, A; Gupta, R; Khan, K H; Haake, R; Haaland, Ø; Hadjidakis, C; Haiduc, M; Hamagaki, H; Hamar, G; Hanratty, L D; Hansen, A; Harris, J W; Hartmann, H; Harton, A; Hatzifotiadou, D; Hayashi, S; Hayrapetyan, A; Heckel, S T; Heide, M; Helstrup, H; Herghelegiu, A; Herrera Corral, G; Herrmann, N; Hess, B A; Hetland, K F; Hicks, B; Hippolyte, B; Hori, Y; Hristov, P; Hřivnáčová, I; Huang, M; Humanic, T J; Hutter, D; Hwang, D S; Ilkaev, R; Ilkiv, I; Inaba, M; Incani, E; Innocenti, G M; Ionita, C; Ippolitov, M; Irfan, M; Ivanov, M; Ivanov, V; Ivanytskyi, O; Jachołkowski, A; Jahnke, C; Jang, H J; Janik, M A; Jayarathna, P H S Y; Jena, S; Jimenez Bustamante, R T; Jones, P G; Jung, H; Jusko, A; Kalcher, S; Kaliňák, P; Kalweit, A; Kang, J H; Kaplin, V; Kar, S; Karasu Uysal, A; Karavichev, O; Karavicheva, T; Karpechev, E; Kazantsev, A; Kebschull, U; Keidel, R; Ketzer, B; Khan, M M; Khan, P; Khan, S A; Khanzadeev, A; Kharlov, Y; Kileng, B; Kim, T; Kim, B; Kim, D J; Kim, D W; Kim, J S; Kim, M; Kim, M; Kim, S; Kirsch, S; Kisel, I; Kiselev, S; Kisiel, A; Kiss, G; Klay, J L; Klein, J; Klein-Bösing, C; Kluge, A; Knichel, M L; Knospe, A G; Kobdaj, C; Köhler, M K; Kollegger, T; Kolojvari, A; Kondratiev, V; Kondratyeva, N; Konevskikh, A; Kovalenko, V; Kowalski, M; Kox, S; Koyithatta Meethaleveedu, G; Kral, J; Králik, I; Kramer, F; Kravčáková, A; Krelina, M; Kretz, M; Krivda, M; Krizek, F; Krus, M; Kryshen, E; Krzewicki, M; Kucera, V; Kucheriaev, Y; Kugathasan, T; Kuhn, C; Kuijer, P G; Kulakov, I; Kumar, J; Kurashvili, P; Kurepin, A B; Kurepin, A; Kuryakin, A; Kushpil, V; Kushpil, S; Kweon, M J; Kwon, Y; Ladrón de Guevara, P; Lagana Fernandes, C; Lakomov, I; Langoy, R; Lara, C; Lardeux, A; Lattuca, A; La Pointe, S L; La Rocca, P; Lea, R; Lechman, M; Lee, S C; Lee, G R; Legrand, I; Lehnert, J; Lemmon, R C; Lenhardt, M; Lenti, V; Leoncino, M; León Monzón, I; Lévai, P; Li, S; Lien, J; Lietava, R; Lindal, S; Lindenstruth, V; Lippmann, C; Lisa, M A; Ljunggren, H M; Lodato, D F; Loenne, P I; Loggins, V R; Loginov, V; Lohner, D; Loizides, C; Lopez, X; López Torres, E; Løvhøiden, G; Lu, X-G; Luettig, P; Lunardon, M; Luo, J; Luparello, G; Luzzi, C; Jacobs, P M; Ma, R; Maevskaya, A; Mager, M; Mahapatra, D P; Maire, A; Malaev, M; Maldonado Cervantes, I; Malinina, L; Mal'Kevich, D; Malzacher, P; Mamonov, A; Manceau, L; Manko, V; Manso, F; Manzari, V; Marchisone, M; Mareš, J; Margagliotti, G V; Margotti, A; Marín, A; Markert, C; Marquard, M; Martashvili, I; Martin, N A; Martinengo, P; Martínez, M I; Martínez García, G; Martin Blanco, J; Martynov, Y; Mas, A; Masciocchi, S; Masera, M; Masoni, A; Massacrier, L; Mastroserio, A; Matyja, A; Mazer, J; Mazumder, R; Mazzoni, M A; Meddi, F; Menchaca-Rocha, A; Mercado Pérez, J; Meres, M; Miake, Y; Mikhaylov, K; Milano, L; Milosevic, J; Mischke, A; Mishra, A N; Miśkowiec, D; Mitu, C; Mlynarz, J; Mohanty, B; Molnar, L; Montaño Zetina, L; Monteno, M; Montes, E; Morando, M; Moreira De Godoy, D A; Moretto, S; Morreale, A; Morsch, A; Muccifora, V; Mudnic, E; Muhuri, S; Mukherjee, M; Müller, H; Munhoz, M G; Murray, S; Musa, L; Nandi, B K; Nania, R; Nappi, E; Nattrass, C; Nayak, T K; Nazarenko, S; Nedosekin, A; Nicassio, M; Niculescu, M; Nielsen, B S; Nikolaev, S; Nikulin, S; Nikulin, V; Nilsen, B S; Nilsson, M S; Noferini, F; Nomokonov, P; Nooren, G; Nyanin, A; Nyatha, A; Nystrand, J; Oeschler, H; Oh, S K; Oh, S; Olah, L; Oleniacz, J; Oliveira Da Silva, A C; Onderwaater, J; Oppedisano, C; Ortiz Velasquez, A; Oskarsson, A; Otwinowski, J; Oyama, K; Pachmayer, Y; Pachr, M; Pagano, P; Paić, G; Painke, F; Pajares, C; Pal, S K; Palaha, A; Palmeri, A; Papikyan, V; Pappalardo, G S; Park, W J; Passfeld, A; Patalakha, D I; Paticchio, V; Paul, B; Pawlak, T; Peitzmann, T; Pereira Da Costa, H; Pereira De Oliveira Filho, E; Peresunko, D; Pérez Lara, C E; Perrino, D; Peryt, W; Pesci, A; Pestov, Y; Petráček, V; Petran, M; Petris, M; Petrov, P; Petrovici, M; Petta, C; Piano, S; Pikna, M; Pillot, P; Pinazza, O; Pinsky, L; Pitz, N; Piyarathna, D B; Planinic, M; Płoskoń, M; Pluta, J; Pochybova, S; Podesta-Lerma, P L M; Poghosyan, M G; Polichtchouk, B; Pop, A; Porteboeuf-Houssais, S; Pospíšil, V; Potukuchi, B; Prasad, S K; Preghenella, R; Prino, F; Pruneau, C A; Pshenichnov, I; Puddu, G; Punin, V; Putschke, J; Qvigstad, H; Rachevski, A; Rademakers, A; Rak, J; Rakotozafindrabe, A; Ramello, L; Raniwala, S; Raniwala, R; Räsänen, S S; Rascanu, B T; Rathee, D; Rauch, W; Rauf, A W; Razazi, V; Read, K F; Real, J S; Redlich, K; Reed, R J; Rehman, A; Reichelt, P; Reicher, M; Reidt, F; Renfordt, R; Reolon, A R; Reshetin, A; Rettig, F; Revol, J-P; Reygers, K; Riccati, L; Ricci, R A; Richert, T; Richter, M; Riedler, P; Riegler, W; Riggi, F; Rivetti, A; Rodríguez Cahuantzi, M; Rodriguez Manso, A; Røed, K; Rogochaya, E; Rohni, S; Rohr, D; Röhrich, D; Romita, R; Ronchetti, F; Rosnet, P; Rossegger, S; Rossi, A; Roy, P; Roy, C; Rubio Montero, A J; Rui, R; Russo, R; Ryabinkin, E; Rybicki, A; Sadovsky, S; Safařík, K; Sahoo, R; Sahu, P K; Saini, J; Sakaguchi, H; Sakai, S; Sakata, D; Salgado, C A; Salzwedel, J; Sambyal, S; Samsonov, V; Sanchez Castro, X; Sándor, L; Sandoval, A; Sano, M; Santagati, G; Santoro, R; Sarkar, D; Scapparone, E; Scarlassara, F; Scharenberg, R P; Schiaua, C; Schicker, R; Schmidt, C; Schmidt, H R; Schuchmann, S; Schukraft, J; Schulc, M; Schuster, T; Schutz, Y; Schwarz, K; Schweda, K; Scioli, G; Scomparin, E; Scott, R; Scott, P A; Segato, G; Selyuzhenkov, I; Seo, J; Serci, S; Serradilla, E; Sevcenco, A; Shabetai, A; Shabratova, G; Shahoyan, R; Sharma, S; Sharma, N; Shigaki, K; Shtejer, K; Sibiriak, Y; Siddhanta, S; Siemiarczuk, T; Silvermyr, D; Silvestre, C; Simatovic, G; Singaraju, R; Singh, R; Singha, S; Singhal, V; Sinha, B C; Sinha, T; Sitar, B; Sitta, M; Skaali, T B; Skjerdal, K; Smakal, R; Smirnov, N; Snellings, R J M; Soltz, R; Song, M; Song, J; Soos, C; Soramel, F; Spacek, M; Sputowska, I; Spyropoulou-Stassinaki, M; Srivastava, B K; Stachel, J; Stan, I; Stefanek, G; Steinpreis, M; Stenlund, E; Steyn, G; Stiller, J H; Stocco, D; Stolpovskiy, M; Strmen, P; Suaide, A A P; Subieta Vásquez, M A; Sugitate, T; Suire, C; Suleymanov, M; Sultanov, R; Sumbera, M; Susa, T; Symons, T J M; Szanto de Toledo, A; Szarka, I; Szczepankiewicz, A; Szymański, M; Takahashi, J; Tangaro, M A; Tapia Takaki, J D; Tarantola Peloni, A; Tarazona Martinez, A; Tauro, A; Tejeda Muñoz, G; Telesca, A; Terrevoli, C; Ter Minasyan, A; Thäder, J; Thomas, D; Tieulent, R; Timmins, A R; Toia, A; Torii, H; Trubnikov, V; Trzaska, W H; Tsuji, T; Tumkin, A; Turrisi, R; Tveter, T S; Ulery, J; Ullaland, K; Ulrich, J; Uras, A; Urciuoli, G M; Usai, G L; Vajzer, M; Vala, M; Valencia Palomo, L; Vande Vyvre, P; Vannucci, L; Van Hoorne, J W; van Leeuwen, M; Vargas, A; Varma, R; Vasileiou, M; Vasiliev, A; Vechernin, V; Veldhoen, M; Venaruzzo, M; Vercellin, E; Vergara, S; Vernet, R; Verweij, M; Vickovic, L; Viesti, G; Viinikainen, J; Vilakazi, Z; Villalobos Baillie, O; Vinogradov, A; Vinogradov, L; Vinogradov, Y; Virgili, T; Viyogi, Y P; Vodopyanov, A; Völkl, M A; Voloshin, S; Voloshin, K; Volpe, G; von Haller, B; Vorobyev, I; Vranic, D; Vrláková, J; Vulpescu, B; Vyushin, A; Wagner, B; Wagner, V; Wagner, J; Wang, Y; Wang, Y; Wang, M; Watanabe, D; Watanabe, K; Weber, M; Wessels, J P; Westerhoff, U; Wiechula, J; Wikne, J; Wilde, M; Wilk, G; Wilkinson, J; Williams, M C S; Windelband, B; Winn, M; Xiang, C; Yaldo, C G; Yamaguchi, Y; Yang, H; Yang, P; Yang, S; Yano, S; Yasnopolskiy, S; Yi, J; Yin, Z; Yoo, I-K; Yushmanov, I; Zaccolo, V; Zach, C; Zampolli, C; Zaporozhets, S; Zarochentsev, A; Závada, P; Zaviyalov, N; Zbroszczyk, H; Zelnicek, P; Zgura, I S; Zhalov, M; Zhang, F; Zhang, Y; Zhang, H; Zhang, X; Zhou, D; Zhou, Y; Zhou, F; Zhu, X; Zhu, J; Zhu, J; Zhu, H; Zichichi, A; Zimmermann, M B; Zimmermann, A; Zinovjev, G; Zoccarato, Y; Zynovyev, M; Zyzak, M

    2013-11-27

    The ALICE measurement of K(S)(0) and Λ production at midrapidity in Pb-Pb collisions at √(s(NN))=2.76 TeV is presented. The transverse momentum (p(T)) spectra are shown for several collision centrality intervals and in the p(T) range from 0.4 GeV/c (0.6 GeV/c for Λ) to 12 GeV/c. The p(T) dependence of the Λ/K(S)(0) ratios exhibits maxima in the vicinity of 3 GeV/c, and the positions of the maxima shift towards higher p(T) with increasing collision centrality. The magnitude of these maxima increases by almost a factor of three between most peripheral and most central Pb-Pb collisions. This baryon excess at intermediate p(T) is not observed in pp interactions at √s=0.9 TeV and at √s=7 TeV. Qualitatively, the baryon enhancement in heavy-ion collisions is expected from radial flow. However, the measured p(T) spectra above 2 GeV/c progressively decouple from hydrodynamical-model calculations. For higher values of p(T), models that incorporate the influence of the medium on the fragmentation and hadronization processes describe qualitatively the p(T) dependence of the Λ/K(S)(0) ratio.

  16. Angelica gigas Ameliorates Hyperglycemia and Hepatic Steatosis in C57BL/KsJ-db/db Mice via Activation of AMP-Activated Protein Kinase Signaling Pathway.

    Science.gov (United States)

    Bae, Ui-Jin; Choi, Eun-Kyung; Oh, Mi-Ra; Jung, Su-Jin; Park, Joon; Jung, Tae-Sung; Park, Tae-Sun; Chae, Soo-Wan; Park, Byung-Hyun

    2016-01-01

    The prevention and management of type 2 diabetes mellitus has become a major global public health challenge. Decursin, an active compound of Angelica gigas Nakai roots, was recently reported to have a glucose-lowering activity. However, the antidiabetic effect of Angelica gigas Nakai extract (AGNE) has not yet been investigated. We evaluated the effects of AGNE on glucose homeostasis in type 2 diabetic mice and investigated the underlying mechanism by which AGNE acts. Male C57BL/KsJ-db/db mice were treated with either AGNE (10 mg/kg, 20 mg/kg, and 40 mg/kg) or metformin (100 mg/kg) for 8 weeks. AGNE supplementation (20 and 40 mg/kg) significantly decreased fasting glucose and insulin levels, decreased the areas under the curve of glucose in oral glucose tolerance and insulin tolerance tests, and improved homeostatic model assessment-insulin resistant (HOMA-IR) scores. AGNE also ameliorated hepatic steatosis, hyperlipidemia, and hypercholesterolemia. Mechanistic studies suggested that the glucose-lowering effect of AGNE was mediated by the activation of AMP activated protein kinase, Akt, and glycogen synthase kinase-3[Formula: see text]. AGNE can potentially improve hyperglycemia and hepatic steatosis in patients with type 2 diabetes.

  17. Preventative effects of the flowers of Inula britannica on autoimmune diabetes in C57BL/KsJ mice induced by multiple low doses of streptozotocin.

    Science.gov (United States)

    Kobayashi, Takao; Song, Qing-Hua; Hong, Tie; Kitamura, Hajime; Cyong, Jong-Chol

    2002-06-01

    We have reported that an aqueous extract from the flowers of Inula britannica L. subsp. japonica Kitam. (IB) prevented immunologically induced experimental hepatitis in mice and suggested that the antihepatitic effect of IB is due to inhibition of IFN-gamma production. We then investigated the effects of IB on diabetes in mice induced by multiple low doses of streptozotocin (MLDSTZ), which is a mouse model for IFN-gamma-dependent autoimmune diabetes. C57BL/KsJ mice (male, 7 weeks) were provided with IB extract (500 mg/ kg/ day) in drinking water ad libitum, starting 7 days before the first STZ injection. Autoimmune diabetes was induced by MLDSTZ (40 mg/kg/day for 5 daily doses, i.p.). The IB treatment significantly suppressed the increase of blood glucose levels. Histological analysis of the pancreas showed that the degree of insulitis and destruction of beta-cells were reduced by IB treatment. The IFN-gamma production from stimulated splenic T lymphocytes was inhibited by the IB treatment. Moreover, the proportion of IFN-gamma-producing cells in the CD4(+) population, which was increased by MLDSTZ, was significantly decreased by the IB treatment. These results suggest that IB has a preventative effect on autoimmune diabetes by regulating cytokine production. Copyright 2002 John Wiley & Sons, Ltd.

  18. A harmful-intrusion detection method based on background reconstruction and two-dimensional K-S test in an optical fiber pre-warning system

    Science.gov (United States)

    Bi, Fukun; Zheng, Tong; Qu, Hongquan; Pang, Liping

    2016-06-01

    The key technology and main difficulty for optical fiber intrusion pre-warning systems (OFIPS) is the extraction of harmful-intrusion signals. After being processed by a phase-sensitive optical time-domain reflectometer (Φ-OTDR), vibration signals can be preliminarily extracted. Generally, these include noises and intrusions. Here, intrusions can be divided into harmful and harmless intrusions. With respect to the close study of signal characteristics, an effective extraction method of harmful intrusion is proposed in the paper. Firstly, in the part of the background reconstruction, all intrusion signals are first detected by a constant false alarm rate (CFAR). We then reconstruct the backgrounds by extracting two-part information of alarm points, time and amplitude. This ensures that the detection background consists of intrusion signals. Secondly, in the part of the two-dimensional Kolmogorov-Smirnov (K-S) test, in order to extract harmful ones from all extracted intrusions, we design a separation method. It is based on the signal characteristics of harmful intrusion, which are shorter time interval and higher amplitude. In the actual OFIPS, the detection method is used in some typical scenes, which includes a lot of harmless intrusions, for example construction sites and busy roads. Results show that we can effectively extract harmful intrusions.

  19. Measurement of ${D^{0}}$-${\\overline{D}{}^{0}}$ Mixing and Search for Indirect $CP$ Violation Using ${D^0\\to K_S^0\\pi^+\\pi^-}$ Decays

    CERN Document Server

    Abdesselam, A; Aihara, H; Arinstein, K; Asner, D M; Aulchenko, V; Aushev, T; Ayad, R; Bakich, A M; Bala, A; Bhardwaj, V; Bhuyan, B; Bobrov, A; Bondar, A; Bonvicini, G; Bozek, A; Červenkov, D; Chekelian, V; Chen, A; Cheon, B G; Cho, I -S; Cho, K; Chobanova, V; Choi, Y; Cinabro, D; Dalseno, J; Danilov, M; Doležal, Z; Drásal, Z; Drutskoy, A; Dutta, D; Eidelman, S; Farhat, H; Fast, J E; Ferber, T; Frost, O; Gaur, V; Ganguly, S; Garmash, A; Gillard, R; Goh, Y M; Golob, B; Haba, J; Hara, T; Hayasaka, K; Hayashii, H; He, X H; Hoshi, Y; Hou, W -S; Hyun, H J; Iijima, T; Ishikawa, A; Itoh, R; Iwasaki, Y; Iwashita, T; Jaegle, I; Julius, T; Kang, J H; Kato, E; Katrenko, P; Kawai, H; Kawasaki, T; Kichimi, H; Kim, D Y; Kim, H J; Kim, J B; Kim, J H; Kim, M J; Kim, Y J; Kinoshita, K; Klucar, J; Ko, B R; Kodyš, P; Korpar, S; Križan, P; Krokovny, P; Kronenbitter, B; Kuhr, T; Kumar, R; Kumita, T; Kuzmin, A; Lee, S -H; Li, Y; Gioi, L Li; Libby, J; Liu, C; Liu, Y; Liu, Z Q; Liventsev, D; Lukin, P; Miyata, H; Mizuk, R; Mohanty, G B; Moll, A; Mussa, R; Nakao, M; Natkaniec, Z; Nayak, M; Nedelkovska, E; Nisar, N K; Nishida, S; Nitoh, O; Ogawa, S; Pakhlov, P; Park, H; Park, H K; Pedlar, T K; Pestotnik, R; Petrič, M; Piilonen, L E; Ribežl, E; Ritter, M; Röhrken, M; Rostomyan, A; Sahoo, H; Saito, T; Sakai, Y; Sandilya, S; Santel, D; Santelj, L; Sanuki, T; Sato, Y; Savinov, V; Schneider, O; Schnell, G; Schwanda, C; Seidl, R; Semmler, D; Senyo, K; Sevior, M E; Shapkin, M; Shebalin, V; Shen, C P; Shibata, T -A; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Sohn, Y -S; Sokolov, A; Solovieva, E; Stanič, S; Starič, M; Sumiyoshi, T; Tamponi, U; Tatishvili, G; Teramoto, Y; Trabelsi, K; Uchida, M; Uehara, S; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Ushiroda, Y; Usov, Y; Van Hulse, C; Vanhoefer, P; Varner, G; Varvell, K E; Vinokurova, A; Vorobyev, V; Wagner, M N; Wang, C H; Wang, M -Z; Wang, P; Wang, X L; Watanabe, M; Watanabe, Y; Wehle, S; Williams, K M; Won, E; Yamashita, Y; Yashchenko, S; Yook, Y; Yuan, C Z; Zhang, C C; Zhilich, V; Zhulanov, V; Zupanc, A

    2014-01-01

    We report a measurement of ${D^{0}}$-${\\overline{D}{}^{0}}$ mixing parameters and a search for indirect $CP$ violation through a time-dependent amplitude analysis of ${D^0\\to K_S^0\\pi^+\\pi^-}$ decays. The results are based on 921~fb$^{-1}$ of data accumulated with the Belle detector at the KEKB asymmetric-energy $e^+e^-$ collider. Assuming $CP$ conservation, we measure the mixing parameters $x=(0.56\\pm0.19^{+0.03}_{-0.09}{^{+0.06}_{-0.09}})\\%$ and $y=(0.30\\pm0.15^{+0.04}_{-0.05}{^{+0.03}_{-0.06})}\\%$, where the errors are statistical, experimental systematic, and systematic due to the amplitude model, respectively. With $CP$ violation allowed, the parameters $|q/p|=0.90^{+0.16}_{-0.15}{^{+0.05}_{-0.04}}{^{+0.06}_{-0.05}}$ and $\\arg(q/p)=(-6\\pm11{\\pm3}{^{+3}_{-4}})^{\\circ}$ are found to be consistent with conservation of $CP$ symmetry in mixing and in the interference between mixing and decay, respectively.

  20. Tuba üks null üks / Abdul Turay

    Index Scriptorium Estoniae

    Turay, Abdul, 1967-

    2010-01-01

    Autor leiab, et iga Eesti külaline võib täheldada, et eestlased tunnevad suurt hirmu rahvusliku väljasuremise ees. Eesti noorte taibukusest ja andekusest, autor ei usu, et Eesti noortel on alkoholiga probleeme, pidades seda teemat meedia ja poliitikute poolt ületähtsustatuks

  1. Transverse Momentum Spectra of KS0 and K*0 at Midrapidity in d + Au, Cu + Cu, and p+p Collisions at sNN=200 GeV

    Directory of Open Access Journals (Sweden)

    Bao-Chun Li

    2015-01-01

    Full Text Available We analyze transverse momentum spectra of KS0 and K*0 at midrapidity in d + Au, Cu + Cu, and p+p collisions at sNN=200 GeV in the formworks of Tsallis statistics and Boltzmann statistics, respectively. Both of them can describe the transverse momentum spectra and extract the thermodynamics parameters of matter evolution in the collisions. The parameters are helpful for us to understand the thermodynamics factors of the particle production.

  2. Microscopic mechanisms for long QT syndrome type 1 revealed by single-channel analysis of I(Ks) with S3 domain mutations in KCNQ1.

    Science.gov (United States)

    Eldstrom, Jodene; Wang, Zhuren; Werry, Daniel; Wong, Nathan; Fedida, David

    2015-02-01

    The slowly activating delayed rectifier current IKs participates in cardiac repolarization, particularly at high heart rates, and mutations in this K(+) channel complex underlie long QT syndrome (LQTS) types 1 and 5. The purpose of this study was to determine biophysical mechanisms of LQT1 through single-channel kinetic analysis of IKs carrying LQT1 mutations in the S3 transmembrane region of the pore-forming subunit KCNQ1. We analyzed cell-attached recordings from mammalian cells in which a single active KCNQ1 (wild type or mutant) and KCNE1 complex could be detected. The S3 mutants of KCNQ1 studied (D202H, I204F, V205M, and S209F), with the exception of S209F, all led to a reduction in channel activity through distinct kinetic mechanisms. D202H, I204F, and V205M showed decreased open probability (Po) compared with wild type (0.07, 0.04, and 0.12 vs 0.2); increased first latency from 1.66 to >2 seconds at +60 mV (I204F, V205M); variable-to-severe reductions in open dwell times (≥50% in V205M); stabilization of closed states (D202H); and an inability of channels to reach full conductance levels (V205M, I204F). S209F is a kinetic gain-of-function mutation with a high Po (0.40) and long open-state dwell times. S3 mutations in KCNQ1 cause diverse kinetic defects in I(Ks), affecting opening and closing properties, and can account for LQT1 phenotypes. Copyright © 2015 Heart Rhythm Society. Published by Elsevier Inc. All rights reserved.

  3. Klinefelter Syndrome (KS): Condition Information

    Science.gov (United States)

    ... Get "DS Connected" Picture This: NICHD Support for Neuroscience Research All related news BACK TO ... to Sleep® National Child & Maternal Health Education Program RELATED WEBSITES NIH.gov HHS.gov USA. ...

  4. Klinefelter Syndrome (KS): Other FAQs

    Science.gov (United States)

    ... which educators and parents can improve learning and communication among XXY males, including: Using images and visual clues Teaching them new words Encouraging conversation Using examples in language Minimizing distractions Breaking tasks into small steps Creating ...

  5. Klinefelter Syndrome (KS): Other FAQs

    Science.gov (United States)

    ... early expressive language and speech milestones Early speech therapy and language evaluation Difficulty during transition from elementary school to ... Language evaluation, increased opportunities to communicate through written language, ... occupational therapy, activities that build strength What is ...

  6. HYDRAULICS, HARVEY COUNTY, KS PMR

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  7. Auhind kvaliteedi eest vaid mõne aastaga / Sigrid Vestmann

    Index Scriptorium Estoniae

    Vestmann, Sigrid

    2003-01-01

    Autor toob välja Eesti kvaliteediauhinna võitnud kiirtranspordi ja -kullerteenuste firma TNT Eesti edu peamised põhjused. Vt. samas: Eesti kvaliteediauhinna konkurss; Intervjuu Euroopa kvaliteediauhinnavõitja, puidutööstusettevõtte SAM Mouldings juhtide Julienne ja Sam McCreaga

  8. Vaid klaas vett päevas / Kadri Kalda

    Index Scriptorium Estoniae

    Kalda, Kadri

    2013-01-01

    Rahvusvahelisest koostööprojektist Ghana St Raphaeli algkooli, Valga gümnaasiumi ja EBS-i gümnaasiumiga teemal „Vesi ja sanitaartingimused”. Abistas Põhja-Ghanas Kongo külas töötanud MTÜ Mondo vabatahtlik Diana Tamm

  9. Gaboni riigipea lahkub presidendipaleest vaid jalad ees / Allan Espenberg

    Index Scriptorium Estoniae

    Espenberg, Allan

    2005-01-01

    Kesk-Aafrika riigi Gaboni president Omar Bongo püüab detsembris toimuvatel presidendivalimistel taotleda enda tagasivalimist. Bongo on juhtinud Gaboni 38 aastat, olles sellega Aafrika riigipeade hulgas kõige staazhikam valitseja

  10. "Surmaeelsed kogemused" võivad olla vaid uni / Alo Lõhmus

    Index Scriptorium Estoniae

    Lõhmus, Alo

    2006-01-01

    Surmasuust tagasi pöördunud inimeste kogetud valgusaistingud ja kehast lahkumise illusioonid võivad olle põhjustatud unelaadsest seisundist. Lexingtoni Kentucky ülikooli neuropsühholoogi Kevin Nelsoni uuringutest

  11. Rahvaalgatus toimib vaid kohalikus elus / Väino Linde

    Index Scriptorium Estoniae

    Linde, Väino, 1959-

    2006-01-01

    Ilmunud ka: Vooremaa, Meie maa 19. okt. lk. 2, Pärnu Postimees, Harjumaa 20. okt. lk. 15,2, Põhjarannik, Severnoje Poberezhje, Elva Postipoiss 21. okt. lk. 2,2,4, Nädaline 24. okt. lk. 2, Koit 28. okt. lk. 6, Sakala 31. okt. lk. 2. Riigikogu õiguskomisjoni esimehe sõnul tuleb Eestis pöörata tähelepanu kodanike kaasamisele avaliku võimu teostamisse, tehes seda parlamentaarsele riigile omasel viisil

  12. Oht ei ole liberalism, vaid selle solkimine / Andres Arrak

    Index Scriptorium Estoniae

    Arrak, Andres, 1958-2017

    2007-01-01

    Autori arvates on Eestis liberaalne turumajandus ära rikutud kauboikapitalismiga, mis on inimesi võõrandanud vabaturu ideedest. Näiteid riikide valitsuste rollist ja USA edust. Vastukaja Urmas Varblase artiklile 8. veebr. Postimehes

  13. Some Dilemmas of H1 V/AIDS Prevention

    African Journals Online (AJOL)

    The main economic activity in the area was subsistence farming augmented with fishing and poaching. Many of the villagers also had riverside gardens ..... consequence of the anthropologist's work does not in reality create situations where risk and uncertainties increase extensively. The anthropologist would, I.

  14. Taktikaline meedia. Ei hea ega halb, vaid vajalik / Margus Tamm

    Index Scriptorium Estoniae

    Tamm, Margus, 1977-

    2009-01-01

    Taktikalisest meediast ja selle võimalikest rakendusnäidetest Eesti kontekstis. Taktikalise meedia tüüptöövõtted: üldtuntud logodega manipuleerimine, klišeelise reklaamkeele kasutamine, plakati fiktiivne autor

  15. Turvalisust ei taga vaid sinine vilkur / Ken-Marti Vaher

    Index Scriptorium Estoniae

    Vaher, Ken-Marti, 1974-

    2005-01-01

    Kuritegevuse vastasest võitlusest. Sama ka Pärnu Postimees 8. juuni 2005, lk. 15 ; Hiiu Leht 10. juuni 2005, lk. 2 ; Vali Uudised 8. juuni 2005, lk. 2 artiklis pealkiri kujul: Turvalisust ei taga ainuüksi sinine vilkur ; Nädaline 14. juuni 2005, lk. 4 ; Koit 14. juuni 2005, lk. 6 ; Valgamaalane 5. juuli 2005, lk. 2

  16. Unistusest lahutas vaid väin / Tiiu Speek

    Index Scriptorium Estoniae

    Speek, Tiiu

    2004-01-01

    1995. aasta augustis-septembris läbis 23 eestlast Livonial polaaruurijate John Franklini, Roald Amundseni ja Henry Larseni jälgedes Loodeväila. Rein Vahisalu raamatu "Amundseni nimekiri : eestlased Loodeväilas" (Tallinn, 2004) põhjal

  17. Bushi toetus madalseisus, Kerryl vaid pisut parem / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2004-01-01

    Ameerika Ühendriikides läbi viidud küsitlusest, mille kohaselt toetab ametis oleva presidendi George Bushi tegevust 42 protsenti ameeriklastest; samas ei ole kasvanud ka vastaskandidaat John Kerry toetus

  18. Saku ei taha olla vaid õlletootja / Marko Tooming

    Index Scriptorium Estoniae

    Tooming, Marko

    2007-01-01

    Saku Õlletehase juhatuse esimehe Ireneusz Smaga sõnul on turu kasv kõikides joogikategooriates peale õlleturu kiire, mis sunnibki ettevõtet tulevikku vaadates keskenduma jookide turuosa suurendamisele

  19. Valitsusliidu perepoliitika vaid rikkamate perede huvides / Randel Länts

    Index Scriptorium Estoniae

    Länts, Randel, 1978-

    2004-01-01

    Ilmunud ka: Pärnu Postimees, 7. okt. 2004, lk. 11; Põhjarannik, 6. okt. 2004, lk. 2; Severnoje Poberezhje, 6. okt. 2004, lk. 2; Hiiu Leht, 8. okt. 2004, lk. 2; Meie Maa, 12. okt. 2004, lk. 2; Koit, 19. okt. 2004, lk. 6; Valgamaalane, 25. nov. 2004, lk. 2; Sotsiaaldemokraat, nr. 97, okt. 2004, lk. 6. 2005. a. riigieelarve kriitika Noorte Sotsiaaldemokraatide perepoliitikast lähtudes. Ajal. Sotsiaaldemokraat autor märkimata

  20. Mitte lõbu, vaid seksorjus / Marianne Mikko

    Index Scriptorium Estoniae

    Mikko, Marianne, 1961-

    2004-01-01

    Ilmunud ka: Vali Uudised, 19. märts 2004, lk. 2; Harjumaa, 19. märts 2004, lk. 2; Põhjarannik, 17. märts 2004, lk. 2; Severnoje Poberezhje, 17. märts 2004, lk. 2; Vooremaa, 18. märts 2004, lk. 2; Koit, 18. märts 2004, lk. 6; Nädaline, 20. märts 2004, lk. 4; Hiiu Leht, 23. märts 2004, lk. 2; Sakala, 24. märts 2004, lk. 2; Türi Rahvaleht, 26. märts 2004, lk. 4; Vesti Nedeli, 4. juuni 2004, lk. 8; Valgamaalane, 29. juuli 2004, lk. 2. Sotsiaaldemokraatlik Erakond peab vajalikuks võidelda prostitutsiooniga seadusandluse reguleerimise teel

  1. In vitro lung delivery of bacteriophages KS4-M and ΦKZ using dry powder inhalers for treatment of Burkholderia cepacia complex and Pseudomonas aeruginosa infections in cystic fibrosis.

