42 CFR 456.407 - UR responsibilities of administrative staff.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false UR responsibilities of administrative staff. 456... administrative staff. The UR plan must describe— (a) The UR support responsibilities of the ICF's administrative staff; and (b) Procedures used by the staff for taking needed corrective action. UR Plan: Informational...
DEFF Research Database (Denmark)
Christoffersen, Erik Exe
2009-01-01
Om Odin Teatrets dramaturgier og om Barbas dramaturgi-begreb relateret til forestillingen Ur-Hamlet (2006)......Om Odin Teatrets dramaturgier og om Barbas dramaturgi-begreb relateret til forestillingen Ur-Hamlet (2006)...
[Distal ureteral lithiasis. ESWL versus ambulatory URS].
Miján Ortiz, J L; Gutiérrez Tejero, F; López Carmona, F; Nogueras Ocaña, M; Arrabal Martín, M; Zuluaga Gómez, A
2001-11-01
To present the results achieved in the treatment of 1802 distal ureteral stones treated at the Lithotripsy Unit of the San Cecilio University Hospital over the last 10 years (1990-2000). Stones were treated by extracorporeal shock wave lithotripsy (ESWL) or ureteroscopy (URS). ESWL was the initial treatment in 81% of the cases (1460 calculi) and URS in the remaining 19% (342 stones). URS was performed for complication or failed ESWL (102 stones) and ESWL was performed for failed URS, basically due to stone migration (24 stones). Ureterolithotomy was required on 7 occasions. Sedation-analgesia with fentanyl and midazolam was routinely used in URS. Sedation was required in only 55% of the ESWL procedures. Elective ESWL resolved 93% of the cases, a percentage which is similar to that achieved with URS as first treatment. The ESWL retreatment rate was 1.3. URS was successful in 98% of the cases of failed ESWL. There are two treatment modalities for stones in the distal ureter: ESWL and URS. We advocate the use of outpatient URS with sedation preferably in the female patient, impacted stones, obstructive uropathy, stones larger than 2 cm and radiotransparent stones.
Theatrum Mundi: Odin Teatret's Ur-Hamlet
DEFF Research Database (Denmark)
Christoffersen, Erik Exe
2008-01-01
Analyse af Odin Teatrets forestilling Ur-Hamlet opført på Kronborg 2006 med 100 medvirkende fra hele verden.......Analyse af Odin Teatrets forestilling Ur-Hamlet opført på Kronborg 2006 med 100 medvirkende fra hele verden....
Complications associated with ureterorenoscopy (URS) related to treatment of urolithiasis
DEFF Research Database (Denmark)
Somani, B K; Giusti, G; Sun, Y
2017-01-01
INTRODUCTION: Ureterorenoscopy (URS) is a popular and growing option for management of ureteric and renal stones. The CROES URS Global Study was set up to assess the outcomes of URS in a large worldwide cohort of patients involving multiple centres. In this paper, we analysed the database for intra...
2006 URS Corporation Bare Earth Topographic Lidar: Shawsheen River, Massachusetts
National Oceanic and Atmospheric Administration, Department of Commerce — URS Corporation contracted EarthData International to aquire topographic elevation data for 82 square miles in Essex and Middlesex Counties, Massachusetts during...
Duplication urétrale épispade: Diagnostic et prise en charge. à ...
African Journals Online (AJOL)
I. Diabaté
Résumé. La duplication urétrale épispade est une malformation génito-urinaire rare. Elle est caractérisée par la juxtaposition dans le plan sagittal de deux urètres, l'un étant l'urètre principal et l'autre accessoire. Les formes symptomatiques se manifestent par un jet urinaire double et le diagnostic est basé sur l'urétro-.
DEFF Research Database (Denmark)
Ravn, Ole; Andersen, Nils Axel; Andersen, Thomas Timm
While working with the UR-10 robot arm, it has become apparent that some commands have undesired behaviour when operating the robot arm through a socket connection, sending one command at a time. This report is a collection of the results optained when testing the performance of the different...
The underground retrievable storage (URS) high-level waste management concept
International Nuclear Information System (INIS)
Ramspott, L.D.
1991-01-01
This papers presents the concept of long-term underground retrievable storage (URS) of spent reactor fuel in unsaturated rock. Emplacement would be incremental and the system is planned to be experimental and flexible. The rationale for retrievability is examined, and a technical basis for 300-year retrievability is presented. Maximum isolation is the rationale for underground as opposed to surface storage. Although the potential repository site at Yucca Mountain Nevada would be suitable for a URS, alternate sites are discussed. The technical issues involved in licensing a URS for 300 years are simpler than licensing a 10,000 year repository. 16 refs
Fine Mapping of Ur-3, a Historically Important Rust Resistance Locus in Common Bean
Directory of Open Access Journals (Sweden)
Oscar P. Hurtado-Gonzales
2017-02-01
Full Text Available Bean rust, caused by Uromyces appendiculatus, is a devastating disease of common bean (Phaseolus vulgaris in the Americas and Africa. The historically important Ur-3 gene confers resistance to many races of the highly variable bean rust pathogen that overcome other rust resistance genes. Existing molecular markers tagging Ur-3 for use in marker-assisted selection produce false results. Here, we describe the fine mapping of the Ur-3 locus for the development of highly accurate markers linked to Ur-3. An F2 population from the cross Pinto 114 (susceptible × Aurora (resistant with Ur-3 was evaluated for its reaction to four different races of U. appendiculatus. A bulked segregant analysis using the SNP chip BARCBEAN6K_3 placed the approximate location of Ur-3 in the lower arm of chromosome Pv11. Specific SSR and SNP markers and haplotype analysis of 18 sequenced bean varieties positioned Ur-3 in a 46.5 kb genomic region from 46.96 to 47.01 Mb on Pv11. We discovered in this region the SS68 KASP marker that was tightly linked to Ur-3. Validation of SS68 on a panel of 130 diverse common bean cultivars containing all known rust resistance genes revealed that SS68 was highly accurate and produced no false results. The SS68 marker will be of great value in pyramiding Ur-3 with other rust resistance genes. It will also significantly reduce time and labor associated with the current phenotypic detection of Ur-3. This is the first utilization of fine mapping to discover markers linked to rust resistance in common bean.
Fine Mapping of Ur-3, a Historically Important Rust Resistance Locus in Common Bean.
Hurtado-Gonzales, Oscar P; Valentini, Giseli; Gilio, Thiago A S; Martins, Alexandre M; Song, Qijian; Pastor-Corrales, Marcial A
2017-02-09
Bean rust, caused by Uromyces appendiculatus , is a devastating disease of common bean ( Phaseolus vulgaris ) in the Americas and Africa. The historically important Ur-3 gene confers resistance to many races of the highly variable bean rust pathogen that overcome other rust resistance genes. Existing molecular markers tagging Ur-3 for use in marker-assisted selection produce false results. Here, we describe the fine mapping of the Ur-3 locus for the development of highly accurate markers linked to Ur-3 An F 2 population from the cross Pinto 114 (susceptible) × Aurora (resistant with Ur-3 ) was evaluated for its reaction to four different races of U. appendiculatus A bulked segregant analysis using the SNP chip BARCBEAN6K_3 placed the approximate location of Ur-3 in the lower arm of chromosome Pv11. Specific SSR and SNP markers and haplotype analysis of 18 sequenced bean varieties positioned Ur-3 in a 46.5 kb genomic region from 46.96 to 47.01 Mb on Pv11. We discovered in this region the SS68 KASP marker that was tightly linked to Ur-3 Validation of SS68 on a panel of 130 diverse common bean cultivars containing all known rust resistance genes revealed that SS68 was highly accurate and produced no false results. The SS68 marker will be of great value in pyramiding Ur-3 with other rust resistance genes. It will also significantly reduce time and labor associated with the current phenotypic detection of Ur-3 This is the first utilization of fine mapping to discover markers linked to rust resistance in common bean. Copyright © 2017 Hurtado-Gonzales et al.
Simulation of antiproton-nucleus interactions in the framework of the UrQMD model
International Nuclear Information System (INIS)
Galoyan, A.S.; Polanski, A.
2003-01-01
This paper proposes to apply the Ultra-Relativistic Quantum Molecular Dynamics (UrQMD) approach to implement the PANDA project (GSI, Germany). Simulation of p bar A interactions has been performed at antiproton energies from 1 to 200 GeV by using the UrQMD model. We have studied average multiplicities, multiplicity distributions of various types of secondary particles, correlations between the multiplicities, rapidity, and transverse momentum distributions of the particles. The UrQMD model predictions on inelastic p bar A collisions have been found to reproduce qualitatively the experimental data. However, to reach the quantitative agreement, especially, in fragmentation regions, it is needed to modify the UrQMD model
[Urs Fischer: faux amis : documentation d'exposition
2016-01-01
Tiré du site internet des Musées d'art et d'histoire (www.ville-geneve.ch/mah): "Urs Fischer - Faux Amis propose une sélection inédite d'œuvres de la collection Dakis Joannou, présentée pour la première fois au Musée d'art et d'histoire de Genève. Conçue par le commissaire Massimiliano Gioni comme une synthèse inhabituelle entre une présentation monographique et une exposition de groupe, Faux Amis réunit un ensemble d'œuvres signées Urs Fischer (né en 1973), l'un des artistes suisses les plus...
1 r urT log ),( r t lim ),( ) ( , urT urrT r r
African Journals Online (AJOL)
Preferred Customer
dθ where u+(z) = max(u(z), 0). The lower order λ of u is given by λ = lim r. urT log. ),(. A sequence {rn} of positive numbers is said to be a sequence of Pólya peaks for T(r, u) of order λ > 0 if there is a sequence {∈n}, ∈n > 0 such that ∈n → 0.
Analysis of journal usage by Wageningen UR staff members via article references
Veller, van M.G.P.
2013-01-01
The research activities of Wageningen University and Research (or Wageningen UR) are concentrated around food and food production, living environment and health, lifestyle and livelihood. To facilitate the scientific information access of Wageningen UR staff members, the library strives to provide a
URS Altiva – a new oat cultivar with high agronomic performance
Directory of Open Access Journals (Sweden)
Itamar C. Nava
2016-09-01
Full Text Available The oat cultivar URS Altiva, developed from the simple cross ‘UFRGS 995090-2 x URS 21’, and released by the Oat Breeding Program of the Federal University of Rio Grande do Sul (UFRGS in 2015, presents high grain yield, high grain quality, desirable agronomic performance, and partial resistance to crown rust.
[Lithiasis of the distal ureter: ESWL or URS].
González Enguita, C; Sánchez Gómez, J; Rodríguez-Miñon Cifuentes, J L; Cabrera Pérez, J; Calahorra Fernández, F J; García Cardoso, J; García de la Peña, E; Vela Navarrete, R
1998-10-01
A nephritic colic is the clinical picture that evidences the presence of ureteral stones, the natural evolution being their spontaneous passing. Stones in the distal ureter are self-eliminated in about 71-80% cases. The adoption of a "watchful wait" involves an uncertain occupational and medical evolution since, although in some cases the stones will pass with no problems, in other instances they can result in severe, life threatening situations for the patient's health (intractable pain, anuria or sepsis). When a decision is made to treat the condition, there are two choices available: "in situ" SWEL (extracorporeal lithotrity), or URS (ureterorenoscopy), long-standing conflicting techniques each with its own advantages and disadvantages, which should now be considered complementary. SWEL's major disadvantage is the number of repetitions required and the long wait, sometimes even months, until the last fragment is passed. The greater strength of URS is that it can be resolutive in just one episode (95% cases), thus avoiding the obstruction problems that can arise after SWEL. In the Lithiasis-Lithotrity Unit of FJD, SWEL is the first therapeutical option for the treatment of stones in the distal ureter. SWEL and URS are equally likely to be performed although SWEL is the initial choice for efficiency reasons that are explained. We achieve 93.6% positive results with a 1.82% re-SWEL rate (retreatment), 0.60 coefficient of efficiency (EQ) and 0.69 modified coefficient of efficiency (EQM) (Chart). No serious complications were recorded. Morbidity is variable with little clinical significance. Distal ureter lithiasis can be treated with either URS and SWEL, both considered "different and complementary". The choice in each particular case and within each hospital will depend on availability of means to perform one or the other, equipment's efficiency, skill of the urologist, patient's preference and cost of each treatment.
Motornenko, A.; Bravina, L.; Gorenstein, M. I.; Magner, A. G.; Zabrodin, E.
2018-03-01
Properties of equilibrated nucleon system are studied within the ultra-relativistic quantum molecular dynamics (UrQMD) transport model. The UrQMD calculations are done within a finite box with periodic boundary conditions. The system achieves thermal equilibrium due to nucleon-nucleon elastic scattering. For the UrQMD-equilibrium state, nucleon energy spectra, equation of state, particle number fluctuations, and shear viscosity η are calculated. The UrQMD results are compared with both, statistical mechanics and Chapman-Enskog kinetic theory, for a classical system of nucleons with hard-core repulsion.
Bibliometric analyses on repository contents for the evaluation of research at Wageningen UR
Veller, van M.G.P.; Gerritsma, W.; Togt, van der P.L.; Leon, C.D.; Zeist, van C.M.
2010-01-01
Since the last two decennia, Wageningen UR Library has been involved in bibliometric analyses for the evaluation of scientific output of staff, chair groups and research institutes of Wageningen UR. In these advanced bibliometric analyses several indicator scores, such as the number of publications,
Manzoor, Salman; Hashmi, Altaf Hussain; Sohail, Muhammad Ali; Mahar, Feroz; Bhatti, Shahid; Khuhro, Abdul Qayoom
2013-10-01
To compare the stone free rate at one week after extracorporeal shock wave lithotripsy (ESWL) and ureterorenoscopic (URS) manipulation for proximal ureteric stone (10 - 15 mm size). Randomized controlled trial. Sindh Institute of Urology and Transplantation (SIUT), Karachi, from August 2010 to February 2011. One hundred and ninety patients with 10 - 15 mm proximal urteric stone, in each group were treated with ESWL and ureterorenoscopic manipulation by using an 8.0 or 8.5 Fr semi rigid ureteroscope. Intracorporeal lithotripsy was performed by using pneumatic lithoclast. The stone free rate were compared between groups by considering size of stone at one week after procedure. The success rate, retreatment rate, auxiliary procedure and complication rate were compared in each group. Success rate was 49.2% for ESWL and 57.8% for URS (p = 0.008). The re-treatment rate was significantly higher in ESWL group than in URS group (40% vs. 11 and 18% in URS group). Although ESWL is regarded as the preferred choice of treatment for proximal ureteric stone, the present results suggest that ureterorenoscopic manipulation with intracorporeal lithotripsy is a safe alternative, with an advantage of obtaining an earlier or immediate stone-free status. Laparoscopic approaches are reasonable alternatives in cases, where ESWL and URS have failed.