    Science.gov (United States)

    Golshahi, L; Lynch, K H; Dennis, J J; Finlay, W H

    2011-01-01

    To determine the feasibility of formulating and aerosolizing powders containing bacteriophages KS4-M and ΦKZ for lung delivery and treatment of pulmonary Burkholderia cepacia complex and Pseudomonas aeruginosa infections. Endotoxin-removed bacteriophages KS4-M and ΦKZ were lyophilized in lactose/lactoferrin 60 : 40 w/w matrix and deagglomerated in a mixer mill (without beads) to formulate respirable powders. The powders were then aerosolized using an Aerolizer(®) capsule inhaler. Mass median aerodynamic diameter (MMAD) of this inhalable aerosol was determined using Andersen cascade impactor at 60 l min(-1). Measured MMAD for both types of powders was 3·4 μm, and geometric standard deviation was 1·9-2·0. Viability of bacteriophages delivered distal to an idealized mouth-throat replica was determined from bioassays of samples collected on filters placed after the idealized replica. As a percentage of inhaler load, amount of powder delivered distal to the mouth-throat replica, which is a measure of lung delivery, was 33·7 ± 0·3% for KS4-M and 32·7 ± 0·9% for ΦKZ. Titres collected downstream of the mouth throat were (3·4 ± 2·5) × 10(6) PFU for KS4-M with an Aerolizer capsule load of (9·8 ± 4·8) × 10(6) and (1·9 ± 0·6) × 10(7) for ΦKZ with an Aerolizer capsule load of (6·5 ± 1·9) × 10(7). Bacteriophages KS4-M and ΦKZ can be lyophilized without significant loss of viability in a lactose/lactoferrin 60 : 40 w/w matrix. The resulting powders can be aerosolized to deliver viable bacteriophages to the lungs.   Development of lactoferrin-based bacteriophage aerosol powders solidifies the ground for future research on developing novel formulations as an alternative to inhaled antibiotic therapy in patients with cystic fibrosis. © 2010 The Authors. Journal of Applied Microbiology © 2010 The Society for Applied Microbiology.

  2. Bush lubas tõstatada viisavabaduse teema / George W. Bush, Toomas Hendrik Ilves ; interv. Ingvar Bärenklau

    Index Scriptorium Estoniae

    Bush, George W., 1946-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke, Põhjarannik, Severnoje Poberezhje 29. nov. lk. 3,2,2. USA presidendi George W. Bushi ja Eesti presidendi Toomas Hendrik Ilvese vastused ajakirjanike küsimustele Eesti Panga Iseseisvussaalis toimunud pressikonverentsil 28. novembril 2006

  3. Üks kuningas En-metena raidkiri (En-metena E1.9.5.3.). Kas esimene teadaolev sõprusleping muistses Lähis-Idas? / Vladimir Sazonov

    Index Scriptorium Estoniae

    Sazonov, Vladimir, 1979-

    2015-01-01

    Üks raidkiri varadünastilise perioodi III perioodist on eriline, kuna nimetab "sõprust" või olemuslikult võimalikku "sõpruspakti" kahe Sumeri valitseja vahel. Tegemist on Lagaši kuninga El-metena raidkirjaga. Esmakordselt on tekst avaldatud eesti keeles. Juttu on sõprusest Lagaši kuninga E-metena ja Uruki vürsti Lugal-kiğine-dudu vahel. En-metena isikust. Sündmuste rekontruktsioonist pärast En-metena surma Lagašis 2340. a. paiku e. Kr. Uruki ja Uri valitsejast Lugal-kiğine-dudu'st

  4. A robust morphological classification of high-redshift galaxies using support vector machines on seeing limited images. II. Quantifying morphological k-correction in the COSMOS field at 1 < z < 2: Ks band vs. I band

    Science.gov (United States)

    Huertas-Company, M.; Tasca, L.; Rouan, D.; Pelat, D.; Kneib, J. P.; Le Fèvre, O.; Capak, P.; Kartaltepe, J.; Koekemoer, A.; McCracken, H. J.; Salvato, M.; Sanders, D. B.; Willott, C.

    2009-04-01

    Context: Morphology is the most accessible tracer of galaxies physical structure, but its interpretation in the framework of galaxy evolution still remains problematic. Its quantification at high redshift requires deep high-angular resolution imaging, which is why space data (HST) are usually employed. At z > 1, the HST visible cameras however probe the UV flux, which is dominated by the emission of young stars, which could bias the estimated morphologies towards late-type systems. Aims: In this paper we quantify the effects of this morphological k-correction at 1 Methods: In Paper I we presented a new non-parametric method of quantifying morphologies of galaxies on seeing-limited images based on support vector machines. Here we use this method to classify ~50 000 Ks selected galaxies in the COSMOS area observed with WIRCam at CFHT. We use a 10-dimensional volume, including 5 morphological parameters, and other characteristics of galaxies such as luminosity and redshift. The obtained classification is used to investigate the redshift distributions and number counts per morphological type up to z ~ 2 and to compare them to the results obtained with HST/ACS in the I-band on the same objects. We associate to every galaxy with Ks find less early-type galaxies than the Ks-band one by a factor ~1.5, which might be a consequence of morphological k-correction effects. Conclusions: We argue therefore that studies based on I-band HST/ACS classifications at z > 1 could be underestimating the elliptical population. Using our method in a Ks ≤ 21.5 magnitude-limited sample, we observe that the fraction of the early-type population is (21.9% ± 8%) at z ~ 1.5-2 and (32.0% ± 5%) at the present time. We will discuss the evolution of the fraction of galaxies in types from volume-limited samples in a forthcoming paper. Based on observations obtained at the Canada-France-Hawaii Telescope (CFHT) which is operated by the National Research Council of Canada, the Institut National des

  5. Measurement of $CP$ violation and constraints on the CKM angle $\\gamma$ in $B^{\\pm}\\rightarrow D K^{\\pm}$ with $D \\rightarrow K_S^0 \\pi^+ \\pi^-$ decays

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Balagura, Vladislav; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carranza-Mejia, Hector; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gordon, Hamish; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hartmann, Thomas; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanciotti, Elisa; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Guoming; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Moran, Dermot; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Muresan, Raluca; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Powell, Andrew; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Alexander; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Sabatino, Giovanni; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sapunov, Matvey; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Senderowska, Katarzyna; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Stagni, Federico; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Feng; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-01-01

    A model-dependent amplitude analysis of $B^{\\pm} \\rightarrow D K^{\\pm}$ with $D \\rightarrow K_S^0 \\pi^+ \\pi^-$ decays is performed using proton-proton collision data, corresponding to an integrated luminosity of $1$ fb$^{-1}$, recorded by LHCb at a centre-of-mass energy of $7$ TeV in $2011$. Values of the $CP$ violation observables $x_{\\pm}$ and $y_{\\pm}$, which are sensitive to the CKM angle $\\gamma$, are measured to be \\begin{align*} x_- &= +0.027 \\pm 0.044 ^{+0.010}_{-0.008} \\pm 0.001, \\\\ y_- &= +0.013 \\pm 0.048 ^{+0.009}_{-0.007} \\pm 0.003, \\\\ x_+ &= -0.084 \\pm 0.045 \\pm 0.009 \\pm 0.005, \\\\ y_+ &= -0.032 \\pm 0.048 ^{+0.010}_{-0.009} \\pm 0.008, \\end{align*} where the first uncertainty is statistical, the second systematic and the third arises from the uncertainty of the $D \\rightarrow K_S^0 \\pi^+ \\pi^-$ amplitude model. The value of $\\gamma$ is determined to be $(84^{+49}_{-42})^\\circ$, including all sources of uncertainty. Neutral $D$ meson mixing is found to have negligible effect.

  6. Katrin Denev pokazala harakter

    Index Scriptorium Estoniae

    2006-01-01

    Veneetsia 63. filmifestivali auhinnatutest, kellest vaid Stephen Frears'i filmis "Kuninganna" ("The Queen") peaosa kehastanud Helen Mirren oli üks favoriitidest. Parima filmi peaauhind Kuldlõvi läks üllatuslikult Hiina režissööri Jia Zhang-Ke filmile "Vaikelu" ("Dong"). Ka teistest Veneetsia 63. filmifestivali võitjatest. Festivali žüriid juhatas Catherine Deneuve

  7. Innovatsioon pole mingi relatiivsusteooria / Rowan Gibson

    Index Scriptorium Estoniae

    Gibson, Rowan

    2007-01-01

    Maailma juhtivama äristrateegi sõnul tagab vaid innovatsioon ettevõtte pikaajalise kasvu, alguse saab see heast ideest. Vt. samas: Arvo Kivikas. Juhi ülesanne on panna õiged inimesed õigetele kohtadele; Tanel Talve. Igaüks jäägu oma liistude juurde

  8. Eesti hirmuvabaks! / David Vseviov

    Index Scriptorium Estoniae

    Vseviov, David, 1949-

    2011-01-01

    Erinevalt parteiliikmetest saab üksikkandidaadina valitu Riigikogus hääletada vabast tahtest lähtudes ja karistushirmu tundmata. Me ei peaks panustama lootusele, et üks inimene osutub paljudest teistest vabamaks ja julgemaks, vaid sellele, et arvamuste väljendamine ja hirmuvaba otsustamine on Eestis norm

  9. Taheva : vald naiste juhtimise all / Väinu Rozental, Erik Prozes

    Index Scriptorium Estoniae

    Rozental, Väinu, 1957-

    2008-01-01

    Taheva vallavanem Monika Rogenbaum valla juhtimisest ja ettevõtlusest. Taheva valla mõjukaim ettevõtja on 78aastane Uno Teemägi, kes tegeleb teraviljakasvatusega. Lisa: Taheva vallas tänavu sündinud vaid üks laps. Vt. samas: Valgalane peab Tahevas kauplust

  10. Andris Blaka : "Advertising agencies will have to re-invent themselves" / Andris Blaka ; interv. Alina Lisina

    Index Scriptorium Estoniae

    Blaka, Andris

    2005-01-01

    Baltimaade reklaaminduse üks pioneere ja Läti Reklaami Assotsiatsiooni president peab oma tähtsaimaks eesmärgiks hoida ära reklaamitööstuse killustumist ning kahetseb, et reklaaminduses leidub vaid 20% inimesi, kes reklaamide tegemist tõeliselt naudivad

  11. Veresauna järel hakkasid Indias pead lendama / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2008-01-01

    Pärast Mumbais toimunud terrorirünnakuid teatasid oma ametist lahkumisest Maharashtra osariigi valitsusjuht Vilasrao Deshmukh ja tema asetäitja R. R. Patil, samuti India keskvalitsuse sisejulgeolekuminister Shivraj Patil. Ükski Mumbai rannavalvekaater ei tegele patrullimisega, riigis on vaid üks terrorismivastane eriüksus ning see tegeleb juhtivpoliitikute turvamisega

  12. Mõõtmine ja intelligentsus / Rein Raud

    Index Scriptorium Estoniae

    Raud, Rein, 1961-

    2007-01-01

    Geeniteadlane James Watson leidis, et Aafrikas elavate inimeste intelligentsustase ei ole võrdne valge nahavärviga inimeste omaga. TLÜ professor Rein Raud leiab, et selle väite peamine nõrkus on eeldus, et on vaid üks ja universaalne mõõtmisparameeter

  13. Kas Huntington oli prohvet? / Priit Simson

    Index Scriptorium Estoniae

    Simson Priit, 1977-

    2008-01-01

    Autor käsitleb Samuel Huntingtoni teese ning leiab, et tegelikult Huntington ei pakkunud õigustust islamiriikide ründamisele, vaid pigem hoiatas tsivilisatsioonide siseasjusse sekkumise, tekkida võiva ahelreaktsiooni eest, kus üks tsivilisatsiooni liige tõmbab sõtta ka teise

  14. Ülihiidtäht Betelgeuse kaotab massi / Jüri Ivask

    Index Scriptorium Estoniae

    Ivask, Jüri, 1961-

    2009-01-01

    Betelgeuse, heleduselt teine täht Orioni tähtkujus, on punane ülihiid - üks suurimaid tähti, mida teatakse. Olles vaid mõne miljoni aasta vanune, läheneb Betelgeuse juba oma eluea lõpule ning peab peagi plahvatama supernoovana

  15. A direct test of time-reversal symmetry in the neutral K meson system with KS → πℓν and KL → 3π0 at KLOE-2

    Directory of Open Access Journals (Sweden)

    Gajos Aleksander

    2014-01-01

    Full Text Available Quantum entanglement of K and B mesons allows for a direct experimental test of time-reversal symmetry independent of CP violation. The T symmetry can be probed by exchange of initial and final states in the reversible transitions between flavor and CP- definite states of the mesons which are only connected by the T conjugation. While such a test was successfully performed by the BaBar experiment with neutral B mesons, the KLOE-2 detector can probe T -violation in the neutral kaons system by investigating the process with KS → π±l∓νl and KL → 3π0 decays. Analysis of the latter is facilitated by a novel reconstruction method for the vertex of KL → 3π0 decay which only involves neutral particles. Details of this new vertex reconstruction technique are presented as well as prospects for conducting the direct T symmetry test at the KLOE-2 experiment.

  16. CASKS (Computer Analysis of Storage casKS): A microcomputer based analysis system for storage cask design review. User`s manual to Version 1b (including program reference)

    Energy Technology Data Exchange (ETDEWEB)

    Chen, T.F.; Gerhard, M.A.; Trummer, D.J.; Johnson, G.L.; Mok, G.C. [Lawrence Livermore National Lab., CA (United States)

    1995-02-01

    CASKS (Computer Analysis of Storage casKS) is a microcomputer-based system of computer programs and databases developed at the Lawrence Livermore National Laboratory (LLNL) for evaluating safety analysis reports on spent-fuel storage casks. The bulk of the complete program and this user`s manual are based upon the SCANS (Shipping Cask ANalysis System) program previously developed at LLNL. A number of enhancements and improvements were added to the original SCANS program to meet requirements unique to storage casks. CASKS is an easy-to-use system that calculates global response of storage casks to impact loads, pressure loads and thermal conditions. This provides reviewers with a tool for an independent check on analyses submitted by licensees. CASKS is based on microcomputers compatible with the IBM-PC family of computers. The system is composed of a series of menus, input programs, cask analysis programs, and output display programs. All data is entered through fill-in-the-blank input screens that contain descriptive data requests.

  17. Insulin/IGF-1 signaling, including class II/III PI3Ks, β-arrestin and SGK-1, is required in C. elegans to maintain pharyngeal muscle performance during starvation.

    Science.gov (United States)

    Dwyer, Donard S; Aamodt, Eric J

    2013-01-01

    In C. elegans, pharyngeal pumping is regulated by the presence of bacteria. In response to food deprivation, the pumping rate rapidly declines by about 50-60%, but then recovers gradually to baseline levels on food after 24 hr. We used this system to study the role of insulin/IGF-1 signaling (IIS) in the recovery of pharyngeal pumping during starvation. Mutant strains with reduced function in the insulin/IGF-1 receptor, DAF-2, various insulins (INS-1 and INS-18), and molecules that regulate insulin release (UNC-64 and NCA-1; NCA-2) failed to recover normal pumping rates after food deprivation. Similarly, reduction or loss of function in downstream signaling molecules (e.g., ARR-1, AKT-1, and SGK-1) and effectors (e.g., CCA-1 and UNC-68) impaired pumping recovery. Pharmacological studies with kinase and metabolic inhibitors implicated class II/III phosphatidylinositol 3-kinases (PI3Ks) and glucose metabolism in the recovery response. Interestingly, both over- and under-activity in IIS was associated with poorer recovery kinetics. Taken together, the data suggest that optimum levels of IIS are required to maintain high levels of pharyngeal pumping during starvation. This work may ultimately provide insights into the connections between IIS, nutritional status and sarcopenia, a hallmark feature of aging in muscle.

  18. Insulin/IGF-1 signaling, including class II/III PI3Ks, β-arrestin and SGK-1, is required in C. elegans to maintain pharyngeal muscle performance during starvation.

    Directory of Open Access Journals (Sweden)

    Donard S Dwyer

    Full Text Available In C. elegans, pharyngeal pumping is regulated by the presence of bacteria. In response to food deprivation, the pumping rate rapidly declines by about 50-60%, but then recovers gradually to baseline levels on food after 24 hr. We used this system to study the role of insulin/IGF-1 signaling (IIS in the recovery of pharyngeal pumping during starvation. Mutant strains with reduced function in the insulin/IGF-1 receptor, DAF-2, various insulins (INS-1 and INS-18, and molecules that regulate insulin release (UNC-64 and NCA-1; NCA-2 failed to recover normal pumping rates after food deprivation. Similarly, reduction or loss of function in downstream signaling molecules (e.g., ARR-1, AKT-1, and SGK-1 and effectors (e.g., CCA-1 and UNC-68 impaired pumping recovery. Pharmacological studies with kinase and metabolic inhibitors implicated class II/III phosphatidylinositol 3-kinases (PI3Ks and glucose metabolism in the recovery response. Interestingly, both over- and under-activity in IIS was associated with poorer recovery kinetics. Taken together, the data suggest that optimum levels of IIS are required to maintain high levels of pharyngeal pumping during starvation. This work may ultimately provide insights into the connections between IIS, nutritional status and sarcopenia, a hallmark feature of aging in muscle.

  19. Individual and co-operative roles of lactic acid and hydrogen peroxide in the killing activity of enteric strain Lactobacillus johnsonii NCC933 and vaginal strain Lactobacillus gasseri KS120.1 against enteric, uropathogenic and vaginosis-associated pathogens.

    Science.gov (United States)

    Atassi, Fabrice; Servin, Alain L

    2010-03-01

    The mechanism underlying the killing activity of Lactobacillus strains against bacterial pathogens appears to be multifactorial. Here, we investigate the respective contributions of hydrogen peroxide and lactic acid in killing bacterial pathogens associated with the human vagina, urinary tract or intestine by two hydrogen peroxide-producing strains. In co-culture, the human intestinal strain Lactobacillus johnsonii NCC933 and human vaginal strain Lactobacillus gasseri KS120.1 strains killed enteric Salmonella enterica serovar Typhimurium SL1344, vaginal Gardnerella vaginalis DSM 4944 and urinary tract Escherichia coli CFT073 pathogens. The cell-free culture supernatants (CFCSs) produced the same reduction in SL1344, DSM 4944 and CFT073 viability, whereas isolated bacteria had no effect. The killing activity of CFCSs was heat-stable. In the presence of Dulbecco's modified Eagle's minimum essential medium inhibiting the lactic acid-dependent killing activity, CFCSs were less effective at killing of the pathogens. Catalase-treated CFCSs displayed a strong decreased activity. Tested alone, hydrogen peroxide triggered a concentration-dependent killing activity against all three pathogens. Lactic acid alone developed a killing activity only at concentrations higher than that present in CFCSs. In the presence of lactic acid at a concentration present in Lactobacillus CFCSs, hydrogen peroxide displayed enhanced killing activity. Collectively, these results demonstrate that for hydrogen peroxide-producing Lactobacillus strains, the main metabolites of Lactobacillus, lactic acid and hydrogen peroxide, act co-operatively to kill enteric, vaginosis-associated and uropathogenic pathogens.

  20. Evidence for C P violation in B+→K*(892)+ π0 from a Dalitz plot analysis of B+→KS0 π+π0 decays

    Science.gov (United States)

    Lees, J. P.; Poireau, V.; Tisserand, V.; Grauges, E.; Palano, A.; Eigen, G.; Stugu, B.; Brown, D. N.; Kerth, L. T.; Kolomensky, Yu. G.; Lee, M. J.; Lynch, G.; Koch, H.; Schroeder, T.; Hearty, C.; Mattison, T. S.; McKenna, J. A.; So, R. Y.; Khan, A.; Blinov, V. E.; Buzykaev, A. R.; Druzhinin, V. P.; Golubev, V. B.; Kravchenko, E. A.; Onuchin, A. P.; Serednyakov, S. I.; Skovpen, Yu. I.; Solodov, E. P.; Todyshev, K. Yu.; Lankford, A. J.; Dey, B.; Gary, J. W.; Long, O.; Franco Sevilla, M.; Hong, T. M.; Kovalskyi, D.; Richman, J. D.; West, C. A.; Eisner, A. M.; Lockman, W. S.; Panduro Vazquez, W.; Schumm, B. A.; Seiden, A.; Chao, D. S.; Cheng, C. H.; Echenard, B.; Flood, K. T.; Hitlin, D. G.; Miyashita, T. S.; Ongmongkolkul, P.; Porter, F. C.; Röhrken, M.; Andreassen, R.; Huard, Z.; Meadows, B. T.; Pushpawela, B. G.; Sokoloff, M. D.; Sun, L.; Bloom, P. C.; Ford, W. T.; Gaz, A.; Smith, J. G.; Wagner, S. R.; Ayad, R.; Toki, W. H.; Spaan, B.; Bernard, D.; Verderi, M.; Playfer, S.; Bettoni, D.; Bozzi, C.; Calabrese, R.; Cibinetto, G.; Fioravanti, E.; Garzia, I.; Luppi, E.; Piemontese, L.; Santoro, V.; Calcaterra, A.; de Sangro, R.; Finocchiaro, G.; Martellotti, S.; Patteri, P.; Peruzzi, I. M.; Piccolo, M.; Rama, M.; Zallo, A.; Contri, R.; Monge, M. R.; Passaggio, S.; Patrignani, C.; Bhuyan, B.; Prasad, V.; Adametz, A.; Uwer, U.; Lacker, H. M.; Mallik, U.; Chen, C.; Cochran, J.; Prell, S.; Ahmed, H.; Gritsan, A. V.; Arnaud, N.; Davier, M.; Derkach, D.; Grosdidier, G.; Le Diberder, F.; Lutz, A. M.; Malaescu, B.; Roudeau, P.; Stocchi, A.; Wormser, G.; Lange, D. J.; Wright, D. M.; Coleman, J. P.; Fry, J. R.; Gabathuler, E.; Hutchcroft, D. E.; Payne, D. J.; Touramanis, C.; Bevan, A. J.; Di Lodovico, F.; Sacco, R.; Cowan, G.; Brown, D. N.; Davis, C. L.; Denig, A. G.; Fritsch, M.; Gradl, W.; Griessinger, K.; Hafner, A.; Schubert, K. R.; Barlow, R. J.; Lafferty, G. D.; Cenci, R.; Hamilton, B.; Jawahery, A.; Roberts, D. A.; Cowan, R.; Cheaib, R.; Patel, P. M.; Robertson, S. H.; Neri, N.; Palombo, F.; Cremaldi, L.; Godang, R.; Summers, D. J.; Simard, M.; Taras, P.; De Nardo, G.; Onorato, G.; Sciacca, C.; Raven, G.; Jessop, C. P.; LoSecco, J. M.; Honscheid, K.; Kass, R.; Margoni, M.; Morandin, M.; Posocco, M.; Rotondo, M.; Simi, G.; Simonetto, F.; Stroili, R.; Akar, S.; Ben-Haim, E.; Bomben, M.; Bonneaud, G. R.; Briand, H.; Calderini, G.; Chauveau, J.; Leruste, Ph.; Marchiori, G.; Ocariz, J.; Biasini, M.; Manoni, E.; Rossi, A.; Angelini, C.; Batignani, G.; Bettarini, S.; Carpinelli, M.; Casarosa, G.; Chrzaszcz, M.; Forti, F.; Giorgi, M. A.; Lusiani, A.; Oberhof, B.; Paoloni, E.; Rizzo, G.; Walsh, J. J.; Lopes Pegna, D.; Olsen, J.; Smith, A. J. S.; Anulli, F.; Faccini, R.; Ferrarotto, F.; Ferroni, F.; Gaspero, M.; Pilloni, A.; Piredda, G.; Bünger, C.; Dittrich, S.; Grünberg, O.; Hess, M.; Leddig, T.; Voß, C.; Waldi, R.; Adye, T.; Olaiya, E. O.; Wilson, F. F.; Emery, S.; Vasseur, G.; Aston, D.; Bard, D. J.; Cartaro, C.; Convery, M. R.; Dorfan, J.; Dubois-Felsmann, G. P.; Dunwoodie, W.; Ebert, M.; Field, R. C.; Fulsom, B. G.; Graham, M. T.; Hast, C.; Innes, W. R.; Kim, P.; Leith, D. W. G. S.; Lindemann, D.; Luitz, S.; Luth, V.; Lynch, H. L.; MacFarlane, D. B.; Muller, D. R.; Neal, H.; Perl, M.; Pulliam, T.; Ratcliff, B. N.; Roodman, A.; Schindler, R. H.; Snyder, A.; Su, D.; Sullivan, M. K.; Va'vra, J.; Wisniewski, W. J.; Wulsin, H. W.; Purohit, M. V.; Wilson, J. R.; Randle-Conde, A.; Sekula, S. J.; Bellis, M.; Burchat, P. R.; Puccio, E. M. T.; Alam, M. S.; Ernst, J. A.; Gorodeisky, R.; Guttman, N.; Peimer, D. R.; Soffer, A.; Spanier, S. M.; Ritchie, J. L.; Schwitters, R. F.; Izen, J. M.; Lou, X. C.; Bianchi, F.; De Mori, F.; Filippi, A.; Gamba, D.; Lanceri, L.; Vitale, L.; Martinez-Vidal, F.; Oyanguren, A.; Villanueva-Perez, P.; Albert, J.; Banerjee, Sw.; Beaulieu, A.; Bernlochner, F. U.; Choi, H. H. F.; King, G. J.; Kowalewski, R.; Lewczuk, M. J.; Lueck, T.; Nugent, I. M.; Roney, J. M.; Sobie, R. J.; Tasneem, N.; Gershon, T. J.; Harrison, P. F.; Latham, T. E.; Band, H. R.; Dasu, S.; Pan, Y.; Prepost, R.; Wu, S. L.; BaBar Collaboration

    2017-10-01

    We report a Dalitz plot analysis of charmless hadronic decays of charged B mesons to the final state KS0π+π0 using the full BABAR data set of 470.9 ±2.8 million B B ¯ events collected at the Υ (4 S ) resonance. We measure the overall branching fraction and C P asymmetry to be B (B+→K0π+π0) =(31.8 ±1.8 ±2. 1-0.0+6.0 ) ×10-6 and AC P(B+→K0π+π0) =0.07 ±0.05 ±0.0 3-0.03+0.02 , where the uncertainties are statistical, systematic, and due to the signal model, respectively. This is the first measurement of the branching fraction for B+→K0π+π0. We find first evidence of a C P asymmetry in B+→K*(892 )+π0decays: AC P(B+→K*(892 )+π0) =-0.52 ±0.14 ±0.0 4-0.02+0.04 . The significance of this asymmetry, including systematic and model uncertainties, is 3.4 standard deviations. We also measure the branching fractions and C P asymmetries for three other intermediate decay modes.

  1. Amplitude Analysis and Measurement of the Time-dependent CP Asymmetry of B0 to KsKsKs Decays

    Energy Technology Data Exchange (ETDEWEB)

    Lees, J.P.

    2012-04-11

    We present the first results on the Dalitz-plot structure and improved measurements of the time-dependent CP-violation parameters of the process B{sup 0} {yields} K{sub S}{sup 0}K{sub S}{sup 0}K{sub S}{sup 0} obtained using 468 x 10{sup 6} B{bar B} decays collected with the BABAR detector at the PEP-II asymmetric-energy B factory at SLAC. The Dalitz-plot structure is probed by a time-integrated amplitude analysis that does not distinguish between B{sup 0} and {bar B}{sup 0} decays. We measure the total inclusive branching fraction {Beta}(B{sup 0} {yields} K{sub S}{sup 0}K{sub S}{sup 0}K{sub S}{sup 0}) = (6.19 {+-} 0.48 {+-} 0.15 {+-} 0.12) x 10{sup -6}, where the first uncertainty is statistical, the second is systematic, and the third represents the Dalitz-plot signal model dependence. We also observe evidence for the intermediate resonant states f{sub 0}(980), f{sub 0}(1710), and f{sub 2}(2010). Their respective product branching fractions are measured to be (2.70{sub -1.19}{sup +1.25} {+-} 0.36 {+-} 1.17) x 10{sup -6}, (0.50{sub -0.24}{sup +0.46} {+-} 0.04 {+-} 0.10) x 10{sup -6}, and (0.54{sub -0.20}{sup +0.21} {+-} 0.03 {+-} 0.52) x 10{sup -6}. Additionally, we determine the mixing-induced CP-violation parameters to be S = -0.94{sub -0.21}{sup +0.24} {+-} 0.06 and C = -0.17 {+-} 0.18 {+-} 0.04, where the first uncertainty is statistical and the second is systematic. These values are in agreement with the standard model expectation.

  2. Caulerpa lentillifera extract ameliorates insulin resistance and regulates glucose metabolism in C57BL/KsJ-db/db mice via PI3K/AKT signaling pathway in myocytes.

    Science.gov (United States)

    Sharma, Bhesh Raj; Kim, Hyun Jung; Rhyu, Dong Young

    2015-02-15

    Glucose homeostasis is distorted by defects of the PI3K/AKT and AMPK pathways in insulin-sensitive tissues, allowing the accumulation of glucose in the blood. The purpose of this study was to assess the effects and mechanisms by which ethanol extract of Caulerpa lentillifera (CLE) regulates glucose metabolism in C57BL/KsJ-db/db (db/db) mice. Mice were administered CLE (250 or 500 mg/kg BW) or rosiglitazone (RSG, 10 mg/kg BW) for 6 weeks. Then, oral glucose tolerance test (OGTT) and intraperitoneal insulin tolerance test (IPITT) were performed, and blood glucose was measured in db/db mice. Levels of insulin and insulin resistance factors in plasma, glycogen content in the liver, and IRS, PI3K, AKT, and GLUT4 expressions in skeletal muscles were measured in db/db mice. Glucose uptake and insulin signaling molecules were measured in L6 myocytes, using fluorometry and Western blotting. CLE significantly decreased fasting blood glucose, glucose level in OGTT and IPITT, plasma insulin, homeostatic model assessment-insulin resistant (HOMA-IR), TNF-α, IL-6, FFA, TG and TC levels, and hepatic glycogen content in db/db mice. CLE significantly increased the activation of IRS, AKT, PI3K, and GLUT4, which are the key effector molecules of the PI3K/AKT pathway in L6 myocytes and the skeletal muscles of db/db mice. The enhanced glucose uptake by CLE was abolished by treatment with a PI3K inhibitor (LY294002), but not by an AMPK inhibitor (compound C) in L6 myocytes. CLE regulated glucose uptake and homeostasis via the PI3K/AKT pathway in myocytes and db/db mice, respectively. Our results suggest that CLE could be a potential candidate for the prevention of diabetes.

  3. Veel üks raamatuleid / Lembit Andresen

    Index Scriptorium Estoniae

    Andresen, Lembit, 1929-2016

    2009-01-01

    Jan Amos Komenský rootsi-ladinakeelsest keeleõpikust "Orbis sensualium pictus", trükitud 1683. a. Riias. "Orbis sensualium pictus" anti J. A. Komenský poolt välja võõrkeele õppimiseks, kuid see pidi täitma ka emakeele algõpiku ja aabitsa ülesannet

  4. 78 FR 26679 - Kansas Disaster #KS-00073

    Science.gov (United States)

    2013-05-07

    ..., Dickinson, Ellis, Franklin, Harper, Harvey, Hodgeman, Kingman, Marion, Mcpherson, Ness, Osage, Osborne, Pawnee, Phillips, Pratt, Rice, Rooks, Rush, Russell, Smith, Stafford. The Interest Rates are: Percent For...

  5. Üks lahe festival / Mart Koldits

    Index Scriptorium Estoniae

    Koldits, Mart

    2007-01-01

    Teisest NU performance'i-festivalist, mille raames taaslavastatakse 13. ja 14. XI Von Krahli teatris 1980. a. Leonhard Lapini Noorsooteatris lavastatud multimeedium "Multiplitseeritud inimene", mis põhineb Johannes Vares-Barbaruse luulel. Lavastab Leonhard Lapin, kaasa löövad Kristel Leesmend, Uku Uusberg ja Indrek Ojari

  6. Basemap Framework Submission for Clay County, KS

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — FEMA Framework Basemap datasets comprise six of the seven FGDC themes of geospatial data that are used by most GIS applications (Note: the seventh framework theme,...

  7. Floodplain Mapping Submission for Finney County, KS

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Floodplain Mapping/Redelineation study deliverables depict and quantify the flood risks for the study area. The primary risk classifications used are the...

  8. French Pen Pals Made Easy KS3

    CERN Document Server

    Leleu, Sinéad

    2010-01-01

    French Pen Pals Made Easy provides an easy way for pupils to communicate in French with other French speakers. It contains fill-in-the-gap letters, so even pupils just beginning to learn French can have the satisfaction of being able to communicate effectively in French. The format is ideal for non-specialist teachers as it does not require fluency and little or no preparation is required. English translations of the letters are included, as are lists of vocabulary, key grammar points and exten

  9. Prof. KS Krishnan and Crystal Magnetism

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 12. Prof. K S Krishnan and Crystal Magnetism. U S Ghosh. General Article Volume 7 Issue 12 December 2002 pp 65-70. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/007/12/0065-0070. Keywords.

  10. Üks küsimus

    Index Scriptorium Estoniae

    2003-01-01

    Euroopa Komisjoni laienemisvoliniku Günther Verheugeni eestkõneleja Jean-Christophe Filori vastab küsimusele, milleni võivad viia valitsuskriisist tulenevad häired Riigikogu töös EL-iga liitumiseks vajalike seaduste vastuvõtmisel

  11. 77 FR 32708 - Kansas Disaster #KS-00064

    Science.gov (United States)

    2012-06-01

    ... Organizations Without Credit Available Elsewhere. 3.000 For Economic Injury: Non-Profit Organizations Without.... Physical Loan Application Deadline Date: 07/23/2012. Economic Injury (EIDL) Loan Application Deadline Date... the President's major disaster declaration on 05/24/2012, Private Non- Profit organizations that...

  12. Premarket Notifications (510(k)s)

    Data.gov (United States)

    U.S. Department of Health & Human Services — Medical device manufacturers are required to submit a premarket notification or 510(k) if they intend to introduce a device into commercial distribution for the...

  13. Basemap Framework Submission for Harvey County, KS

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — FEMA Framework Basemap datasets comprise six of the seven FGDC themes of geospatial data that are used by most GIS applications (Note: the seventh framework theme,...

  14. DCS Survey Submission for Harvey County, KS

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Survey data includes spatial datasets and data tables necessary to digitally represent data collected in the survey phase of the study. (Source: FEMA Guidelines and...

  15. Prof. KS Krishnan and Crystal Magnetism

    Indian Academy of Sciences (India)

    number of diamagnetic and paramagnetic substances. In the following, we shall describe two major con tributions of Krishnan in the field of magnetism. Firstly, he developed an ingenious technique for the accurate measurement of magnetic anisotropy of single crystals and fabricated a very simple instrument for the purpose ...

  16. Kuidas läks? / Juhan Ulfsak

    Index Scriptorium Estoniae

    Ulfsak, Juhan, 1973-

    2009-01-01

    11. veebruaril esietendus Brüsselis Kuninglikus Flaami Teatris must komöödia "Mental Finland", autor-lavastaja Kristian Smeds. Lavastuses tegid kaasa Eva Klemets ja Juhan Ulfsak. Näitleja vastab küsimusele

  17. Üks etnograafide futurism / Karlo Funk

    Index Scriptorium Estoniae

    Funk, Karlo, 1971-

    1995-01-01

    Arvustus: Waterfowl way = Vodptitsnaja doroga : A selection of articles and fiction from the conference of ethnofuturism of the young authors of the finno-ugric peoples held in Tartu from may 5 to 9, 1994 / Edited by Kauksi Ülle. Trt. : EK$, 1995

  18. Probiotics (Lactobacillus gasseri KS-13, Bifidobacterium bifidum G9-1, and Bifidobacterium longum MM-2) improve rhinoconjunctivitis-specific quality of life in individuals with seasonal allergies: a double-blind, placebo-controlled, randomized trial.

    Science.gov (United States)

    Dennis-Wall, Jennifer C; Culpepper, Tyler; Nieves, Carmelo; Rowe, Cassie C; Burns, Alyssa M; Rusch, Carley T; Federico, Ashton; Ukhanova, Maria; Waugh, Sheldon; Mai, Volker; Christman, Mary C; Langkamp-Henken, Bobbi

    2017-03-01

    Background: Rhinoconjunctivitis-specific quality of life is often reduced during seasonal allergies. The Mini Rhinoconjunctivitis Quality of Life Questionnaire (MRQLQ) is a validated tool used to measure quality of life in people experiencing allergies (0 = not troubled to 6 = extremely troubled). Probiotics may improve quality of life during allergy season by increasing the percentage of regulatory T cells (Tregs) and inducing tolerance.Objective: The objective of this study was to determine whether consuming Lactobacillus gasseri KS-13, Bifidobacterium bifidum G9-1, and B. longum MM-2 compared with placebo would result in beneficial effects on MRQLQ scores throughout allergy season in individuals who typically experience seasonal allergies. Secondary outcomes included changes in immune markers as part of a potential mechanism for changes in MRQLQ scores.Design: In this double-blind, placebo-controlled, parallel, randomized clinical trial, 173 participants (mean ± SEM: age 27 ± 1 y) who self-identified as having seasonal allergies received either a probiotic (2 capsules/d, 1.5 billion colony-forming units/capsule) or placebo during spring allergy season for 8 wk. MRQLQ scores were collected weekly throughout the study. Fasting blood samples were taken from a subgroup (placebo, n = 37; probiotic, n = 35) at baseline and week 6 (predicted peak of pollen) to determine serum immunoglobulin (Ig) E concentrations and Treg percentages.Results: The probiotic group reported an improvement in the MRQLQ global score from baseline to pollen peak (-0.68 ± 0.13) when compared with the placebo group (-0.19 ± 0.14; P = 0.0092). Both serum total IgE and the percentage of Tregs increased from baseline to week 6, but changes were not different between groups.Conclusions: This combination probiotic improved rhinoconjunctivitis-specific quality of life during allergy season for healthy individuals with self-reported seasonal allergies; however, the associated mechanism is still

  19. Briti teadlane: kübersõda ei tule / Thomas Rid ; intervjueerinud Raimo Poom

    Index Scriptorium Estoniae

    Rid, Thomas

    2013-01-01

    Sõjauuringute õppejõud Thomas Rid leiab, et internetis on palju ohte, kuid kübersõda ei ole üks neist. Ridi arvates on äärmiselt ebatõenäoline, et NATO käivitaks kunagi küberrünnaku tõttu 5. artikli. Interneti kõige suuremaks ohustajaks pole NSA, vaid vabadust piirata soovivad autoritaarsed riigid

  20. Maha turumajandus, elagu monopol! / Paul Tammert

    Index Scriptorium Estoniae

    Tammert, Paul, 1956-

    2007-01-01

    Ilmunud ka: Võrumaa Teataja, 11. sept. 2007, lk. 2; Lääne Elu, 8. sept. 2007, lk. 2; Põhjarannik, 12. sept. 2007, lk. 2; Severnoje Poberezhje, 12. sept. 2007, lk. 2; Meie Maa, 13. sept. 2007, lk. 2. Autori sõnul meenutab Eesti praegune olukord tüüpilist elitaristlikku majandust, mille keskmes on vaid üks monopoolne ettevõte absurdselt kõrgete hindadega

  1. "Tühjad on teed, kuhu rõõmuga jooksime..." : [luuletused] / Jana Lepik

    Index Scriptorium Estoniae

    Lepik, Jana

    2007-01-01

    Sisu: "Tühjad on teed, kuhu rõõmuga jooksime..." ; "Kuhu külvaja kõnnib..." ; "Sõid lapsed kõhu täis..." ; "Ei lase keha vaimul tõusta lendu..." ; "Mu laps. Nüüd kuula hoolega..." ; "Ja särab hommik haua kohal..." ; "Unes vaid tulen..." ; Sim-sala-bim ; "Liblikad linnas..." ; Katkenud lend ; "Kes kõnnib koridoris..." ; "Pane silmad kinni. See on üks teine muinasjutt..."

  2. Pole demokraatiat, pole probleemi / Vahur Made

    Index Scriptorium Estoniae

    Made, Vahur, 1971-2017

    2005-01-01

    Rets. rmt.: Fareed Zakaria. Vabaduse tulevik. Mitteliberaalse demokraatia ohud tänapäeva maailmas. Raamatu sisu võib kokku võtta lausega - tänapäeva poliitika vajab mitte rohkem, vaid vähem demokraatiat. Raamat jaguneb tinglikult kaheks, üks osa sisaldab Zakaria maailmaajaloolisi ja globaalseid spekulatsioone demokraatia ja vabaduse teemal, teises osas käsitletakse USA sisepoliitilisi arengusuundi

  3. Search for the decay B^+ \\to K_S^0 K_S^0 \\pi ^+

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.; Bona, M.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Prencipe, E.; Prudent, X.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Lopez, L.; Palano, A.; Pappagallo, M.; /INFN, Bari /Bari U.; Eigen, G.; Stugu, B.; Sun, L.; /Bergen U.; Abrams, G.S.; Battaglia, M.; Brown, D.N.; Cahn, R.N.; Jacobsen, R.G.; /LBL, Berkeley /UC, Berkeley /Birmingham U. /Ruhr U., Bochum /Bristol U. /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UCLA /UC, Riverside /UC, San Diego /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /INFN, Ferrara /Ferrara U. /INFN, Ferrara /INFN, Ferrara /Ferrara U. /INFN, Ferrara /INFN, Ferrara /Ferrara U. /Frascati /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /Harvard U. /Heidelberg U. /Humboldt U., Berlin /Imperial Coll., London /Iowa U. /Iowa State U. /Johns Hopkins U. /Orsay, LAL /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Louisville U. /Karlsruhe U., EKP /Manchester U. /Maryland U. /Massachusetts U., Amherst /MIT, LNS /McGill U. /INFN, Milan /Milan U. /INFN, Milan /INFN, Milan /Milan U. /Mississippi U. /Montreal U. /Mt. Holyoke Coll. /INFN, Naples /Naples U. /INFN, Naples /INFN, Naples /Naples U. /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /INFN, Padua /Padua U. /INFN, Padua /INFN, Padua /Padua U. /Paris U., VI-VII /Pennsylvania U. /INFN, Perugia /Perugia U. /INFN, Pisa /Pisa U. /INFN, Pisa /Pisa, Scuola Normale Superiore /INFN, Pisa /Pisa U. /INFN, Pisa /Princeton U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /Rostock U. /Rutherford /DSM, DAPNIA, Saclay /South Carolina U. /SLAC /Stanford U., Phys. Dept. /SUNY, Albany /Tennessee U. /Texas U. /Texas U., Dallas /INFN, Turin /Turin U. /INFN, Trieste /Trieste U. /Valencia U., IFIC /Victoria U. /Warwick U. /Wisconsin U., Madison

    2009-02-23

    The authors search for charmless decays of charged B mesons to the three-body final state K{sub S}{sup 0}K{sub S}{sup 0}{pi}{sup +}. Using a data sample of 423.7 fb{sup -1} collected at the {Upsilon}(4S) resonance with the BABAR detector, corresponding to (465.1 {+-} 5.1) x 10{sup 6} B{bar B} pairs, they find no significant signal and determine a 90% confidence level upper limit on the branching fraction of 5.1 x 10{sup -7}.

  4. Analyses of D+ -> K(S)0 K+ and D+ -> K(S)0 pi +

    Energy Technology Data Exchange (ETDEWEB)

    Jessop, Colin P.

    2003-05-12

    Using data collected with the CLEO II detector at the Cornell Electron Storage Ring, we present new measurements of the branching fractions for D{sup +} {yields} K{sub S}K{sup +} and D{sup +} {yields} K{sub S}{pi}{sup +}. These results are combined with other CLEO measurements to extract the ratios of isospin amplitudes and phase shifts for D {yields} KK and D {yields} K{pi}.

  5. Üks riik, üks teema, kaks festivali ... / Rait Avestik

    Index Scriptorium Estoniae

    Avestik, Rait, 1974-

    2005-01-01

    Kahest lasteteatrite festivalist, kuuendast Eestis peetud ASSITEJ NB-festivalist ja festivalist "Banaanikala 2005", kus parimateks tunnistati VAT Teatri "Kalevipoeg" ja "Pal-tänava poisid" ning Eesti Riikliku Nukuteatri "Troll-poiss"

  6. Küsimus pole MRP-s, vaid agressioonis / Enn Soovik

    Index Scriptorium Estoniae

    Soovik, Enn, 1933-2010

    2005-01-01

    Autor leiab, et on vajalik esitada Venemaale pretensioon Nõukogude Liidu poolt Eesti vastu 1939/40 toime pandud agressiooni ja selle järelmite suhtes ning mitte laskuda MRP-ga seotud viljatusse vaidlusse

  7. Gustav Suitsu õhtu järel : mitte arvustuseks, vaid arutluseks / Mati Unt

    Index Scriptorium Estoniae

    Unt, Mati, 1944-2005

    2004-01-01

    Gustav Suitsu loomingu põhjal valminud Evald Hermaküla ja Jaan Toominga lavastusest "Ühte laulu tahaks laulda" Tallinna Kirjanike Majas ja mõtetest, mis selle õhtu järel tekkisid, meenutades kaasaegse teatri isa Antonin Artaud`d, kes kohati suhtus lausa nihilistlikult kogu kultuuripärandisse

  8. Koolidiplom pole lõpp, vaid alles õpitöö algus / Liivia Anion

    Index Scriptorium Estoniae

    Anion, Liivia

    2004-01-01

    Ülevaade 2002. aastal läbi viidud politseiametnike õpimotivatsiooniuuringu tulemustest, mis sisaldasid politseis töötamise ja õpimotivatsiooni kujundavaid tegureid ning hinnanguid oma praegustele teadmistele ja edasiõppimisvajadusele. Diagramm: Õppimise olulisemad motiivid politseis

  9. Audi - midagi sellist näeb tavaliselt vaid ulmefilmides! / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2008-01-01

    Eesti juhtide külaskäigust Audi Saksamaal Ingolstadtis asuvasse tehasesse. Kommenteerivad Ilves-Extra nõukogu esimees Arvo Kivikas, Mecro AS nõukogu esimees Ando Aron, AB Medical Group OÜ juhataja Marko Kalle. Lisa: Audi AG

  10. Rahvas : automaks aitaks vaid eelarveauke täita! / Viktoria Jürmann

    Index Scriptorium Estoniae

    Jürmann, Viktoria

    2008-01-01

    Ilmunud ka: Stolitsa 8. sept. 2008, lk. 4. Uuringufirma Klaster teostatud uuringust selgus, et 2/3 Tallinna elanikest ei poolda valitsuse automaksu kehtestamise ideed. Vt. samas: Kas pooldate automaksu kehtestamist? Diagramm: Mis eesmärke teeniks Teie arvates automaksu kehtestamine?

  11. Tartu kooliõpetajate seas leidus vaid üksikuid streigimurdjaid / Martin Pau

    Index Scriptorium Estoniae

    Pau, Martin, 1975-

    2003-01-01

    4. detsembril streikinud Tartu õpetajad parandasid ärajäänud tundide ajal koolivihikuid, pidasid streigikoosolekuid ning leidsid, et neil on enamiku lapsevanemate tugi. Leidus ka õpetajaid, kes keeldusid streikimast

  12. Iraani president saatis Bushile vaid küsimusi / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    Iraani president Mahmoud Ahmadinejad saatis 8. mail USA presidendile George W. Bushile kirja, milles ennustab Lääne ideaalide ja ühiskonna peatset hävingut ning püüab selgitada, kuidas maailma edasistest kriisidest päästa. Lisa: Katkeid Iraani presidendi kirjast

  13. Norman Aas: vaid õiguskaitsele lootes võidab JOKK-mõtlemine / Norman Aas

    Index Scriptorium Estoniae

    Aas, Norman, 1975-

    2009-01-01

    Peaprokurör selgitab intervjuus, et prokuratuuri süüdistamine korruptsioonis õõnestab usku demokraatiasse. Õiglast õigusemõistmist peavad toetama poliitilise, majandusliku ja kultuurieliidi väärtushinnangud

  14. Rahvas pole väsinud reformidest, vaid tühjadest lubadustest / Toomas Hendrik Ilves

    Index Scriptorium Estoniae

    Ilves, Toomas Hendrik, 1953-

    2010-01-01

    Vabariigi Presidendi kõne Riigikogu uue hooaja avaistungil 13. septembril 2010. a. Lüh. Ilmunud ka: Õhtuleht 14. sept. 2010, lk. 8, pealk.: Kes me tahame riigina olla?; Sakala 14. sept. 2010, lk. 5, pealk.: President kutsus seadma uusi sihte; Pärnu Postimees 15. sept. 2010, lk. 15, pealk.: Kes me tahame ühiskonna ja riigina olla?. Tsitaat kõnest ilmunud ka: Järva Teataja 14. sept. 2010, lk. 6; Postimees 15. sept. 2010, lk. 2; Meie Maa 15. sept. 2010, lk. 2; Järva Teataja 16. sept. 2010, lk. 2

  15. Ei hoopiski päikeselisel Mauritiusel, vaid Eestis / Jaan Jürine

    Index Scriptorium Estoniae

    Jürine, Jaan, 1946-

    2008-01-01

    30. jaanuarist 2. veebruarini mängitakse Coral Clubi siseväljakuil FedCupi Euro-Aafrika tsooni teise liiga turniir. Eesti naiskonnale pakuvad konkurentsi Iirimaa, Kreeka Türgi, LAV, Bosnia ja Leedu

  16. Eduka ettevõtte aluseks saab olla vaid looming / Ave Schmidt

    Index Scriptorium Estoniae

    Schmidt, Ave

    2010-01-01

    Tänapäeva ettevõttele tagavad konkurentsieelise inspiratsioon ja originaalsed ideed. Arvamust avaldavad Tallinna kohviku Nop asutaja Margit Aasmäe, Estonian Airi arendusdirektor Gunnar Mägi, Tallinna Kaubamaja müügi- ja turundusdirektor Enn Parel ja Balteco disainijuht Aivar Habakukk

  17. "Okupeerigem kogu maailm" tekitas tõelise mürgli vaid Roomas / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2011-01-01

    Protestiaktsioonidest Roomas, Londonis, New Yorgis jm. "Okupeerigem Wall Street" tõi 15 oktoobril maailmas tänavaile inimesi ligemale 1500 linnas ja enam kui 80 riigis. Autor märgib, et New Yorgi protest väljendab tüüpilist keskklassi unistust odavast heaolust

  18. Eesmärgiks saab olla vaid mõistlik elukorraldus / Kalev Kotkas

    Index Scriptorium Estoniae

    Kotkas, Kalev, 1960-

    2008-01-01

    Ilmunud ka: Sotsiaaldemokraat okt. nr. 133 lk. 6. Riigikogu maaelukomisjoni esimehe sõnul on Eesti haldusterritoriaalse reformi süsteemitu käsitlemine tekitanud omavalitsustasandil palju asjatuid probleeme ja pingeid

  19. Toomas Luman : nutavad ja halavad vaid rumalad! / Toomas Luman ; interv. Toivo Tänavsuu

    Index Scriptorium Estoniae

    Luman, Toomas, 1959-

    2008-01-01

    Kaubandus-Tööstuskoja juht ja AS-i Eesti Ehitus omanik kommenteerib majanduslangust Eestis ning leiab, et ettevõtted peaksid majandusliku edu saavutamiseks tootma rohkem lisandväärtusega tooteid. Lisa: Luman: miks pole maadevahetuse asi kohtusse jõudnud?

  20. Suitsupaki omahind on vaid 2.20 / Toivo Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Toivo

    2007-01-01

    Tubakafirmad kinnitavad üheselt, et vaatamata riiklikele keeldudele ja piirangutele on nende ärid kasumlikud. Lisa: Tubakareklaami lipulaev Saksamaa. Vt. samas: Portugalis ei lasta sportlasi suitsuruumidesse

  1. USA mõtleja : vaid rikkus riiki koos ei hoia / Robert Putnam ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Putnam, Robert

    2006-01-01

    USA Harvardi ülikooli politoloogiaprofessori Robert Putnami arvates on etniliselt mitmekesistes riikides ühtsustunde loomine raske, selle saavutamisele aitaksid kaasa ühiskonna pingevabam enesemääratlus ning paindlikumad töögraafikud naistele ühendamaks pere tööga. Lisa: Üksi või koos?

  2. Afgaane ei saa aidata vaid läbi soomuki akna / Toomas Sildam

    Index Scriptorium Estoniae

    Sildam, Toomas, 1961-

    2005-01-01

    Põhja-Afganistani Mazar-e-Sharifi linnas brittide juhtimisel tegutseva provintsi ülesehitusmeeskonna koosseisu kuulub kaks Eesti üksust - vaatlusmeeskond ja Eesti kaitseväe demineerijate rühm. Kaitseministeeriumi plaani kohaselt saadetakse 2006. aastal Lõuna-Afganistani ligi 120 Eesti sõdurit. Kaart. Vt. samas lühiintervjuud kapten Tiit Paljakuga: Kapten Tiit Paljak: me ei tee afgaanide eest kõike ära

  3. Midagi enamat kui vaid tasuta töö / Sirje Pärismaa

    Index Scriptorium Estoniae

    Pärismaa, Sirje, 1958-

    2016-01-01

    Vabatahtlikust tegevusest. Oma kogemustest vabatahtlikuna räägib Tallinna reaalkooli 11. klassi õpilane Tomi-Andre Piirmets, kes tegi ka uurimistöö gümnaasiuminoorte aktiivsusest vabatahtlikus tegevuses

  4. Mitte uhke, vaid omanäoline ja hubane / Ell-Maaja Randküla

    Index Scriptorium Estoniae

    Randküla, Ell-Maaja, 1939-2016

    2005-01-01

    Tallinnas Aaviku elurajoonis asuva eramu sisekujundus. Sisearhitekt Tiiu Truus, AB Studio 3. Ehitaja: KMG Ehitus. Põrandad on betoonist, viimistlusmaterjalideks vineer, plekk ja mööblilinoleum. T. Truus on kavandanud ka osa mööblist. T. Truusist, tema tähtsamad tööd. Ill.: 2 plaani, 9 värv. vaadet

  5. Boksis ei tohi olla vaid müügimehed / Tiit Sarv

    Index Scriptorium Estoniae

    Sarv, Tiit, 1957-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 18. apr. lk. 14. Erinevat tüüpi messikülastajate tundmine ning nendega arvestamine lisab messil osalemisele efektiivsust. Kommenteerivad: Taivo Lõhmus, Toini Aps ja Raivo Vilbaste. Vt. samas: Messikülastajatel erinevad huvid; Messi valides tähtis otsustajate kohaletulek; Toidumessi külastajad tulevad end harima

  6. Säästmiseks on tarvis vaid eesmärke ja pealehakkamist / Margit Aedla

    Index Scriptorium Estoniae

    Aedla, Margit, 1970-

    2004-01-01

    Märt Meerits Ühispangast, Baltic Asset Management AS-i arendusjuht Peeter Schamardin, Mattias Mustonen Hansapangast, Kaidi Oorn rahandusministeeriumist ning Helo Meigas Hansapangast laenude, säästmise, investeeringute, tarbimise tähtsusest Eesti ühiskonnas. Diagrammid. Graafik

  7. Viktor Siilats : pole tähtis, millega tegeled, vaid kellega koos tegeled / Mart Raudsaar

    Index Scriptorium Estoniae

    Raudsaar, Mart, 1973-

    2003-01-01

    Auto-, video- ja kaatriärimees, Info Ettevõtete Grupi juhi Viktor Siilatsi karjäärist, partnerlusest Rootsi ajakirjaniku Andres Küngiga ning koostööst Volvo Cars Intercontinentaliga. Lisa: Viktor Siilatsi CV

  8. Euro pole eesmärk, vaid vahend heaolu poole / Jüri Ratas

    Index Scriptorium Estoniae

    Ratas, Jüri, 1978-

    2009-01-01

    Riigikogu liige kritiseerib IRLi juhi Mart Laari tegevust peaministrina ja mõtet, et Eesti peab seadma üheseks ja kõiki teisi prioriteete allutavaks tegevussuunaks eurole ülemineku. Ta leiab, et eurole üleminek peab olema osa meie pikaajalisest strateegiast

  9. Briti kaitseminister: kärped saavad olla vaid ajutised / Liam Fox ; intervjueerinud Priit Simson

    Index Scriptorium Estoniae

    Fox, Liam, 1961-

    2011-01-01

    Intervjuu Eestit külastanud Suurbritannia kaitseministriga. Ministri sõnul on vastutustundetu ühineda NATO-ga ning muudkui lõigata kaitse-eelarvet ja riigi panust sõltumata rahalistest tingimustest. Suurbritannia sõjalistest investeeringutest, kaitsele "ehituskivi põhimõttel" lähenemisest

  10. Kunstioksjonil müüdi vaid neljandik töödest

    Index Scriptorium Estoniae

    1999-01-01

    Rahvusraamatukogus toimunud galerii Riose kunstioksjonil müüdi 45-st enampakkumisele pandud tööst ainult 11. Kalleima hinnaga müüdi Paul Raua maal "Lühikese jala vaade" (51000 krooni). Ostmata jäänud töid

  11. Eesti toit jääb püsima vaid meie kaasabil / Ester Tuiksoo

    Index Scriptorium Estoniae

    Tuiksoo, Ester, 1965-

    2005-01-01

    Vt. ka Delovõje Vedomosti 17. aug. lk. 6, Virumaa Teataja 18. aug, lk. 7, Nädaline : Talu Leht 18. aug., lk. 10, Lääne Elu 18. aug., lk. 2, Lõunaleht 18. aug. lk. 2, Põhjarannik, 19. aug, lk. 2 Severnoje Poberezhje 19. aug., lk. 2, Vali Uudised 19. aug., lk. 2, Sakala 19. aug., lk. 2, Harjumaa 19. aug. lk. 2, Valgamaalane 23. aug., lk. 2, Hiiu Leht 23. aug., lk. 2, Koit 23. aug. lk. 6, Meie Maa 25. aug. lk. 5, Narvskaja Nedelja 5. nov. lk. 5. Põllumajandusminister põhjendab arengukava "Eesti toit" vajalikkust ja selgitab arengukava eesmärke

  12. Hiina eksperte on Eestis vaid käputäis / Kai Kreos

    Index Scriptorium Estoniae

    Kreos, Kai

    2016-01-01

    Tartu ülikooli, Tallinna tehnikaülikooli ja Tallinna ülikooli ühisest Aasia-teemalisest magistriõppekavast, mille eesmärk on kujundada välja arvestatav pädevus teadmistes tänapäeva Hiina kohta. Sügisest alustav magistriõppekava keskendub eelkõige praegusaja Aasia ühiskondade, majanduse ja poliitika õpetamisele. Vestlusest Hiina asjatundjate Urmas Pappeli ja Tauno Tõhkiga õppekavast

  13. Lactobacillus gasseri KS-13, Bifidobacterium bifidum G9-1, and Bifidobacterium longum MM-2 Ingestion Induces a Less Inflammatory Cytokine Profile and a Potentially Beneficial Shift in Gut Microbiota in Older Adults: A Randomized, Double-Blind, Placebo-Controlled, Crossover Study.

    Science.gov (United States)

    Spaiser, Samuel J; Culpepper, Tyler; Nieves, Carmelo; Ukhanova, Maria; Mai, Volker; Percival, Susan S; Christman, Mary C; Langkamp-Henken, Bobbi

    2015-01-01

    This study determined whether older adults who consumed a probiotic mixture would have a greater proportion of circulating CD4+ lymphocytes, altered cytokine production, and a shift in intestinal microbiota toward a healthier microbial community. Participants (70 ± 1 years [mean ± SEM]; n = 32) consumed a probiotic (Lactobacillus gasseri KS-13, Bifidobacterium bifidum G9-1, and Bifidobacterium longum MM2) or a placebo twice daily for 3 weeks with a 5-week washout period between intervention periods. Blood and stools were collected before and after each intervention. The percentage of circulating CD4+ lymphocytes and ex vivo mitogen-stimulated cell cytokine production were measured. In stools, specific bacterial targets were quantified via quantitative polymerase chain reaction (qPCR) and community composition was determined via pyrosequencing. During the first period of the crossover the percentage of CD4+ cells decreased with the placebo (48% ± 3% to 31% ± 3%, p < 0.01) but did not change with the probiotic (44% ± 3% to 42% ± 3%) and log-transformed concentrations of interleukin-10 increased with the probiotic (1.7 ± 0.2 to 3.4 ± 0.2, p < 0.0001) but not the placebo (1.7 ± 0.2 to 2.1 ± 0.2). With the probiotic versus the placebo a higher percentage of participants had an increase in fecal bifidobacteria (48% versus 30%, p < 0.05) and lactic acid bacteria (55% versus 43%, p < 0.05) and a decrease in Escherichia coli (52% versus 27%, p < 0.05). Several bacterial groups matching Faeacalibactierium prausnitzii were more prevalent in stool samples with the probiotic versus placebo. The probiotic maintained CD4+ lymphocytes and produced a less inflammatory cytokine profile possibly due to the changes in the microbial communities, which more closely resembled those reported in healthy younger populations.