Quantitative measurement of XLR11 and UR-144 in oral fluid by LC-MS-MS.
Amaratunga, Piyadarsha; Thomas, Christopher; Lemberg, Bridget Lorenz; Lemberg, Dave
2014-01-01
Availability and consumption of synthetic cannabinoids have risen recently in the USA and Europe. These drugs have adverse effects, including acute psychosis and bizarre behavior. In 2012, the United States Drug Enforcement Agency permanently banned five of the synthetic cannabinoids and in 2013, temporarily added XLR11, UR-144 and AKB48 to Schedule I of the Controlled Substances Act. As synthetic cannabinoid strains are added to the Schedule I list, new strains are being introduced into the market. XLR11 and UR-144 are two of the most recent additions to the synthetic cannabinoid drug class. To test collected oral fluid samples for XLR11 and UR-144, we developed a bioanalytical method that initially purifies the sample with solid-phase extraction and then quantitatively identifies the drugs with ultra-high-performance liquid chromatography-tandem mass spectrometry. The method was validated according to United States Food and Drug Administration guidelines and Scientific Working Group for Forensic Toxicology guidelines and the validation data showed that the method is an accurate, precise, robust and efficient method suited for high-throughput toxicological screening applications. We tested human subject samples with the developed method and found the presence of parent drugs (XLR11 and UR-144), their metabolites and their pyrolysis products in oral fluid. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
2016-05-11
With the issuance of this final rule, the Drug Enforcement Administration places (1-pentyl-1H-indol-3-yl)(2,2,3,3-tetramethylcyclopropyl)methanone (UR-144), [1-(5-fluoro-pentyl)-1H-indol-3-yl](2,2,3,3-tetramethylcyclopropyl)methanone (5-fluoro-UR-144, XLR11), and N-(1-adamantyl)-1-pentyl-1H-indazole-3-carboxamide (APINACA, AKB48), including their salts, isomers, and salts of isomers whenever the existence of such salts, isomers, and salts of isomers is possible, into schedule I of the Controlled Substances Act. This scheduling action is pursuant to the Controlled Substances Act which requires that such actions be made on the record after opportunity for a hearing through formal rulemaking. This action imposes the regulatory controls and administrative, civil, and criminal sanctions applicable to schedule I controlled substances on persons who handle (manufacture, distribute, reverse distribute, import, export, engage in research, conduct instructional activities or chemical analysis, or possess), or propose to handle UR-144, XLR11, or AKB48.
42 CFR 456.523 - Revised UR plan.
2010-10-01
... control over the utilization of services; and (2) Conducts reviews in a way that improves the quality of...) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Review Plans: FFP, Waivers, and Variances for Hospitals and Mental Hospitals Ur Plan: Remote Facility Variances from Time Requirements § 456.523 Revised...
International Nuclear Information System (INIS)
Manzoor, S.; Khuhro, A.Q.; Hashmi, A.H.; Sohail, M.A.; Mahar, F.; Bhatti, S.
2013-01-01
Objective: To compare the stone free rate at one week after extracorporeal shock wave lithotripsy (ESWL) and ureterorenoscopic (URS) manipulation for proximal ureteric stone (10 - 15 mm size). Study Design: Randomized controlled trial. Place and Duration of Study: Sindh Institute of Urology and Transplantation (SIUT), Karachi, from August 2010 to February 2011. Methodology: One hundred and ninety patients with 10 - 15 mm proximal urteric stone, in each group were treated with ESWL and ureterorenoscopic manipulation by using an 8.0 or 8.5 Fr semi rigid ureteroscope. Intracorporeal lithotripsy was performed by using pneumatic lithoclast. The stone free rate were compared between groups by considering size of stone at one week after procedure. The success rate, retreatment rate, auxiliary procedure and complication rate were compared in each group. Results: Success rate was 49.2% for ESWL and 57.8% for URS (p = 0.008). The re-treatment rate was significantly higher in ESWL group than in URS group (40% vs. 11 and 18% in URS group). Conclusion: Although ESWL is regarded as the preferred choice of treatment for proximal ureteric stone, the present results suggest that ureterorenoscopic manipulation with intracorporeal lithotripsy is a safe alternative, with an advantage of obtaining an earlier or immediate stone-free status. Laparoscopic approaches are reasonable alternatives in cases, where ESWL and URS have failed. (author)
URS Brava – a new oat cultivar with partial resistance to crown rust
Directory of Open Access Journals (Sweden)
Luiz Carlos Federizzi
2015-08-01
Full Text Available The cultivar URS Brava, obtained from a simple cross between the line ‘UFRGS 995078-2’ and the cultivar ‘URS 21’, shows high grain yield and stability, high grain quality, desirable agronomical traits and partial resistance to crown rust, caused by the fungus Puccinia coronata f. sp. avenae.
2015-05-15
The Administrator of the Drug Enforcement Administration (DEA) is issuing this final order to extend the temporary placement of (1-pentyl-1H-indol-3-yl)(2,2,3,3-tetramethylcyclopropyl)methanone (UR-144), [1-(5-fluoro-pentyl)-1H-indol-3-yl](2,2,3,3-tetramethylcyclopropyl)methanone (5-fluoro-UR-144, XLR11) and N-(1-adamantyl)-1-pentyl-1H-indazole-3-carboxamide (APINACA, AKB48), including their salts, isomers, and salts of isomers whenever the existence of such salts, isomers, and salts of isomers is possible, in schedule I of the Controlled Substances Act. The current final order temporarily placing UR-144, XLR11, and AKB48 in schedule I is due to expire on May 15, 2015. This final order will extend the temporary scheduling of UR-144, XLR11, and AKB48 to May 15, 2016, or until the permanent scheduling action for these three substances is completed, whichever occurs first.
UrQt: an efficient software for the Unsupervised Quality trimming of NGS data.
Modolo, Laurent; Lerat, Emmanuelle
2015-04-29
Quality control is a necessary step of any Next Generation Sequencing analysis. Although customary, this step still requires manual interventions to empirically choose tuning parameters according to various quality statistics. Moreover, current quality control procedures that provide a "good quality" data set, are not optimal and discard many informative nucleotides. To address these drawbacks, we present a new quality control method, implemented in UrQt software, for Unsupervised Quality trimming of Next Generation Sequencing reads. Our trimming procedure relies on a well-defined probabilistic framework to detect the best segmentation between two segments of unreliable nucleotides, framing a segment of informative nucleotides. Our software only requires one user-friendly parameter to define the minimal quality threshold (phred score) to consider a nucleotide to be informative, which is independent of both the experiment and the quality of the data. This procedure is implemented in C++ in an efficient and parallelized software with a low memory footprint. We tested the performances of UrQt compared to the best-known trimming programs, on seven RNA and DNA sequencing experiments and demonstrated its optimality in the resulting tradeoff between the number of trimmed nucleotides and the quality objective. By finding the best segmentation to delimit a segment of good quality nucleotides, UrQt greatly increases the number of reads and of nucleotides that can be retained for a given quality objective. UrQt source files, binary executables for different operating systems and documentation are freely available (under the GPLv3) at the following address: https://lbbe.univ-lyon1.fr/-UrQt-.html .
Progress Report Open Course Programme Wageningen UR, 2012
Hijweege, W.L.
2013-01-01
Annually, the Wageningen UR open course programme for mid-career professionals provides some six hundred individuals with the opportunity to update their competencies and insights. The Ministry of Economic Affairs co-finances this course programme with the aim to maintain the courses’ close linkages
MUSIC with the UrQMD Afterburner
International Nuclear Information System (INIS)
Ryu, Sangwook; Jeon, Sangyong; Gale, Charles; Schenke, Björn; Young, Clint
2013-01-01
As RHIC is entering the precision measurement era and the LHC is producing a copious amount of new data, the role of 3+1D event-by-event viscous hydrodynamics is more important than ever to understand the bulk data as well as providing the background for hard probes. For more meaningful comparison with the experimental data, it is also important that hydrodynamics be coupled to the hadronic afterburner. In this proceeding we report on preliminary results of coupling MUSIC with UrQMD
MUSIC with the UrQMD Afterburner
Energy Technology Data Exchange (ETDEWEB)
Ryu, Sangwook; Jeon, Sangyong; Gale, Charles [McGill University, Montreal, QC (Canada); Schenke, Björn [Brookhaven National Laboratory, Upton, NY (United States); Young, Clint [McGill University, Montreal, QC (Canada); University of Minnesota, Minneaplis, MN (United States)
2013-05-02
As RHIC is entering the precision measurement era and the LHC is producing a copious amount of new data, the role of 3+1D event-by-event viscous hydrodynamics is more important than ever to understand the bulk data as well as providing the background for hard probes. For more meaningful comparison with the experimental data, it is also important that hydrodynamics be coupled to the hadronic afterburner. In this proceeding we report on preliminary results of coupling MUSIC with UrQMD.
Directory of Open Access Journals (Sweden)
Silva Rosângela Maria Nunes da
2001-01-01
Full Text Available Esta pesquisa foi desenvolvida, utilizando 15 vacas lactantes (Holandês x Gir alimentadas à vontade com rações isoprotéicas constituídas de 60% de silagem e 40% de concentrado na matéria seca (MS e 0; 0,7; 1,4; e 2,1% de uréia, correspondentes aos teores de 2,08; 4,01; 5,76; e 8,07% de proteína bruta na forma de compostos nitrogenados não-protéicos (NNP, com os objetivos de desenvolver metodologia não-invasiva, para estimar a produção de proteína microbiana, utilizando-se a excreção total de derivados de purinas (DP; avaliar as concentrações de creatinina, uréia e N-uréia no plasma e no leite; e comparar as excreções de DP e uréia obtidas a partir de coletas de urina total e spot. Os animais tinham peso vivo médio inicial de 511,8 kg e foram distribuídos ao acaso entre tratamentos. O período experimental teve duração de 90 dias para cada vaca, iniciando-se imediatamente após o parto. Os resultados obtidos foram avaliados estatisticamente por análises de variância e de regressão. As amostras de urina foram obtidas a partir de coletas com 24 horas de duração ou a partir de amostra de urina obtida aproximadamente 4 horas após a alimentação (urina spot, enquanto as de sangue foram obtidas 4 horas após o fornecimento do alimento. As concentrações de uréia e N-uréia no plasma e leite, assim como a excreção de creatinina, que apresentou valor médio de 23,60 mg/kg PV, não foram afetadas pela adição de quantidades crescentes de NNP à ração. As excreções urinárias de uréia, alantoína, ácido úrico e DP, as purinas absorvidas e a produção de N microbiano não foram influenciadas pela dieta. As excreções diárias estimadas de uréia, alantoína e ácido úrico seguiram o mesmo padrão obtido pela coleta de 24 horas de duração. Amostra spot de urina foi capaz de estimar satisfatoriamente a excreção de DP e, subseqüentemente, a produção de N microbiano.
Sharing your urban residential WiFi (UR-WiFi)
Kawade, Santosh; van Bloem, J.W.H.; Abhayawardhana, V.S.; Wisely, D.
2006-01-01
Cheap and ubiquitous broadband wireless access is what most of the operators are aiming for. This paper analyses an innovative proposal to extend the traditional fixed coverage offered by residential broadband into an urban wireless coverage using urban residential wireless fidelity (UR-WiFi)
Cytochrome P450-mediated metabolism of the synthetic cannabinoids UR-144 and XLR-11
DEFF Research Database (Denmark)
Nielsen, Line Marie; Holm, Niels Bjerre; Olsen, Lars
2016-01-01
In recent years, synthetic cannabinoids have emerged in the illicit drug market, in particular via the Internet, leading to abuse of these drugs. There is currently limited knowledge about the specific enzymes involved in the metabolism of these drugs. In this study, we investigated the cytochrome...... of UR-144 and XLR-11, while inhibition of the other CYP enzymes in HLM had only minor effects. Thus, CYP3A4 is the major contributor to the CYP mediated metabolism of UR-144 and XLR-11 with minor contributions from CYP1A2. Users of UR-144 and XLR-11 are thus subject to the influence of potential drug-drug...... interactions, if they are concomitantly medicated with CYP3A4 inducers (e.g. some antiepileptics) or inhibitors (e.g. some antifungal drugs). Copyright © 2015 John Wiley & Sons, Ltd....
Bagley, Mark C; Davis, Terence; Rokicki, Michal J; Widdowson, Caroline S; Kipling, David
2010-02-01
UR-13756 is a potent and selective p38 mitogen-activated protein kinase (MAPK) inhibitor, reported to have good bioavailability and pharmacokinetic properties and, thus, is of potential use in the treatment of accelerated aging in Werner syndrome. Irradiation of 2-chloroacrylonitrile and methylhydrazine in ethanol at 100 °C gives 1-methyl-3-aminopyrazole, which reacts with 4-fluorobenzaldehyde and a ketone, obtained by Claisen condensation of 4-picoline, in a Hantzsch-type 3-component hereocyclocondensation, to give the pyrazolopyridine UR-13756. UR-13756 shows p38 MAPK inhibitory activity in human telomerase reverse transcriptase-immortalized HCA2 dermal fibroblasts, with an IC(50) of 80 nm, as shown by ELISA, is 100% efficacious for up to 24 h at 1.0 μm and displays excellent kinase selectivity over the related stress-activated c-Jun kinases. In addition, UR-13756 is an effective p38 inhibitor at 1.0 μm in Werner syndrome cells, as shown by immunoblot. The convergent synthesis of UR-13756 is realized using microwave dielectric heating and provides a highly selective inhibitor that shows excellent selectivity for p38 MAPK over c-Jun N-terminal kinase.
Karla Alves Magalhães; Sebastião de Campos Valadares Filho; Rilene Ferreira Diniz Valadares; Mônica Lopes Paixão; Douglas dos Santos Pina; Pedro Veiga Rodrigues Paulino; Mário Luiz Chizzotti; Marcos Inácio Marcondes; Alexandre Magno Araújo; Marlos Oliveira Porto
2005-01-01
Com o objetivo de avaliar os efeitos dos níveis de uréia ou casca de algodão sobre a produção de proteína microbiana, estimada por meio dos derivados de purinas na urina, a concentração de uréia plasmática (NUP) e as excreções de uréia em novilhos, foram realizados dois experimentos. No primeiro, 24 novilhos mestiços castrados, com peso vivo médio inicial de 300 kg, foram alocados em delineamento inteiramente casualizado, nos quatro tratamentos: 0; 0,65; 1,30 e 1,95% de uréia na base da MS to...
Urètrocèle post-traumatique chez l'homme: A propos de 2 cas
African Journals Online (AJOL)
Y. Sow
d'épithélium et de couche musculaire lisse [2]. Il peut être secon- daire à une effraction de la paroi urétrale par un traumatisme pelvien ou périnéal [1] (c'est le cas de nos observations) ou à un traumatisme iatrogène: sondage vésical prolongé surtout chez les paraplégiques ou traumatique, urètrotomie endoscopique [3].