  14. Üks doktor ja kaks magistrit / Halliki Uibu

    Index Scriptorium Estoniae

    Uibu, Halliki

    2001-01-01

    18. juunil 2001 toimus TPÜ kultuuriajaloo kaitsmisnõukogus Lauri Lindströmi doktoritöö "Album Academicum Universitatis Tartuensis 1918-1944. Rahvus, sugu, sünni- ja keskhariduse omandamise koht üliõpilaskonna kujunemist ja kõrghariduse omandamist mõjutavate teguritena" kaitsmine. Lauri Lindströmile omistati teaduskraad doctor philosophiae (PhD) kultuuriajaloo alal. TPÜ kultuuriajaloo magistrikraadi kaitsmisnõukogus kaitsesid 18. juunil 2001 Igor Tõnurist magistritööd "Pillid ja pillimäng eesti külaelus" ja Tatjana Tšervova magistritööd "Vene kogukonna ühiskondlikust ja kultuurielust Tallinnas 1880-1905". Igor Tõnuristile ja Tatjana Tšervovale omistati teaduskraad magister artium kultuuriajaloo alal hindega cum laude

  15. WTO uks läks Venemaa ees lukku

    Index Scriptorium Estoniae

    2008-01-01

    Pärast Gruusia konflikti USA kaubandusministri Carlos Gutierreze Venemaa WTO-sse astumise vastast avaldust ütles Venemaa lahti mitmest WTO-ga sõlmitud lepingust ning on juba varemgi loobunud läbirääkimiste käigus järeleandmiste tegemisest

  16. Kuidas läks? / Helen Sooväli

    Index Scriptorium Estoniae

    Sooväli, Helen, 1974-

    2009-01-01

    Tallinna Ülikoolis esitleti virtuaalkeskkonnas Second Life Eestit välisriikides tutvustav rändnäitus "Pildistatud Eesti". Fotode autoriteks on Annika Haas, Birgit Püve, Ingmar Muusikus ja Gabriela Järvet. Näituse kuraator Helen Sooväli. Näitus avati esmalt Eesti saatkonna hoones Washingtonis

  17. Rõuge park on üks ilusamaid Võrumaal / Ivi Kaarna

    Index Scriptorium Estoniae

    Kaarna, Ivi

    2007-01-01

    Inglise vabastiilis Rõuge pargist, mille 1895-1898 rajas mõisnik Samson von Himmelstjerna. Pargis on Tiiu Kirsipuu skulptuur "Kaarnakivi". Pargi korrastamisprojekti tegi Reti Randoja-Muts. Kommentaarid pargi ja säilinud hoonete kohta Jaan Allaselt. Illustratsioon: Viive Kuksi "Rõuge park"

  18. Animated Dreamsi peaauhind läks Tšiili

    Index Scriptorium Estoniae

    2009-01-01

    Pimedate Ööde 13. filmifestivali teise alafestivali Animated Dreams auhinnasaajad : võitis Cristobal Leoni, Niles Atallah' ja Joaquin Cocina "Lucia", Anoba nominatsiooni sai Kaspar Jancise "Krokodill"

  19. DIGITAL FLOOD INSURANCE RATE MAP DATABASE, CLOUD COUNTY, KS

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Digital Flood Insurance Rate Map (DFIRM) Database depicts flood risk information and supporting data used to develop the risk data. The primary risk...

  20. "Pingviinide marss" - aasta üks edukamaid filmiteekondi / Triin Thalheim

    Index Scriptorium Estoniae

    Thalheim, Triin, 1982-

    2005-01-01

    Prantsusmaa 2005.a. dokumentaalfilm "Pingviinide marss" ("La Marche de l'empereur") : režissöör Luc Jacquet. Muuhulgas esitatakse filmikriitikute seisukohti - kas tegemist on loodusfilmiga või traditsiooniliste pereväärtuste propagandaga

  1. Üks PÖFF, tuhat maailma / Mathura

    Index Scriptorium Estoniae

    Mathura, pseud., 1973-

    2006-01-01

    Autorit enim köitnud filmidest PÖFFil: "Paani labürint" (režissöör Guillermo del Toro, Mehhiko-Hispaania, 2006), "Lillede org" (režissöör Pan Nalin, India-Prantsusmaa-Saksamaa-Jaapan, 2006), "Opera Jawa" (režissöör Garin Nugroho, Indoneesia-Austria, 2006), "Tsotsi" (režissöör Gavin Hood, LAV-Inglismaa, 2005), "Põuaperiood" (režissöör Mahamat-Saleh Haroun, Tšaad-Prantsusmaa-Belgia-Austria, 2006), "Meeletu" (režissöör Elmo Nüganen, Eesti, 2006), "Lahtikistud mees" (režissöör Aku Louhimies, Soome, 2006)

  2. City of Leavenworth, KS - Clean Water Act Public Notice

    Science.gov (United States)

    The EPA is providing notice of a proposed Administrative Penalty Assessment against the City of Leavenworth, Kansas, a municipality located at 100 N. 5th Street, Leavenworth, Kansas for alleged violations of its National Pollutant Discharge Elimination Sys

  3. Üks kordaläinud joonistuskonkurss / Tiina Vapper

    Index Scriptorium Estoniae

    Vapper, Tiina, 1955-

    2014-01-01

    Jäätisetootja Balbiino jäätisepaberi kujundamise konkursist. Lasteaialastel ja põhikooliõpilastel oli võimalus ise välja mõelda „Minu jäätise” jäätisepaber. Konkursi võitis kolmeaastane Pauline Tanis Tallinna Nurmenuku lasteaiast õpetaja Reena Uusmetsa juhendamisel

  4. Üks päev Eesti kinos I

    Index Scriptorium Estoniae

    1995-01-01

    Briti Filmiinstituudi algatatud ülemaailmse küsitluse "One day in the life of World Cinema" raames küsiti, "mis toimus eesti kinos 10. juunil 1993?". Vastavad K. Kiisk, H. Volmer, P. Simm, A. Ruus, J. Põldma, R. ja H. Lintrop. Sissejuhatus Jaan Ruusilt. Järgneb TMK 1995, nr. 2

  5. Hiinlasest Shakespeare'ks. Eestlasest Shakespeare / Udo Uibo

    Index Scriptorium Estoniae

    Uibo, Udo, 1956-

    2011-01-01

    Ajalehe "Shanghai Daily" (21.04 2011) teatel kavatsevat hiina kirjanik Zhang Yiyi oma viimase menuk aromaaniga teenitud 1, 2 miljonit jüaani (u. 153 00 dollarit) kulutada iluoperatsioonile, mille eesmärgiks on muuta nägu William Shakespeare'i sarnaseks. Nii olla artikli autor okupatsiooni ajal näinud Ain Kaalepil ainult Shakespeare'i sonettidest koosnevat käsikirja, mida kaunistas tema portree soenguga à la Shakespeare'i

  6. Tants - üks viis edastada kehalist kogemist / Evelin Lagle

    Index Scriptorium Estoniae

    Lagle, Evelin, 1986-

    2008-01-01

    Helsingi teatriakadeemia tantsukompanii TADaC Kumus 25. III 2008: Ervi Siren "Seize the Moment - Snatch, Catch, Enjoy", Jyrki Karttunen "Dramatic Miniatures", Maria Saivosalmi ja Andrius Katinas "Farewell Anna Karenina", Jenni Kivelä "Scrapbook for Rainy Days", Ari Tenhula videomäng/installatsioon "Entr'acte"

  7. TERRAIN, City of El Dorado, Butler County, KS

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Terrain data, as defined in FEMA Guidelines and Specifications, Appendix M: Data Capture Standards, describe the digital topographic data that were used to create...

  8. Üks võõramaine lind

    Index Scriptorium Estoniae

    1999-01-01

    lühirefereering Rootsi maastikuarhitektide ajakirja "Utblick/Landskap" 1998.a. erinumbris "Tre profiler" ilmunud Tove Jonstoj'i 8-leheküljelisest artiklist eesti päritolu aiaarhitektist Hele Lüüsist

  9. Eesti kirjandus läks üle piiri

    Index Scriptorium Estoniae

    2015-01-01

    Ingliskeelse kirjandusliku veebiajakirja "Words Without Borders" (http://www.wordswithoutborders.org/) oktoobrinumber oli pühendatud eesti kirjandusele. USA kirjastuselt "Dalkey Archive Press" ilmus Mihkel Muti romaani "Kooparahvas läheb ajalukku" tõlge

  10. Suitsetamise kolm valet ja üks idee / Kaur Kender

    Index Scriptorium Estoniae

    Kender, Kaur, 1971-

    2005-01-01

    Autor purustab kolm suitsetamise mahajätmisega seotud müüti, mis ütlevad esiteks, et mahajätmine on raske, teiseks, et nikotiinist loobudes tekib hea enesetunne ning kolmandaks, et suitsetatakse sotsiaalse rituaali, mitte nikotiinisõltuvuse pärast

  11. K.S. Micro‑Implant Placement Guide

    African Journals Online (AJOL)

    Kuroda S, Yamada K, Deguchi T, Hashimoto T, Kyung HM,. Takano‑Yamamoto T. Root proximity is a major factor for screw failure in orthodontic anchorage. Am J Orthod. Dentofacial Orthop 2007;131:S68‑73. 3. Asscherickx K, Vannet BV, Wehrbein H, Sabzevar MM. Root repair after injury from mini‑screw. Clin Oral Implants ...

  12. SURVEY, City of El Dorado, Butler County, KS

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Survey data includes spatial datasets and data tables necessary to digitally represent data collected in the survey phase of the study. (Source: FEMA Guidelines and...

  13. Üks uitmõte / Margot Visnap

    Index Scriptorium Estoniae

    Visnap, Margot, 1959-

    2006-01-01

    6. apr. NO99 teatris esietendunud Andrei Tarkovski ja vendade Strugatskite stsenaariumi järgi loodud filmil põhinevast lavastusest "Stalker", lavastaja Sebastian Hartmann ja kunstnik Peter Schubert (mõlemad Saksamaalt)

  14. Eesti majandus üks maailma vabamaid / Warren K Christolon

    Index Scriptorium Estoniae

    Christolon, Warren K

    2000-01-01

    Varajane vabaturu ja kapitalistliku algatuse juurutamine Eestis peale iseseisvuse saavutamist N. Liidust toodab tähelepanuväärseid tulemusi eestimaalastele. Ülemaailmse majandusliku vabaduse hinnangul on Eesti 14. kohal. Ilmunud ka: Postimees 28. nov. lk. 11

  15. Heidmetsa film Stuttgardis üks publiku lemmikuid

    Index Scriptorium Estoniae

    2004-01-01

    Stuttgardi animafilmide festivali võistlusprogrammis olid Eestist Rao Heidmetsa "Instinkt" ja Hardi Volmeri "Barbarid" stuudiolt Nukufilm ja Priit Pärna "Karl ja Marilyn" ning Ülo Pikkovi "Ahviaasta" Eesti Joonisfilmilt. Lastefilmide seas võistleb Pärtel Talli "Porgand". Telepubliku telefonihääletusel sai "Instinkt" teise koha, saades preemiaks 4000 eurot

  16. Maailma turismimagnet number üks on Prantsusmaa / Tõnu Prei

    Index Scriptorium Estoniae

    Prei, Tõnu, 1950-

    2004-01-01

    Maailma Turismiorganisatsiooni (WTO) andmeil kasvab turism aastas umbes 4%, sealjuures looduspiirkondade külastatavus 8-10% aastas. Tabelid: Maailma enamkülastatavad turismimaad 2004. a.; Turismist enam tulu teenivad maad 2003. a.

  17. Pink läks pikemaks... / Margit Tõnson

    Index Scriptorium Estoniae

    Tõnson, Margit, 1978-

    2007-01-01

    20. sept. VAT Teatris esietendunud Eesti Muusika ja Teatriakadeemia Lavakunstikooli lavastajate õppesuuna tudengite koolitööst "Pink", mis koosneb kahest iseseisvast loost - Jon Fosse "Talv", lavastaja Robert Annus ja Edward Albee "Loomaaialugu", lavastaja Uku Uusberg. Lisaks küsimus "Aare Toikka, kuidas noored lavastajatudengid VAT Teatri tiiva alla sattusid?"

  18. Esimene ports elektrit läks Soome

    Index Scriptorium Estoniae

    2006-01-01

    Ilmunud ka: Linnaleht : na russkom jazõke 24. nov. lk. 1. Firma ABB merealuse kaabli Estlink testimisest ja esimeste elektrikoguste Soome edastamisest. Projekti partneriteks on Eesti, Läti, Leedu ja Soome energiaettevõtted

  19. Keskkonnakaitse Nobel läks apalatshile / Arni Alandi

    Index Scriptorium Estoniae

    Alandi, Arni, 1969-

    2003-01-01

    Goldmani keskkonnapreemia võitis Julia Bonds. Ülejäänud preemiad jagunesid maailma eri paikadesse. Nende saajad olid Odigha Odigha, Von Hernandez, Maria Elena Foronda Farrol, Pedro Arrojo-Agudo, Eileen Kampakuta Brown ja Eileen Wani Wingfield

  20. General Motorsi faas üks : tunnistamine / Tarvo Vaarmets

    Index Scriptorium Estoniae

    Vaarmets, Tarvo

    2008-01-01

    Kütusehinna tõusu tõttu on General Motors vähendanud suure kütusekuluga mudelite tootmist ning on võtnud suuna ökonoomsemate autode tootmisele. Vt. samas: Aasia tootjad võtavad võimu. Diagrammid: Majandusnäitajad; Aktsia hind

  1. Üks maailm, üks raha? / Robert Mundell, Milton Friedman ; tõlk. Maris Kaskmann

    Index Scriptorium Estoniae

    Mundell, Robert

    2004-01-01

    Majanduslikest kaalutlustest fikseeritud või ujuva vahetuskursi kasuks otsustamisel, USA, Kanada ja Iirimaa rahapoliitikast, euro käibelelaskmise tagajärgedest, 1944. a. loodud Bretton Woodsi fikseeritud vahetuskursi süsteemist, kullastandardist ja maailmaraha ideest

  2. Tallinna võim on libastumine?

    Index Scriptorium Estoniae

    2005-01-01

    Elmar Sepp ja Tõnis Palts vastavad küsimusele, mis puudutab Taavi Veskimäe väidet, et Res Publica koostöö Tallinnas on Res Publica suurima poliitilise libastumise tagajärg. Elmar Sepp ei välista sügisestel valimistel Keskerakonna ja Res Publica koostöö jätkumist Tallinnas, tema sõnul ei ole Keskerakond mitte totalitaarne, vaid Eesti üks demokraatlikumaid erakondi. Vt. samas: Katkend Taavi Veskimäe kõnest Res Publica üldkogul

  3. Tõestamata kahtlused heidavad varju : Tiit Kuusiku vahi alt vabastamise eest maksmine on vaid väidetav / Toomas Mattson

    Index Scriptorium Estoniae

    Mattson, Toomas, 1970-

    1997-01-01

    Politsei salajaste agentuuriteadete avalikustamine on ohtlik. K. Pikaro infobüroo Ius Dicere läbiotsimisel leitud agentuuriteade failist, mis käsitleb relvaärimehe T. Kuusik, N. Seli, Ü. Hage suhteid

  4. Alati peab olema valmis mitte ainult plaan B, vaid ka C, D, E ... / Ülle Järv

    Index Scriptorium Estoniae

    Järv, Ülle, 1958-

    2008-01-01

    Ilmunud ka: Finansovõi Menedzhment : infovõpusk nr. 22 märts lk. 8-9. Baltika strateegiline pööre sisaldas kolme teemat: uue strateegia finantseerimine, uue finantsaruandlussüsteemi ülesehitamine ning riskide määratlemine ja juhtimine

  5. Iisraeli tuleb kas lõplik rahu või jääb vaid lootus / Sten A. Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Sten A., 1979-

    2005-01-01

    Autor analüüsib Iisraeli ja Palestiina tegevust peale vägivallast loobumise kokkuleppe sõlmimist Iisraeli peaministri Ariel Sharoni ja palestiinlaste liidri Mahmoud Abbasi vahel. Lisa: Terroristide provokatsioonid

  6. Pole vaja palju, vaid väärt esemeid / Julia Maria Künnap ; intervjueerinud Reet Varblane

    Index Scriptorium Estoniae

    Künnap, Julia Maria

    2010-01-01

    Julia Maria Künnapi disainitud lastetool "Mari" pälvis Red Doti disainipreemia. Auhind antakse üle Esseni Aalto teatris 5. juulil, tunnustatud töid eksponeeritakse näitusel Esseni Disainimuuseumis 6.07.-1.08.2010. Kunstnik ehtekunstist, disainist, enda loodud ehetest, Red Doti konkursist, tooli "Mari" tootmise võimalustest

  7. Eesti tööstuse areng on vaid kohalike ettevõtjate kätes / interv. Raul Kalev

    Index Scriptorium Estoniae

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke : Tehnika i Proizvodstvo 9. juuni lk. 1,4-5. Vestlusringis Eesti tööstuse perspektiividest osalesid majandus- ja kommunikatsiooniminister Juhan Parts, lehtmetalli töötleva AS Favor omanik Almar Proos, AS Baltika juht Meelis Milder ja tööandjate keskliidu juht Tarmo Kriis

  8. Kommunikatsioon ei ole vaid sõnum / Alfredo Jaar ; intervjueerinud Maria-Kristiina Soomre ja Reet Varblane

    Index Scriptorium Estoniae

    Jaar, Alfredo, 1956-

    2010-01-01

    Tšiili nüüdiskunstnik Alfredo Jaar, kes esitles 14. aprillil Kumu auditooriumis oma filmi itaalia filmirežissöörist ja kirjanikust Pier Paolo Pasolinist "Pasolini tuhk" (USA, 2009), endast, oma loomingust, eri arengutasemega maade kunstnike osalemisest biennaalidel, kunstniku sõltumatusest, praeguse kunsti ja publiku lõhest, kunstiteose kommunikatiivsusest, maailma muutmisest kunsti abil jm.

  9. Mikko Fritze : kultuuripealinna ei tehta vaid turistide ja ametnike lõbustamiseks / Mikko Fritze ; interv. Liina Ristoja

    Index Scriptorium Estoniae

    Fritze, Mikko, 1963-

    2008-01-01

    Sihtasutuse Tallinn Euroopa Kultuuripealinnaks 2011 juht Mikko Fritze vastab küsimustele, mis puudutavad kultuuripealinna tiitli mõjusid Tallinna linnale ning Eesti kultuurielule. Kommenteerib Peeter Jalakas

  10. John Kjaer : Nõukogude Liitu ja euroliitu seob vaid sõna "liit" / John Kjaer ; interv. Tuuli Koch

    Index Scriptorium Estoniae

    Kjaer, John

    2003-01-01

    Euroopa Komisjoni delegatsiooni juht Eestis John Kjaer vastab küsimustele, mis puudutavad Edgar Savisaare kõnet Keskerakonna kongressil, kus ta võrdles NSV Liitu Euroopa Liiduga; peamisi erinevusi EL-i ja totalitaarriigi vahel, otsuste langetamise põhimõtteid EL-is

  11. Telelegend Leo Karpin : ETV uus juhtkond teeb vaid lammutustööd / Leo Karpin ; interv. Verni Leivak

    Index Scriptorium Estoniae

    Karpin, Leo, 1946-2014

    2004-01-01

    Pea 40 aastat Eesti Televisioonis töötanud telerežissöör oma teletöölt lahkumise põhjustest. Lisaks kommentaar "ETV juhatuse esimees Ilmar Raag, miks tunnustatud telemees Leo Karpin ametist vabastati?"

  12. Roger Mitchell : Maailma päästmine pole vaid teadlaste asi / Roger Mitchell ; interv. Silvia Lotman

    Index Scriptorium Estoniae

    Mitchell, Roger

    2006-01-01

    Earthwatch Instituut on ülemaailmne organisatsioon, mille missiooniks on kaasata vabatahtlikke ja teadlasi, levitamaks säästva arengu sõnumit. Instituuti tutvustab teaduse ja hariduse osakonna direktor Roger Mitchell

  13. Iraagis võivad piiranguteta sõdida vaid USA ja Eesti / Ants Laaneots ; interv. Urmo Soonvald

    Index Scriptorium Estoniae

    Laaneots, Ants, 1948-

    2007-01-01

    Intervjuu kaitseväe juhataja Ants Laaneotsaga Eesti sõdurite teenistusest Iraagis ja Afganistanis. Vt. samas: Kaitseväelased pole palgaga rahul; BBCil Bagdadis koguni oma tänav; Ihukaitsjatele 1000 dollarit päevas

  14. Inimesed kasutavad ID-kaardi väärt võimalustest vaid väheseid / Holger Roonemaa

    Index Scriptorium Estoniae

    Roonemaa, Holger

    2006-01-01

    SA E-Riigi Akadeemia direktori Ivar Tallo väitel on riik jätnud tegemata teavitustöö ID-kaardi kasutusvõimaluste kohta. Lisad: Kauplus kasutab kliendikaardina ID-kaarti; E-hääletamine keset Parmat

  15. Allan Martinson: eestlastel jääb edu saavutamiseks puudu vaid tahtmisest / Allan Martinson ; interv. Andres Reimer

    Index Scriptorium Estoniae

    Martinson, Allan, 1966-

    2009-01-01

    Riskikapitalist Allan Martinson vastab küsimustele, mis puudutavad valitsuse tegevust Eesti kriisist välja toomiseks, puudujääke Eesti tehnoloogiaäris, ettevõtjate tegevust kriisiolukorras, infotehnoloogiaäri arengut, Eesti infotehnoloogiasektori eksporti, investori jaoks huvi pakkuvaid investeerimisobjekte ning edukaid müügikõlblikke ettevõtteid Eestis

  16. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Silicibacter pomeroyi DSS-3] ... Length = 124 ... Query: 1 ... MQKQGHPAMTDPQPSGELTLRTLAMPRDVNVNGDIFGGWVLSQ...MDIXXXXXXXXXXXXXX 60 ... MQKQGHPAMTDPQPSGELTLRTLAMPRDVNVNGDIFGGWVLSQMDI ... ... ... Sbjct: 1 ... MQKQGHPAMTDPQPSGELTLRTLAMPRDVNVNGDIFGGWVLSQMDIAAGLTAGARAGGRV 60 ... Query: 121 VAID 124 ... VAID Sbjct: 121 VAID 124

  17. President Ilves võõrustas Kanada ministrit Peter Van Loan'i

    Index Scriptorium Estoniae

    2010-01-01

    President Toomas Hendrik Ilves kohtus 9. juulil 2010 Ärmal Kanada väliskaubandusministri Peter Van Loan'iga, kes mõjuka parlamendi- ja valitsuspoliitikuna aitas oluliselt kaasa Kanada valitsuse otsusele anda Eesti kodanikele viisavabadus

  18. Üks pluss üks on enam kui kaks. Nii ütleb Ott Karulin / Ott Karulin ; interv. Andres Keil

    Index Scriptorium Estoniae

    Karulin, Ott, 1980-

    2008-01-01

    Kevadel asutatud Eesti Teatri Agentuurist, mis moodustati kahe asutuse - Eesti Näitemänguagentuuri ja Eesti Teatriliidu Teabekeskuse - ühendamisel. Agentuuri juht, teatriteaduse doktorant Ott Karulin uue asutuse tegevusest

  19. Measurement of time dependent CP asymmetry parameters in B0 meson decays to omegaKs, etaprimeKz, and pi0Ks

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, : B.

    2008-09-10

    The authors present measurements of the time-dependent CP-violation parameters S and C in the decays B{sup 0} {yields} {omega}K{sub S}{sup 0}, B{sup 0} {yields} {eta}{prime}K{sup 0}, reconstructed as {eta}{prime}K{sub S}{sup 0} and {eta}{prime}K{sub L}{sup 0}, and B{sup 0} {yields} {pi}{sup 0}K{sub S}{sup 0}. The data sample corresponds to the full BABAR dataset of 467 x 10{sup 6} B{bar B} pairs produced at the PEP-II asymmetric-energy e{sup +}e{sup -} collider at the Stanford Linear Accelerator Center. The results are S{sub {omega}K{sub S}{sup 0}} = 0.55{sub -0.29}{sup +0.26} {+-} 0.02, C{sub {omega}K{sub S}{sup 0}} = -0.52{sub -0.20}{sup +0.22} {+-} 0.03, S{sub {eta}{prime}K{sup 0}} = 0.57 {+-} 0.08 {+-} 0.02, C{sub {eta}{prime}K{sup 0}} = -0.08 {+-} 0.06 {+-} 0.02, S{sub {pi}{sup 0}K{sub S}{sup 0}} = 0.55 {+-} 0.20 {+-} 0.03, and C{sub {pi}{sup 0}K{sub S}{sup 0}} = 0.13 {+-} 0.13 {+-} 0.03, where the first errors are statistical and the second systematic. These results are consistent with the previous measurements and the world average of sin2{beta} measured in B{sup 0} {yields} J/{psi}K{sub S}{sup 0}.

  20. Carla del Ponte : Serbia koostöö ei saa piirduda vaid ühe inimesega / Carla Del Ponte ; interv. Krister Paris

    Index Scriptorium Estoniae

    Del Ponte, Carla

    2006-01-01

    ÜRO sõjakuritegude tribunali peasüüdistaja Carla del Ponte ei anna Serbia ühinemisele EL-iga oma heakskiitu enne, kui Belgrad hakkab täielikku koostööd tegema. Vt. samas: Del Ponte seisab Serbia teel EL-i

  1. Tallinnas on hakanud tegutsema mitte ainult uus, vaid lausa uut tüüpi galerii... / Olga Temnikova ; intervjueerinud R[eet] V[arblane

    Index Scriptorium Estoniae

    Temnikova, Olga

    2010-01-01

    Uuest kunstigaleriist Temnikova & Kasela (Tallinn, teater NO99), mille eesmärk on tuua Eestisse väliskunsti ja eesti kunsti maailma viia. Osalemisest messidel. Berliini messil korraldati Jaan Toomiku lühifilmi "Oleg" linastus koos Andres Lõo heliliste etteastete ja Edith Karlsoni skulptuuride ekspositsiooniga

  2. Viru keskuse katusel näeb reedest filme - igaühte vaid korra või paar / Tiiu Laks

    Index Scriptorium Estoniae

    Laks, Tiiu, 1984-

    2010-01-01

    Linnapargina kujundatud Tallinna Viru keskuse katusekino filmiprogrammist. Katusekino on osa Tallinn 2011 sündmuste sarjast "Kinolinnaruumis". Lühidalt 9.-11. juulini Viimsi Rannarahva Muuseumis toimuva valgete ööde filmifestivali programmist

  3. Jüri Tamm: vaid osaledes on võimalik silma vaadata ja mõista oksjoni mõtet / toimetanud Kristi Vahemaa

    Index Scriptorium Estoniae

    Tamm, Jüri, 1937-

    2011-01-01

    Oksjoni idee autor ja korraldaja Jüri Tamm 4.12.2011 toimuvast 12. heategevuslikust kunstioksjonist, mille tulud lähevad hukkunud sportlaste laste toetuseks. Tänavune väliskülaline on kõrgushüppaja Dick Fosbury. Müügile tulevate taieste nimekiri. Tagasivaade oksjonitele. Koostööd tehakse galeriiga Rios

  4. Liitmine pole võimalus, vaid suisa kohustus : valitsuse aktiivsus regionaalhaldusreformi läbiviimisel ei ole põhiseadusvastane / Värner Lootsmann

    Index Scriptorium Estoniae

    Lootsmann, Värner, 1945-

    2008-01-01

    Haldusreformi läbiviimisest ja vastavatest sätetest põhiseaduses, kohaliku omavalitsuse korralduse seaduses ja Eesti territooriumi haldusjaotuse seaduses. Lisatud Siim Kiisleri, Kajar Lemberi, Marek Strandbergi, Peep Aru ja Kalvi Kõva arvamused

  5. Euroopa üksmeel saab sündida vaid ühistest väärtustest / Jacek Saryusz-Wolski

    Index Scriptorium Estoniae

    Saryusz-Wolski, Jacek

    2007-01-01

    Euroopa Parlamendi väliskomisjoni esimees räägib europarlamendi välispoliitilistest põhimõtetest, Euroopa energiapoliitikast ja suurriiklikest huvidest, uute liikmesriikide mõjuvõimu kasvust. Lisa: Jacek Saryusz-Wolski: Eestil on õigus tegeleda 4 aastat valitsenud natsistliku ja 48 aastat kestnud Nõukogude terroriga omaenda äranägemise järgi : EP väliskomisjoni esimehe avaldus 7. mail 2007. aastal

  6. Linnavalitsus tõmbab ametnike palgakäärid koomale : lisatasu saavad edaspidi vaid kauaaegsed töötajad / Mari-Liis Hüvato

    Index Scriptorium Estoniae

    Hüvato, Mari-Liis

    2008-01-01

    Tartu linnavalitsuse liikmete ja töötajate palkadest. Diagrammid ja tabelid. Vt. samas vastuseid küsimusele, kas tunnete osakonnajuhatajana, et mõni teie alluv saab ebaõiglast palka?: Meida Griin, Rein Haak, Karin Raid, Urmas Ahven

  7. Aprillimässu mõjud jätavad iga päev jõude seisma vaid ühe rongi / Hindrek Riikoja

    Index Scriptorium Estoniae

    Riikoja, Hindrek

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 19. okt. lk. 5. Statistikaameti andmetel on transiitvedude maht vähenenud maist augustini võrreldes 2006. aastaga 2%. Eesti Raudtee juhi Kaido Simmermanni sõnul on talle statistikaameti arvutused arusaamatud. Diagramm: Raudteeveod on vähe kahanenud. Vastuseks vt. ka Rene Vareki art. Postimees 19. okt. lk. 8

  8. Jutuvestjate esikoht läks Vene gümnaasiumisse / Grete Naaber

    Index Scriptorium Estoniae

    Naaber, Grete, 1942-

    2008-01-01

    Pärnus toimunud jutuvestjate võistlusest. Konkursi juhendaja oli Reet Mõis, zhürissee kuulusid Triinu Ojalo, Kaili Närep ja Liis Laigna. I koha sai Aleksander Zvorovski, II koha Johanna Odes ja III koha Oskar Seeman

  9. Targeting Class I PI3Ks in the Treatment of T-cell Acute Lymphoblastic Leukemia

    Science.gov (United States)

    2013-08-01

    glucocorticoids is associated with unfavorable prognosis in this disease ( Hongo et al., 1997; Inaba and Pui; Klumper et al., 1995). Primary glucocorticoid...resistance is particularly frequent in T-ALL ( Hongo et al., 1997; Inaba and Pui, 2010; Klumper et al., 1995), leading us to hypothesize that activation of...agents or molecular targeted drugs in vitro and in vivo. Molecular cancer therapeutics 9, 1956-1967. Hongo , T., Yajima, S., Sakurai, M., Horikoshi, Y

  10. Keenia hotelliplahvatust peetakse al-Quaida kätetööks / Riina Luik

    Index Scriptorium Estoniae

    Luik, Riina, 1962-

    2002-01-01

    Suitsiiditerroristide rünnakust Iisraeli turiste majutavas Keenia sadama- ja kuurortlinna Mombasa hotellis. Vt. samas: Siseminister Seppik: Keenia puutub ka meisse. Vt. ka sama autori art. lk. 11 Hotellirünnakus Keenias hukkus 15 inimest

  11. The HI Content of the Eridanus Group of Galaxies A. Omar ∗1 & KS ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    2005-03-22

    Mar 22, 2005 ... that halos contain a reservoir of hot gas, which sustains star formation in galaxies over their present ages (Larson et al. .... diameters of galaxies used in HG84 were from the Upsala General Catalog (UGC). The optical diameters of galaxies in the .... 2 × 1020 cm. −2 . The first contour is at NHI. = 1020 cm. −2.