Arendt and Ricœur on Ideology and Authority.
Directory of Open Access Journals (Sweden)
Carlos Alfonso Garduño Comparán
2014-12-01
Full Text Available AbstractHannah Arendt’s work is an important reference for Paul Ricœur. Her definition of power as the free action in concert of individuals within a community of equals, guaranteed by institutions, allows Ricœur to ground his reflection on the political dimension of recognition and justice. However, as I will show in this paper, such a definition is problematic, particularly because of the relation that Arendt establishes between power and authority, her decision to separate the social and the political, and her understanding of ideology, philosophy, and common sense in politics.After describing Arendt’s account of the relation between power and authority, I argue that, without rejecting the spirit of her political thought or her basic concepts, Ricœur’s reflections on the functions of ideology in his Lectures on Ideology and Utopia offer a broader but complementary vision that allows us to understand the issues that remain obscure in Arendt’s approach.Keywords: Arendt, Ideology, Authority, Power, Social.RésuméL’œuvre de Hannah Arendt constitue une référence importante pour Paul Ricœur. La définition arendtienne du pouvoir comme agir ensemble des individus au sein d’une communauté d’égaux garantie par des institutions, fournit en effet à Ricœur les bases de sa réflexion sur la dimension politique de la reconnaissance et de la justice. Cependant, cet article s’efforce de montrer qu’une telle définition est problématique, non seulement en raison de la relation qu’Arendt établit entre le pouvoir et l’autorité, mais aussi en ce qui concerne sa distinction du social et du politique, sa compréhension de l’idéologie, ainsi que sa conception de la philosophie et du sens commun dans le domaine politique.Après une analyse des thèses d’Arendt sur la relation entre le pouvoir et l’autorité, cet article soutient que, sans rejeter l’esprit de la pensée politique arendtienne et ses concepts de base, la
Handlen og væren. Paul Ricœurs polytetiske refleksionsteori
DEFF Research Database (Denmark)
Pallesen, Carsten
erläutert, wie sich die Hermeneutik des Selbst als eine hegelsche Verschiebung der herkömmlichen Subjektsphilosophie verstehen lässt, die jedoch Hegels Begriff des absoluten Wissens durch den Begriff der Bezeugung (attestation) ersetzt. Dieser Begriff wird profiliert in einer textnahen Lektüre von Ricœurs...... Auseinandersetzung mit Husserl, Heidegger und Lévinas, in der Körper, Gewissen und der Andere als konstituierende Passivitätserfahrungen ausgelegt werden, die als solche das Verständnis des Anderssein als ontologischen Begriff für das Selbst begründen. Der fünfte Hauptteil beleuchtet die Attestationshermeneutik...... in zwei unterschiedlichen vorphilosophischen Bereichen: Psychoanalyse und Theologie. Hier wird Ricœurs Theorie der Erinnerung und sein Begriff des Gewissens in gerechtigkeitstheoretischer Perspektive erörtert, die eine gewisse Distanz zu realphilosophischen Bereichen wie z.B. Psychoanalyse und Theologie...
Mohr, Amanda L A; Ofsa, Bill; Keil, Alyssa Marie; Simon, John R; McMullin, Matthew; Logan, Barry K
2014-09-01
Ongoing changes in the synthetic cannabinoid drug market create the need for relevant targeted immunoassays for rapid screening of biological samples. We describe the validation and performance characteristics of an enzyme-linked immunosorbent assay designed to detect use of one of the most prevalent synthetic cannabinoids in urine, UR-144, by targeting its pentanoic acid metabolite. Fluorinated UR-144 (XLR-11) has been demonstrated to metabolize to this common product. The assay has significant cross-reactivity with UR-144-5-OH, UR-144-4-OH and XLR-11-4-OH metabolites, but assay's cutoff is 5 ng/mL relative to the pentanoic acid metabolite of UR-144, which is used as the calibrator. The method was validated with 90 positive and negative control urine samples for UR-144, XLR-11 and its metabolites tested versus liquid chromatography-tandem mass spectrometry. The accuracy, sensitivity and specificity were determined to be 100% for the assay at the specified cutoff. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Paul Ricœur: Variations et continuité d'un projet politique
Directory of Open Access Journals (Sweden)
Pierre-Olivier Monteil
2013-01-01
Full Text Available Les commentateurs s’accordent pour constater une évolution dans la pensée politique de Ricœur conduisant d’un radicalisme à un réformisme. Par-delà ces variations, on se propose plutôt de mettre en évidence la continuité d’un projet. Non seulement la critique du capitalisme se poursuit jusqu’au bout, mais la perspective du socialisme semble très tôt tenue pour improbable. Dans les deux cas, la préoccupation centrale porte sur la nécessité de raviver les traditions et de faire émerger l’élan initial sous la doctrine “ossifiée ” en les situant en tension critique entre elles pour qu’elles se corrigent mutuellement. Le projet politique de Ricœur consiste à établir en vis-à-vis libéralisme et socialisme.
Urämische Kardiomyopathie und der Einfluss der Hämodialyse
Valina, Ulrike Katrin
2011-01-01
ZIEL: Analyse von Risikofaktoren und Entstehungsmechanismen der urämischen Kardiomyopathie bei Hämodialysepatienten und Vergleich von Diagnostiken zur frühen Detektion kardialer Funktionstörungen zur Optimierung der Therapie bei terminaler Niereninsuffizienz und Senkung der hohen Mortalitätsrate. METHODEN: Einschluss von 32 Hämodialysepatienten. Messungen mittels Blutentnahme (Entzündungs-, Atherosklerose-, Anämieparameter, EPO, PTH und RAAS) und MRT (Herzfunktion, Herzmorphologie und Her...
El Trabajo y la producción textil en la Tercera Dinastía de Ur
García Ventura, Agnès
2012-01-01
La presente tesis propone una interpretación de la organización de la producción textil en la Tercera Dinastía de Ur (ca. 2100-2000 a.n.e.) en Mesopotamia. Se centra en las relaciones de género, la división sexual del trabajo, la jerarquización y el estatus para explicar las categorías laborales y los grupos de trabajo especializados. La evidencia utilizada procede esencialmente de textos sumerios de Ur III publicados entre 1972 y 2010. De entre ellos se han seleccionado 100 textos relacionad...
Mi, Yuanyuan; Ren, Kewei; Pan, Haiyan; Zhu, Lijie; Wu, Sheng; You, Xiaoming; Shao, Hongbao; Dai, Feng; Peng, Tao; Qin, Feng; Wang, Jian; Huang, Yi
2016-08-01
The objective of the study was to systematically review the efficacy and safety of flexible ureterorenoscopy (F-URS) with holmium laser versus extracorporeal shock wave lithotripsy (ESWL) for the treatment of renal stone ESWL (WMD = 2.13, 95 % CI 1.13-4.00, P = 0.02). F-URS is associated with higher SFR, lower APR and RR than ESWL. F-URS is a safe and effective procedure. It can successfully treat patients with stones for 1-2 cm, especially for lower pole stone, without increasing complications, operative time and hospital stay. F-URS can be used as an alternative treatment to ESWL in selected cases with larger renal stones. However, further randomized trials are needed to confirm these findings.
TaylUR 3, a multivariate arbitrary-order automatic differentiation package for Fortran 95
International Nuclear Information System (INIS)
Hippel, G.M. von
2009-09-01
The new version of TaylUR is based on a completely new core, which now is able to compute the numerical values of all of a complex-valued function's partial derivatives up to an arbitrary order, including mixed partial derivatives. (orig.)
Lin, Yi-Wen; Hsieh, Ching-Liang
2011-05-17
Epilepsy is a common clinical syndrome with recurrent neuronal discharges in cerebral cortex and hippocampus. Here we aim to determine the protective role of Uncaria rhynchophylla (UR), an herbal drug belong to Traditional Chinese Medicine (TCM), on epileptic rats. To address this issue, we tested the effect of UR on kainic acid (KA)-induced epileptic seizures and further investigate the underlying mechanisms. Oral UR successfully decreased neuronal death and discharges in hippocampal CA1 pyramidal neurons. The population spikes (PSs) were decreased from 4.1 ± 0.4 mV to 2.1 ± 0.3 mV in KA-induced epileptic seizures and UR-treated groups, respectively. Oral UR protected animals from neuronal death induced by KA treatment (from 34 ± 4.6 to 191.7 ± 48.6 neurons/field) through attenuating glial cell proliferation and S100B protein expression but not GABAA and TRPV1 receptors. The above results provide detail mechanisms underlying the neuroprotective action of UR on KA-induced epileptic seizure in hippocampal CA1 neurons. Crown Copyright © 2011. Published by Elsevier Ireland Ltd. All rights reserved.
Krambeck, Amy; Wijnstok, Nienke; Olbert, Peter; Mitroi, George; Bariol, Simon; Shah, Hemendra N; El-Abd, Ahmed S; Onal, Bulent; de la Rosette, Jean
2017-01-01
Although ureteroscopy (URS) has been established as a viable treatment for stones in obese patients, its safety and success has not been fully elucidated. The current study describes the worldwide prevalence of obesity in patients with urolithiasis and examines trends in URS outcomes, safety, and efficacy. This study utilized the Clinical Research Office of the Endourological Society (CROES) URS Global Study, which was a prospective, multicenter study including 11,885 patients treated with URS for urinary stones at 1 of 114 urology departments across 32 countries. The relationship between body mass index (BMI), diabetes, and creatinine, with retreatment, stone-free rates, complications, and long hospital stay, was examined with a multivariate logistic regression analyses. Of the 10,099 URS patients with BMI data, 17.4% were obese and 2.2% were super obese. Overall, 86.7% patients were stone free and 16.8% required retreatment. Higher BMI was associated with lower stone-free rates, and any deviation from normal weight was associated with higher retreatment rates. In multivariate analysis controlling for several variables including stone size, the association between BMI and lower stone-free rates with higher retreatment rates persisted. Intraoperative complications occurred in 518 (5.1%) patients, and 343 (3.4%) experienced a postoperative complication. Postoperative complications were more frequent in the underweight and super obese subjects, and there was no relationship between BMI and intraoperative complications. Although URS for stone disease was found to be an overall safe procedure for obese and super obese patients, efficacy of the procedure may be lower compared with normal-weight subjects and higher retreatment rates may be necessary.
Características seminais de ovinos suplementados ou não com uréia e diferentes fontes de enxofre
Directory of Open Access Journals (Sweden)
Thais Rose dos Santos Hamilton
2009-02-01
Full Text Available Doze carneiros machos adultos mestiços Santa Inês de mesma idade e porte semelhante foram empregados em um delineamento inteiramente casualizado, por um período experimental de 60 dias. Os animais foram distribuídos para três tratamentos: A. 100% das exigências em proteína degradável no rúmen (controle; B. 100% das exigências em proteína degradável no rúmen + 3% de uréia + enxofre (99% S e C. 100% das exigências em proteína degradável no rúmen + 3% de uréia + enxofre quelatado (21,5% S. Semanalmente foram colhidas amostras de sêmen obtidas com emprego de vagina artificial e de sangue para determinação da concentração de nitrogênio uréico plasmático, assim como realizadas pesagens dos animais e aferições de circunferência escrotal. No sêmen foram analisados: volume e turbilhonamento; vigor, motilidade e concentração espermática; total de espermatozóides e total de espermatozóides viáveis no ejaculado; integridade de membrana e de acrossoma; morfologia espermática e concentração de nitrogênio uréico no plasma seminal. Os animais suplementados com uréia apresentaram níveis de N-uréico no plasma sanguíneo e seminal significativamente maiores que os encontrados nos do tratamentos controle (p<0,05. Houve diferença significativa entre as fontes de enxofre utilizadas (p<0,05 quanto às características do sêmen estudadas, o tratamento C apresentando valores maiores para turbilhonamento (4,57, motilidade espermática (85,69%, vigor espermático (4,66 e total de espermatozóides por ejaculado (9,02 x 10(9, além de uma porcentagem inferior de defeitos menores (5,37% quando comparado ao tratamento B.
Implementing portal functionality at Wageningen UR Library : combining the old with the new
Loman, M.E.; Gerritsma, W.
2003-01-01
Library Wageningen UR is a relatively small, but highly specialized academic library serving a population of about 5900 researchers and 4700 students in the life sciences. To better serve the needs of our users portal functionality has been introduced gradually to our Desktop Library. A beginning
Directory of Open Access Journals (Sweden)
Ćurčić Srećko B.
2005-01-01
Full Text Available A new species of cavernicolous and endemic trechine ground beetles Rascioduvalis zlatiborensis n. sp., is described and diagnosed in the present paper. Also, all important taxonomic features are considered and illustrated. The type specimens of the new species were collected from the Markova (= Ršumska Pećina Cave, village of Gornji Ljubiš, Mt. Zlatibor, Western Serbia. The new species and its congeners belong to a separate phyletic lineage of Tertiary age. All members of Rascioduvalius S. B. Ćurčić, Brajković, Mitić & B. P. M. Ćurčić are distributed in Western Serbia only, where they have gone through intense differentiation and radiation due to evolution of the karstic relief.
Study of radiation heating (part 1). UR spectroscopic characteristics of radiant heat source
Energy Technology Data Exchange (ETDEWEB)
Nagaoka, Yoshikazu; Ajisaka, Kazuhiro; Toyonaga, Hajime; Kitahata, Hiroki; Oshida, Shun' ichi; Sugihara, Tomonori
1987-09-01
There are many IR permeable substances. When this is heated with IR beam, UR beam penetrated into the substance and heat up the substance from the inside. In this case, the inside gets hot quicker than the surface which gives much difference in the finish of the product. Characteristics of permeation and absorption of the IR beam vary by the type of the substance and the wave-length of the UR beam. Examples of effectiveness of far infra-red heater are: Baking of rice cake. Baking of PVC granules as a slip-stop for a working gloves. Far infra-red sauna (sweating effect around 50/sup 0/C). Tokyo Gas Co., Ltd. and other companies introduced an IR spectroscopic radiometer of Minarad Systems of USA to establish a data exchange system in 1984. The spectroscopic radio-meter system consists of 3 components, i.e., a spectrophotometric radiometer, a black body furnace, and a computer for data processing. (14 figs, 5 tabs)
Pokras, V. M.; Yevdokimov, V. P.; Maslov, V. D.
1978-01-01
The structure and potential of the information reference system OZhUR designed for the automated data processing systems of scientific space vehicles (SV) is considered. The system OZhUR ensures control of the extraction phase of processing with respect to a concrete SV and the exchange of data between phases.The practical application of the system OZhUR is exemplified in the construction of a data processing system for satellites of the Cosmos series. As a result of automating the operations of exchange and control, the volume of manual preparation of data is significantly reduced, and there is no longer any need for individual logs which fix the status of data processing. The system Ozhur is included in the automated data processing system Nauka which is realized in language PL-1 in a binary one-address system one-state (BOS OS) electronic computer.
Palacios-Pérez, Miryam; Andrade-Díaz, Fernando; José, Marco V.
2017-11-01
Herein we outline a plausible proteome, encoded by assuming a primeval RNY genetic code. We unveil the primeval phenotype by using only the RNA genotype; it means that we recovered the most ancestral proteome, mostly made of the 8 amino acids encoded by RNY triplets. By looking at those fragments, it is noticeable that they are positioned, not at catalytic sites, but in the cofactor binding sites. It implies that the stabilization of a molecule appeared long before its catalytic activity, and therefore the Ur-proteome comprised a set of proteins modules that corresponded to Cofactor Stabilizing Binding Sites (CSBSs), which we call the primitive bindome. With our method, we reconstructed the structures of the "first protein modules" that Sobolevsky and Trifonov (2006) found by using only RMSD. We also examine the probable cofactors that bound to them. We discuss the notion of CSBSs as the first proteins modules in progenotes in the context of several proposals about the primitive forms of life.
Directory of Open Access Journals (Sweden)
Carlos de Sousa Lucci
2006-08-01
Full Text Available Doze ovinos com cânulas de rúmen foram empregados para comparar seis tratamentos, dispostos em um arranjo fatorial 2 x 3: cana de açúcar nas formas fresca (CAF ou ensilada (CAS x teores de uréia iguais a 0,0%, 0,5% e 1,0%. Foram estimadas: taxas de degradabilidade efetiva (DGE dos alimentos volumosos, concentrações de ácidos graxos voláteis(AGV e de nitrogênio amoniacal (N-NH3 e valores de pH do conteúdo do rúmen, além de concentrações de N-uréico no sangue. As taxas de DGE da matéria seca (MS mostraram-se semelhantes para CAF e CAS. A adição de teores crescentes de uréia às forragens resultou em diminuição linear da DGE da MS tanto da CAF como da CAS. No caso da CAS, a DGE da fibra em detergente neutro diminuiu linearmente com concentrações crescentes de uréia. Os valores de pH do conteúdo ruminal foram maiores para CAS em relação a CAF, mas não ocorreram diferenças devidas à adição de uréia. Os teores do conteúdo ruminal em total de AGV e os de ácido propiônico foram maiores para a CAF em relação a CAS; os de ácido acético, ao contrário, foram maiores para a CAS. Os teores de N-NH3 do conteúdo ruminal foram maiores para a CAS que para a CAF. Nos tratamentos com CAF e nos com CAS, as concentrações de N-NH3 no conteúdo ruminal e de N-uréico no sangue aumentaram linearmente com maiores adições de uréia. Concluiu-se que a adição de 0,5% e 1,0% uréia às forragens frescas ou ensiladas de cana-de-açucar não mostrou resultados satisfatórios e que CAF apresentou indícios de melhor qualidade nutricional que CAS.
Michel Foucault et Paul Ricœur, vers un dialogue possible
Directory of Open Access Journals (Sweden)
Simon Castonguay
2011-01-01
Full Text Available Il est désormais connu que Michel Foucault s’est intéressé à la fin de sa vie à l’ ”herméneutique du sujet.” Mais cette histoire de la constitution du sujet (ou de la subjectivité fait étrangement l’économie d’une réflexion sur le rôle de la compréhension, alors que Foucault qualifie son travail d’ ”ontologie historique de nous-mêmes.” C'est sur ce point précis qu’est ici mis à l'épreuve le caractère médiateur de l’œuvre de Paul Ricœur, dont l’herméneutique du soi prend en charge une ontologie de la compréhension. Suite à ces considérations, la seconde partie de l’article cherche à démontrer que la théorie de l’agir de Ricœur peut favoriser le passage d’une reconnaissance de type objectale à une reconnaissance des capacités du sujet à se tenir pour responsable. Ce passage sera opéré directement sur le modèle d’analyse du “dernier Foucault,” c’est-à-dire son concept-clé de “processus de subjectivation.”In his later work, Michel Foucault manifested a strong interest for the “hermeneutics of the subject.” Yet this history of the constitution of the subject (or subjectivity does without any reflection on the role of understanding, even though Foucault characterizes his project as a historical ontology of ourselves. The power of mediation emphasized in the work of Paul Ricœur may help us redefine an ontology of understanding through a hermeneutics of the self. Following this, the second part of the article aims to show that Ricœur’s theory of action can facilitate a transition from the recognition of the self, first described as “objectivation,” to a recognition of the subject’s capacity to be held responsible. This passage will draw on the model of analysis in the later Foucault, specifically, on his key concept of the subjectivation process.
Directory of Open Access Journals (Sweden)
Karla Alves Magalhães
2005-08-01
Full Text Available Com o objetivo de avaliar os efeitos dos níveis de uréia ou casca de algodão sobre a produção de proteína microbiana, estimada por meio dos derivados de purinas na urina, a concentração de uréia plasmática (NUP e as excreções de uréia em novilhos, foram realizados dois experimentos. No primeiro, 24 novilhos mestiços castrados, com peso vivo médio inicial de 300 kg, foram alocados em delineamento inteiramente casualizado, nos quatro tratamentos: 0; 0,65; 1,30 e 1,95% de uréia na base da MS total, em substituição à proteína do farelo de soja. No segundo, 16 novilhos mestiços, com peso vivo médio inicial de 230 kg, foram distribuídos em delineamento inteiramente casualizado, nos quatro tratamentos: 0, 10, 20 e 30% de casca de algodão na base da MS total, em substituição à silagem de capim-elefante. As amostras de urina foram obtidas por meio da coleta de urina spot, na qual foram determinados os derivados de purinas (alantoína e ácido úrico. No soro sanguíneo e na urina, foram analisadas as concentrações de uréia e creatinina. Não houve efeito dos níveis de uréia, tampouco dos de casca de algodão, sobre os derivados de purinas e sobre a eficiência de síntese microbiana. A concentração de NUP e a excreção de uréia não foram influenciadas pelos níveis de uréia das rações. A concentração de NUP decresceu linearmente com a inclusão da casca de algodão na dieta. Tanto a uréia quanto a casca de algodão podem ser utilizadas, até os níveis de 1,95% e 30%, respectivamente, na MS total da dieta de novilhos de origem leiteira, sem afetar a eficiência de síntese microbiana.Two trials were conducted to study the effects of different levels of urea or cottonseed hulls on yield of microbial protein, estimated by the urinary excretion of purine derivatives, concentration of plasma urea, and excretion of urea in steers. In the first trial, 24 crossbred castrated steers averaging 300 kg of initial live
Teores de lignina e ácidos urônicos na madeira e polpa celulósica de Eucalipto
Zanuncio,Antônio José Vinha; Colodette,Jorge Luiz
2011-01-01
O teor de lignina influencia a alvura da polpa celulósica e, por isto, é uma variável importante no processo de sua fabricação, o que torna fundamental estabelecer métodos para determinar seu valor. Baseado na hipótese de que os métodos disponíveis para avaliar o teor de lignina solúvel medem, também, os ácidos urônicos na madeira, isto tornaria este método impreciso. O objetivo desse trabalho foi verificar se existe correlação entre a lignina e ácidos urônicos na madeira de eucalipto e na po...
The theoretical aspects of UrQMD & AMPT models
Energy Technology Data Exchange (ETDEWEB)
Saini, Abhilasha, E-mail: kashvini.abhi@gmail.com [Research Scholar, Department of Physics, Suresh Gyan vihar University, Jaipur (India); Bhardwaj, Sudhir, E-mail: sudhir.hep@gmail.com [Assistant professor, Govt. College of Engineering & Technology, Bikaner (India)
2016-05-06
The field of high energy physics is very challenging in carrying out theories and experiments to unlock the secrets of heavy ion collisions and still not cracked and solved completely. There are many theoretical queries; some may be due to the inherent causes like the non-perturbative nature of QCD in the strong coupling limit, also due to the multi-particle production and evolution during the heavy ion collisions which increase the complexity of the phenomena. So for the purpose of understanding the phenomena, variety of theories and ideas are developed which are usually implied in the form of Monte-Carlo codes. The UrQMD model and the AMPT model are discussed here in detail. These methods are useful in modeling the nuclear collisions.
[Rethinking ethics with Paul Ricœur. Nursing: between responsibility, care and justice].
Svandra, Philippe
2016-03-01
In this article, the purpose is less praising Paul Ricoeur's work than enlightening how the reader may actually find some practical, even operative help in this philosophical thought. This is particularly true regarding the fields of medicine and care. Paul Ricœur is now worldwide renowned as a major philosophical figure of the 20th century, and with books such as "Oneself as another", he occupies a very peculiar place at the crossroads of phenomenology and hermeneutics. Through both these philosophical traditions, Paul Ricœur offers some narrative ethics which may greatly sustain caregivers in their reflexion. Yet, the aim of this article is to focus on this philosopher who invites us to inhabit and play a role in this world. The goal is also to bring out the pragmatic ethics that this thinker developed, based on Aristotelian and Kantian traditions. Then, this piece seeks to demonstrate how the three stages of Ricoeur's "petite éthique" (his "small ethics"), which are the self's aim "for the good life with and for others in just institutions" can shed some light on the ethical consideration of politicals and caregivers.
Ozvenchuk, V.; Rybicki, A.
2018-05-01
The UrQMD transport model, version 3.4, is used to study the new experimental data on transverse momentum spectra of π±, K±, p and p bar produced in inelastic p + p interactions at SPS energies, recently published by the NA61/SHINE Collaboration. The comparison of model predictions to these new measurements is presented as a function of collision energy for central and forward particle rapidity intervals. In addition, the inverse slope parameters characterizing the transverse momentum distributions are extracted from the predicted spectra and compared to the corresponding values obtained from NA61/SHINE distributions, as a function of particle rapidity and collision energy. A complex pattern of deviations between the experimental data and the UrQMD model emerges. For charged pions, the fair agreement visible at top SPS energies deteriorates with the decreasing energy. For charged K mesons, UrQMD significantly underpredicts positive kaon production at lower beam momenta. It also underpredicts the central rapidity proton yield at top collision energy and overpredicts antiproton production at all considered energies. We conclude that the new experimental data analyzed in this paper still constitute a challenge for the present version of the model.
DEFF Research Database (Denmark)
Burisch, Johan; Gisbert, Javier P; Siegmund, Britta
2018-01-01
Background: The "United Registries for Clinical Assessment and Research" (UR-CARE) database is an initiative of the European Crohn's and Colitis Organisation (ECCO) to facilitate daily patient care and research studies in inflammatory bowel disease (IBD). Herein, we sought to validate the database......-99%); Case 5: 91% (87-93%)]. These numbers did not differ significantly from those found 6 weeks later (NcNemar's test p>0.05). Conclusion: The UR-CARE database appears to be feasible, valid and reliable as a tool and easy to use regardless of prior user experience and level of clinical IBD experience. UR......-CARE has the potential to enhance future European collaborations regarding clinical research in IBD....
Treatment of small lower pole calculi--SWL vs. URS vs. PNL?
Knoll, Thomas; Tasca, Andrea; Buchholz, Noor P
2011-03-01
According to current guideline recommendations extracorporeal shock wave lithotripsy (SWL) remains the first choice treatment for small and mid-sized renal calculi. However, the results of SWL treatment for lower pole stones can be disappointing whilst more invasive endoscopic modalities, such as flexible ureterorenoscopy (fURS) and percutaneous nephrolithotomy (PNL) are often considered more effective. This article summarizes a point-counterpoint discussion at the 9th eULIS symposium in Como, Italy, and discusses the potential advantages and disadvantages of the different therapeutic approaches.
Brown-Paul, Chr.; Bakker, J.C.
2014-01-01
Wageningen UR Greenhouse Horticulture collaborate with research institutes in Australia on research in the field of greenhouse horticultural production. Interview with Dr. Sjaak Bakker of the Business Unit.
Recent developments on the UrQMD hybrid model
Energy Technology Data Exchange (ETDEWEB)
Steinheimer, J., E-mail: steinheimer@th.physik.uni-frankfurt.de; Nahrgang, M., E-mail: nahrgang@th.physik.uni-frankfurt.de; Gerhard, J., E-mail: jochen.gerhard@compeng.uni-frankfurt.de; Schramm, S., E-mail: schramm@fias.uni-frankfurt.de; Bleicher, M., E-mail: bleicher@fias.uni-frankfurt.de [Frankfurt Institute for Advanced Studies (FIAS) (Germany)
2012-06-15
We present recent results from the UrQMD hybrid approach investigating the influence of a deconfinement phase transition on the dynamics of hot and dense nuclear matter. In the hydrodynamic stage an equation of state that incorporates a critical end-point (CEP) in line with lattice data is used. The equation of state describes chiral restoration as well as the deconfinement phase transition. We compare the results from this new equation of state to results obtained by applying a hadron resonance gas equation of state, focusing on bulk observables. Furthermore we will discuss future improvements of the hydrodynamic model. This includes the formulation of chiral fluid dynamics to be able to study the effects of a chiral critical point as well as considerable improvements in terms of computational time which would open up possibilities for observables that require high statistics.
How to create an interface between UrQMD and Geant4 toolkit
Abdel-Waged, Khaled; Uzhinskii, V.V.
2012-01-01
An interface between the UrQMD-1.3cr model (version 1.3 for cosmic air showers) and the Geant4 transport toolkit has been developed. Compared to the current Geant4 (hybrid) hadronic models, this provides the ability to simulate at the microscopic level hadron, nucleus, and anti-nucleus interactions with matter from 0 to 1 TeV with a single transport code. This document provides installation requirements and instructions, as well as class and member function descriptions of the software.
“Þur sarriþu þursa trutin”: monster-fighting and medicine in early medieval Scandinavia
Directory of Open Access Journals (Sweden)
Hall, Alaric
2009-06-01
Full Text Available This paper seeks evidence among our extensive Scandinavian mythological texts for an area which they seldom discuss explicitly: the conceptualisation and handling of illness and healing. Its core evidence is two runic texts (the Canterbury Rune-Charm and the Sigtuna Amulet which conceptualise illness as a þurs (‘ogre, monster’. The article discusses the semantics of þurs, arguing that illness and supernatural beings could be conceptualised as identical in medieval Scandinavia. This provides a basis for arguing that myths in which gods and heroes fight monsters provided a paradigm for the struggle with illness. The article proceeds, more speculatively, to use the Eddaic poem Skírnismál and the Finnish Riiden synty as the basis for arguing that one cause of illness could be the transgression of moral norms.