  12. Eestis tegutseb üks Euroopa parimaid tööandjaid / Agne Narusk

    Index Scriptorium Estoniae

    Narusk, Agne, 1971-

    2005-01-01

    Kiirtransporditeenust pakkuv TNT Express Worldwide Eesti AS võitis mullu Euroopa parima tööandja tiitli. Tänavu jõudis ettevõte Euroopa kvaliteediauhinna konkursil kolme parema hulka väikeste ja keskmiste ettevõtete kategoorias. Lisa: Mahukas raport. Eri tasemed

  13. Bush müüks Ameerika sadamad araablastele / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 23. veebr. lk. 11. USA presidendi George W. Bushi plaani kohaselt ostaks New Yorgi, New Jersey, Philadelphia, Baltimore'i, Miami ja New Orleansi sadamad Dubai firma Peninsular and Oriental Steam Navigation Company. Mitmed USA poliitikud leiavad, et sadamate müük seab ohtu USA julgeoleku. Lisa: Välisfirmade võim

  14. Kui homme on üks päev liiga hilja / Magnus Lepasalu

    Index Scriptorium Estoniae

    Lepasalu, Magnus

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 3. okt. lk. 19. Logistikaturul on oma kindla koha leidnud nn. kiirabilogistikat (emergency logistics) pakkuvad ettevõtted, mis on spetsialiseerunud eriti ajakriitiliste saadetiste toimetamisele ja suudavad pakkuda erinevaid transpordiliike

  15. Animated Dreamsi grand prix läks Tšiilisse / Kristiina Davidjants

    Index Scriptorium Estoniae

    Davidjants, Kristiina, 1974-

    2009-01-01

    Pimedate Ööde 13. filmifestivali teise alafestivali Animated Dreams auhinnasaajad: võitis Cristobal Leoni, Niles Atallah' ja Joaquin Cocina "Lucia", ANOBA nominatsiooni sai Kaspar Jancise "Krokodill". Lisatud nimekiri "Animated Dreamsi võitjad"

  16. Ukraina president läks tülli ka uue valitsusega / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2008-01-01

    Ukraina peaminister Julia Tõmoshenko tahab anda riigiettevõtted erakätesse, president Viktor Jushtshenko on selle vastu. Valitsus tahtis tagandada riigivarafondi juhi, nähes temas erastamise pidurdajat, president keeldust teda ametist vabastamist

  17. Kalevi kommivabrik läks Luksemburgi investeerimisfondile / Toivo Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Toivo

    2007-01-01

    Kalevi ja Tere omandanud Luksemburgis registreeritud fondi Alta Capital Partners S.C.A. osanikud on 80% ulatuses Indrek Rahumaa, Andres Rätsepp, Jaak Raid ja Marius Binkevicius, 20% osakutest kuulub Briti varahaldusfirmale Bonfield Asset Management. Fondi hakkab haldama Läti firma Alta Capital Partners SIA. Skeemid: Mis Oliver Kruudale alles jäi? Mida Indrek Rahumaa ostis

  18. Taevo Gans : "Alati on võimalusi rohkem kui üks" / Gitte Hint

    Index Scriptorium Estoniae

    Hint, Gitte

    2004-01-01

    Taevo Gans (sünd. 1941) kodumaiste materjalide ja tootjate eelistamisest, sisearhitekti valikust, proportsiooni- ja värvitaju vajalikkusest sisekujunduse loomisel, oma eelistustest ruumikujunduses jm. T. Gansist, osalemisest mööbli- ja sisustusmessidel, 1991. a. loodud perefirmast Stuudio Gadis AS, omistatud preemiad, teostatud interjööri ja mööbli projektid aastatel 1968-2002. Ill.: foto T. Gansist

  19. Analysis of ATLAS 6-inch cold leg break simulation with MARS-KS code

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Se Yun; Jun, Hwang Yong; Ha, Sang Jun [Korea Electric Power Company, Daejeon (Korea, Republic of)

    2011-05-15

    A Domestic Standard Problem (DSP) exercise using ATLAS facility has been organized by KAERI. As the second DSP exercise, the 6-inch cold leg bottom break was determined. This experiment is the counterpart test to the DVI line break to verify the safety performance of the DVI method over the traditional CLI method. Compared with the large break LOCA, the phases of the small break LOCA prior to core recovery occur over a long period. The blowdown, natural circulation, loop seal clearance, boil-off, and core recovery phase should be investigated minutely with relevant models of safety analysis codes in order to predict these thermal hydraulic phenomena correctly. To investigate the ECC bypass phenomena, a finer study on the thermalhydraulic behavior in upper annulus downcomer was carried out

  20. A new measurement of the branching ratio of $K_{s} \\to \\gamma\\gamma$

    CERN Document Server

    Lai, A; Bevan, A; Dosanjh, R S; Gershon, T J; Hay, B; Kalmus, George Ernest; Lazzeroni, C; Munday, D J; Olaiya, E; Parker, M A; White, T O; Wotton, S A; Barr, Giles David; Bocquet, G; Ceccucci, Augusto; Çuhadar-Dönszelmann, T; Cundy, Donald C; D'Agostini, Giulio; Doble, Niels T; Falaleev, V P; Gatignon, L; Gonidec, A; Gorini, B; Govi, G; Grafström, P; Kubischta, Werner; Lacourt, A; Lenti, M; Mikulec, I; Norton, Alan Robert; Palestini, S; Panzer-Steindel, B; Tatishvili, G T; Taureg, Hans; Velasco, M; Wahl, H; Cheshkov, C; Gaponenko, A N; Khristov, P Z; Kekelidze, V D; Madigozhin, D T; Molokanova, N A; Potrebenikov, Yu K; Tkachev, A L; Zinchenko, A I; Knowles, I; Martin, V; Sacco, R; Walker, A; Contalbrigo, M; Dalpiaz, Pietro; Duclos, J; Frabetti, P L; Gianoli, A; Martini, M; Petrucci, F; Savrié, M; Bizzeti, A; Calvetti, M; Collazuol, G; Graziani, G; Iacopini, E; Martelli, F; Veltri, M; Becker, H G; Eppard, M; Fox, H; Holtz, K; Kalter, A; Kleinknecht, K; Koch, U; Köpke, L; Lopes da Silva, P; Marouelli, P; Pellmann, I A; Peters, A; Renk, B; Schmidt, S A; Schönharting, V; Schué, Yu; Wanke, R; Winhart, A; Wittgen, M; Chollet, J C; Fayard, Louis; Iconomidou-Fayard, L; Ocariz, J; Unal, G; Wingerter-Seez, I; Anzivino, Giuseppina; Cenci, P; Imbergamo, E; Lubrano, P; Mestvirishvili, A; Nappi, A; Pepé, M; Piccini, M; Bertanza, L; Carosi, R; Casali, R; Cerri, C; Cirilli, M; Costantini, F; Fantechi, R; Giudici, Sergio; Mannelli, I; Pierazzini, G M; Sozzi, M; Chèze, J B; Cogan, J; De Beer, M; Debu, P; Formica, A; Granier de Cassagnac, R; Mazzucato, E; Peyaud, B; Turlay, René; Vallage, B; Holder, M; Maier, A; Ziolkowski, M; Arcidiacono, R; Biino, C; Cartiglia, N; Guida, R; Marchetto, F; Menichetti, E; Pastrone, N; Nassalski, J P; Rondio, Ewa; Szleper, M; Wislicki, W; Wronka, S; Dibon, Heinz; Fischer, G; Jeitler, Manfred; Markytan, Manfred; Neuhofer, Günther; Pernicka, Manfred; Taurok, Anton; Widhalm, L

    2000-01-01

    The decay rate of $\\ksgg$ has been measured with the NA48 detector at the CERN SPS. A total of $149$ $\\ksgg$ events have been observed. The branching ratio is determined to be $(2.58 \\pm0.36(stat) \\pm0.22(sys))\\times10^{-6}$.

  1. Search for the decay $K_{S} \\to \\pi^{0} \\gamma\\gamma$

    CERN Document Server

    Lai, A; Batley, J Richard; Bevan, A; Dosanjh, R S; Gershon, T J; Kalmus, George Ernest; Munday, D J; Olaiya, E; Parker, M A; White, T; Wotton, S A; Barr, G; Bocquet, G; Ceccucci, Augusto; Çuhadar-Dönszelmann, T; Cundy, Donald C; Doble, Niels T; Falaleev, V P; Gatignon, L; Gonidec, A; Gorini, B; Govi, G; Grafström, P; Kubischta, Werner; Lacourt, A; Lenti, M; Norton, A; Palestini, S; Panzer-Steindel, B; Tatishvili, G T; Taureg, Hans; Velasco, M; Wahl, H; Cheshkov, C; Khristov, P Z; Kekelidze, V D; Madigozhin, D T; Molokanova, N A; Potrebenikov, Yu K; Tkatchev, A; Zinchenko, A I; Knowles, I; Lazzeroni, C; Martin, V; Sacco, R; Walker, A; Contalbrigo, M; Dalpiaz, Pietro; Duclos, J; Frabetti, P L; Gianoli, A; Martini, M; Masetti, L; Petrucci, F; Savrié, M; Bizzeti, A; Calvetti, M; Collazuol, G; Graziani, G; Iacopini, E; Becker, H G; Eppard, M; Fox, H; Holtz, K; Kalter, A; Kleinknecht, K; Koch, U; Köpke, L; Lopes da Silva, P; Marouelli, P; Pellmann, I A; Peters, A; Renk, B; Schmidt, S A; Schönharting, V; Schué, Yu; Wanke, R; Winhart, A; Wittgen, M; Chollet, J C; Fayard, Louis; Iconomidou-Fayard, L; Ocariz, J; Unal, G; Wingerter-Seez, I; Anzivino, Giuseppina; Cenci, P; Imbergamo, E; Lubrano, P; Mestvirishvili, A; Nappi, A; Pepé-Altarelli, M; Piccini, M; Carosi, R; Casali, R; Cerri, C; Cirilli, M; Costantini, F; Fantechi, R; Giudici, Sergio; Mannelli, I; Pierazzini, G M; Sozzi, M; Chèze, J B; Cogan, J; De Beer, M; Debu, P; Formica, A; Granier de Cassagnac, R; Mazzucato, E; Peyaud, B; Turlay, René; Vallage, B; Holder, M; Maier, A; Ziolkowski, M; Arcidiacono, R; Biino, C; Cartiglia, N; Guida, R; Marchetto, R; Menichetti, E; Pastrone, N; Nassalski, J P; Rondio, Ewa; Szleper, M; Wislicki, W; Wronka, S; Dibon, Heinz; Fischer, G; Jeitler, Manfred; Markytan, Manfred; Mikulec, I; Neuhofer, Günther; Pernicka, Manfred; Taurok, Anton; Widhalm, L

    2003-01-01

    A search for the decay K/sub S/ to pi /sup 0/ gamma gamma has been made using the NA48 detector at the CERN SPS. Using data collected in 1999 during a 40-hour run with a high-intensity K/sub S/ beam, an upper limit for the branching ratio BR(K/sub S/ to pi /sup 0/ gamma gamma , z to >or= 0.2) < 3.3 * 10/sup -7/ has been obtained at 90% confidence level, where z = m/sub gamma gamma //sup 2//m(K/sub 0/) /sup 2/. (8 refs).

  2. Kommunismiohvrite memoriaali ideekavandi konkursi võit läks jagamisele / Kärt Anvelt

    Index Scriptorium Estoniae

    Anvelt, Kärt, 1973-

    2011-01-01

    1.-2. kohta jagavad ideekavandid "Vest" (autorid Armin Valter, Joel Kopli) ja "Mälutulbad" (autor Koit Ojaliiv). Loetletud eripreemia pälvinud neli tööd ja äramärgitud neli tööd. Võistlustöödega (66) saab tutvuda 4. dets.-ni avatud näitusel Eesti Arhitektuurimuuseumis

  3. Inclusive $\\pi^{0}$ and $K_{S}^{0}$ in $\\gamma \\gamma$ reactions at L3

    CERN Document Server

    Achard, P

    2001-01-01

    The e/sup +/e/sup -/ to e/sup +/e/sup -/ pi /sup 0/+X and e/sup +/e /sup -/ to e/sup +/e/sup -/K/sub S//sup 0/+X reactions are studied at LEP using data collected with the L3 detector at square root s =189-202 GeV. Preliminary results for the differential cross section d sigma /dp/sub T/ in the transverse momentum range 0.2 GeV1 GeV the cross sections are compared to NLO QCD calculations and to LO Monte Carlo predictions. (15 refs).

  4. [Review of: K.-S. Taussig Ordinary genomes: science, citizenship, and genetic identities

    NARCIS (Netherlands)

    Kato, M.

    2010-01-01

    Ordinary Genomes is an ethnography of clinical genetics practice in the Netherlands, written by US anthropologist Karen-Sue Taussig. By looking at the case of the Netherlands, this book aims to illuminate the way specific scientific knowledge - in this case genomics - which is generally presumed to

  5. Üks vormiõpetus (I) : Vaimumõõgad / Henn Saari

    Index Scriptorium Estoniae

    Saari, Henn, 1924-1999

    1998-01-01

    Diskussioonist eesti nüüdiskeele võrmiõpetuse ning selle eelduseks oleva fooniasüsteemi üle uut õigekeelsussõnaraamatut ette valmistades. Vt. ka: Ehala, Martin. Eesti morfoloogia olemus // Keel ja Kirjandus, 1997, nr. 6 ; Hint, Mati. Eesti foneetika möödunud hiilgus ja möödumata viletsus // Keel ja Kirjandus, 1997, nr. 2 ; Ross, Kristiina. Eesti morfo(fono)loogia põnevamad probleemid : EKG contra Mati Hint // Keel ja Kirjandus, 1997, nr. 5

  6. Kuus näitlejat, üks Bob Dylan / Jaanus Noormets

    Index Scriptorium Estoniae

    Noormets, Jaanus

    2008-01-01

    Todd Haynes'i mängufilm muusik Bob Dylanist "Kus on Bob Dylan?" ("I'm Not There") : laulja alter ego kehastavad Ben Whishaw, Christian Bale, Heath Ledger, Cate Blanchett, Richard Gere, Marcus Carl Franklin : Ameerika Ühendriigid 2007

  7. Üks sõda kahes raamatus / Aivar Jürgenson

    Index Scriptorium Estoniae

    Jürgenson, Aivar, 1969-

    2014-01-01

    Arvustus: Laar, Mart. Impeeriumi vastulöök : Vene-Gruusia sõda, august 2008. Tallinn : Read, 2014 ; Laaneots, Ants. Vene-Gruusia 2008. aasta sõda - põhjused ja tagajärjed. Tartu : Eesti Ülikoolide Kirjastus, 2014

  8. "Poistelaulu" üks hõbe jäi Pärnusse

    Index Scriptorium Estoniae

    2005-01-01

    Konkursi "Poistelaul 2005" lõppvoorus 17. apr. Pärnu kontserdimajas saavutas noormeeste vanuserühmas teise koha Toomas Volli laulukooli õpilane Oliver Timmusk, võistulaulmise lõppvoorus osalesid veel pärnakad Karl Paisuots, Oskar Samuel Rebane ja Carl Väljaäär. Üldvõidu pälvis Türi Gümnaasiumi õpilane Mikk Dede

  9. Neli Hieronymus Boschi tööd on üks tervik? / Greta Koppel

    Index Scriptorium Estoniae

    Koppel, Greta

    2001-01-01

    Hamburgi kunstiajaloolase dr. Peter Kleini vastsest uurimustööst selgub, et Hieronymus Boschi maalid "Rändkaupmees", "Narrilaev", "Õgardluse allegooria" ja "Ühe kitsipunga surm" on tõenäoliselt maalitud ühe tiibaltari jaoks. Need tööd on 1. IX avatud H. Boschi retrospektiivnäitusel Boymans van Beuningeni muuseumis Rotterdamis

  10. Schiphol - üks saar muudab Hollandi / Rem Koolhaas ; tõlk. Inga Raukas

    Index Scriptorium Estoniae

    Koolhaas, Rem, 1944-

    2000-01-01

    Schipholi lennuvälja ümberpaigutamine kunstlikule saarele meres. Hollandi arhitektuuribüroo OMA arhitektuurse projekti kirjeldus. Projekteerijad Rem Koolhaas, Reinier de Graaf, Jens Hommert, Mateo Poli, Adam Kurdahl, Anna Little, Bert Karel Deuten. 23 ill

  11. Presidendilossis pidutses ka üks Res Publica liige / Kadri Jakobson

    Index Scriptorium Estoniae

    Jakobson, Kadri, 1970-

    2006-01-01

    SL Õhtulehele presidendilossis toimunud noortepidudest rääkinud neiu on Res Publica liige, kuid tema sõnul pole tema parteiline kuuluvus pidudega seotud. Arvamust avaldavad Res Publica juhatuse liige Andreas Kaju, erakonna esimees Taavi Veskimägi, ERL-i pressiesindaja Agu Uudelepp jt.

  12. Uudised : Bella Musica presentatsioon. Muusikaesseede võistlus läks korda / Anu Kõlar

    Index Scriptorium Estoniae

    Kõlar, Anu, 1961-

    2001-01-01

    14. veebr. toimusid läbirääkimised saksa firma Bella Musica, saksa muusikapromotsiooni firma Pro Classics ja äsjaloodud plaadiproduktsioonide firma ERP (Estonian Record Productions) vahel. Toimus ka kaubamärgi Antes Classics presentatsioon ning kontsert. Muusikateemaliste esseede võistlusest ja selle tulemustest

  13. Steven Spielberg peab oma uut filmi koostööks Stanley Kubrickuga

    Index Scriptorium Estoniae

    2001-01-01

    30. juunil üheaegselt Jaapanis ja USAs esilinastub Steven Spielbergi "Tehisintellekt" ("A.I. Artificial Intelligence"), mille kohta režissöör Tokyos pressikonverentsil väitis, et see on õieti Stanley Kubricku film, kuna põhineb temast järelejäänud 90-leheküljelisel ideeprojektil

  14. Zellweger : kusagil on ikka üks suurem plaan / Christoph Zellweger ; interv. K. M.

    Index Scriptorium Estoniae

    Zellweger, Christoph

    2002-01-01

    Šveitsi-austria päritolu, praegu Inglismaal elav ja töötav ehtekunstnik Christoph Zellweger endast, oma loomingust, mida tema tööd kajastavad, ehtekunsti väljavaadetest, implantaatidest, eesti ehetest jm.

  15. DCS HYDRAULICS Submission for City of El Dorado, Butler County KS

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  16. "Welcome To Estonia" läks vaatajaile hinge / Verni Leivak

    Index Scriptorium Estoniae

    Leivak, Verni, 1966-

    2002-01-01

    Poliitikuid pilavad Rain Tolk ja Ken Saan uues filmis "Welcome To Estonia" : režissöör Andres Maimik : toimetaja Juhan Ulfsak. Film esilinastusest 6. detsembril kinos Sõprus Pimedate Ööde filmifestivali raames

  17. Seoselise mõisteskeemi kasutamine Estica õpetamisel : üks näide / Christi Sepp

    Index Scriptorium Estoniae

    Sepp, Christi

    2000-01-01

    Seoseline mõisteskeem aitab näha Estica kursuse raames õpetatavate ainete (eesti kirjandus, ajalugu, geograafia, muusika jne.) omavahelist seotust. Tervikpildi loomise võimaluseks on erinevate kultuurilooliste ainete õpetamine läbi kirjandusteose. Artiklis vaadeldakse, kuidas koostada ja kasutada seoselist mõisteskeemi ning kirjeldatakse ühe võimalusena rahvusliku identiteedi kujunemise käsitlemist Eduard Bornhöhe "Tasuja" põhjal

  18. Eesti muusika päevad - üks kord aastas, kõigile / Jelena Gandshu

    Index Scriptorium Estoniae

    Gandshu, Jelena

    2008-01-01

    Muusikateadlased Jelena Gandshu ja Gerhard Lock, heliloojad Age Hirv ja Liis Jürgens 3.-10. aprillini toimunud Eesti muusika päevade kontsertidest: kinos Sõprus "Sensatsioon!!!", Kultuuritehases Polymer "Cellissimo", Estonia kontserdisaalis ERSO "Sümfoonilised hääled", Tallinna raekojas Mihkel Poll ja Oliver Kuusik, Katariina kirikus PaukenfEst, Nigulistes Jüri Reinvere autorikontsert. Järgneb

  19. Turuanalüüs - eduka turunduse juhtimise üks võtmetegur / Mait Miljan

    Index Scriptorium Estoniae

    Miljan, Mait

    2002-01-01

    Ettevõtte turunägemuse kujundamisel puutub kokku selliste mõistetega nagu turu definitsioon, turu arenguindeks (Market - MDI), turupotentsiaal, turunõudlus, turuosa arenguindeks (Share Development Index - SDI). Diagrammid

  20. Kaks meest, üks lugu / Gergely Kovacs ; tõlk. Edvin Hiedel

    Index Scriptorium Estoniae

    Kovacs, Gergely

    2000-01-01

    Ungari režissöör Mikl̤s Jancs̤ ja operaator Ferenc Grunwalsky oma tööst mängufilmidega "Pagan võtku! Sääsed"(1999) ja "Mulle andis Vanajumal Pestis laterna kätte" (1998) (Ajaleht "Magyar HÍrlap" 28.8.1999)

  1. Vello Salo - üks Maarjamaa mees / Vello Salo ; interv. Kristel Schwede

    Index Scriptorium Estoniae

    Salo, Vello, 1925-

    2008-01-01

    Intervjuu vaimuliku, kirjastaja ja literaadi Vello Saloga. Vt. ka foto lk. 10: Nõupidamine New Yorgi Eesti Maja keldris raamatu "Lugusid möödunud aegadest" (ilmus 1987) asjus. Fotol ka Toomas Hendrik Ilves

  2. Üks aadressimärkmik kõige jaoks / Adam Tanner

    Index Scriptorium Estoniae

    Tanner, Adam

    2013-01-01

    Bart Lorang soovib luua täiuslikku iseuuenevat aadressimärkmikku. Esialgses versioonis on juba 300 miljonit nime Internetis kättesaadavatest avalikest andmetest olemas, kuid andmekaitseeksperdid kahtlevad selle äri seaduslikkuses

  3. Graafikatriennaali peapreemia läks Lätti / Kadri Karro

    Index Scriptorium Estoniae

    Karro, Kadri

    2011-01-01

    Kumu Kunstimuuseumis avatud 15. Tallinna Graafikatriennaali "Armastuse, mitte raha pärast" Grand Prix saanud Edmunds Jansonsi (Läti) animeeritud dokumentaalfilmist "Väikese linnukese päevik" (2007). Kolm võrdset preemiat pälvinud Antonio Claudio Carvalho (Brasiilia), õde Mary Corita (Corita Kent, 1918-1986, USA) ja Alina Rudnitskaja (Venemaa) töödest. Eripreemiate saajad. Oliver Laas sai ERKF Olev Soansi mälestusfondi stipendiumi

  4. Evaluation on Long-term Cooling of CANDU after Sump Blockage using MARS-KS

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Seon Oh; Cho, Yong Jin [KINS, Daejeon (Korea, Republic of); Kim, Sung Joong [Hanyang University, Seoul (Korea, Republic of)

    2016-05-15

    There was a real incident that part of the fibrous insulation debris stripped by steam jet was transported to the pool and clogged the intake strainers of the drywell spray system, which revealed a weakness in the defense-in-depth concept which under other circumstances could have led to the ECCS failing to provide coolant to the core. Since the above Barseback-2 incident in 1992, lots of the international activities have been carried out to identify essential parameters and physical phenomena and to promote consensus on the technical issues, important for safety and possible paths for their resolution. In nuclear power plant under operation, if an unplanned reactor trip or a power reduction occurs, operators are required to maintain the reactor in a stable state according to emergency operating procedure (EOP) and to take diagnosis and appropriate mitigation actions if necessary. Subject to the EOP of Wolsong unit 1 (the first Korean PHWR NPP) under LOCA, intact or broken loops are diagnosed using the available plant information such as pressure and temperature of outlet headers. For the intact loop, effective long-term cooling is envisioned through the operation of shutdown cooling system as implemented in the EOP. In this work, the adequacy of long-term cooling during the recirculation phase of LOCA was evaluated under the postulated condition of the reduced flow path of the recirculation sump due to the inflow of substantial amount of debris released by the break flow with high energy. For the intact loop, although the incipience of boiling in the fuel channel was evaluated to occur, the effective long-term cooling can be achieved through the shutdown cooling system as guided in the EOP.

  5. Sperantapük e Linglänapük as volapüks

    DEFF Research Database (Denmark)

    Haberland, Hartmut

    2006-01-01

    En sammenligning af esperanto og engelsk som verdenssprog, og en diskussion af esperantos neutralitet og ejerskab......En sammenligning af esperanto og engelsk som verdenssprog, og en diskussion af esperantos neutralitet og ejerskab...

  6. Euroopa Liit läks Kosovo tunnustamise osas lõhki / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2008-01-01

    Euroopa Liidu välisministrite kohtumisel ei saavutatud üksmeelt Kosovo tunnustamises. EL-i avalduse kohaselt langetab iga EL-i liikmesriik suhete loomise otsuse ise. Lisa: Kosovo jäetakse ukse taha

  7. Eesti filmipublikule läks hinge laste saatus / Maris Kuuda

    Index Scriptorium Estoniae

    Kuuda, Maris

    2006-01-01

    Pärnu 20. dokumentaal- ja antropoloogiafilmide festivali auhindade võitjad. Eesti Rahva Auhinna saaja ühisnimetaja "Inimene otsib õnne" all oli Richard Ladkani, Kief Davidsoni "Saatana kaevur" ("The Devil's Miner") : Saksamaa 2004. Peaauhinna sai Arunas Matelise "Enne maale naasmist", parim laste tehtud dokumentaaliks tunnistati Erlend E. Mo "Kas taevalaotuses võib surra?"

  8. TIGER/Line Shapefile, 2013, county, Butler County, KS, Current Address Ranges Relationship File

    Data.gov (United States)

    US Census Bureau, Department of Commerce — The TIGER/Line shapefiles and related database files (.dbf) are an extract of selected geographic and cartographic information from the U.S. Census Bureau's Master...

  9. Vanade pangahoonete kohandamine keskpanga tööks / Märt Karmo

    Index Scriptorium Estoniae

    Karmo, Märt

    2004-01-01

    Panga peahoonest (Estonia pst. 13), endisest Vene Riigipanga hoonest (Estonia pst. 13) ja teenistujate elamust (Sakala 6), endisest Aadlipanga hoonest (Estonia pst. 11), endisest maakrediidiseltsi elamust-büroohoonest (Sakala 4), õppe- ja juhtimiskeskusest Kuressaares. Uue pangamaja projektidest (Jüri Karu, Eesti Tööstusprojekt, 1992; AB Rein Murula), sularahaveo turvahoonest (EKE Ehitus ja Hans Tombach, 1993)

  10. Coping styles in people with chronic fatigue syndrome identified from the general population of Wichita, KS.

    Science.gov (United States)

    Nater, Urs M; Wagner, Dieter; Solomon, Laura; Jones, James F; Unger, Elizabeth R; Papanicolaou, Dimitris A; Reeves, William C; Heim, Christine

    2006-06-01

    Studies of primary and tertiary care patients suggest that maladaptive coping styles contribute to the pathogenesis and maintenance of chronic fatigue syndrome (CFS). We assessed coping styles in persons with unexplained fatigue and nonfatigued controls in a population-based study. We enrolled 43 subjects meeting the 1994 Research Case Definition of CFS, matching them with 61 subjects with chronic unexplained fatigue who did not meet criteria for CFS [we term them insufficient symptoms or fatigue (ISF)] and 60 non-ill (NI) controls. Coping styles and clinical features of CFS were assessed using standard rating scales. Subjects with CFS and ISF reported significantly more escape-avoiding behavior than NI controls. There were no differences between the CFS and ISF subjects. Among participants with CFS, escape-avoiding behavior was associated with fatigue severity, pain, and disability. We demonstrate significantly higher reporting of maladaptive coping in a population-based sample of people with CFS and other unexplained fatiguing illnesses defined by reproducible standardized clinical empirical means in comparison to NI controls.

  11. TIGER/Line Shapefile, 2013, county, Stanton County, KS, Current Address Ranges Relationship File

    Data.gov (United States)

    US Census Bureau, Department of Commerce — The TIGER/Line shapefiles and related database files (.dbf) are an extract of selected geographic and cartographic information from the U.S. Census Bureau's Master...

  12. Kuidas Alfred Adler läks tülli Sigmund Freudiga / Aivar Kull

    Index Scriptorium Estoniae

    Kull, Aivar, 1955-

    1996-01-01

    Arvustus: Adler, Alfred. Inimesetundmine : Inimeste iseloomude peategurid ja nende areng / Tlk. Debora Hint. 2.tr. Tln. : Kupar, 1995. Vaata ka: Kull, Aivar. Kulli pilk. - Tartu : Ilmamaa, 2005, lk. 97-100

  13. Integrating Multiple Microarray Data for Cancer Pathway Analysis Using Bootstrapping K-S Test

    Directory of Open Access Journals (Sweden)

    Bing Han

    2009-01-01

    Full Text Available Previous applications of microarray technology for cancer research have mostly focused on identifying genes that are differentially expressed between a particular cancer and normal cells. In a biological system, genes perform different molecular functions and regulate various biological processes via interactions with other genes thus forming a variety of complex networks. Therefore, it is critical to understand the relationship (e.g., interactions between genes across different types of cancer in order to gain insights into the molecular mechanisms of cancer. Here we propose an integrative method based on the bootstrapping Kolmogorov-Smirnov test and a large set of microarray data produced with various types of cancer to discover common molecular changes in cells from normal state to cancerous state. We evaluate our method using three key pathways related to cancer and demonstrate that it is capable of finding meaningful alterations in gene relations.

  14. Demonstration Assessment of Light-Emitting Diode (LED) Parking Lot Lighting in Leavenworth, KS

    Energy Technology Data Exchange (ETDEWEB)

    Myer, Michael; Kinzey, Bruce R.; Curry, Ku' uipo

    2011-05-06

    This report describes the process and results of a demonstration of solid-state lighting (SSL) technology in a commercial parking lot lighting application, under the U.S. Department of Energy (DOE) Solid-State Lighting Technology GATEWAY Demonstration Program. The parking lot is for customers and employees of a Walmart Supercenter in Leavenworth, Kansas and this installation represents the first use of the LED Parking Lot Performance Specification developed by the DOE’s Commercial Building Energy Alliance. The application is a parking lot covering more than a half million square feet, lighted primarily by light-emitting diodes (LEDs). Metal halide wall packs were installed along the building facade. This site is new construction, so the installed baseline(s) were hypothetical designs. It was acknowledged early on that deviating from Walmart’s typical design would reduce the illuminance on the site. Walmart primarily uses 1000W pulse-start metal halide (PMH) lamps. In order to provide a comparison between both typical design and a design using conventional luminaires providing a lower illuminance, a 400W PMH design was also considered. As mentioned already, the illuminance would be reduced by shifting from the PMH system to the LED system. The Illuminating Engineering Society of North America (IES) provides recommended minimum illuminance values for parking lots. All designs exceeded the recommended illuminance values in IES RP-20, some by a wider margin than others. Energy savings from installing the LED system compared to the different PMH systems varied. Compared to the 1000W PMH system, the LED system would save 63 percent of the energy. However, this corresponds to a 68 percent reduction in illuminance as well. In comparison to the 400W PMH system, the LED system would save 44 percent of the energy and provide similar minimum illuminance values at the time of relamping. The LED system cost more than either of the PMH systems when comparing initial costs. However, when the life-cycle costs from energy and maintenance were factored into the scenario, the LED system had lower costs at the end of a 10-year analysis period. The LED system had a 6.1 year payback compared to the 1000W PMH system and a 7.5 year payback versus the 400W PMH system. The costs reflect high initial cost for the LED luminaire, plus more luminaires and (subsequently) more poles for the LED system. The other major issue affecting cost effectiveness was that Leavenworth, Kansas has very low electricity costs. The melded rate for this site was $0.056 per kWh for electricity. However, if the national electricity rate of $0.1022/kWh was used the payback would change to between four and five years for the LED system. This demonstration met the GATEWAY requirements of saving energy, matching or improving illumination, and being cost effective. The project also demonstrated that the Commercial Building Energy Alliance (CBEA) specification works in practice. Walmart appreciated having an entire site lighted by LEDs to gain more experience with the technology. Walmart is reviewing the results of the demonstration as they consider their entire real estate portfolio.