Este artículo tiene por objetivo encontrar pruebas en los numerosos textos mitológicos escandinavos sobre un tema sobre el que pocas veces estos tratan de forma explícita: la conceptualización y el tratamiento de las enfermedades y su curación. La principal prueba se encuentra en dos textos rúnicos (el Canterbury Rune-Charm (El conjuro rúnico de Canterbury y el Sigtuna Amulet (El amuleto de Sigtuna que conceptualizan la enfermedad como un þurs (‘ogro, monstruo’. El artículo trata sobre la semántica de þurs y sostiene que las enfermedades y los seres sobrenaturales podían conceptualizarse como idénticos en la Escandinavia de la época medieval, en base a lo cual afirma que los mitos en los que los dioses y los héroes luchan contra los monstruos representaban un paradigma de la lucha contra las enfermedades. De forma más especulativa, el artículo utiliza el poema eddaico Skírnismál y el poema finlandés Riiden synty como base para sostener que la transgresión de las normas morales podía considerarse una posible causa de las enfermedades.
Mecanismos básicos da encefalopatia urêmica Mechanisms underlying uremic encephalopathy
Directory of Open Access Journals (Sweden)
Giselli Scaini
2010-06-01
Full Text Available Em pacientes com insuficiência renal, a encefalopatia é um problema comum que pode ser provocado pela uremia, deficiência de tiamina, diálise, rejeição de transplante, hipertensão, desequilíbrios hidroeletrolíticos e toxicidades medicamentosas. Em geral a encefalopatia se apresenta como um complexo de sintomas que progride de uma leve obnubilação sensitiva até delírio e coma. Esta revisão discute questões importantes com relação aos mecanismos de base da fisiopatologia da encefalopatia urêmica. A fisiopatologia da encefalopatia urêmica é até hoje incerta, mas postula-se o envolvimento de diversos fatores; trata-se de um processo complexo e provavelmente multifatorial. Distúrbios hormonais, estresse oxidativo, acúmulo de metabólitos, desequilíbrio entre os neurotransmissores excitatórios e inibitórios, e distúrbio do metabolismo intermediário foram identificados como fatores contribuintes. A despeito do progresso continuado na terapêutica, a maior parte das complicações neurológicas da uremia, como a encefalopatia urêmica, não respondem plenamente à diálise e muitas delas são desencadeadas ou agravadas pela diálise ou transplante renal. Por outro lado, estudos prévios demonstraram que a terapia antioxidante pode ser utilizada como terapia coadjuvante para o tratamento destas complicações neurológicas.In patients with renal failure, encephalopathy is a common problem that may be caused by uremia, thiamine deficiency, dialysis, transplant rejection, hypertension, fluid and electrolyte disturbances or drug toxicity. In general, encephalopathy presents with a symptom complex progressing from mild sensorial clouding to delirium and coma. This review discusses important issues regarding the mechanisms underlying the pathophysiology of uremic encephalopathy. The pathophysiology of uremic encephalopathy up to now is uncertain, but several factors have been postulated to be involved; it is a complex and probably
Kansen voor vrouwelijk talent : over carrières en barrières van vrouwen bij Wageningen UR
Lebbink, S.; Steuten, C.; Neefjes, M.
2013-01-01
Dit rapport inventariseert de situatie van de doorstroming van vrouwelijke wetenschappers aan Wageningen UR. Zo blijkt er binnen Wageningen University een dik glazen plafond te bestaan, te meten aan de doorstroom van de ene functieschaal naar de volgende. In dit rapport beschrijven we een aantal
Watanabe, Shimpei; Kuzhiumparambil, Unnikrishnan; Fu, Shanlin
2018-03-08
The number of new psychoactive substances keeps on rising despite the controlling efforts by law enforcement. Although metabolism of the newly emerging drugs is continuously studied to keep up with the new additions, the exact structures of the metabolites are often not identified due to the insufficient sample quantities for techniques such as nuclear magnetic resonance (NMR) spectroscopy. The aim of the study was to characterise several metabolites of the synthetic cannabinoid (1-pentyl-1H-indol-3-yl) (2,2,3,3-tetramethylcyclopropyl) methanone (UR-144) by NMR spectroscopy after the incubation with the fungus Cunninghamella elegans. UR-144 was incubated with C. elegans for 72 h, and the resulting metabolites were chromatographically separated. Six fractions were collected and analysed by NMR spectroscopy. UR-144 was also incubated with human liver microsomes (HLM), and the liquid chromatography-high resolution mass spectrometry analysis was performed on the HLM metabolites with the characterised fungal metabolites as reference standards. Ten metabolites were characterised by NMR analysis including dihydroxy metabolites, carboxy and hydroxy metabolites, a hydroxy and ketone metabolite, and a carboxy and ketone metabolite. Of these metabolites, dihydroxy metabolite, carboxy and hydroxy metabolites, and a hydroxy and ketone metabolite were identified in HLM incubation. The results indicate that the fungus is capable of producing human-relevant metabolites including the exact isomers. The capacity of the fungus C. elegans to allow for NMR structural characterisation by enabling production of large amounts of metabolites makes it an ideal model to complement metabolism studies.
Il romanzo moderno nella poetica del sé di Paul Ricœur
Directory of Open Access Journals (Sweden)
Roberto Talamo
2013-12-01
Full Text Available La riflessione sul romanzo moderno e la nascita di uno dei concetti più importanti dell’ermeneutica del sé, quello di «identità narrativa», sono strettamente intrecciati nel pensiero di Ricœur. Attraverso una lettura di diverse opere del filosofo francese, si mostrerà il percorso di genesi poetica di questo concetto, confrontando altresì la teorizzazione ricoeuriana a proposito del romanzo moderno con le principali acquisizioni su questa forma letteraria da parte della critica e della teoria della letteratura.
A Detailed Study and Synthesis of Flow Observables in the IP-Glasma+MUSIC+UrQMD Framework
McDonald, Scott; Shen, Chun; Fillion-Gourdeau, François; Jeon, Sangyong; Gale, Charles
2017-11-01
In this work we use the IP-Glasma+MUSIC+UrQMD framework to systematically study a wide range of hadronic flow observables at 2.76 TeV. In addition to the single particle spectra and anisotropic flow coefficients vn previously studied in [S. McDonald, C. Shen, F. Fillion-Gourdeau, S. Jeon and C. Gale, arxiv:arXiv:1609.02958 [hep-ph
Ricœur et la théorie de l’action
Directory of Open Access Journals (Sweden)
Jean-Luc Petit
2014-07-01
Full Text Available AbstractRicoeur’s Philosophy of the Will is reexamined here both as a source of motivation for his project of dialoguing with the analytic theory of action and as an explanation for the lack of response on the part of his Anglo-American interlocutors.Keywords: Actions, Language, Body, Idealism. RésuméLa Philosophie de la volonté de Ricœur est revisitée ici comme source de motivation de son entreprise de dialogue avec la théorie analytique de l’action et comme explication du défaut de réponse de ses interlocuteurs anglo-américains.Mots-clés: Actions, Langage, Corps, Idéalisme.
Supplement to LA-UR-17-21218: Application to SSVD
Energy Technology Data Exchange (ETDEWEB)
Tregillis, Ian Lee [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2018-01-22
We apply the formalism derived in LA-UR-17-21218 to the prescription for an RMI-based self-similar velocity distribution (SSVD) derived by Ham- merberg et al.. We compute analytically the true [mt(t)] and inferred [mi(t)] ejecta mass arriving at the piezoelectric sensor for several shots de- scribed in the literature and compare the results to the data. We nd that while the \\RMI + SSVD" prescription gives rise to decent estimates for the nal accumulated mass at the pin, the time-dependent accumulation rises too sharply and linearly to agree with data. We also compute the time-dependent pressure and voltage at the sensor, and compare the latter to data. The pres- sure does not rise smoothly from zero, instead exhibiting a strong surge as the leading edge of the ejecta cloud arrives, which produces an initial sharp spike in the voltage trace, which is not observed. These inconsistencies result from a discontinuity in the prescribed self-similar velocity distribution at maximum relative velocity.
La sténose urétérale post infectieuse et la mégacalicose: un train ...
African Journals Online (AJOL)
La sténose urétérale post infectieuse et la mégacalicose: un train qui en cache un autre. Babacar Sine, Ndeye Aissatou Bagayogo, Boubacar Fall, Yaya Sow, Amath Thiam, Alioune Sarr, Abdou Razak Hamidou Zakou, Samba Thiapato Faye, Babacar Diao, Papa Ahmed Fall, Alain khassim Ndoye ...
Directory of Open Access Journals (Sweden)
Jean-Marc Tétaz
2014-07-01
Full Text Available AbstractThe favourable reception of the analytic philosophy of language plays a central role in the composition of Ricœur’s literary hermeneutics. Following a brief description of the historical and methodological context of this reception, we show how Ricœur intends to link up phenomenology and analytic philosophy of language. Then we examine the role allocated to the analytic philosophy of language in establishing the idea of metaphor as a “more fundamental mode of reference” in The Rule of Metaphor. But once again Ricœur situates this semantic interpretation of metaphor within the context of an ontology. The result is methodological difficulties that mark the limits of Ricœur’s reception of the analytic philosophy of language.Keywords: Semantics, Metaphor, Ontology, Structuralism, Poetics.RésuméLa réception de la philosophie analytique du langage joue un rôle central dans la constitution de l’herméneutique littéraire de Ricœur. Après avoir tracé le cadre historique et systématique dans lequel s’inscrit cette réception, on montre comment Ricœur se propose d’articuler phénoménologie et philosophie analytique du langage. On étudie ensuite le rôle assigné à la philosophie analytique du langage pour la mise en place de la conception de la métaphore comme “mode plus fondamental de la référence” dans La métaphore vive. Mais Ricœur situe encore une fois cette interprétation sémantique de la métaphore dans un cadre ontologique. Il en résulte des difficultés systématiques qui marquent les limites de la réception de la philosophie analytique du langage par Ricœur.Mots-clés: Sémantique, Métaphore, Ontologie, Structuralisme, Poétique.
Veller, van M.G.P.; Gerritsma, W.
2015-01-01
Wageningen UR Library has developed a tool based upon co-citation analysis to recommend alternative journals to researchers for a journal they look up in the tool. The journal recommendations can be tuned in such a way to include citation preferences for each of the five science groups that comprise
Peng, Sheng-Yu
2013-01-01
This thesis begins a dialogue between Hans Urs von Balthasar’s theological aesthetics and Chinese academic aesthetics. We identify a tension between aesthetics and religion in Chinese academic aesthetics, and argue that a dialogue with von Balthasar’s work has the potential to contribute to the development of Chinese academic aesthetics with regard to overcoming that tension. In order to set a ground for the dialogue, von Balthasar’s theological aesthetics is examined in Par...
La persona como singularidad concreta en la obra de Hans Urs von Balthasar
Directory of Open Access Journals (Sweden)
Anneliese Meis W.
2001-01-01
Full Text Available El presente estudio aborda el concepto de persona de Hans Urs von Balthasar en cuanto singularidad concreta, descubierto a través de una intensa lectura analítica de su voluminosa obra, búsqueda a la luz de la pregunta ¿por qué yo soy precisamente yo? En efecto, el teólogo suizo nunca sistematiza su comprensión de persona la distingue sí de los conceptos "individuo", "sujeto" y "espíritu, pese a que se sirve de aquella como de uno de los pilares más significativos de su pensamiento. Los resultados obtenidos evidencian la complejidad de factores conceptuales, que demuestran que el yo tiene su fundamento último en el acto libre del amor infinito, que como tal constituye la persona desde el dinamismo intradivino de las relaciones opuestas entre Padre, Hijo y Espíritu SantoThis paper regards the concept of person as a concrete singularity in Hans Urs Von Balthasar's work. Such concept rose after a deep analytical reading of his voluminous work, in the light of the guiding question; Why am I, precisely I? The Swiss theologian distinguishes person from the concepts "individual", "subject" and "spirit", but he never synthesises his understanding of person, even though he uses it as one of the most significant pillars of his thought. The results obtained from the research confirm the complexity of the conceptual factors, which show that one's self has its deepest foundation in the free act of the infinite love, which as such, constitutes the person from the intra-divine dynamism of the opposed relations between the Father, Son and Holy Spirit
Síndrome hemolítico urémico: Aspectos epidemiológicos y patogénicos
Directory of Open Access Journals (Sweden)
Yardelis Pérez del Campo
2000-09-01
Full Text Available Se hace una revisión de los aspectos actuales en relación con la epidemiología y patogenia del síndrome hermolítico urémico. El síndrome hemolítico urémico es el resultado de la acción de numerosos factores etiológicos y patogénicos. Se han aislado varias cepas de Escherichia coli productoras de una citotoxina para células vero, denominada verotoxina o toxina shiga-like (SL-T, esta toxina, específicamente la producida por la Escherichia coli serotipo O157: H7 ha sido relacionada con casos esporádicos y epidémicos y con menor frecuencia O111, O26 y O113, actúan mediante la liberación de exotoxinas a la circulación sanguínea. El primer fenómeno en la patogénesis del síndrome hemolítico urémico es la lesión del endotelio vascular que de manera secundaria genera una cascada de fenómenos tales como la adhesión, agregación plaquetaria y el depósito de fibrina mediante distintos mediadores, cuyo resultado final sería la formación de trombos en la microcirculación: la microangiopatía trombótica.A review was made on the present aspects of the epidemiology and pathogeny of hemolytic uremic syndrome which is the result of a number of etiologic and pathogenic factors. Several Escherichia coli strains which produce a cytotoxin for Vero cells, called verotoxin or Shiga-like toxin(SL-T have been isolated. This toxin, particularly that produced by Escherichia coli serotype =157: H7 has been related to sporadic and epidemic cases and less frequently serotypes 0111, 026 and 0113 act through release of exotocins into blood stream. The first phenomenum in the pathogenesis of the hemolytic syndrome is vascular endothelium injure that as a side effect generates a series of phenomena such as adhesion, platelet aggregation and fibrin deposists through several mediators; the final result would be the formation of thrombi in microcirculation: the thrombotic microangiopathy.
Directory of Open Access Journals (Sweden)
Mônica Kanashiro Oyafuso
2010-02-01
Full Text Available O estudo teve como objetivo avaliar os casos de urolitíase canina em que a composição mineral dos urólitos foi analisada quantitativamente. Foi avaliada quantitativamente a composição mineral de 156 urólitos obtidos de cães (nefrólitos, ureterólitos, urocistólitos e uretrólitos. Desse total, 79,5% (n=124 eram simples, 18% (n=28 eram compostos e apenas 2,5% (n=4 eram mistos. A estruvita foi o tipo mineral mais frequente nos urólitos simples (47,6%; n=59, em todos os mistos (100%; n=4 e nas camadas núcleo e pedra de urólitos compostos (32,1 e 75%, respectivamente. O oxalato de cálcio foi o segundo mineral mais frequente dos urólitos simples (37,9%, n=47. Ao contrário do que é preconizado para os urólitos simples, as recomendações para o tratamento de urólitos compostos são mais complexas, tais como protocolos de tratamento de dissolução diferentes (se composto por minerais distintos e passíveis de dissolução como urato e estruvita. Além disso, a dissolução pode não ser viável, caso ocorra presença de material insolúvel envolvendo o urólito ou se este representar mais de 20% da camada. Vinte e dois urólitos compostos (78,7% apresentaram uma camada externa não passível de dissolução (oxalato de cálcio ou fosfato de cálcio; dois (7,1% apresentaram camadas externas passíveis de dissolução (estruvita ou urato, porém camadas mais internas não solúveis, o que permitiria apenas a dissolução parcial do urólito. Assim, o conhecimento da composição de todas as camadas que compõem o urólito é essencial para o entendimento da formação do cálculo e consequentemente para a indicação do tratamento adequado, assim como para prevenção de recidivas.The aim of this study was to evaluate dogs with urolithiasis in which mineral composition of calculi was quantitatively analyzed. Quantitative mineral composition was performed in 156 canine uroliths. Simple uroliths represented 79.5% (n=124 of the cases, 18
Competencia motriz del paciente urémico en el programa de hemodiálisis
Peña-Amaro, María-del-Pilar
2013-01-01
[ES]El paciente urémico en programa de hemodiálisis entra en una dinámica de inactividad física inducido por causas tanto de tipo biológico como psicológico o social y ello reduce su competencia motriz. esta inactividad física puede favorecer las alteraciones cardiovasculares y nutricionales ( de composición corporal) que se producen por causa tanto de la patología como de la técnica sustitutiva en la que se encuentran incluidos. Determinar si un ejercicio físico moderado pero mantenido tiene...
La costellazione dei generi: forme letterarie e modi del discorso nel pensiero di Paul Ricœur
Directory of Open Access Journals (Sweden)
Roberto Talamo
2013-12-01
Full Text Available Il pensiero filosofico di Ricœur si è sviluppato attraverso un costante e proficuo confronto con le diverse forme della letteratura antica e moderna. Con una carrellata attraverso i testi del filosofo e quelli dei principali interpreti della sua riflessione, si ricostruisce la trama significativa dei nessi tra filosofia e generi letterari: questi offrono al pensiero ricoeuriano la possibilità di «pensare di più» i nodi etici del campo filosofico.
Directory of Open Access Journals (Sweden)
Kátia Fernanda Gobbi
2005-06-01
Full Text Available Avaliaram-se os efeitos da adição de uréia em níveis crescentes sobre a composição química e digestibilidade in vitro da matéria seca (DIVMS do feno de Brachiaria decumbens colhida no estádio de pós-florescimento. O feno foi tratado com seis níveis de uréia (0, 2, 4, 6, 8 e 10%, com base na matéria seca (MS. A uréia foi dissolvida em quantidade de água suficiente para elevar o teor de umidade do feno para 30%. O delineamento experimental adotado foi o inteiramente casualizado, com três repetições. O feno tratado foi armazenado em sacos plásticos (2 kg/saco vedados, por 35 dias, e, após abertura, foram coletadas amostras para as análises químicas. Verificou-se que o teor de nitrogênio total (NT aumentou linearmente em função dos níveis crescentes de uréia. Os teores de NIDN e NIDA, em relação ao nitrogênio total (NIDN/NT e NIDA/NT, tiveram redução linear em função dos níveis crescentes de uréia, demonstrando aumento nos teores de nitrogênio disponível no material amonizado. A adição de uréia promoveu redução no teor de fibra em detergente neutro (FDN, fibra em detergente ácido (FDA e celulose. Os teores de hemicelulose e lignina não foram alterados pelo tratamento com uréia. A digestibilidade in vitro da matéria seca (DIVMS foi influenciada de forma quadrática pelos níveis de uréia, estimando-se valor máximo de 68, 9% para o nível de 7, 15% de uréia. A amonização com uréia alterou a composição química e a digestibilidade do feno de Brachiaria decumbens, melhorando o valor nutritivo do material tratado.An experiment was conducted to evaluate the effects of urea treatment on the chemical-bromatologic compounds and in vitro dry matter digestibility (IVDMD of Brachiaria decumbens hay. The hay were reconstituted with water to get final forage moisture concentration of 30%, and treated with urea at 0, 2, 4, 6, 8, and 10% of the forage dry matter. A completely randomized design with three
Directory of Open Access Journals (Sweden)
Marc-Antoine Vallée
2012-06-01
Full Text Available This paper proposes a presentation and an analysis of the first philosophical writing of Paul Ricœur, on the problem of God in the reflexive philosophies of Lachelier and Lagneau. His principal aim is to situate this first writing in the context of Ricœur’s philosophical work, by underlining his belonging to the french reflexive tradition and his refusing of the absolute idealism of Lachelier and Lagneau. The author insists more precisely on the realistic and personalist thesis of the young Ricœur and on the appearance of the problem of evil in his work.
VisualUrText: A Text Analytics Tool for Unstructured Textual Data
Zainol, Zuraini; Jaymes, Mohd T. H.; Nohuddin, Puteri N. E.
2018-05-01
The growing amount of unstructured text over Internet is tremendous. Text repositories come from Web 2.0, business intelligence and social networking applications. It is also believed that 80-90% of future growth data is available in the form of unstructured text databases that may potentially contain interesting patterns and trends. Text Mining is well known technique for discovering interesting patterns and trends which are non-trivial knowledge from massive unstructured text data. Text Mining covers multidisciplinary fields involving information retrieval (IR), text analysis, natural language processing (NLP), data mining, machine learning statistics and computational linguistics. This paper discusses the development of text analytics tool that is proficient in extracting, processing, analyzing the unstructured text data and visualizing cleaned text data into multiple forms such as Document Term Matrix (DTM), Frequency Graph, Network Analysis Graph, Word Cloud and Dendogram. This tool, VisualUrText, is developed to assist students and researchers for extracting interesting patterns and trends in document analyses.
Le syndrome de la jonction pyélo-urétérale de l'adulte : à propos de ...
African Journals Online (AJOL)
Le syndrome de la jonction pyélo-urétérale (SJPU) est l'une des uropathies malformatives les plus fréquentes. Nous rapportons les résultats d'une étude rétrospective descriptive portant sur 12 cas de SJPU colligés sur 5 ans à la Clinique Universitaire d'Urologie-Andrologie de Cotonou. Il s'agissait de 7 hommes et 5 ...
Directory of Open Access Journals (Sweden)
Mário Marcos de Santana Faria
2008-03-01
Full Text Available O trabalho foi desenvolvido com o objetivo de avaliar os efeitos da amonização com uréia pecuária sobre a composição bromatológica do co-produto do processamento do sisal (Agave sisalana, Perrine em diferentes tempos de estocagens. Foram utilizados 300 kg do co-produto, igualmente distribuídos em 60 sacos de polietileno preto, onde se adicionou uréia nas concentrações de 0, 2, 4, 6 e 8% (base matéria seca - MS nos tempos de estocagem de 0, 2, 4 e 6 semanas. Determinaram-se os teores de matéria seca (MS, proteína bruta (PB, fibra em detergente neutro (FDN, fibra em detergente ácido (FDA e carboidratos não fibrosos (CNF. O consumo (CMS e a digestibilidade (DMS de MS foram obtidos por estimativa. O delineamento utilizado foi inteiramente casualizado (DIC, com 20 tratamentos e três repetições, seguindo o esquema fatorial 5 ´ 4 (cinco doses de uréia e quatro períodos de estocagem. A análise de variância revelou significância para o efeito da dose de uréia para as variáveis PB e MS. Para FDA, CNF e DMS, houve efeito significativo da interação dose de uréia ´ período de fermentação, ao passo que para FDN não houve significância de nenhum dos fatores. O teor de PB cresceu linearmente com a adição de uréia. Além disso, foi observado acréscimo nos teores de FDA, em função do decréscimo dos teores de CNF. As diminuições dos teores de CNF com o aumento dos níveis de uréia indicam que estes foram usados, provavelmente, para a síntese microbiana ou carreados com o efluente. Conclui-se que a adição de até 8% de uréia elevou os teores de PB e, com o aumento do tempo de estocagem, reduziu os teores de CNF e a DMS.The experiment was carried out to evaluate addition effects of five urea levels with four ammonization periods on Agave sisalana residue chemical composition in the different storage times. It was used 300 kg of this co-product, equally distributed in 60 black polyethylene bags, which urea was added
Directory of Open Access Journals (Sweden)
DUTRA Sandra Valduga
1999-01-01
Full Text Available A análise de aminoácidos e uréia em mosto de Cabernet Sauvignon fermentado com diferentes leveduras, foram os principais objetivos desse trabalho. Cabernet Sauvignon foi utilizada por ser teoricamente uma cultivar com alto teor de prolina e baixo teor de arginina, em comparação com cultivares com alto teor e predominância de arginina. Os mostos foram coletados em Santana do Livramento, RS e transportados para a UFSM; lá foram dividos em dois lotes aos quais foram adicionados diferentes leveduras: Saccharomyces cerevisiae Fermol Bouquet e Saccharomyces cerevisiae 2056. A análise dos aminoácidos foi realizada utilizando um analizador de aminoácidos marca Hitachi L-8500 conforme SANDERS e OUGH (21. Uréia foi determinada de acordo com ALMY e OUGH (1 modificado por PEREIRA e DAUDT (19. O aminoácido encontrado no mosto, em maior quantidade foi a prolina (847mg/l seguido por arginina (235mg/l e alanina (87mg/l. A maioria dos aminoácidos (exceção de prolina foram consumidos pelas leveduras logo após o início da fermentação. A liberação máxima de uréia no meio coincidiu com o consumo máximo de arginina, que na fermentação com a levedura 2056 ocorreu à 19° Brix (2,7mg/l e com a levedura Fermol Bouquet ocorreu com o mosto a 15° Brix (4,1mg/l. O teor de prolina permaneceu elevado durante todo o processo fermentativo, confirmando a pouca preferência das leveduras por este aminoácido. Os aminoácidos arginina, treonina, serina, aspartato e isoleucina, podem ser considerados melhores fontes de nitrogênio para as leveduras.
Aspiration, Consumer Culture, and Individualism in Les Belles-Sœurs
Directory of Open Access Journals (Sweden)
Julie Robert
2014-01-01
Full Text Available The premise of Michel Tremblay’s revolutionary 1968 play, Les Belles-Sœurs , is a working bee. A group of working-class women gather to paste a million trading stamps, won in a sweepstakes, into booklets that once full can be redeemed for household goods. As the guests surreptitiously pilfer what they see as their hostess’s underserved windfall, their actions problematize the links between the individualistic aspects of consumer and material culture and the communal values they share as members of Quebec’s working class. Taking consumer culture and material desire as a starting point, this essay considers the relationship between the individual and the collective inherent in such matters and situates it in relation to the ways in which consumer culture, individual advancement, and national projects of collective betterment, namely the Quiet Revolution, are implicitly treated in the play. It is argued that Tremblay does not resolutely condemn consumer culture as something apart from the monumental social and political changes of the era, but rather sees in the practices of consumerism aspects of collective behavior that trouble interpretations of the accumulation of material goods as selfish or individualistic undertakings.
URS DataBase: universe of RNA structures and their motifs.
Baulin, Eugene; Yacovlev, Victor; Khachko, Denis; Spirin, Sergei; Roytberg, Mikhail
2016-01-01
The Universe of RNA Structures DataBase (URSDB) stores information obtained from all RNA-containing PDB entries (2935 entries in October 2015). The content of the database is updated regularly. The database consists of 51 tables containing indexed data on various elements of the RNA structures. The database provides a web interface allowing user to select a subset of structures with desired features and to obtain various statistical data for a selected subset of structures or for all structures. In particular, one can easily obtain statistics on geometric parameters of base pairs, on structural motifs (stems, loops, etc.) or on different types of pseudoknots. The user can also view and get information on an individual structure or its selected parts, e.g. RNA-protein hydrogen bonds. URSDB employs a new original definition of loops in RNA structures. That definition fits both pseudoknot-free and pseudoknotted secondary structures and coincides with the classical definition in case of pseudoknot-free structures. To our knowledge, URSDB is the first database supporting searches based on topological classification of pseudoknots and on extended loop classification.Database URL: http://server3.lpm.org.ru/urs/. © The Author(s) 2016. Published by Oxford University Press.
Burisch, Johan; Gisbert, Javier P; Siegmund, Britta; Bettenworth, Dominik; Thomsen, Sandra Bohn; Cleynen, Isabelle; Cremer, Anneline; Ding, Nik John Sheng; Furfaro, Federica; Galanopoulos, Michail; Grunert, Philip Christian; Hanzel, Jurij; Ivanovski, Tamara Knezevic; Krustins, Eduards; Noor, Nurulamin; O'Morain, Neil; Rodríguez-Lago, Iago; Scharl, Michael; Tua, Julia; Uzzan, Mathieu; Ali Yassin, Nuha; Baert, Filip; Langholz, Ebbe
2018-04-27
The 'United Registries for Clinical Assessment and Research' [UR-CARE] database is an initiative of the European Crohn's and Colitis Organisation [ECCO] to facilitate daily patient care and research studies in inflammatory bowel disease [IBD]. Herein, we sought to validate the database by using fictional case histories of patients with IBD that were to be entered by observers of varying experience in IBD. Nineteen observers entered five patient case histories into the database. After 6 weeks, all observers entered the same case histories again. For each case history, 20 key variables were selected to calculate the accuracy for each observer. We assumed that the database was such that ≥ 90% of the entered data would be correct. The overall proportion of correctly entered data was calculated using a beta-binomial regression model to account for inter-observer variation and compared to the expected level of validity. Re-test reliability was assessed using McNemar's test. For all case histories, the overall proportion of correctly entered items and their confidence intervals included the target of 90% (Case 1: 92% [88-94%]; Case 2: 87% [83-91%]; Case 3: 93% [90-95%]; Case 4: 97% [94-99%]; Case 5: 91% [87-93%]). These numbers did not differ significantly from those found 6 weeks later [NcNemar's test p > 0.05]. The UR-CARE database appears to be feasible, valid and reliable as a tool and easy to use regardless of prior user experience and level of clinical IBD experience. UR-CARE has the potential to enhance future European collaborations regarding clinical research in IBD.