  15. World Energy Data System (WENDS). Volume II. Country data, CZ-KS

    Energy Technology Data Exchange (ETDEWEB)

    None

    1979-06-01

    The World Energy Data System contains organized data on those countries and international organizations that may have critical impact on the world energy scene. Included in this volume, Vol. II, are Czechoslovakia, Denmark, Egypt, Finland, France, Germany (East), Germany (West), Greece, Guinea, India, Indonesia, Iran, Italy, Japan, and Korea (South). The following topics are covered for most of the countries: economic, demographic, and educational profiles; energy policy; indigenous energy resources and uses; forecasts, demand, exports, imports of energy supplies; environmental considerations of energy use; power production facilities; energy industries; commercial applications of energy; research and development activities of energy; and international activities.

  16. Sotsiaalset kaitset võib vajada igaüks / Maris Jesse, Anu Toots, Tõnis Kõiv

    Index Scriptorium Estoniae

    Jesse, Maris, 1968-

    2009-01-01

    Sotsiaalpoliitika asjatundjad Eesti sotsiaalsüsteemi probleemidest ja arenguteedest. Vestlusringist võtsid osa Tervise Arengu Instituudi direktor Maris Jesse, Tallinna Ülikooli riigiteaduste instituudi võrdleva halduspoliitika professor Anu Toots ja Riigikogu sotsiaalkomisjoni liige Tõnis Kõiv. Vestlusringi juhtis RiTO peatoimetaja Helle Ruusing

  17. Maris Jesse üks 34st maailma tervise-otsustajast / Maris Jesse

    Index Scriptorium Estoniae

    Jesse, Maris, 1968-

    2009-01-01

    21. mail Eesti esindajana Maailma Terviseorganisatsiooni täitevkogu liikmeks kinnitatud Maris Jesse vastab küsimustele, mis puudutavad tema tööd uuel ametikohal, valitsuskriisi Eestis, suhtumist proua Evelin Ilvese meditsiiniteemalistesse seisukohtadesse

  18. Skandaali peategelasel süüks 17 pistisejuhtu / Andris Feldmanis

    Index Scriptorium Estoniae

    Feldmanis, Andris, 1982-

    2005-01-01

    Seoses altkäemaksu võtmisega on kriminaalasi algatatud 22 liikluspolitseiniku vastu. Kümme aastat politseis töötanud Livio Karrot süüdistatakse 17 kuriteoepisoodis. Vt. samas intervjuud Põhja ringkonnaprokuratuuri eriasjade prokuröri Jüri Kasesaluga

  19. BSR-kotkas läks lendu / Toomas Jüriado

    Index Scriptorium Estoniae

    Jüriado, Toomas, 1947-

    2005-01-01

    Hiiu maavalitsuse arendusnõunik Reet Kokovkin asus juhtima Euroopa piiriülese koostöö programmi Interreg IIIB rahastatavat Läänemere piirkonna keskkonnahariduse projekti BSR Eagle, mis tegeleb loodushariduse ja looduse õpetamise arendamisega Läänemere ääres

  20. Çocuklarda kronik öksürüğün nedenlerinin incelenmesi

    OpenAIRE

    Yasin Yildiz; Mahir igde

    2017-01-01

    Purpose: The aim of this study was to evaluate the etiology and underlying risk factors of chornic cough in children. Material and Methods: The study group included 90 patients aged between 6-17 selected from individuals who presented with cough persisting for four weeks and 30 further patients as the control group. For chronic cough approach to guide the 2006 American College of Chest Physicians guidelines was modeled. Results: The prevalence of night cough was 47.8%, atopy in the fam...

  1. Vironia läks avareisile "tühja kõhuga" / Erik Gamzejev

    Index Scriptorium Estoniae

    Gamzejev, Erik, 1967-

    2006-01-01

    Ilmunud ka: Severnoje Poberezhje 22. märts lk. 4, Pärnu Postimees 23. märts lk. 6. Saaremaa Laevakompanii tütarfirma Narva Line tegi algust regulaarreisidega Sillamäe ja Kotka vahel, esimesel reisil polnud Vironia pardal ei reisijaid ega kaubaautosid

  2. "Ooperifantoomi" üks peaosatäitjatest valitud! / Sash Uusjärv

    Index Scriptorium Estoniae

    Uusjärv, Sash

    2008-01-01

    Detsembri alguses neljal õhtul Tallinnas Saku Suurhallis etenduva Ivan Jacobsi muusikali "The Phantom of the Opera" naispeaosalise Christine Daae rolli valiti sopran Toni Dolce. Muusikalist ja tema versioonidest

  3. Üks inimene teatrilaval - igav või intrigeeriv ? / Tiiu Laks

    Index Scriptorium Estoniae

    Laks, Tiiu, 1984-

    2006-01-01

    Vaadeldakse sel hooajal Eesti teatrites etendatud monolavastuste fenomeni : Andrus Kivirähki "Aabitsakukk" (Eesti Draamateater, mängib Tõnu Oja), Pip Uttoni "Adolf" (Vanemuine, lavastaja Ervin Õunapuu, mängib Indrek Taalmaa), Sasha Pepeljajevi "Hamletid" (Von Krahli Teater, mängib Juhan Ulfsak), Kai Henseli "Klammi sõda" (VAT Teater, lavastaja Aare Toikka, mängib Marika Vaarik), Geraldine Aroni " Minu oivaline lahutus" (Eesti Draamateater, lavastaja Kaie Mihkelson, mängib Ülle Kaljuste), Kati Murutar "Pidu" (Rakvere Teater, mängib Ülle Lichtfeldt), "Unistaja soovikontsert" (Rakvere Teater, lavastaja Kadi Tudre). Lisad : "Monotükid Eesti teatriajaloos" ja "Monotükid maailma lavadel"

  4. Raamatukogudest läks kaduma info tuhandete raamatute kohta / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2011-01-01

    Detsembris 2010 kadusid infosüsteemi URRAM kasutavate raamatukogude arvutitest laenutusandmed, probleemid lugejateeninduses võivad kesta nädalaid. Vt. ka Sikk, Rein. Kultuuriministeeriumi sovetlik digitüng, lk. 2

  5. Eesti filmil läks hästi Karlovy Vary festivalil / Marianne Kõrver

    Index Scriptorium Estoniae

    Kõrver, Marianne, 1980-

    2006-01-01

    Lühimängufilm "Tühirand", režissöör Veiko Õunpuu, osales Karlovy Vary rahvusvahelise filmifestivali "Forum of Independents" programmis. 41. Karlovy Vary filmifestivali avas Korea režissööri Kim Ki-duki "Aeg". Lühidalt ka auhinnatutest ja huvitavamatest filmidest

  6. 2006 - veel üks raisatud aasta Euroopa tugevdamisel? / Jeroen Bult

    Index Scriptorium Estoniae

    Bult, Jeroen

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 9. jaan. lk. 8. 2005. aasta kujunes Euroopa Liidule kriisiaastaks. Autor on seisukohal, et maailmapoliitikas osalemiseks peab ühendus lõpetama sisetülid. Lisa: Kas teate?

  7. Üks täht on langenud: aasta Obama võidust / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2009-01-01

    Autor analüüsib USA presidendi Barack Obama populaarsuse langust ning märgib, et ootused, millega kuulati B. Obama võidukõnet, on asendunud rahutuks muutunud suhtumisega tema ametis hakkama saamisesse. Lisa: 6 murtud lubadust

  8. Kallas valmistus Brüsselis voliniku tööks / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2004-01-01

    Siim Kallas kohtus Brüsselis Euroopa Komisjoni presidendi Romano Prodi ning komisjoni volinikega. Suure tõenäosusega saab Kallas oma juhendajaks ettevõtluse ja infoühiskonna valdkonnaga tegeleva Erkki Liikaneni

  9. RAS Ookeani pankrot läks riigile maksma ligi veerand miljardit / Marika Roomere

    Index Scriptorium Estoniae

    Roomere, Marika

    2007-01-01

    Valitsus eraldas reservist ligi 243 miljonit krooni pankrotis RAS Ookeaniga seotud välispankade kahjunõude katteks, täites sellega Rahvusvahelise Investeeringuvaidluste Lahendamise Keskuse (ICSID) vahekohtu 19. nov. otsuse. Kommenteerivad rahandusminister Ivari Padar, justiitsminister Rein Lang ja pankrotihaldur Arno Mägi

  10. Eesti jääks naftareostusega hätta / Sten A. Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Sten A., 1979-

    2004-01-01

    Ulatusliku mõjuga naftatankeriavarii tõenäosus Eesti vetes on ähvardavalt suur, riigikontrolli hinnangul on piirivalve võimekus reostusjuhtude avastamisel väike ja riik pole võimeline reostust omal jõul likvideerima. Lisa: Inimesed naftatõrjest tähtsamad

  11. McDonald's läks maja pärast kohtusse / Vahur Koorits

    Index Scriptorium Estoniae

    Koorits, Vahur, 1981-

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 13. veebr. 2008, lk. 3. McDonaldþsi toidukohti pidava firma Premier Restaurants Eesti AS arvates on tal õigus küsida teistelt samas majas paiknevatelt asutustelt üüri ning nõuab saamata jäänud raha eest üle 8 miljoni krooni kahjutasu. Vt. samas: Viru 24; Lao tõstis McDonaldsi töötajad tänavale

  12. Endine õppejõud : Medvedev ei jääks riigipeana Putinile alla / Jaanus Piirsalu

    Index Scriptorium Estoniae

    Piirsalu, Jaanus, 1973-

    2008-01-01

    Peterburi ülikooli õigusteaduskonna professor Valeri Musini hinnangul on Dmitri Medvedev turumajanduse ja inimõiguste küsimuses sama liberaalne kui Vladimir Putin ning Venemaa rahvuslike huvide ja rahvusvahelise õiguse kaitsmisel sama jäik kui V. Putin. Medvedev presidendina ja Putin peaministrina oleks tugev tandem. D. Medvedevi endiste õpetajate hinnanguid

  13. Estonia - üks tõeline eestimaine spaa / Dagmar Reinolt

    Index Scriptorium Estoniae

    Reinolt, Dagmar

    2015-01-01

    Heaoluspaa võtmes renoveeritud Estonia Spa Hotelsi ühest kompleksist. Rekonstrueerimisprojekti arhitektid: Raivo Kotov, Indrek Mikk. Rekonstrueerimisprojekti sisearhitektid: Raili Paling, Liis Lindvere, Kadri Kaldam, Kärt Loopalu. Valmimisaasta: 2015

  14. Kunst on vaimu avardumise üks keskseid koldeid / Peeter Maria Laurits ; interv. Laura Kuusk

    Index Scriptorium Estoniae

    Laurits, Peeter, 1962-

    2006-01-01

    Peeter Laurits oma loomingust, näitustest "Voolav labürint" (koostöö Katzi ja Hollandi Pavlov Medialabiga) SEB Ühispanga galeriis, "Meistriteoste varjus" (koos Laurentsiusega) Kadrioru Kunstimuuseumis, isikunäitusest "Vana labürint" ArtDepoos, autorikaitsest jm.

  15. Kuldne Palmioks läks filmile Iiri vabadusvõitlusest / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    2006-01-01

    Cannes'i filmifestivali võitjad. Kuldse Palmioksa võitis Ken Loachi mängufilm "Tuul, mis sasib odrapõldu" ("The Wind That Shakes the Barley") : stsenarist Paul Laverty, parim režissöör oli mehhiklane Alejandro Gonzalez Inarritu filmi eest "Paabel" ("Babel"). Lisatud nimekiri "Võitjad"

  16. Elu läks eelmisel aastal 4,4 protsenti kallimaks

    Index Scriptorium Estoniae

    2007-01-01

    Statistikaameti andmeil muutus tarbijahinnaindeks möödunud aastal võrreldes 2005. aastaga 4,4%, 2006. aasta detsembris olid tarbekaubad ja teenused keskmiselt 5,1% kallimad kui 2005. aasta detsembris

  17. Search for Lepton Flavour Violating Decays tau- to l- Ks with the BaBar experiment

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.; Bona, M.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Prencipe, E.; Prudent, X.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Lopez, L.; Palano, A.; Pappagallo, M.; /INFN, Bari /Bari U.; Eigen, G.; Stugu, B.; Sun, L.; /Bergen U.; Abrams, G.S.; Battaglia, M.; Brown, D.N.; Cahn, R.N.; Jacobsen, R.G.; /LBL, Berkeley /UC, Berkeley /Birmingham U. /Ruhr U., Bochum /Bristol U. /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UCLA /UC, Riverside /UC, San Diego /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /INFN, Ferrara /Ferrara U. /INFN, Ferrara /INFN, Ferrara /Ferrara U. /INFN, Ferrara /INFN, Ferrara /Ferrara U. /Frascati /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /Harvard U. /Heidelberg U. /Humboldt U., Berlin /Imperial Coll., London /Iowa U. /Iowa State U. /Johns Hopkins U. /Orsay, LAL /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Louisville U. /Karlsruhe U., EKP /Manchester U. /Maryland U. /Massachusetts U., Amherst /MIT, LNS /McGill U. /INFN, Milan /Milan U. /INFN, Milan /INFN, Milan /Milan U. /Mississippi U. /Montreal U. /Mt. Holyoke Coll. /INFN, Naples /Naples U. /INFN, Naples /INFN, Naples /Naples U. /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /INFN, Padua /Padua U. /INFN, Padua /INFN, Padua /Padua U. /Paris U., VI-VII /Pennsylvania U. /INFN, Perugia /Perugia U. /INFN, Pisa /Pisa U. /INFN, Pisa /Pisa, Scuola Normale Superiore /INFN, Pisa /Pisa U. /INFN, Pisa /Princeton U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /Rostock U. /Rutherford /DSM, DAPNIA, Saclay /South Carolina U. /SLAC /Stanford U., Phys. Dept. /SUNY, Albany /Tennessee U. /Texas U. /Texas U., Dallas /INFN, Turin /Turin U. /INFN, Trieste /Trieste U. /Valencia U., IFIC /Victoria U. /Warwick U. /Wisconsin U., Madison

    2009-01-06

    A search for the lepton flavor violating decays {tau}{sup -} {yields} l{sup -} K{sub S}{sup 0} (l = e or {mu}) has been performed using a data sample corresponding to an integrated luminosity of 469 fb{sup -1}, collected with the BABAR detector at the SLAC PEP-II e{sup +}e{sup -} asymmetric energy collider. No statistically significant signal has been observed in either channel and the estimated upper limits on branching fractions are {Beta}({tau}{sup -} {yields} e{sup -} K{sub S}{sup 0}) < 3.3 x 10{sup -8} and {Beta}({tau}{sup -} {yields} {mu}{sup -}K{sub S}{sup 0}) < 4.0 x 10{sup -8} at 90% confidence level.

  18. Üks võimalus koolipraktika tõhustamiseks õpetamisoskuse hindamisega / Sirje Sisask

    Index Scriptorium Estoniae

    Sisask, Sirje

    2003-01-01

    Artikkel tutvustab õpetamisoskuse hindamise vahendi kasutuselevõtmist pedagoogilisel koolipraktikal ning selle vahendi katsetamist üliõpilase pedagoogiliste oskuste arengu jälgimiseks Tartu koolides 2000/2001. õppeaastal läbi viidud õppepraktikal. Hindamisvahendi koostamisel võeti eeskuju USAs Georgia osariigis välja töötatud TPAI (Teacher Performance Assessment Instrument) hindamissüsteemist.

  19. Measurements of CP-Violating Asymmetries in B Decays to omegaKs

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Ford, K E; Hart, A J; Harrison, T J; Hawkes, C M; Morgan, S E; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van, N; Bakel, M; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Mihályi, A; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H; al, et

    2006-01-01

    We present preliminary measurements of CP-violating asymmetries for the decay omega K0S. The data sample corresponds to 347 million BBbar pairs produced by e+e- annihilation at the Upsilon(4S) resonance. For the decay omega K0S, we measure the time-dependent CP-violation parameters S = 0.62+0.25-0.30+/-0.002, and C = -0.43+0.25-0.23+/-0.03, where the first uncertainty is statistical and the second systematic.

  20. Riigikogu palgasüsteem on üks suur jama / Eiki Nestor ; interv. Argo Ideon

    Index Scriptorium Estoniae

    Nestor, Eiki, 1953-

    2008-01-01

    Riigikogu SDE fraktsiooni esimees kritiseerib parlamendiliikmete palgasüsteemi. Samas viitab ta põhiseadusele, mille kohaselt saab Riigikogu palka muuta alles järgmise Riigikogu koosseisu jaoks. Vt. samas: Eesti Ekspressi üleskutse: Riigikogu, peatage oma taltsutamatu palgatõus!

  1. Nobeli preemia läks vähi-ja aidsiuurijaile / Liisi Poll

    Index Scriptorium Estoniae

    Poll, Liisi, 1980-

    2008-01-01

    2008. aasta medistsiinipreemia pälvisid sakslane Harald zur Hausen emakakealavähki põhjustava viiruse leidmise eest ning prantslased Francoise Barré-Sinoussi ja Luc Montagnier HI-viiruse avastamise eest

  2. RMK hankeil valitseb üks traktorimüüja / Kadri Bank

    Index Scriptorium Estoniae

    Bank, Kadri

    2008-01-01

    RMK harvesterihangetel on juba aastaid edukas metsatehnikafirma Intrac, enamikul konkurentidest on võimatu pakkumist esitama pääseda. Vt. samas: Intrac viis RMK töötajad Rootsi ja USAsse; Hanke võitja ei vasta samuti tingimustele; RMK harvesteride hanked; RMK soetab askeetlikku masinaparki. Kommenteerib Riivo Roos

  3. LIBER-i konsortsiumi lugejauuring - üks võimalus dialoogiks lugejaga / Kristina Pai

    Index Scriptorium Estoniae

    Pai, Kristina, 1967-

    2016-01-01

    2016. a. moodustatud Euroopa Teadusraamatukogude Assotsiatsiooni (LIBER) raamatukogudest moodustatud LibQUAL-i konsortsiumis osalevad Eestist Tartu Ülikooli Raamatukogu ja Tallinna Tehnikaülikooli Raamatukogu

  4. Multi-wavelength campaign on NGC 7469. I. The rich 640 ks RGS spectrum

    Science.gov (United States)

    Behar, Ehud; Peretz, Uria; Kriss, Gerard A.; Kaastra, Jelle; Arav, Nahum; Bianchi, Stefano; Branduardi-Raymont, Graziella; Cappi, Massimo; Costantini, Elisa; De Marco, Barbara; Di Gesu, Laura; Ebrero, Jacobo; Kaspi, Shai; Mehdipour, Missagh; Paltani, Stéphane; Petrucci, Pierre-Olivier; Ponti, Gabriele; Ursini, Francesco

    2017-05-01

    Aims: Outflows in active galaxies (AGNs) are common, although their launching mechanism, location, and physical impact on the host galaxy remain controversial. We conducted a multi-wavelength six-month campaign to observe the nearby Seyfert galaxy NGC 7469 with several observatories in order to better understand and quantify the outflow in this AGN. Methods: We report on the time-integrated line-resolved X-ray spectrum of NGC 7469 obtained with the Reflection Grating Spectrometer (RGS) on board XMM-Newton. We used the RGS spectrum to discern the many AGN outflow components and applied a global fit to obtain their physical parameters. Results: We find that the AGN wind can be well described by three narrow velocity components at -650, -950, and -2050 km s-1. The RGS clearly resolves the -2050 km s-1 component in C5+ Ly α, while the -650 km s-1 and -950 km s-1 velocities are blended. Similar velocities (±200 km s-1) are resolved in the UV. The H-equivalent column densities of these components are, respectively, NH 7 × 1020, 2.2 × 1021, and 1020 cm-2, for a total of 3 × 1021 cm-2, which was also measured in 2004, indicating the absorber did not significantly change. The -650 km s-1 component shows a broad ionization distribution (-1 ≲ log ξ ≲ 2,ξ being the ionization parameter in erg s-1 cm). We identify a photo-ionized emission component blue-shifted by -450 km s-1, somewhat broad (FWHM = 1400 km s-1), and with -1 ≲ log ξ ≲ 1 erg s-1 cm, which we ascribe to the same outflow that produces the absorption lines. We also find a collisionally ionized component at kT = 0.35 keV that we associate with the circum-nuclear star-formation activity of NGC 7469, as it follows the LFIR/LX ≈ 104 relation found in star forming galaxies. The elemental abundance ratios of C, N, Ne, S, and Fe to O in the outflow tend to be between one and two times solar. Preliminary estimates of the absorber distance from the AGN center suggest it is at least a few pc away from the center, but more advanced methods need to be applied in order to obtain better constraints. Conclusions: The complex X-ray spectrum of NGC 7469 demonstrates the richness of high energy phenomena taking place in AGN cores. The subtle spectroscopic differences between the various components require deep, high-resolution observations, such as the present RGS spectrum, if one is to resolve them and perform quantitative plasma diagnostics.

  5. 78 FR 23778 - Quivira National Wildlife Refuge, Stafford, KS; Comprehensive Conservation Plan and Environmental...

    Science.gov (United States)

    2013-04-22

    ... potentially be related to the effects of climate change would continue. Staff would continue to seek... of 1997; and Service policies and procedures for compliance with those laws and regulations. Dated... fish and wildlife management, conservation, legal mandates, and our policies. In addition to outlining...

  6. Projekts: Sporta kluba SIA "Gribasspēks" dibināšana Ventspilī

    OpenAIRE

    Rutkovska, Jana

    2016-01-01

    Projekta mērķis ir nodibināt sabiedrību ar ierobežotu atbildību „Gribasspēks”, kas sniegs klientiem iespēju apmeklēt trenažieru zāli, dažādas veida aerobikas nodarbības, CrossFit zāles treniņus, apļa treniņus un jogas nodarbības. Tādējādi, Ventspils pilsētas un tā novada iedzīvotājiem, būs iespēja saņemt kvalitatīvu pakalpojumu par vidējām cenām tirgū. Nodrošinot stabilu pozīciju vietējā tirgū, tas sniegs iespējas nākotnē paplašināties un pilnveidot uzņēmuma darbību. Darba pētīšanas metodes:...

  7. Veel üks väike sammuke inimese kloonimise poole / Tiit Kändler

    Index Scriptorium Estoniae

    Kändler, Tiit, 1948-

    2001-01-01

    USA erafirma Advanced Cell Technology teadlastel õnnestus esmakordselt maailmas inimrakkude kloonimine. Embrüo kloonijad rõhutavad, et nende ainus eesmärk on kasutada oma töö tulemusi raskete ja seni ravimatute haiguste võimalikuks raviks

  8. Tudengite näitetrupp läks Eestit esindama / Raimu Hanson

    Index Scriptorium Estoniae

    Hanson, Raimu, 1957-

    2004-01-01

    Viljandis alanud Eesti Harrastusteatrite Liidu eestvedamisel alanud rahvusvahelisest festivalist, kus Eestit esindab Tartu Üliõpilasteater lavastusega "Jelizaveta Bam" D. Harmsi teose järgi, lavastaja K. Kudu

  9. The fossil vertebrates of Ksâr'akil, a palaeolithic rock shelter in the Lebanon

    NARCIS (Netherlands)

    Hooijer, D.A.

    1961-01-01

    CONTENTS Introduction................... 4 Systematic part.................. 5 Pisces.................... 5 Amphibia................... 6 Hyla arborea (L.) subsp............... 6 Reptilia................... 6 Testudo spec.................. 6 Ophisaurus apodus (Pallas).............. 8 Chamaeleo

  10. Oma ala meistriks saab igaüks isemoodi / Anna-Liisa Mets

    Index Scriptorium Estoniae

    Mets, Anna-Liisa

    2014-01-01

    Selgusid kutsemeistrivõistluse "Noor meister 2014" parimad. Edukalt esinenud õppurid meisterkondiiter Helen Laht, ehituspuussepp Mirko Pruus, logistik Karl-Erik Maripuu, keskkonnatehnika lukksepp Robert Born, elektrik Tiit Talts ja müürsepp Sander Hindrikus räägivad oma ametiõpingutest ja tulevikuplaanidest

  11. Üks päev Kolumbia lastekodus / Siiri Liiva

    Index Scriptorium Estoniae

    Liiva, Siiri

    2009-01-01

    Puka Avatud Noortekeskuse noorsootöötaja Siiri Liiva kirjutab šokeerivatest ja rõõmsatest kogemustest, mida on pakkunud töö vabatahtlikuna Kolumbia organisatsiooni Proyecto Alma de Nino lastekodus

  12. Not Writing, and Giving "Zero-F**ks" about It: Queer(y)ing Doctoral "Failure"

    Science.gov (United States)

    Burford, James

    2017-01-01

    This article proposes that a queer reading of failure might offer opportunities to re-think the affective-political practice of doctoral writing. It examines data from one case in Aotearoa New Zealand to illustrate how a doctoral student negotiates "failure" in relation to their writing practice and identity. While higher education…

  13. Prantsuse maaklerile pannakse süüks miljardite tuulde laskmist / Liisi Poll

    Index Scriptorium Estoniae

    Poll, Liisi, 1980-

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 28. jaan. 2008, lk. 6. Prantsusmaa suurpanga Societe Generale maakler Jerome Kerviel tekitas lubamatute pangatehingutega pangale viiemiljardilise kahju. Lisa: Kuulsaid pangakaotusi

  14. Sesame style decomposition of KS-DFT molecular dynamics for direct interrogation of nuclear models

    Science.gov (United States)

    Burnett, Sarah; Sheppard, Daniel; Honnell, Kevin

    2017-06-01

    A common paradigm used in the construction of equations of state is to decompose the thermodynamics into a superposition of three terms: a static lattice cold curve, a contribution from the thermal motion of the ions, and a contribution from the thermal excitation of the electrons. While statistical mechanical models for crystals provide tractable framework for the ionic contribution in the solid phase, much less is understood about the ionic contribution above the melt temperature (Cv 3 R) and how it should transition to the high-temperature limit (Cv 3/2 R). In this work, we use the VASP Quantum Molecular Dynamics package to probe thermal ionic behavior in the liquid and to compare the results to two semi-empirical models - the Johnson model and the Chisolm high-temperature liquid model. For each temperature and density of interest, we begin by performing a full Kohn-Sham QMD simulation of the system. The average of the resulting internal energies and pressures is recorded for each particular temperature. Taking the derivative of the energy with respect to temperature using Gram polynomials returns the specific heat, Cv. We describe the general methodology and compare predictions for the constant volume heat capacity of Al to common ionic models. LA-UR-17-21341.

  15. Ilves, Bush discuss security and visas

    Index Scriptorium Estoniae

    2007-01-01

    President Toomas Hendrik Ilves kohtus 25. juunil 2007 Valges Majas USA presidendi George W. Bushiga. Vestlusteemadeks olid olukord Afganistanis, küberrünnakud, NATO küberkaitsekeskuse rajamine Tallinna, viisavabadus, suhted Venemaa ja Euroopa Liiduga. Vabariigi President töövisiidil Ameerika Ühendriikides 25.-26.06.2007

  16. President Ilves met with leaders of the United States Congress

    Index Scriptorium Estoniae

    2007-01-01

    President Toomas Hendrik Ilves kohtus Washingtonis USA Kongressi esindajatekoja spiikri Nancy Pelosi ja kongresmenidega. Kõne all oli viisavabadus, võitlus küberkuritegevuse vastu, suhted Venemaaga. Vabariigi President töövisiidil Ameerika Ühendriikides 25.-26.06.2007

  17. Ohio koolitüdruku parim reis viis ta Eesti saatkonda / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2006-01-01

    Eesti saatkonnas Washingtoni töötab administraatorina USA rahukorpuse liikmena Eestis töötanud Blaine Carvalho. Suursaadik Jüri Luik ei kahtle, et USA presidendi George W. Bushi visiidil Eestisse tõstatatakse viisavabaduse küsimus

  18. Remarks by president Bush and president Ilves, June 24, 2007 / George W. Bush, Toomas Hendrik Ilves

    Index Scriptorium Estoniae

    Bush, George W., 1946-

    2007-01-01

    Ameerika Ühendriikide president George W. Bush ja Eesti president Toomas Hendrik Ilves annavad lühiülevaateValge Maja ovaalkabinetis peetud kõnelusest, mille põhiteemadeks olid olukord Afganistanis ja Iraagis, viisavabadus ning küberrünnakud. Vabariigi President töövisiidil Ameerika Ühendriikides 25.-26.06.2007

  19. Valitsus vaeb USA viisavabadusenõudeid / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2008-01-01

    USA viisavabaduse aluseks oleva vastastikuse mõistmise memorandumi projekt on täna valitsuse istungi päevakorras. Tšehhi ja USA on juba sõlminud kahepoolse memorandumi, mõnedel hinnangutel on Tšehhi järele andnud kogu ameeriklaste nõudmiste paketile. Lisa: Andmekaitsjad pole viimase seisuga kursis

  20. Kanada minister Van Loan on hobieestlane / Peter Van Loan ; interv. Marje Aksli

    Index Scriptorium Estoniae

    Van Loan, Peter

    2007-01-01

    Kanada konservatiivse valitsuse parlamendiasjade juht ja demokraatliku reformi minister vastab küsimustele, mis puudutavad eestlaste hulka tema valimisringkonnas, kohtumist president Toomas Hendrik Ilvesega, viisavabaduse andmist Eestile, samuti pronkssõdurit ja vene poliitikute väidet, et Eestis tõstab pead natsism

  1. Improved Measurement of the CKM Angle gamma in B^-+ to D^(*) K^(*)-+Decays with a Dalitz Plot Analysis of D Decays to K_S^0 pi+ pi- and K_S^0 K+ K-

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, : B.

    2008-04-22

    We report on an improved measurement of the Cabibbo-Kobayashi-Maskawa CP-violating phase {gamma} through a Dalitz plot analysis of neutral D meson decays to K{sub s}{sup 0}{pi}{sup +}{pi}{sup -} and K{sub s}{sup 0}K{sup +}K{sup -} produced in the processes B{sup {-+}} {yields} DK{sup {-+}}, B{sup {-+}} {yields} D* K{sup {-+}} with D* {yields} D{pi}{sup 0}, D{gamma}, and B{sup {-+}} {yields} DK*{sup {-+}} with K8{sup {-+}} {yields} K{sub S}{sup 0}{pi}{sup {-+}}. Using a sample of 383 million B{bar B} pairs collected by the BABAR detector, we measure {gamma} = (76 {+-} 22 {+-} 5{+-} 5){sup o} (mod 180{sup o}), where the first error is statistical, the second is the experimental systematic uncertainty and the third reflects the uncertainty on the description of the Dalitz plot distributions. The corresponding two standard deviation region is 29{sup o} < {gamma} < 122{sup o}. This result has a significance of direct CP violation ({gamma} {ne} 0) of 3.0 standard deviations.

  2. Pügmeede seitse õppetundi tõhusaks meeskonnatööks / Manfred Kets De Vries

    Index Scriptorium Estoniae

    Kets De Vries, Manfred

    2003-01-01

    Kesk-Aafrika vihmametsades pügmeede kogukonnas elanud Euroopa juhtimistreener Manfred Kets De Vries kirjeldab pügmeede igapäevatavasid, mida läänelikud organisatsioonid võiksid pidada efektiivse käitumise eeskujuks. Vt. samas: Psühhoanalüütikust juhtimisguru.

  3. Investigation of CP violation in $B^{0} \\to J/\\psi K_{s}^{0}$ decays at LEP

    CERN Document Server

    Ackerstaff, K.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bobinski, M.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Clarke, P.E.L.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallapiccola, C.; Dallavalle, G.Marco; Davis, R.; De Jong, S.; del Pozo, L.A.; de Roeck, A.; Desch, K.; Dienes, B.; Dixit, M.S.; Doucet, M.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Estabrooks, P.G.; Etzion, E.; Evans, H.G.; Evans, M.; Fabbri, F.; Fanfani, A.; Fanti, M.; Faust, A.A.; Feld, L.; Fiedler, F.; Fierro, M.; Fischer, H.M.; Fleck, I.; Folman, R.; Fong, D.G.; Foucher, M.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Geddes, N.I.; Geich-Gimbel, C.; Geralis, T.; Giacomelli, G.; Giacomelli, P.; Giacomelli, R.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Goodrick, M.J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Hargrove, C.K.; Hart, P.A.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Hocker, James Andrew; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Hutchcroft, D.E.; Igo-Kemenes, P.; Imrie, D.C.; Ishii, K.; Jawahery, A.; Jeffreys, P.W.; Jeremie, H.; Jimack, M.; Joly, A.; Jones, C.R.; Jones, M.; Jost, U.; Jovanovic, P.; Junk, T.R.; Kanzaki, J.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kirk, J.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kyberd, P.; Lafferty, G.D.; Lahmann, R.; Lai, W.P.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Lawson, I.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lefebvre, E.; Lellouch, D.; Letts, J.; Levinson, L.; List, B.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Lui, D.; Macchiolo, A.; Macpherson, A.; Mannelli, M.; Marcellini, S.; Markopoulos, C.; Markus, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mincer, A.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Oldershaw, N.J.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Poli, B.; Posthaus, A.; Rembser, C.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Rooke, A.; Rossi, A.M.; Routenburg, P.; Rozen, Y.; Runge, K.; Runolfsson, O.; Ruppel, U.; Rust, D.R.; Sachs, K.; Saeki, T.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schieck, J.; Schleper, P.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skillman, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Springer, Robert Wayne; Sproston, M.; Stephens, K.; Steuerer, J.; Stockhausen, B.; Stoll, K.; Strom, David M.; Strohmer, R.; Szymanski, P.; Tafirout, R.; Talbot, S.D.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Torrence, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Ueda, I.; Utzat, P.; Van Kooten, Rick J.; Vannerem, P.; Verzocchi, M.; Vikas, P.; Vokurka, E.H.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.

    1998-01-01

    An investigation of CP violation was performed using a total of 24 candidates for B^0 -> J/psi K^0_S decay, with a purity of about 60%. These events were selected from 4.4 million hadronic Z^0 decays recorded by the OPAL detector at LEP. An analysis procedure, involving techniques to reconstruct the proper decay times and tag the produced b-flavours, B^0 or B^0(bar), has been developed to allow a first direct study of the time dependent CP asymmetry that, in the Standard Model, is sin(2beta). The result is sin(2beta) = 3.2_{-2.0}^{+1.8} +/- 0.5, where the first error is statistical and the second systematic. This result is used to determine probabilities for different values of sin(2beta) in the physical region from -1 to +1.

  4. Bali saarel otsitakse üksmeelt, kuidas päästa üks planeet. Meie oma / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2007-01-01

    Indoneesias Bali saarel toimub 13. ÜRO kliimamuutuste konverents. Briti peaministri Gordon Browni kommentaar: Eesmärgiks on vähese süsiniku majandusmudel ja USA suursaadiku Eestis Stanley Davis Phillipsi kommentaar: Bali: edu tänu üleilmsele pingutusele

  5. Prompt $K_{S}^{0}$ production in $pp$ collisions at $\\sqrt{s}$ = 0.9 TeV

    CERN Document Server

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Agari, M; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alfonsi, M; Alvarez Cartelle, P; Alves Jr, A.A; Amato, S; Amhis, Y; Amoraal, J; Anderson, J; Antunes Nobrega, R; Appleby, R; Aquines Gutierrez, O; Arefyev, A; Arrabito, L; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Bagaturia, Y; Bailey, D.S; Balagura, V; Baldini, W; Barber, G; Barham, C; Barlow, R.J; Barsuk, S; Basiladze, S; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Bellunato, T; Belous, K; Belyaev, I; Benayoun, M; Bencivenni, G; Bernet, R; Bernhard, R.P; Bettler, M-O; van Beuzekom, M; Bibby, J.H; Bifani, S; Bizzeti, A; Bjrnstad, P.M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bochin, B; Bonaccorsi, E; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bos, E; Bowcock, T.J.V; Bozzi, C; Brambach, T; van den Brand, J; Brarda, L; Bressieux, J; Brisbane, S; Britsch, M; Brook, N.H; Brown, H; Brusa, S; Buchler-Germann, A; Bursche, A; Buytaert, J; Cadeddu, S; Caicedo Carvajal, J.M; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Cameron, W; Camilleri, L; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carroll, J; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Chadaj, B; Charles, M; Charpentier, Ph; Cheng, J; Chiapolini, N; Chlopik, A; Christiansen, J; Ciambrone, P; Cid Vidal, X; Clark, P.J; Clarke, P.E.L; Clemencic, M; Cliff, H.V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Constantin, F; Conti, G; Contu, A; Cooke, P; Coombes, M; Corajod, B; Corti, G; Cowan, G.A; Currie, R; DAlmagne, B; DAmbrosio, C; DAntone, I; Da Silva, W; Dane, E; David, P; De Bonis, I; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J.M; De Paula, L; De Simone, P; Decamp, D; Decreuse, G; Degaudenzi, H; Deissenroth, M; Del Buono, L; Densham, C.J; Deplano, C; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Dima, M; Donleavy, S; Dornan, P; Dossett, D; Dovbnya, A; Dumps, R; Dupertuis, F; Dwyer, L; Dzhelyadin, R; Eames, C; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Eklund, L; d'Enterria, D; Esperante Pereira, D; Est`eve, L; Fanchini, E; Farber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Felici, G; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Flegel, W; Fontanelli, F; Forti, C; Forty, R; Fournier, C; Franek, B; Frank, M; Frei, C; Frosini, M; Fungueirino Pazos, J.L; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garrido, L; Gascon, D; Gaspar, C; Gaspar De Valenzuela Cue, A; Gassner, J; Gauvin, N; Gavillet, P; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gilitsky, Yu; Gligorov, V.V; Gobel, C; Golubkov, D; Golutvin, A; Gomes, A; Gong, G; Gong, H; Gordon, H; Grabalosa Gandara, M; Gracco, V; Graciani Diaz, R; Granado Cardoso, L.A; Grauges, E; Graziani, G; Grecu, A; Gregson, S; Guerrer, G; Gui, B; Gushchin, E; Guz, Yu; Guzik, Z; Gys, T; Haefeli, G; Haines, S.C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, P.F; He, J; Hennessy, K; Henrard, P; Hernando Morata, J.A; van Herwijnen, E; Hicheur, A; Hicks, E; Hilke, H.J; Hofmann, W; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R.S; Hutchcroft, D; Iacoangeli, F; Iakovenko, V; Iglesias Escudero, C; Ilgner, C; Imong, J; Jacobsson, R; Jahjah Hussein, M; Jamet, O; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; John, M; Johnson, D; Jones, C.R; Jost, B; Kapusta, F; Karbach, T.M; Kashchuk, A; Katvars, S; Keaveney, J; Kerzel, U; Ketel, T; Keune, A; Khalil, S; Khanji, B; Kim, Y.M; Knecht, M; Koblitz, S; Konoplyannikov, A; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kristic, R; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kudryashov, I; Kukulak, S; Kumar, R; Kvaratskheliya, T; La Thi, V.N; Lacarrere, D; Lai, A; Lambert, R.W; Lanfranchi, G; Langenbruch, C; Latham, T; Le Gac, R; Lees, J-P; Lef`evre, R; Leflat, A; Lefrancois, J; Lehner, F; Lenzi, M; Leroy, O; Lesiak, T; Li, L; Li, Y.Y; Li Gioi, L; Libby, J; Lieng, M; Lindner, R; Lindsey, S; Linn, C; Liu, B; Liu, G; Lochner, S; Lopes, J.H; Lopez Asamar, E; Lopez-March, N; Loveridge, P; Luisier, J; Mcharek, B; Machefert, F; Machikhiliyan, I.V; Maciuc, F; Maev, O; Magnin, J; Maier, A; Malde, S; Mamunur, R.M.D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Marki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martinez Santos, D; Massaferri, A; Mathe, Z; Matteuzzi, C; Matveev, V; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Mclean, C; Merk, M; Merkel, J; Merkin, M; Messi, R; Metlica, F.C.D; Miglioranzi, S; Minard, M-N; Moine, G; Monteil, S; Moran, D; Morant, J; Morris, J.V; Moscicki, J; Mountain, R; Mous, I; Muheim, F; Muresan, R; Murtas, F; Muryn, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nardulli, J; Nawrot, A; Nedos, M; Needham, M; Neufeld, N; Neustroev, P; Nicol, M; Nicolas, L; Nies, S; Niess, V; Nikitin, N; Noor, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Ostankov, A; Palacios, J; Palutan, M; Panman, J; Papadelis, A; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C.J; Passaleva, G; Patel, G.D; Patel, M; Paterson, S.K; Patrick, G.N; Patrignani, C; Pauna, E; Pauna (Chiojdeanu), C; Pavel (Nicorescu), C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D.L; Perez Trigo, E; Perez-Calero Yzquierdo, A; Perret, P; Pessina, G; Petrella, A; Petrolini, A; Picatoste Olloqui, E; Pie Valls, B; Piedigrossi, D; Pietrzyk, B; Pinci, D; Playfer, S; Plo Casasus, M; Poli-Lener, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Poss, S; Potterat, C; Powell, A; Pozzi, S; du Pree, T; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J.H; Rakotomiaramanana, B; Raniuk, I; Raven, G; Redford, S; Reece, W; dos Reis, A.C; Ricciardi, S; Riera, J; Rinnert, K; Roa Romero, D.A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Cobo, C; Rodriguez Perez, P; Rogers, G.J; Romanovsky, V; Rondan Sanabria, E; Rosello, M; Rospabe, G; Rouvinet, J; Roy, L; Ruf, T; Ruiz, H; Rummel, C; Rusinov, V; Sabatino, G; Saborido Silva, J.J; Sagidova, N; Sail, P; Saitta, B; Sakhelashvili, T; Salzmann, C; Sambade Varela, A; Sannino, M; Santacesaria, R; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savidge, T; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schmelling, M; Schmidt, B; Schneider, O; Schneider, T; Schopper, A; Schune, M-H; Schwemmer, R; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Serra, N; Serrano, J; Shao, B; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Shires, A; Sigurdsson, S; Simioni, E; Skottowe, H.P; Skwarnicki, T; Smale, N; Smith, A; Smith, A.C; Smith, N.A; Sobczak, K; Soler, F.J.P; Solomin, A; Somogy, P; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spiridenkov, E; Spradlin, P; Srednicki, A; Stagni, F; Stahl, S; Steiner, S; Steinkamp, O; Stenyakin, O; Stoica, S; Stone, S; Storaci, B; Straumann, U; Styles, N; Szczekowski, M; Szczypka, P; Szumlak, T; TJampens, S; Tarkovskiy, E; Teodorescu, E; Terrier, H; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Topp-Joergensen, S; Tran, M.T; Traynor, S; Trunk, U; Tsaregorodtsev, A; Tuning, N; Ukleja, A; Ullaland, O; Uwer, U; Vagnoni, V; Valenti, G; Van Lysebetten, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J.J; Veltri, M; Vervink, K; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, An; Voss, H; Wacker, K; Wandernoth, S; Wang, J; Ward, D.R; Webber, A.D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M.P; Williams, M; Wilson, F.F; Wishahi, J; Witek, M; Witzeling, W; Woodward, M.L; Wotton, S.A; Wyllie, K; Xie, Y; Xing, F; Yang, Z; Ybeles Smit, G; Young, R; Yushchenko, O; Zeng, M; Zhang, L; Zhang, Y; Zhelezov, A; Zverev, E

    2010-01-01

    The production of K_short mesons in pp collisions at a centre-of-mass energy of 0.9 TeV is studied with the LHCb detector at the Large Hadron Collider. The luminosity of the analysed sample is determined using a novel technique, involving measurements of the beam currents, sizes and positions, and is found to be 6.8 +/- 1.0 microbarn^-1. The differential prompt K_short production cross-section is measured as a function of the K_short transverse momentum and rapidity in the region 0 < pT < 1.6 GeV/c and 2.5 < y < 4.0. The data are found to be in reasonable agreement with previous measurements and generator expectations.

  6. 77 FR 33388 - Designation for the Topeka, KS; Cedar Rapids, IA; Minot, ND; and Cincinnati, OH Areas; Correction

    Science.gov (United States)

    2012-06-06

    ... Areas; Correction AGENCY: Grain Inspection, Packers and Stockyards Administration. ACTION: Notice; correction. SUMMARY: The U.S. Department of Agriculture, Grain Inspection, Packers and Stockyards... Administrator, Grain Inspection, Packers and Stockyards Administration. BILLING CODE 3410-KD-P ...

  7. 78 FR 43849 - Correction for the Omaha, NE; Marshall, MI; Frankfort, IN; Topeka, KS; and Minot, ND Areas; and...

    Science.gov (United States)

    2013-07-22

    ... Grain Inspection, Packers and Stockyards Administration Correction for the Omaha, NE; Marshall, MI...: Grain Inspection, Packers and Stockyards Administration, USDA. ACTION: Notice and correction. SUMMARY: The U.S. Department of Agriculture, Grain Inspection, Packers and Stockyards Administration (GIPSA...

  8. Pompejanum Tartu Ülikooli Kunstimuuseumis : üks haruldane interjöörinäidis / Inge Kukk

    Index Scriptorium Estoniae

    Kukk, Inge

    2003-01-01

    Pompeji stiilis 19. saj. ruumikujunduse parim näide Eestis. Antiikaja seinamaali motiivide kasutamisest. Töid alustati 1868. aastal. Tartu maalermeister F. Redlin, juhendas antiikarheoloog Ludwig Schwabe

  9. Miks ohverdada veel üks põlvkond? / Christopher õBeazley ; interv. Berit Teeäär

    Index Scriptorium Estoniae

    õBeazley, Christopher

    2008-01-01

    Euroopa Parlamendi Balti-Euroopa tugirühma esimees Christopher Beazley vastab küsimustele, mis puudutavad tema huvi Balti riikide ja Läänemere regiooni vastu, Läänemere piirkonnas paiknevate Euroopa Liidu vanade ja uute liikmesriikide kontseptuaalsete erinevuste tõttu tekkida võivaid lahkhelisid, Euroopa Liidu ja Venemaa suhete seisu ja arenguperspektiive, liidu ühise välispoliitika kujunemise võimalikkust, Kaliningradi oblasti demilitariseerimist ning selle enklaavi muutmist Euroopa Liidu ja Venemaa vahelise vabakaubanduse pilootprojektiks, Läänemere ökoloogilise olukorra parandamist

  10. Valmisolek igapäevaseks tööks ja tõeliseks pühendumiseks! / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-

    2012-01-01

    Arvustus: Karmo, Märt. Must-kuldne müts me peas...I, Tallinna Reaalkool 1917-1920. Tallinn, 2011. ; Karmo, Märt. Must-kuldne müts me peas...II, Tallinna Reaalkool 1920-1940, Saksa Reaalkool 1919-1939. Tallinn, 2011

  11. Time-Dependent and Time-Integrated Angular Analysis of B -> phi Ks pi0 and B -> phi K+ pi-

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B; Bona, M; Karyotakis, Y; Lees, J P; Poireau, V

    2008-08-04

    We perform a time-dependent and time-integrated angular analysis of the B{sup 0} {yields} {psi}K*(892){sup 0}, {psi}K*{sub 2}(1430{sup 0}), and {psi}(K{pi}){sub S-wave}{sup 0} decays with the final sample of about 465 million B{bar B} pairs recorded with the BABAR detector. Overall, twelve parameters are measured for the vector-vector decay, nine parameters for the vector-tensor decay, and three parameters for the vector-scalar decay, including the branching fractions, CP-violation parameters, and parameters sensitive to final state interaction. We use the dependence on the K{pi} invariant mass of the interference between the scalar and vector or tensor components to resolve discrete ambiguities of the strong and weak phases. We use the time-evolution of the B {yields} {psi}K{sub S}{sup 0}{pi}{sup 0} channel to extract the CP-violation phase difference {Delta}{phi}{sub 00} = 0.28 {+-} 0.42 {+-} 0.04 between the B and {bar B} decay amplitudes. When the B {yields} {psi}K{sup {+-}}{pi}{sup {-+}} channel is included, the fractions of longitudinal polarization f{sub L} of the vector-vector and vector-tensor decay modes are measured to be 0.494 {+-} 0.034 {+-} 0.013 and 0.901{sub -0.058}{sup +0.046} {+-} 0.037, respectively. This polarization pattern requires the presence of a helicity-plus amplitude in the vector-vector decay from a presently unknown source.

  12. Studying the Thenar Eminence of Amateur cooKs (STEAK) study: a double-blinded, cross-sectional study.

    Science.gov (United States)

    Vinycomb, Toby I; Tan, Amanda M-Y; Bhatnagar, Manu; Wong, Joon Ming

    2015-12-14

    To evaluate the reliability of using the thenar eminence to determine steak doneness. Double-blinded, cross-sectional study. Various home kitchens in Melbourne, Australia. Amateur/home cooks. The accuracy of the finger test (the tenseness of the thenar eminence in different hand positions) for determining how well a random beef steak has been cooked (rare v medium-rare v medium v well-done). We also examined whether participants improved with practice and whether the accuracy of the finger test was correlated with age, sex, cooking experience or self-rated steak-cooking ability. Twenty-six participants completed the study, and showed that they could accurately determine the doneness of a steak with the finger test better than chance (χ2[1, n = 156] = 9.88; P amateur cooks to determine beef steak doneness. However, the low overall accuracy of the test suggests that more invasive tests are to be recommended for determining steak doneness for its health benefits.

  13. Tänavune Nobeli majandusauhind läks uue väliskaubandusteooria rajajale / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2008-01-01

    2008. aastal Nobeli majandusauhinna pälvinud Princetoni ülikooli professorist Paul Krugmanist, teadustöö eest, mis aitab seletada, miks teatud riigid rahvusvahelises kaubanduses juhtrolli mängivad. Lisa: Paul R. Krugman

  14. Spanish version of the Kidney Disease Knowledge Survey (KiKS in Peru: cross-cultural adaptation and validation

    Directory of Open Access Journals (Sweden)

    Evelin Mota-Anaya

    2016-08-01

    Full Text Available Resumen INTRODUCCIÓN La enfermedad renal crónica afecta a 50 millones de personas en el mundo. Diversos estudios manifiestan la importancia de implementar intervenciones que mejoren el conocimiento de los pacientes respecto a su enfermedad. En 2011 se elaboró el Kidney Disease Knowledge Survey, cuestionario que valora el conocimiento específico respecto de la enfermedad renal crónica en pacientes no dializados. OBJETIVO Realizar la traducción al español, adaptación cultural y validación del cuestionario Kidney Disease Knowledge Survey en una población de pacientes con enfermedad renal crónica en estadios pre-dialíticos. MÉTODOS Se llevó a cabo la traducción, retraducción y adaptación cultural del cuestionario. Posteriormente, se determinó su validez y fiabilidad. La primera, mediante la validez de constructo y la segunda, valorando su consistencia interna y fiabilidad intra-observador (test-retest. RESULTADOS Se encontró una buena consistencia interna (Kuder–Richardson=0,85. Respecto de la fiabilidad intra observador, el coeficiente de correlación intraclase obtuvo un valor de 0,78 (intervalo de confianza 95%; 0,5-1,0 que indica una buena reproducibilidad. La diferencia de medias de test-retest de -1,1 DS 6,0 (p= 0,369, confirman lo anterior. DISCUSIÓN La versión obtenida en español del Kidney Disease Knowledge Survey es aceptable y equivalente a la versión original. Además, tiene buen grado de fiabilidad, validez y reproducibilidad. Por ende, podría ser empleada en una población de pacientes con enfermedad renal crónica en estadios pre-dialíticos.

  15. Pihl : joobes autojuhtimised pole liikluses probleem number üks / Jüri Pihl ; interv. Peeter Kuimet

    Index Scriptorium Estoniae

    Pihl, Jüri, 1954-

    2007-01-01

    Siseminister Jüri Pihl vastab küsimustele liiklusõnnetuste ja -surmade põhjuste kohta, pidades suurimaks põhjuseks kiiruseületamist ja lahtisi turvavöid. Rikkujate karistamisest ja alkoholimüügi piirangutest. Lisa: Kurb statistika

  16. 78 FR 14097 - Pulse Oximeters-Premarket Notification Submissions [510(k)s]; Guidance for Industry and Food and...

    Science.gov (United States)

    2013-03-04

    ... HUMAN SERVICES Food and Drug Administration Pulse Oximeters--Premarket Notification Submissions ; Guidance for Industry and Food and Drug Administration Staff; Availability AGENCY: Food and Drug Administration, HHS. ACTION: Notice. SUMMARY: The Food and Drug Administration (FDA) is announcing the...

  17. Eesti pätidraama läks Karlovy Varyl täismajale / Tristan Priimägi

    Index Scriptorium Estoniae

    Priimägi, Tristan, 1976-

    2008-01-01

    8. juulil esilinastus Karlovy Vary filmifestivalil Rene Vilbre noortefilm "Mina olin siin", mille aluseks on Sass Henno romaan "Mina olin siin. Esimene arest". Film võistleb võistlusprogrammis "East of the West". Ka teistest eesti filmidest, mida festivali eri programmides näha saab

  18. Director läks ja küsis / Indrek Randveer, Evelyn Karming, Priit Palk ... [jt.

    Index Scriptorium Estoniae

    2010-01-01

    EMT teenindus- ja müügidirektor Indrek Randveer, Estraveli müügidirektor Evelyn Karming, ABC King/Nero/SHU/Suurtüki turundusjuht Anne-Liis Ostov, kohvik-restoran Crepp juhataja Priit Palk ja Sokos Hotel Viru kommunikatsioonijuht Peep Ehasalu vastavad küsimustele, mis puudutavad nende kogemusi keerukate ja absurdsete kliendikaebuste kohta

  19. Aesthetic of the subversion and the violence in Francis Bacon and Frida Kahlo’s WorKs of Art

    Directory of Open Access Journals (Sweden)

    Catarina Pinheiro

    2014-06-01

    Full Text Available Having Frida Kahlo and Francis Bacon ́s work as a starting point, the authors discuss the dimensions of violence and trauma present in their creative forms and on the impact produced on the spectator. They also reflect on its connections with the clinic on the impact/countertransference phenomenon and its transformational possibilities.

  20. Lokaalne ja globaalne MoKS / Evelyn Müürsepp, John Grzinich, Siiri Kolka ; intervjueerinud Maarin Mürk

    Index Scriptorium Estoniae

    Müürsepp, Evelyn

    2011-01-01

    Intervjuu Mooste Kunsti- ja Sotsiaalpraktika Keskuse eestvedajate Evelyn Müürsepa ja John Grzinichiga ning 2010. a. lõpul tööle võetud assistendi Siiri Koklaga. Keskusel saab tänavu 10 aastat tegutsemist. Tähtpäevaks renoveeriti ka Mooste mõisa valitsejamaja

  1. Käsk number üks - saavutada täiskontroll - on täidetud / Toomas Hendrik Ilves

    Index Scriptorium Estoniae

    Ilves, Toomas Hendrik, 1953-

    2006-01-01

    Raamatuarvustus: Baker, Peter; Glasser, Susan. Kremlin Rising: Vladimir Putin's Russia and the End of Revolution. New York: Scribner, 2005. Raamatu autorid on USA ajalehe Washington Post Moskva korrespondendid. Arvustus ilmunud ka: Sirp : Diplomaatia 7. okt. 2005 nr. 25, lk. 14-15

  2. First Observation and Dalitz Analysis of the D^0 --> K_S^0 eta pi^0 Decay

    CERN Document Server

    Rubin, P; Eisenstein, B I; Gollin, G D; Karliner, I; Lowrey, N; Naik, P; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Besson, D; Gao, K Y; Gong, D T; Kubota, Y; Li, S Z; Poling, R A; Scott, A W; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z V; Seth, K K; Tomaradze, A G; Zweber, P; Ernst, J; Arms, K; Eckhart, E; Gan, K K; Severini, H; Skubic, P L; Asner, D M; Dytman, S A; Mehrabyan, S S; Müller, J A; Savinov, V; Li, Z; López, A; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shibata, E I; Shipsey, I P J; Adams, G S; Chasse, M; Cummings, J P; Danko, I; Napolitano, J; Cronin-Hennessy, D; Park, C S; Park, W; Thayer, J B; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Stroynowski, R; Artuso, M; Boulahouache, C; Blusk, S; Butt, J; Dambasuren, E; Dorjkhaidav, O; Menaa, N; Mountain, R; Muramatsu, H; Nandakumar, R; Redjimi, R; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Mahmood, A H; Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; Bornheim, A; Lipeles, E; Pappas, S P; Weinstein, A J; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Adam, N E; Alexander, J P; Berkelman, K; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gittelman, B; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Meyer, T O; Onyisi, P U E; Patterson, J R; Pedlar, T K; Peterson, D; Pivarski, J; Riley, D; Rosner, J L; Ryd, A; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Sun, W M; Thayer, J G; Urner, D; Wilksen, T; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Patel, R; Potlia, V; Stöck, H; Yelton, J

    2004-01-01

    Using 9.0/fb of integrated luminosity in e+e- collisions near the Upsilon(4S) mass collected with the CLEO II.V detector we report the first observation of the decay D0 -> K0S ETA PI0 We measure the ratio of branching fractions, BR(D0 -> K0S ETA PI0) / BR(D0 -> K0S PI0) = 0.46 +- 0.07 +- 0.06. We perform a Dalitz analysis of 155 selected D0 -> K0S ETA PI0 candidates and find leading contributions from a_0(980) K0S and K*(892) ETA intermediate states.

  3. Henrik, Neitsi Maarja ja tema sulased : üks äraspidine arutlus / Jüri Kivimäe

    Index Scriptorium Estoniae

    Kivimäe, Jüri, 1947-

    2014-01-01

    Henriku kroonikast kui Eesti ajaloo alguses seisvast tekstist. Neitsi Maarja kultuse populaarsusest Õhtumaa kristluses 12. ja 13. sajandil. Henriku reisist Rooma. Maarjamaa leiutamisest. 800 aastat hiljem.

  4. Director läks ja küsis / Reet Neemoja, Jaanika Kuusik, Riina Varts... [jt.

    Index Scriptorium Estoniae

    2010-01-01

    MicroLinki personalijuht Reet Neemoja, Elioni personalijuht Jaanika Kuusik, Eesti Energia personalijuht Riina Varts, Rimi personalijuht Õrne Lainde ning Sampo panga personalijuht Liina Oks vastavad küsimustele, mis puudutavad nende suurimat tööalast õppetundi 2009. aastal ning kõige olulisemat 2010. aastal

  5. 77 FR 6781 - Opportunity for Designation in the Topeka, KS; Cedar Rapids, IA; Minot, ND; and Cincinnati, OH...

    Science.gov (United States)

    2012-02-09

    ... eastern Allamakee County line; the eastern and southern Clayton County lines; the eastern Buchanan County..., Bracken, Campbell, Clark, Fleming, Gallatin, Grant, Harrison, Kenton, Lewis (west of State Route 59... Route 296; State Route 296 east to State Route 560; State Route 560 south to the Clark County line; the...

  6. Savisaare ja Ansipi näo tundis ära igaüks / Lilia Krõsina

    Index Scriptorium Estoniae

    Krõsina, Lilia

    2009-01-01

    Venekeelne ajaleht Postimees otsustas välja selgitada, kas vene keelt kõnelevad inimesed tunnevad nägupidi Eesti tipp-poliitkuid ja ühiskonnategelasi. Küsitluses osalejatele näidatud 13 foto seas olid ka president Toomas Hendrik Ilvese ja proua Evelin Ilvese pildid

  7. "Pärnu In Graafika" festival : Üks paras idealism / Reiu Tüür ; interv. Tiiu Leis

    Index Scriptorium Estoniae

    Tüür, Reiu

    1998-01-01

    Intervjuu Pärnus toimuva Pärnu, Tartu ja Tallinna noorte graafikute loomingut kajastava kunstifestivali "In Graafika" (12. jaan. - 21. jaan.) korraldaja Reiu Tüüriga, teemaks festivali eesmärgid ja üritused, mille hulka kuuluvad peale näituste ka workshopid ja performance'id; DJna esineb Tarrvi, Laamann, ansambliga Mügarik Marko Mäetamm.

  8. Võrumaa ehitus-Elevant läks Taani ettevõtte kätte / Kaisa Tahlfeld

    Index Scriptorium Estoniae

    Tahlfeld, Kaisa

    2010-01-01

    Akna- ja uksekomponente valmistava firma Barruse saeveski omanik Arno Tammjärv müüs 80% Barruse aktsiatest Taani kapitalil põhinevale ettevõttele Inter-Invest A/S. Firma plaanib selleks aastaks üle 200 miljoni kroonist käivet ehk 25% suurust käibe kasvu

  9. Nagu papa soovitas, nii ka läks - tütar hakkas botaanikuks / Tiina Randlane

    Index Scriptorium Estoniae

    Randlane, Tiina, 1953-

    2012-01-01

    Samblikuteadlase Tiina Randlase lapsepõlvest ning aktiivsest tegevusest Tallinna noorte naturalistide jaamas (hilisemas loodusesõprade majas). Tiina Randlase vanemateks olid Tallinna vabariikliku psühhoneuroloogiahaigla psühhiaatrid Ellen ja Vsevolod Grüntal

  10. Kaks perekonda (pluss üks) Karja kihlekonnast : mälestuste mälestusi / Mall Jõgi

    Index Scriptorium Estoniae

    Jõgi, Mall, 1947-

    2008-01-01

    Sisaldab bibliograafiat ja märkusi joonealustes viidetes. - Mälestusi Saaremaa külaelanikest: külafotograafist Grepi Karlast, Oskar Kallase isast Mihkel Kallasest ja emast Miina Kallasest, Mihkel Kallase õdedest Ann, Viiu, Madli ja Ingel Kallasest ja vendadest Tõnis ja Kustu Kallasest; kooliõpetaja Reedik Allasest ning tema järeltulijatest Andrus Allasest ja Carl Allasest; Viktor Kingissepa vanaisast Ado Kingissepast, isast Eduard Kingissepast ja emast Eliise Kingissepast

  11. Üks õnneliku lõpuga eksirännak : 1939. aasta eesti muusika salvestised taas Eestis / Ilvi Rauna

    Index Scriptorium Estoniae

    Rauna, Ilvi

    2008-01-01

    Taani Kuningriigi kingitusest Eestile - 151 heliplaatide metallist originaalmatriisi Riigi Ringhäälingus 1939. aastal salvestatud Eesti muusikaga. Eelloost, helisalvestamise ettevalmistamisest 1937. aastast, finantseerimisest, salvesatud teostest, matritside saatusest

  12. Televiisorit kaissu ei võta, kuid raamatut küll : raamatupoe letilt võib leida mitte lihtsalt häid, vaid lausa suurepäraseid lasteraamatuid / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2001-01-01

    Sisu : Lloyd Alexander. Llyri loss; Lloyd Alexander. Rändur Taran; Skomantas. Teutoonide vang. Lühidalt ka Otfried Preussleri, Thorbjırn Egneri, Vitezlav Nezvali, Jỉi Trnka, Aino Perviku ja Ellen Niidu raamatutest

  13. SUUNTA JA MUUTOS. HAVAINTOJA VIRON JA SUOMEN LIIKEVERBEISTÄ

    Directory of Open Access Journals (Sweden)

    Hannu Tommola

    2010-01-01

    Full Text Available Suund ja muutumine. Tähelepanekuid eesti ja soome liikumisverbidest. Käesolevas artiklis püütakse selgitada eesti ja soome keele kõige sagedasemate liikumisverbide polüfunktsionaalsust. Soome keele tulla vastab küll põhitähenduses eesti verbile tulema, kuid ei väljenda lahkumist – seda väljendatakse soome keeles verbiga lähteä. Samuti erinevad meie keeled inhoatiivi väljendamises: soome keele kõige tavalisem muutumisverb on tulla, eesti keeles aga saama. Soome keele verbi jäädä ja eesti keele verbi jääma on vaadeldud liikumisverbidena nende võimaliku muutuse presupositsiooni tõttu. Jääma väljendab siiski ka seisundi tekkimise tähendust. See tähendus esineb soome verbil jääda vaid idioomides. Eesti keele jääma on näide polüseemia tüübist, mida on nimetatud enantioseemiaks (ühel ja samal lekseemil on vastandtähendused. Üks läänemeresoome liikumisverbide omapära näiteid on verb käydä/käima, mis võimaldab väljendada kahesuunalist liikumist. Soome ja eesti verbide põhitähendused on sarnased, aga kõigis kasutustes käydä ja käima ei kattu, sest käydä esineb ka muutumisverbina, eesti verbil see tähendus puudub. Lõpuks käsitletakse lühidalt idiomaatilisi väljendeid, nt. tuli kuntoon / meni pieleen ning läks korda/viltu.