Assimos, Dean; Crisci, Alfonso; Culkin, Daniel; Xue, Wei; Roelofs, Anita; Duvdevani, Mordechai; Desai, Mahesh; de la Rosette, Jean
2016-04-01
To compare outcomes of ureteric and renal stone treatment with ureteroscopy (URS) in patients with or without the placement of a preoperative JJ stent. The Clinical Research Office of the Endourological Society (CROES) URS Global Study collected prospective data for 1 year on consecutive patients with ureteric or renal stones treated with URS at 114 centres around the world. Patients that had had preoperative JJ stent placement were compared with those that did not. Inverse-probability-weighted regression adjustment (IPWRA) was used to examine the effect of preoperative JJ stent placement on the stone-free rate (SFR), length of hospital stay (LOHS), operative duration, and complications (rate and severity). Of 8 189 patients with ureteric stones, there were 978 (11.9%) and 7 133 patients with and without a preoperative JJ stent, respectively. Of the 1 622 patients with renal stones, 590 (36.4%) had preoperative stenting and 1 002 did not. For renal stone treatment, preoperative stent placement increased the SFR and operative time, and there was a borderline significant decrease in intraoperative complications. For ureteric stone treatment, preoperative stent placement was associated with longer operative duration and decreased LOHS, but there was no difference in the SFR and complications. One major limitation of the study was that the reason for JJ stent placement was not identified preoperatively. The placement of a preoperative JJ stent increases SFRs and decreases complications in patients with renal stones but not in those with ureteric stones. © 2015 The Authors BJU International © 2015 BJU International Published by John Wiley & Sons Ltd.
Una aproximación al pensamiento de Hans Urs von Balthasar desde la perspectiva de Bernhard Welte
Directory of Open Access Journals (Sweden)
César Lambert
2009-01-01
Full Text Available Este artículo investiga las dimensiones biográfica y sistemática de la relación entre Hans Urs von Balthasar y Bernhardt Welte. En el primer caso, la carencia de un encuentro real entre ellas es asombrosa, sobre todo considerando el hecho de la cercanía entre Basel y Freiburg, ciudades en que vivieron por mucho tiempo. Por otro lado, la dimensión sistemática deja claro que tanto Balthasar como Welte tratan de responder una pregunta que concierne a la respuesta humana a la revelación de Dios en Cristo. Welte enfatiza la autorrealización de la fe, y Balthasar arguye que la revelación del amor de Dios provee todos los medios necesarios para que el hombre comprenda este amor glorioso de forma apropiada.This article investigates both the biographical and the systematic dimensions of the relationship between Hans Urs von Balthasar and Bernhard Welte. In the first case, the lack of a real encounter between them is astonishing- despite the fact that Basel and Freiburg -that is, the cities where they lived for a long time- are close to each other. On the other hand, the systematic dimension makes clear that Balthasar and Welte are trying to answer a question concerning the human response to the Revelation of God in Christ. Welte emphasizes the self-realization of faith, and Balthasar argues that the Revelation of God's love provides all the means necessary for human beings to understand this glorious love properly.
International Nuclear Information System (INIS)
Fontes, Talita Filier
2009-01-01
Alpha prime phase leads to decreased corrosion resistance and mechanical properties losses of duplex stainless steels. In this work mechanical and electrochemical tests were performed in duplex stainless steel UR 52N+ aged at 475 degree C for various periods in order to determine the sensibility of these tests to alpha prime presence. Hardness tests showed a gradual increase in its values; on the other hand, impact tests revealed that the material aged for 12h losses about 80% of energy absorption capacity of the solution annealed sample. Notwithstanding cyclic polarization tests showed that significant changes are only noted for aging times greater than 96h. (author)
Directory of Open Access Journals (Sweden)
Marta Castellote
2009-12-01
Full Text Available Una de las principales causas de despasivación de las armaduras embebidas en hormigón es la denominada carbonatación, que consiste en la neutralización de la matriz de cemento como consecuencia de su interacción con el C0(2 atmosférico. En este trabajo, se presenta un resumen del desarrollo de un modelo de carbonatación de las matrices de base cemento (UR-CORE. En primer lugar se ha llevado a cabo la carbonatación acelerada (al 100% de C0(2 sobre probetas de pasta de cemento con distintas matrices cementantes tomando espectros de Difracción de Neutrones a lo largo del tiempo de experimento. La evolución de la intensidad de los picos correspondientes a cada una de las fases involucradas ha proporcionado datos de conversión fraccional en tiempo real, lo que ha posibilitado una aproximación cinética al fenómeno de la carbonatación y el desarrollo del modelo UR-CORE, basado en los principios de los sistemas de "núcleo sin reaccionar", típicos de los procesos en ingeniería química.One of the most important depassivation mechanisms of steel reinforcement in concrete is that caused by the neutralisation of the cement matrix. In this work, a summary of the development of a model for the carbonation of cementitious matrixes (UR-CORE is presented. On one hand, in-situ monitoring of the changes that take place in the phase composition of cement pastes during accelerated carbonation (100% C02 for different binders, is reported, by taking Neutrón Diffraction patterns in parallel with the carbonation experiments. The variation of the intensity of chosen reflections for each phase along the experiment supplied data, in real time, for fractional conversión of different phases. On the second hand, fitting of these results allowed to make a quantitative approach to the kinetics of the carbonation of the different phases, and develop the UR-CORE model that is based on the principies of the "unreacted-core" systems, typical of chemical
LA-UR-14-27684, Analysis of Wildland Fire Hazard to the TWF at Los Alamos National Labs
Energy Technology Data Exchange (ETDEWEB)
Gilbertson, Sarah [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2014-10-02
Wildfires represent an Anticipated Natural Phenomena Hazard for LANL and the surrounding area. The TWF facility is located in a cleared area and is surrounded on three sides by roadway pavement. Therefore, direct propagation of flames to the facility is not considered the most credible means of ignition. Rather, fires started by airborne transport of burning brands constitute the most significant wildland fire threat to the TWF. The purpose of this document is to update LA-UR-13-24529, Airborne Projection of Burning Embers – Planning and Controls for Los Alamos National Laboratory Facilities, to be specific to the TWF site and operations.
Directory of Open Access Journals (Sweden)
Sangoi Luís
2003-01-01
Full Text Available A volatilização de amônia (NH3 é a principal perda de nitrogênio (N responsável pela baixa eficiência da uréia aplicada na superfície do solo. Este trabalho objetivou avaliar os efeitos do modo de aplicação da uréia e da forma de manejo dos resíduos de aveia preta sobre a volatilização de amônia, em dois solos com diferentes teores de argila e matéria orgânica, sob condições de laboratório. Foram conduzidos dois experimentos num Nitossolo Vermelho (NV e num Neossolo Quartzarênico (NQ, contendo 520 e 50g kg-1 de argila, respectivamente. Os tratamentos consistiram de três formas de manejo do fertilizante nitrogenado (sem N, uréia aplicada na superfície e uréia incorporada ao solo e três métodos de manejo dos resíduos de aveia (sem palha, palha aplicada na superfície e palha incorporada ao solo. Utilizou-se o equivalente a 4,0mg ha-1 de palha e 255kg ha-1 de N. As unidades experimentais foram constituídas por colunas de PVC, contendo 1,47kg de solo argiloso e 2,1kg de solo arenoso. As colunas foram hermeticamente vedadas e a parte superior foi conectada, através de uma mangueira plástica, a frascos coletores com ácido sulfúrico. A quantidade de N-NH3 volatilizada foi determinada por arraste de vapor, em diferentes períodos, após a implantação do experimento. A aplicação superficial da uréia proporcionou maior volatilização de N-NH3 do que sua incorporação, nos dois solos. A manutenção da palha sobre a superfície do solo estimulou a perda de N-NH3 no solo arenoso, independentemente da forma de aplicação da uréia ao solo. A perda de N-NH3 foi numericamente maior e o período de máxima volatilização ocorreu antes no NQ, provavelmente devido ao menor teor de argila, à matéria orgânica e à menor capacidade de troca de cátions, relativamente ao NV.
Aminoácidos livres e uréia durante a fermentação de mosto de Chardonnay com diferentes leveduras
Directory of Open Access Journals (Sweden)
DUTRA Sandra Valduga
1999-01-01
Full Text Available A análise de aminoácidos e uréia durante a fermentação da cultivar Chardonnay, fermentada com diferentes leveduras, foram os principais objetivos deste trabalho. Os mostos foram coletados em Santana do Livramento, RS, transportados para a UFSM; lá foram divididos em dois lotes aos quais foram adicionadas diferentes leveduras: Saccharomyces cerevisiae Fermol Bouquet e Saccharomyces cerevisiae D47. O aminoácido encontrado no mosto em maior quantidade foi a prolina (327 mg/L seguido por treonina, arginina e alanina (239 mg/L. A maioria dos aminoácidos foi consumida pelas leveduras, logo após o início da fermentação. A liberação máxima de uréia no meio coincidiu com o máximo de consumo de arginina, que para a levedura Fermol Bouquet foi com 15ºBrix e para a levedura D47 com 11ºBrix. Confirmando a pouca preferência de prolina pelas leveduras, o teor deste aminoácido permaneceu elevado durante o processo fermentativo. Os aminoácidos, arginina, alanina, treonina, serina, ácido aspártico e isoleucina podem ser considerados as melhores fontes de nitrogênio para as leveduras.
Directory of Open Access Journals (Sweden)
Irina Keshabyan
2009-12-01
Full Text Available The present paper aims at carrying out structural and lexical analysis of two contrasting plays –Shakespeare´s Hamlet and Sumarokov´s Gamlet- in a specific linguistic domain. In this contribution, we will attempt to gain some insight into two essential content words: vengeance and hono(ur, their derivatives and related words, through quantitative analysis of these words and qualitative analysis of their collocates and concordances. Collocational approach will be used to analyse and compare the ways the authors perceive the concepts of vengeance and hono(ur. In general, the findings will indicate important similarities and/or differences between the structures of the plays per acts and both texts´ basic contents in relation to two important topics -vengeance and hono(ur.El presente artículo tiene como objetivo un análisis estructural y léxico de dos obras contrastivas –Hamlet de Shakespeare y Gamlet de Sumarokov- en un dominio lingüístico específico. En esta contribución, intentaremos adentrarse en el estudio de dos sustantivos: venganza y honor, sus derivados y palabras relacionadas- a través de un análisis cuantitativo de las mismas y el análisis cualitativo de sus colocados y concordancias. El método de los colocados será utilizado para analizar y comparar el modo en que los autores perciben los conceptos de venganza y honor. En general, los resultados van a señalar las similitudes y/o diferencias importantes entre las estructuras de las obras por actos y los contenidos básicos de ambos textos en relación con dos temas importantes, tal como, venganza y honor.
Directory of Open Access Journals (Sweden)
Regina Marcia Longo
2005-07-01
Full Text Available Este trabalho objetivou estudar a velocidade de hidrólise da uréia em dois diferentes solos brasileiros (Latossolo Vermelho Aluminoférrico típico e Latossolo Vermelho distrófico típico onde foram realizados ensaios sobre o efeito do tempo e condições de armazenamento, concentração do substrato (uréia, temperatura, pH e tempo de incubação sobre a atividade da urease. As melhores condições de armazenamento foram em temperatura ambiente ou 5 ºC, após secagem ao ar, por um período de até 7 dias; para as condições estudadas, o melhor tempo de incubação foi de uma hora a 25-30 ºC, sem a utilização de tampão para acertar o pH, e a concentração de uréia suficiente foi de 3,30 g L-1, para o Latossolo Vermelho Aluminoférrico típico, e de 2,5 g L-1, para o Latossolo Vermelho distrófico típico para obter a velocidade máxima da enzima.This study evaluated the kinetics of urease hydrolysis in two different Brazilian soils (Rhodic Oxisols: a typic alumino-ferric Red Latossol and a typic distrophic Red Latosol. The trials were carried out to study the effects of air drying, soil sampling, storage conditions and temperature, pH, time of incubation, and substrate concentration on the urease activity. Results showed that best conditions for soil sample storage after air-drying for a 7-day period were at room temperature or at a temperature of 5 ºC. For the studied conditions the best incubation time was one hour at 25-30 ºC, without pH buffering. The ideal urea concentration suggested for the detection of the maximum velocity was 3.3 g L-1 for the typic alumino-ferric Red Latossol and 2.5 g L-1 for the typic distrophic Red Latosol.
Pesteil Philippe, L’émotion identitaire en Corse. Un territoire au cœurParis, L’Harmattan, 2010
Directory of Open Access Journals (Sweden)
Gilles Ferréol
2012-06-01
Full Text Available Spécialiste des dynamiques identitaires, des mutations sociales et de l’alimentation, Philippe Pesteil se propose, dans ce volume, de questionner les modes d’appréhension et d’expression du territoire corse à partir d’un fil conducteur original et pertinent : l’emploi de la métaphore “au cœur de”. Prenant appui sur un corpus de quatre-vingt articles parus dans Corse-matin, l’auteur – s’inscrivant sans une optique socio-anthropologique – replace la réalité insulaire dans le cadre de représenta...
Soares, Victor Dias Maia; Universidade do Estado do Rio de Janeiro / Universidade de Coimbra
2017-01-01
Este trabalho tem como objetivo principal promover o diálogo entre Paul Ricœur e Jacques Derrida no que concerne às abordagens que estes dois autores fazem da noção de perdão. A partir disso, discute-se primeiramente a ideia do perdão difícil em Ricœur e, num segundo momento, aquela do perdão im-possível em Derrida. Ainda que falem a partir de posições de fala diferentes, segundo idiomas filosóficos distintos, sustenta-se que a confrontação de ambas as perspectivas nos dá a pensar o perdão de...
Kim, Dong-Young; Jung, Jung-A; Kim, Tae-Ho; Seo, Sang-Wan; Jung, Sung-Ki; Park, Cheung-Seog
2009-04-21
Uncariae rhynchophylla (UR) is an herb which has blood pressure lowering and anti-inflammatory effects and has been prescribed traditionally to treat stroke and vascular dementia. In the present study, we examined whether UR suppress Atopic dermatitis (AD)-like skin lesions in NC/Nga mice treated with 2, 4-dinitrofluorobenzene (DNFB) under SPF conditions. The effect of UR in DNFB- treated NC/Nga mice was determined by measuring the skin symptom severity, levels of serum IgE, and of the amounts of IL-4 and IFN-gamma secreted by activated T cells in draining lymph nodes. Oral administration of UR to DNFB-treated NC/Nga mice was found to inhibit ear thickness increases and the skin lesions induced by DNFB. IFN-gamma production by CD4+ T cells from the lymph nodes of DNFB-treated NC/Nga mice was significantly inhibited by UR treatment, although levels of IL-4 and total IgE in serum were not. UR may suppress the development of AD-like dermatitis in DNFB-treated NC/Nga mice by reducing IFN-gamma production.