  14. PM просмотрел документы WikiLeaks / Прийт Пуллеритс

    Index Scriptorium Estoniae

    Пуллеритс, Прийт, 1965-

    2011-01-01

    Ajaleht Postimees hakkab avaldama Norra ajalehe Aftonposten toimetusest saadud USA diplomaatide koostatud konfidentsiaalseid ettekandeid, mida Wikileaks oli varem näidanud vaid maailma viiele juhtivale ajalehele

  15. Restaureerimine vs renoveerimine vs rekonstrueerimine - veidi mõistetest / Anneli Randla

    Index Scriptorium Estoniae

    Randla, Anneli, 1970-

    2006-01-01

    Muinsuskaitseseaduse paragrahv 35 järgi on mälestistel lubatud tegevused vaid konserveerimine, restaureerimine ja remont. Mõistetest muinsuskaitseseaduses, ehitusseaduses ja Rahandusministeeriumi dokumentides (sh riigieelarves)

  16. Postimehe ajakirjanik käis Norras saladokumentide järel / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2011-01-01

    Ajaleht Postimees hakkab avaldama Norra ajalehe Aftonposten toimetusest saadud USA diplomaatide koostatud konfidentsiaalseid ettekandeid, mida Wikileaks oli varem näidanud vaid maailma viiele juhtivale ajalehele

  17. Nam haljava ne nuzhna / Artur Kurvits

    Index Scriptorium Estoniae

    Kurvits, Artur

    2007-01-01

    Soomes toob mobiilifirma Blyk turule klientidele tasuta kõnede paketi, klient peab vaid nõustuma reklaamiklippide kuulamisega mobiiltelefonist. Eesti mobiilioperaatorid sellist teenust esilagu ei planeeri

  18. Vabariigi President kohtus Euroopa Komisjoni presidendiga

    Index Scriptorium Estoniae

    2008-01-01

    President Toomas Hendrik Ilvese ja Euroopa Komisjoni presidendi Jose Manuel Durao Barroso kohtumisel 11. märtsil 2008 olid kõne all Euroopa Liidu energiajulgeolek ja energiasõltumatus ning mitme Euroopa Liidu liikmesmaa, sealhulgas Eesti, kahepoolsed läbirääkimised Ameerika Ühendriikidega, et saavutada USAga viisavabadus. Ingl. k. ilmunud ka: Vaba Eesti Sõna 20. märts 2008, lk. 12, pealk.: All EU Citizens should have Visa-free Access to USA

  19. Eesti ja USA juhtide kohtumiste peateema on NATO ja demokraatia / Vahur Koorits

    Index Scriptorium Estoniae

    Koorits, Vahur, 1981-

    2006-01-01

    USA presidendi George W. Bushi visiidi ajal toimuvatel USA ja Eesti riigijuhtide kohtumistel räägitakse NATO ja demokraatia tulevikust, samuti tulevad kõne alla missioonid Afganistanis ja Iraagis ning eestlaste viisavabadus USA-sse reisimisel. Lisa: Millest kavatsevad riigijuhid kohtumistel rääkida: Ansip, Ilves, Bush. Vt. samas: Bushi visiidi ajal vilksatab Eesti üheks õhtuks ameeriklaste teleekraanidel

  20. Sisseminekuks : [luuletused] / Anna Haava ; [Impressioonid]: Viiu Härm

    Index Scriptorium Estoniae

    Haava, Anna, pseud., 1864-1957

    2004-01-01

    Sisu: Sisseminekuks ; Kartus ; Ööbikule ; Käokene, kuldalindu ; Mis sa tahad, kevade? ; Ei tule uni ; Hoia ennast; Tuksuv süda ; Sina oled kelm ; Hinge hellal' igatsusel' ; Kõik kallile ; Soov ; Unes nägin ; Võin ; Sinu silmad ; Sinu silmist pilk ; Kallis, sul on kuldne süda ; Sa kõige armsam mulle ; Oh võiksin ; Lill ; Nõmmelill ; Meie Mihkel ; Koidulale ; Ehitage rahukojad ; Emakeel ; Isamaja ; Väsinud ; Oh kuhu ma lähen? ; Ööbiku surm ; Ei saa mitte vaiki olla ; Ma olen näinud ; Südameta ; Sellepärast ; See oli ilusal õiekuul; Esimese lume ajal ; Mina vaat'sin muru pääle ; Ikka kurjalt sa mind vaatad ; Oh ma isegi ei tea ; Mis on luule paljalt sõnas? ; Oh oleksin ära surnud ; Lee ääres ; Sinu nimi ; Hoia vahest aken lahti ; Jumalaga jättes vaat'sid ; Ma laulan ; Ei oma õnne peita ; Küll oli ilus mu õieke ; Oh ära sa küsi ; Ei tule luule tuulest ; Köögis seisab ; Järv leegib eha paistel ; Sinu vanaema ; Nii ta on ; Tead küll, mu kuldkallis ; Ma lähen üle nõmme ; Lenda, lepatriinuke ; Vesi voolab, vesi kohab ; Üks ainus kord ; Oh kevade, oh õie-aeg ; Suur kontsert ; Kuupaistel ; Mets kohiseb ; Lind läks magama ; Kui sa tuled, too mull' lilli ; Sinilillekesed ; Ei ole sina minu ingel ; Ei mina õnne usu ; Viimast laulu ei saa laulda ; Kõige ilusam luule ; Üks on minul püham koda! ; Sa oled suurem kui su saatus ; Mu kodumaa, kus oled sa? ; Eest ära! ; Kui kandlekeeled katkevad ; Ma kõnnin koiduvalgel ; Mu mured kõik matsin ma maha ; Kui ma sulle armas olen ; Kas tahad tulla minuga? ; Sa vaata ette, süda! ; Truus sõpruses ma tahan ; Su silmade sügavuses ; Siis mine! ; See oli siis ; Mu süda usub ; Sind teretame, kuldapäike ; Mind jumalaga jätsid ; Sääl kord kasvab kaunis kodu ; Me oleme põhjamaa lapsed ; Hilised lilled ; Sa küsid, kus mu kodu ; külm ; Sina vaikiv, sügav öö ; Ju õitsvad kõik hellerheinad ; Öösünges kohab ; Kui saaks mullegi kord kodu ; On püha mulle mu kodumaa muld ; Oma hind vaid vaba

  1. Ketide Synthase (KS) Domain Prediction and Analysis of Iterative Type II PKS Gene in Marine Sponge-Associated Actinobacteria Producing Biosurfactants and Antimicrobial Agents

    OpenAIRE

    George Seghal Kiran; Joseph eSelvin; Sathiyanarayanan eGanesan; Lipton eAnuj Nishanth; Naif eAbdullah Al-Dhabi; Mariadhas eValan Arasu

    2016-01-01

    The important biological macromolecules such as lipopeptide and glycolipid biosurfactant producing marine actinobacteria were analyzed and their potential linkage between type II polyketide synthase (PKS) genes was also explored. A unique feature of type II PKS genes is their high amino acid sequence homology and conserved gene organization. These enzymes mediate the biosynthesis of polyketide natural products with enormous structural complexity and chemical nature by combinatorial use of var...

  2. Gemini Frontier Fields: Wide-field Adaptive Optics Ks-band Imaging of the Galaxy Clusters MACS J0416.1-2403 and Abell 2744

    Science.gov (United States)

    Schirmer, M.; Carrasco, E. R.; Pessev, P.; Garrel, V.; Winge, C.; Neichel, B.; Vidal, F.

    2015-04-01

    We have observed two of the six Frontier Fields galaxy clusters, MACS J0416.1-2403 and Abell 2744, using the Gemini Multi-Conjugate Adaptive Optics System (GeMS) and the Gemini South Adaptive Optics Imager (GSAOI). With 0.″ 08-0.″ 10 FWHM our data are nearly diffraction-limited over a 100\\prime\\prime × 100\\prime\\prime wide area. GeMS/GSAOI complements the Hubble Space Telescope (HST) redwards of 1.6 μm with twice the angular resolution. We reach a 5σ depth of {{K}s}˜ 25.6 mag (AB) for compact sources. In this paper, we describe the observations, data processing, and initial public data release. We provide fully calibrated, co-added images matching the native GSAOI pixel scale as well as the larger plate scales of the HST release, adding to the legacy value of the Frontier Fields. Our work demonstrates that even for fields at high galactic latitude where natural guide stars are rare, current multi-conjugated adaptive optics technology at 8 m telescopes has opened a new window on the distant universe. Observations of a third Frontier Field, Abell 370, are planned. Based on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the Science and Technology Facilities Council (United Kingdom), the National Research Council (Canada), CONICYT (Chile), the Australian Research Council (Australia), Ministério da Ciência, Tecnologia e Inovação (Brazil) and Ministerio de Ciencia, Tecnología e Innovación Productiva (Argentina). Based on observations made with ESO Telescopes at the La Silla and Paranal Observatories, Chile.

  3. Ülev ei Kivisildniku luules. Üks lugemisviis. The Sublime „No” in Kivisildnik’s Poetry: A Way of Reading

    Directory of Open Access Journals (Sweden)

    Leo Luks

    2012-04-01

    Full Text Available This article aims toward a phenomenological interpretation of the unmediated experience of reading Sven Kivisildnik’s poetry. As the basic theoretical thesis of the article, I assert that there is always an inherent negativity in the feeling of the sublime, since this feeling is caused by unrepresentable experience. Likewise, I claim that this negativity is not merely a lack in aesthetic representation, but that it has deep ontological meaning in itself. I make connections between the inherent negativity in the feeling of the sublime and the concept of failure of linguistic utterance worked out by Jaan Undusk, Jaak Tomberg and Jüri Lipping. I come to the conclusion that the „no” in the feeling of sublimity is given to us in unmediated form. The practical (or applied intention of this article is to show that the dominant sociocentric interpretation of Kivisildnik’s poetry is one-sided and limiting. From the theoretical positions I have worked out, I outline the fundamental motifs of Kivisildnik’s poetry, and by means of examples drawn from the text, demonstrate how the „no” of the sublime is found there. I come to the conclusion that the dominant direction in Kivisildnik’s poetry is destruction. The article consists of an introduction, five sections, and a summary. In the first section („Approaches”, I briefly introduce the phenomenological approach. My position is that the work is always created during the act of reading, as the outcome of the union of text and reader. However, I leave the reader as subject open to definition, leaving it to drift as it were, since I am sceptical about the possibility of defining the subject. I do not claim that the sublime is the only possible conceptual framework for understanding poetry; rather, I consider the sublime as one proper theoretical metaphor for conceptualizing personal experience of reading. In the second section of the article („Defining poetry”, I make use of Rein Raud’s distinctions to provide a preliminary definition of poetry, as located between cognition-centred, grammar-centred, and sociocentric approaches. Due to my phenomenological leanings, I am inclined toward the cognition-centred approach. Next, I discuss the difference between poetry and prose, using Maurice Blanchot’s interpretation of the two slopes of literature. In the rest of the article I focus on the second of these slopes, the one that reaches outward from the world of literature – that is, on poetry. The third section („The Dissolution of the Sublime in Failure”, I rebound from the positions of Undusk, Tomberg, and Lipping, according to whom utterance is unavoidably failure, and that the main goal of the aesthetic text is a drive toward silence. I connect the experience of hearing the silence within utterance with the concept of the sublime, using as bridging concepts Immanuel Kant’s classic definition of the sublime and the subsequent development of this idea by Jean-François Lyotard. According to Lyotard, the general purpose o modern art is striving toward negative representation, that is, toward the avoidance of representation. In the fourth section („Ontological Excursus: The Sublime (NoThing?”, I use Rodolphe Gasché’s arguments to critique Lyotard’s fundamental ontological position, according to which the universe of the phrase is all-encompassing (and contains silence, and something is always happening. According to Gasché’s interpretation – with which I concur, there is within the sublime of non-representability the possibility of non-being as the final phrase. I go on to deepen the latter possibility using Martin Heidegger’s discussion of the unmediated experience of no-thing in anxiety. In order to emphasize the processuality of this possibility, in the following line of reasoning I abandon the concept of no-thing in favour of the more ambiguous „no”. The fifth section („Poetry’s ways of „no”-ing”, I distinguish between three possible types of no-ing poetry, without pretending to any comprehensiveness in this list: metaphysical poetry; poetry that is undergoing weakening or decline, and the poetry of destruction. I then discuss the poetry of Kivisildnik in the framework of this typology, and come to the conclusion that for Kivisildnik, what dominates is the poetry of destruction. In the sixth section, („Great viperous lines...”, I briefly consider the three key motifs of Kivisildnik’s sublime poetry of destruction: terror, abortion, and Estonia as an empty signifier. In the concluding section I demonstrate that the question raised by postmodern art – what is art? is also relevant to Kivisildnik’s poetry. I examine four stylistic figures through which Kivisildnik’s poetry falls into essential uncertainty: mechanicalness, the dispersal of authorship, the turning-into-itself of poetry, and the text’s transmissions into emptiness.

  4. Küberkiusamine - kiusamise üks alaliike kahe Pärnu linna kooli näitel / Maris Jürgenson ; juhendaja Elma Künnapas

    Index Scriptorium Estoniae

    Jürgenson, Maris

    2013-01-01

    Pärnu Sütevaka Humanitaargümnaasiumi õpilase Maris Jürgensoni uurimustöö, mis põhineb Pärnu Sütevaka Humanitaargümnaasiumi ja Pärnu Vanalinna Põhikooli 6.-9. klassi õpilaste seas läbiviidud ankeetküsitlusel

  5. A roadmap to control penguin effects in B-d(0) -> J/psi K-S(0) and B-s(0) -> J/psi phi

    NARCIS (Netherlands)

    De Bruyn, K.; Fleischer, R.

    2015-01-01

    Abstract: Measurements of CP violation in Bd 0 → J/ψKS 0 and Bs 0 → J/ψϕ decays play key roles in testing the quark-flavour sector of the Standard Model. The theoretical interpretation of the corresponding observables is limited by uncertainties from doubly

  6. Tasakaalustatud mõõtmismudel kasumile mittesuunatud organisatsioonides - üks "järgmise" Eesti võimalustest / Sander Karu

    Index Scriptorium Estoniae

    Karu, Sander, 1959-

    2002-01-01

    Ülevaade Tasakaalustatud Mõõtmismudeli (TMM) (Balanced Scorecard - BSC) teoreetilistest alustest, kujundamisest ja kujundamise eripäradest kasumile mittesuunatud organisatsioonides kui ühest "järgmise Eesti" võimalusest tagamaks Eesti tasakaalustatud ja süsteemset arengut ning inimeste rahulolu. Joonised. Tabelid

  7. Measurement of the CP-Violating Asymmetries in B0 -> KS pi0 and of the Branching Fraction of B0 -> K0 pi0

    CERN Document Server

    Aubert, B; Boutigny, D; Karyotakis, Yu; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Garra Tico, J; Graugès-Pous, E; López, L; Palano, A; Pappagallo, M; Eigen, G; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes-Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Osipenkov, I L; Ronan, M T; Tackmann, K; Tanabé, T; Wenzel, W A; Del Amo-Sánchez, P; Hawkes, C M; Watson, A T; Held, T; Koch, H; Pelizaeus, M; Schröder, T; Steinke, M; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Khan, A; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Liu, F; Long, O; Shen, B C; Zhang, L; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Gabareen, A M; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Klose, V; Kobel, M J; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Lombardo, V; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Watson, J E; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Santoro, V; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Panduro-Vazquez, W; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bequilleux, J; D'Orazio, A; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Paramesvaran, S; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Zheng, Y; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; De Nardo, Gallieno; Fabozzi, F; Lista, L; Monorchio, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; Knoepfel, K J; LoSecco, J M; Benelli, G; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gagliardi, N; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Calderini, G; Chauveau, J; David, P; Del Buono, L; De La Vaissière, C; Hamon, O; Leruste, P; Malcles, J; Ocariz, J; Pérez, A; Prendki, J; Gladney, L; Biasini, M; Covarelli, R; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Carpinelli, M; Cenci, R; Cervelli, A; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Biesiada, J; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Baracchini, E; Bellini, F; Cavoto, G; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Renga, F; Voena, C; Ebert, M; Hartmann, T; Schröder, H; Waldi, R; Adye, T; Castelli, G; Franek, B; Olaiya, E O; Ricciardi, S; Röthel, W; Wilson, F F; Emery, S; Escalier, M; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, W; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dunwoodie, W; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Hast, C; Hrynóva, T; Innes, W R; Kaminski, J; Kelsey, M H; Kim, H; Kim, P; Kocian, M L; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ofte, I; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Wagner, A P; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Ruland, A M; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Pelliccioni, M; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Milanes, D A; Oyanguren, A; Albert, J; Banerjee, Sw; Bhuyan, B; Hamano, K; Kowalewski, R; Nugent, I M; Roney, J M; Sobie, R J; Harrison, P F; Ilic, J; Latham, T E; Mohanty, G B; Band, H R; Chen, X; Dasu, S; Flood, K T; Hollar, J J; Kutter, P E; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Neal, H

    2007-01-01

    We present a measurement of the time-dependent CP-violating asymmetries in $B^0 \\to K^0_{\\scriptscriptstyle S}\\pi^0$ decays based on 383 million $\\Upsilon(4S)\\to B\\kern 0.18em\\bar{\\kern -0.18em B}$ events collected by the \\mbox{\\slshape B\\kern-0.1em{\\smaller A}\\kern-0.1em B\\kern-0.1em{\\smaller A\\kern-0.2em R}} experiment at the PEP-II asymmetric-energy $B$ Factory at SLAC. We measure the direct CP-violating asymmetry $C_{K^0_{\\scriptscriptstyle S}\\pi^0} = 0.24 \\pm 0.15 \\pm 0.03$ and the CP-violating asymmetry in the interference between mixing and decay $S_{K^0_{\\scriptscriptstyle S}\\pi^0} = 0.40 \\pm 0.23 \\pm 0.03$, where the first errors are statistical and the second are systematic. On the same sample, we measure the decay branching fraction, obtaining ${\\cal B}(B^0 \\to K^0\\pi^0)= (10.3 \\pm 0.7 \\pm 0.6)\\times 10^{-6}$.

  8. Measurement of time-dependent CP-violating asymmetries in B-0 -> K-*0 gamma(K-*0 -> K-S(0)pi(0)) decays

    NARCIS (Netherlands)

    Aubert, B.; Chen, J.Y.; Schmitz, R.F.; Chen, S.; Zhang, L.L.; Simani, M.C.; Baak, M.A.; Bulten, H.J.; Raven, G.; Snoek, H.; David, P.; de Groot, N.; Yu, Z.

    2004-01-01

    A measurement of the time-dependent CP-violating (CPV) asymmetries in a b → sy process through the exclusive decay, was performed. A systematic uncertainty of 0.02 (0.02) due to tagging asymmetries in the signal and 0.02 (0.02) due to imperfect knowledge of the probability distribution function

  9. Comment on "Changes in atmospheric CO2 levels recorded by the isotopic signature of n-alkanes from plants" from K.S. Machado and S. Froehner

    Science.gov (United States)

    Köhler, Peter; Nehrbass-Ahles, Christoph; Schmitt, Jochen; Stocker, Thomas F.; Fischer, Hubertus

    2017-09-01

    The recently published invited research article by Machado and Froehner (2017) is presenting δ13C values from sedimentary organic matter (n-alkane), measured on samples collected in the Barigui watershed (Brazil) covering the last 400 years. The derived δ13C time series based on C27n-alkane, beginning approximately in the calendar year 1600 (or 1600 CE; with CE for Common Era) until recent times is subsequently - in their Fig. 3 - compared with a record, which is believed to be a representative reconstruction of atmospheric CO2 concentrations covering approximately the last 650 years (with respect to the year 2005 CE). The final conclusion of this article, as reflected in its title, is that changes in atmospheric CO2 levels are recorded in isotopic signatures on n-alkane from plants. We argue, that this conclusion can not be drawn from the study of Machado and Froehner (2017), since what is shown in their Fig. 3 is not a time series of atmospheric CO2 concentration of the last 650 years. The authors show reconstructions of atmospheric CO2 concentrations based on Antarctic ice cores over the past 650,000 years and use them for the past 650 years by ignoring the fact that the time scale in IPCC (2007), from which, according to the caption of their Fig. 3, they took this CO2 time series, is in kyr (1 kyr = 1 kilo year = 1000 years). This is wrong and any conclusion based on this comparison is incorrect. Instead they should have used for a correct CO2 time series for the comparison with their measurements.

  10. Afganistan 1979-1989 : viimase viie aastakümne üks verisemaid sõdu / Küllo Arjakas

    Index Scriptorium Estoniae

    Arjakas, Küllo, 1959-

    2007-01-01

    Järgneb. 25.09, 26.09, 27.09, 28.09, 29.09, 01.10, 02.10, 03.10, 04.10, 05.10, 08.10, 09.10, 10.10, 11.10, 12.10, 15.10, 16.10, 17.10, 18.10, 19.10, 22.10, 23.10, 24.10, 25.10, 26.10, 30.10, 31.10, 01.11, 02.11, 05.11, 06.11, 07.11, 12.11, 13.11, 14.11, 15.11, 16.11, 19.11, 20.11, 21.11, 22.11, 23.11

  11. Praegune "step by step" arenguvõimalus on üks paremaid, arvab Sven Mällo / Sven Mällo ; interv. Signe Kalberg

    Index Scriptorium Estoniae

    Mällo, Sven

    2008-01-01

    Maailma ühe suurema geneerilisi ravimeid tootva firma Sandoz D. D. Eesti, Läti ja Leedu filiaali juht räägib oma haridusteest, tööst arstina, karjäärist ravimite müügi alal, perekonnast, hobidest. Kommenteerib kursusekaaslane, Eesti Kohtuekspertiisi instituudi direktor Üllar Lanno

  12. Üks kord lõika, üheksa korda mõõda / Imre Sooäär

    Index Scriptorium Estoniae

    Sooäär, Imre, 1969-

    2004-01-01

    Ilmunud ka: Severnoje Poberezhje, 27. märts 2004, lk. 2; Vooremaa, 30. märts 2004, lk. 2; Hiiu Leht, 30. märts 2004, lk. 2; Nädaline, 30. märts 2004, lk. 4; Meie Maa, 30. märts 2004, lk. 2; Pärnu Postimees, 2. apr. 2004, lk. 15; Valgamaalane, 6. apr. 2004, lk. 2. Euroopa ühise põllumajanduspoliitika rakendamise seaduse vastuvõtmisest Riigikogus

  13. HPN, a Synthetic Analogue of Bromophenol from Red Alga Rhodomela confervoides: Synthesis and Anti-Diabetic Effects in C57BL/KsJ-db/db Mice

    Directory of Open Access Journals (Sweden)

    Jingya Li

    2013-01-01

    Full Text Available 3,4-Dibromo-5-(2-bromo-3,4-dihydroxy-6-(isopropoxymethylbenzylbenzene-1,2-diol (HPN is a synthetic analogue of 3,4-dibromo-5-(2-bromo-3,4-dihydroxy-6-(ethoxymethylbenzylbenzene-1,2-diol (BPN, which is isolated from marine red alga Rhodomela confervoides with potent protein tyrosine phosphatase 1B (PTP1B inhibition (IC50 = 0.84 μmol/L. The in vitro assay showed that HPN exhibited enhanced inhibitory activity against PTP1B with IC50 0.63 μmol/L and high selectivity against other PTPs (T cell protein tyrosine phosphatase (TCPTP, leucocyte antigen-related tyrosine phosphatase (LAR, Src homology 2-containing protein tyrosine phosphatase-1 (SHP-1 and SHP-2. The results of antihyperglycemic activity using db/db mouse model demonstrated that HPN significantly decreased plasma glucose (P < 0.01 after eight weeks treatment period. HPN lowered serum triglycerides and total cholesterol concentration in a dose-dependent manner. Besides, both of the high and medium dose groups of HPN remarkably decreased HbA1c levels (P < 0.05. HPN in the high dose group markedly lowered the insulin level compared to the model group (P < 0.05, whereas the effects were less potent than the positive drug rosiglitazone. Western blotting results showed that HPN decreased PTP1B levels in pancreatic tissue. Last but not least, the results of an intraperitoneal glucose tolerance test in Sprague–Dawley rats indicate that HPN have a similar antihyperglycemic activity as rosiglitazone. HPN therefore have potential for development as treatments for Type 2 diabetes.

  14. Study of CP violation in Dalitz-plot analyses of B0 to K K-KS, B to K K-K , and B to KSKSK

    Energy Technology Data Exchange (ETDEWEB)

    Lees, J.P.

    2012-03-20

    We perform amplitude analyses of the decays B{sup 0} {yields} K{sup +}K{sup -}K{sub s}{sup 0}, B{sup +} {yields} K{sup +}K{sup -}K{sup +}, and B{sup +} {yields}, and measure CP-violating parameters and partial branching fractions. The results are based on a data sample of approximately 470 x 10{sup 6} B{bar B} decays, collected with the BABAR detector at the PEP-II asymmetric-energy B factory at the SLAC National Accelerator Laboratory. For B{sup +} {yields} K{sup +}K{sup -}K{sup +}, we find a direct CP asymmetry in B{sup +} {yields} {phi}(1020)K{sup +} of A{sub CP} = (12.8 {+-} 4.4 {+-} 1.3)%, which differs from zero by 2.8{sigma}. For B{sup 0} {yields} K{sup +}K{sup -}K{sub s}{sup 0}, we measure the CP-violating phase {beta}{sub eff} ({phi}(1020)K{sub s}{sup 0}) = (21 {+-} 6 {+-} 2){sup o}. For B{sup +} {yields} K{sub s}{sup 0}K{sub s}{sup 0}K{sup +}, we measure an overall direct CP asymmetry of A{sub CP} = (4{sub -5}{sup +4} {+-} 2)%. We also perform an angular-moment analysis of the three channels, and determine that the f{sub X}(1500) state can be described well by the sum of the resonances f{sub 0}(1500), f{prime}{sub 2}(1525), and f{sub 0}(1710).

  15. IMPROVEMENT OF PERSONNEL POLICY IN A PLANT DUE ADVERSE FACTORS ERMAKOV K.S., KYSAKIN A.M., A.V. MYHAMADIEVA

    Directory of Open Access Journals (Sweden)

    2015-01-01

    Full Text Available Provision of civil aviation enterprises the necessary human resources and their rational use, high levels of labor productivity of services and increase efficiency. The modern market dictates the need for more rational use of labor resources and more reliable method of staff monitoring.

  16. Fookuses on lugemine : üks küsimus ajakirja "Raamatukogu" toimetuskolleegiumi liikmeile / Anneli Sepp, Hele Ellermaa, Mihkel Volt ... [jt.

    Index Scriptorium Estoniae

    2010-01-01

    Vastavad ERÜ esimees Anneli Sepp, Kõrveküla raamatukogu direktor Hele Ellermaa, Eesti Rahvusraamatukogu teadus- ja arenduskeskuse juhataja Mihkel Volt, Tartu Ülikooli Raamatukogu käsikirjade ja haruldaste raamatute osakonna juhataja Malle Ermel, Tartu Ülikooli Viljandi Kultuuriakadeemia infohariduse osakonna juhataja Ilmar Vaaro, Tallinna Ülikooli Akadeemlise Raamatukogu baltika ja haruldaste raamatute osakonna juhataja Katrin Kaugver, Tallinna Tehnikaülikooli Raamatukogu asedirektor Gerda Koidla ja Tartu Lutsu-nimelise Linnaraamatukogu direktor Asko Tamme

  17. Venemaa üks tuntumaid rokkbände Bi-2 tuleb Eestisse. Eesti pillimehed sõidavad Sotši muusikute jalgpalli-MMile

    Index Scriptorium Estoniae

    2007-01-01

    Vene ansambel Bi-2 Õllesummeri festivali pealaval 5. juulil Tallinna Lauluväljakul. Ansambel Compromise Blue esindamas Eestit 24. juunil algaval artistide esimesel maailmameistrivõistlusel jalgpallis Sotšis

  18. Kuidas olla peresõbralik tööandja : muret valmistab erisoodustusmaks, kuid hoolivus on ülesanne number üks

    Index Scriptorium Estoniae

    2008-01-01

    Oma ettevõtte peresõbralikkusest ja paindlikkusest räägivad Kädi Vestberg HR factory OÜ-st, Kadri Johanson CV-Keskusest, Kati Oja reisibüroost Estravel, Helena Erm Scania Eesti AS-ist, Moonika Kähr kinnisvarafirmast Uus Maa, Liina Oks Sampo pangast, Reet Treial Balti Investeeringute Grupi Pank AS-ist, Ülle Matt elektroonikafirmast Elcoteq, Silvia Savik Nukuteatrist, Ülle Filin Tele2 Eesti AS-ist, Sirje Tammiste Sirje Tammiste Konsultandibüroost, Getri Järvsoo Fortum Termest AS-ist ja Kärt Kirso AS-ist Kalev Chocolate Factory

  19. Measurement of cos(2beta) in B0 -> D(*)0 h0 decays with a time-dependent Dalitz plot analysis of D0 -> Ks pi+ pi-

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Ford, K E; Hart, A J; Harrison, T J; Hawkes, C M; Morgan, S E; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Y; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Mihályi, A; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H; al, et

    2006-01-01

    We report a preliminary measurement of $\\cos2\\beta$ in $B^0\\to D^{(*)0}h^0$ decays with a time-dependent Dalitz plot analysis of $D^0\\to K_S\\pi^+\\pi^-$, where $h^0$ is a light neutral meson such as $\\pi^0$, $\\eta$, $\\eta'$ or $\\omega$. The strong phase variation on the Dalitz plot allows the access to the angle $\\beta$ with only a two-fold ambiguity ($\\beta+\\pi$). Using $311\\times 10^{6}$ $B\\bar{B}$ pairs collected at the Babar detector, we obtain $\\cos2\\beta = 0.54 \\pm 0.54 \\pm 0.08 \\pm 0.18$, $\\sin2\\beta = 0.45 \\pm 0.36 \\pm 0.05 \\pm 0.07$, and $|\\lambda| = 0.975^{+0.093}_{-0.085} \\pm 0.012 \\pm 0.002 $, where the first errors are statistical, the second are experimental systematic uncertainties, and the third are the signal Dalitz model uncertainties. This measurement favors the solution of $\\beta= 22^\\circ$ over $68^\\circ$ at an 87% confidence level.

  20. Measurement of the CKM angle gamma in B ->D(*)0K decays with a Dalitz analysis of D0->KS pi- pi+

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Ford, K E; Hart, A J; Harrison, T J; Hawkes, C M; Morgan, S E; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Mihályi, A; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H; al, et

    2006-01-01

    We present a measurement of the Cabibbo-Kobayashi-Maskawa CP-violating phase gamma with a Dalitz analysis of neutral D-meson decays to the K^0_s pi^- pi^+ final state from B^+/- -> D^{(*)}K^+/- decays, using a sample of 347 million B\\bar{B} events collected by the BaBar detector. We measure gamma = (92 +/- 41 +/- 11 +/- 12)deg, where the first error is statistical, the second is the experimental systematic uncertainty and the third reflects the Dalitz model uncertainty. For the ratios r_B^{(*)} between the magnitudes of amplitudes A(B- -> D^{(*)0}K-) and A(B- ->\\bar{D}^{(*)0} K-) we obtain the one-standard deviation intervals [0,0.14] and [0.02,0.20], respectively. All results presented here are preliminary.