Malmqvist, Hanna
2015-01-01
Syftet med denna studie är att se hur några bilderböcker utmanar de stereotypa könsrollerna. Jag kommer att granska hur pojkar och flickor framställs ur ett genusperspektiv och även titta på hur text och bild kompletterar varandra, med hjälp av Nikolajevas (2000) analysmodell för bilderböcker. Jag har valt att analysera tre stycken böcker och två av dessa har pojkar som huvudkaraktärer och en har en flicka som huvudkaraktär. Med den medvetenhet man har idag kring genus så kan dessa böcker var...
International Nuclear Information System (INIS)
Lee, Kwang Suk; Song, Kee Dong; Ham, Chul Hoon; Kim, Seung Soo; Koh, Han Suk
1994-08-01
The purpose of this study is to analyze the impact of such changes in the rules of the game on the Korean nuclear industry and to propose possible countermeasures in short-term and long-term perspectives at the national level. This study also has an educational purpose to help people. working in the nuclear field understand the significance of the changes in the rules of the game. This study looks through the history and contents of the GATT system, the UR, the AGP, and the post-UR movement, providing some insight on the current trend in the rules of the game. Also this study analyzes the impact of the changes in the rules of the game on the Korean nuclear industry in qualitative terms, and proposes possible short-term and long-term countermeasures at the national level in both perspectives of utility and nuclear industry. 5 figs, 15 tabs, 51 refs. (Author)
Energy Technology Data Exchange (ETDEWEB)
Lee, Kwang Suk; Song, Kee Dong; Ham, Chul Hoon; Kim, Seung Soo; Koh, Han Suk [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)
1994-08-01
The purpose of this study is to analyze the impact of such changes in the rules of the game on the Korean nuclear industry and to propose possible countermeasures in short-term and long-term perspectives at the national level. This study also has an educational purpose to help people. working in the nuclear field understand the significance of the changes in the rules of the game. This study looks through the history and contents of the GATT system, the UR, the AGP, and the post-UR movement, providing some insight on the current trend in the rules of the game. Also this study analyzes the impact of the changes in the rules of the game on the Korean nuclear industry in qualitative terms, and proposes possible short-term and long-term countermeasures at the national level in both perspectives of utility and nuclear industry. 5 figs, 15 tabs, 51 refs. (Author).
Participación de la respuesta inflamatoria en el desarrollo del Síndrome Urémico hemolítico
Fernández, Gabriela C.
2002-01-01
La forma típica del síndrome urémico hemolítico (D+SUH) es una microangiopatía trombótica caracterizada por anemia hemolítica con fragmentación de eritrocitos, trombocitopenia con agotamiento de la función plaquetaria y daño renal agudo. Esta enfermedad es la principal causa de daño renal en la población pediátrica y nuestro país presenta la mayor incidencia del mundo. Si bien la mortalidad es baja debido a las terapias de soporte empleadas en el tratamiento de los síntomas, existe una alta p...
Directory of Open Access Journals (Sweden)
Pierre-Olivier Monteil
2017-07-01
Full Text Available This study undertakes a reading of Etienne de La Boétie’s Discours de la servitude volontaire, endeavoring to bring to light the way it convergences with and diverges from the political thought of Paul Ricœur, around the central concept of the will. On the basis of the twin notions of “denaturation” and of “pathology,” a course unfolds which aims at helping establish the people, in comparison with the institution of the State, through a political process revitalised by friendship. But the two thinkers differ when it comes to the resources of the will. This is reflected in the notion of freedom, conceived as absolute in La Boetie, while Ricœur emphasizes its contingency, which leads him to thematize it in terms of capabilities.
The Ouro Negro common bean cultivar contains the Co-34/Phg-3 gene cluster that confers resistance to the anthracnose (ANT) and angular leaf spot (ALS) pathogens. These genes are tightly linked on chromosome 4. Ouro Negro also has the Ur-14 rust resistance gene, reportedly in the vicinity of Co- 34; ...
Directory of Open Access Journals (Sweden)
Marcelo de Andrade Ferreira
2009-01-01
Full Text Available Cinco vacas da raça Holandesa foram distribuídas em um quadrado latino 5 × 5 com o objetivo de estimar a produção de proteína microbiana utilizando-se a excreção total de derivados de purinas (DP, por meio de coletas spot de urina, e as concentrações de nitrogênio (N-uréia no plasma, no leite e na urina. As cinco dietas foram formuladas com diversos volumosos (bagaço de cana-de-açúcar; feno de capim-tifton; feno de capim-elefante; silagem de sorgo; e uma mistura de silagem de sorgo + bagaço de cana associados à palma forrageira. As concentrações de uréia (10,98 mg/dL e N-uréia (5,11 mg/dL no leite não foram afetadas pelos volumosos, assim como as concentrações plasmáticas de uréia (28,10 mg/dL e N-uréia (13,09 mg/dL. As excreções urinárias de uréia, N-uréia, alantoína e derivados de purina, purinas absorvidas, a síntese de N-microbiano e as concentrações de alantoína no leite não foram alteradas. Os volumosos utilizados podem ser associados a palma forrageira na alimentação de vacas Holandesas, pois não alteram a produção de proteína microbiana.Five Holstein cows were allotted to a 5 × 5 Latin square design with the objective of evaluating the microbial protein production, using the total excretion of purine derivatives (PD, obtained from spot urine collection, plasma and milk urea and nitrogen (N-urea. The five treatments contained different forage sources: sugar cane bagasse (CB, tifton hay (TH, elephant grass hay (EH, sorghum silage (SS and a mixture of sugar cane bagasse + sorghum silage (CBSS. The milk urea (10.98 mg/dL and N-urea (5.11 mg/dL concentrations were not influenced by the forage sources, such as plasma urea (28.10 mg/dL and N-urea (13.09 mg/dL concentrations. The urinary urea, N-urea, allantoin and PD excretions, the absorbed purine, N-microbial synthesis and milk allantoin concentration remained unchanged. The different forage sources in association with forage cactus did not change
Hsieh, C L; Chen, M F; Li, T C; Li, S C; Tang, N Y; Hsieh, C T; Pon, C Z; Lin, J G
1999-01-01
This study investigated the anticonvulsant effect of Uncaria rhynchophylla (UR) and the physiological mechanisms of its action in rats. A total of 70 male Sprague-Dawley (SD) rats were selected for study. Thirty four of these rats were divided into 5 groups as follows: 1) CONTROL GROUP (n = 6): received intraperitoneal injection (i.p.) of kainic acid (KA, 12 mg/kg); 2) UR1000 group (n = 10), 3) UR500 group (n = 6) 4) UR250 group, received UR 1000, 500, 250 mg/kg i.p. 30 min prior to KA administration, respectively; 5) Contrast group: received carbamazepine 20 mg/kg i.p. 30 min prior to KA administration. Behavior and EEG were monitored from 15 min prior to drug administration to 3 hours after KA administration. The number of wet dog shakes were counted at 10 min intervals throughout the experimental course. The remaining 36 rats were used to measure the lipid peroxide level in the cerebral cortex one hour after KA administration. These rats were divided into 6 groups of 6 rats as follows: 1) Normal group: no treatment was given; 2) CONTROL GROUP: received KA (12 mg/kg) i.p.; 3) UR1000 group, 4) UR500 group, 5) UR250 group, received UR 1000, 500, 250 mg/kg i.p. 30 min prior to KA administration, respectively; 6) Contrast group: received carbamazepine 20 mg/kg i.p. 30 min prior to KA administration. Our results indicated that both UR 1000 and 500 mg/kg decreased the incidence of KA-induced wet dog shakes, no similar effect was observed in the UR 250 mg/kg and carbamazepine 20 mg/kg group. Treatment with UR 1000 mg/kg, 500 mg/kg, or 250 mg/kg and carbamazepine 20 mg/kg decreased KA-induced lipid peroxide level in the cerebral cortex and was dose-dependent. These findings suggest that the anticonvulsant effect of UR possibly results from its suppressive effect on lipid peroxidation in the brain.
Une lecture de Eine Übertragung de Wolfgang Hilbig à la lumière de Paul Ricœur.
Directory of Open Access Journals (Sweden)
Bénédicte Terrisse
2009-12-01
Full Text Available L’objet de cette étude est de comprendre le roman de Wolfgang Hilbig (1941-2007 Eine Übertragung (1989 à partir de La Métaphore vive de Ricœur et de l’analyse des différents sens du titre du roman (métaphore, transfert, transposition. L’esthétique métaphorique, qui rappelle en de nombreux points l’esthétique mallarméenne, permet à l’auteur de réinterpréter et redécrire la réalité est-allemande en même temps que sa propre biographie. Par le recours au mythe et à l’intertextualité, ces dernières sont assimilées à la modernité esthétique, si bien que la RDA devient le territoire de la littérature moderne. Par la métaphore, Hilbig se réapproprie une réalité définie jusqu’alors par un pouvoir discrétionnaire.Ziel dieses Textes ist es, den Roman Eine Übertragung (1989 von Wolfgang Hilbig (1941-2007 mit Hilfe von Ricœurs La Métaphore vive sowie der Analyse der verschiedenen Titelbedeutungen (als Metapher, Übertragung oder Übersetzung zu verstehen. Diese Ästhetik der Metapher, die in mancher Hinsicht an die Mallarmésche erinnert, ermöglicht es dem Autor, zugleich die Realität der DDR und seine eigene Biographie neu zu interpretieren und zu beschreiben. Durch Rekurs auf Mythos und Intertextualität werden sie der ästhetischen Moderne gleichgesetzt, sodass die DDR zum Ort der Literatur der Moderne wird. Auf diese Weise gelingt es Hilbig, sich eine bis dahin von der politischen Macht dekretierte Wirklichkeit wieder anzueignen.
Directory of Open Access Journals (Sweden)
Maria Aparecida Moreira
2007-12-01
Full Text Available Objetivou-se estudar a viabilidade da substituição parcial ou total do nitrato de amônio por uréia como fonte de nitrogênio no meio de cultura para o cultivo in vitro do abacaxizeiro cv. Pérola. Plantas oriundas das gemas da coroa do fruto com massa fresca em torno de 80 mg foram inoculadas em meio MS (líquido e sólido substituindo-se 100, 80, 60, 40, 20 e 0% do nitrato de amônio por uréia. O delineamento experimental utilizado foi o inteiramente casualizado, com quatro repetições e três plantas/repetição. Após 60 dias,observou-se a possibilidade da substituição parcial de 40% de nitrato de amônio por uréia para as variáveis analisadas e melhor desenvolvimento das plantas em meio de cultura sólido.The partial or total substitution viability of the ammonium nitrate for urea, as source of nitrogen in the culture medium for the in vitro culture of pineapple cv. Pérola was studied. Plants originating from fruit crown buds with fresh weight matter around 80 mg was inoculated on MS medium (liquid and solid with substitution of 100, 80, 60, 40, 20 and 0% of the ammonium nitrate for urea. These treatments were arranged in a completely randomized design, with four replications and three plants/replications. After 60 days, thepossibility of 40% ammonium nitrate for urea partial substitution was observed for the analyzed variables. In addition, better plant development in solid culture medium was observed as well.
Directory of Open Access Journals (Sweden)
L.C.V. Ítavo
2008-04-01
Full Text Available Avaliou-se o efeito da suplementação protéica (40% PB com amiréia ou uréia sobre o consumo de suplemento, desempenho e características econômicas de novilhos terminados em pastagens. Foram utilizados 120 novilhos com 19 meses de idade e 358kg, sendo 60 Nelore e 60 F1 Brangus x Nelore, divididos em três tratamentos com 20 animais, alojados em piquetes de Brachiaria brizantha cv. Marandu de 10 hectares cada, totalizando 120 hectares, sendo dois piquetes por grupo genético e tratamento, pastejados alternadamente a cada pesagem (42 dias. Os tratamentos consistiram em mistura mineral com amiréia-150S (AM, mistura mineral com uréia+milho+enxofre (UR e mistura mineral (MM. As médias de consumo de suplemento dos animais F1 foram de 206,1; 145,9 e 73,1g/dia, e as dos animais Nelore, 236,0; 205,1 e 94,3g/dia para os tratamentos AM, UR e MM, respectivamente. Para os novilhos Nelore, houve efeito (PThe effects of protein supplementation of finishing grazing steers by feeding nitrogenous salts (40% CP, urea or starea or mineralized salt only on supplement intake, growing performance and profitability were evaluated. One hundred and twenty steers (60 Nellore and 60 Brangus x Nellore, 19-month old, 358kg BW were divided in 12 equal groups which were allotted to one of 12 Brachiaria brizantha pastures (10-ha each performing two pastures for each breeding group and nutritional treatment. Groups were allowed to graze each pasture for 42 days when they were randomly moved into a new one. Nutritional treatments were as follow: MS - mineralized salt only; ST -mineralized salt plus starea - 150S; and UR - mineralized salt plus urea, corn and sulphur. UR supplement was prepared mixing the same ingredient contents of ST. Crossbred steers consumed 206.1; 145.9 and 73.1g/day whereas Nellore steers consumed 236.0; 205.11 and 94.29g/day of ST, UR and MS; respectively. For Nellore steers, UR increased slaughter weight (518.8kg compared to ST and MS (491.9 and
Optical band gap energy and ur bach tail of CdS:Pb2+ thin films
Energy Technology Data Exchange (ETDEWEB)
Chavez, M.; Juarez, H.; Pacio, M. [Universidad Autonoma de Puebla, Instituto de Ciencias, Centro de Investigacion en Dispositivos Semiconductores, Av. 14 Sur, Col. Jardines de San Manuel, Ciudad Universitaria, Puebla, Pue. (Mexico); Gutierrez, R.; Chaltel, L.; Zamora, M.; Portillo, O. [Universidad Autonoma de Puebla, Facultad de Ciencias Quimicas, Laboratorio de Materiales, Apdo. Postal 1067, 72001 Puebla, Pue. (Mexico); Mathew, X., E-mail: osporti@yahoo.mx [UNAM, Instituto de Energias Renovables, Temixco, Morelos (Mexico)
2016-11-01
Pb S-doped CdS nano materials were successfully synthesized using chemical bath. Transmittance measurements were used to estimate the optical band gap energy. Tailing in the band gap was observed and found to obey Ur bach rule. The diffraction X-ray show that the size of crystallites is in the ∼33 nm to 12 nm range. The peaks belonging to primary phase are identified at 2θ = 26.5 degrees Celsius and 2θ = 26.00 degrees Celsius corresponding to CdS and Pb S respectively. Thus, a shift in maximum intensity peak from 2θ = 26.4 to 28.2 degrees Celsius is clear indication of possible transformation of cubic to hexagonal phase. Also peaks at 2θ = 13.57, 15.9 degrees Celsius correspond to lead perchlorate thiourea. The effects on films thickness and substrate doping on the band gap energy and the width on tail were investigated. Increasing doping give rise to a shift in optical absorption edge ∼0.4 eV. (Author)
Directory of Open Access Journals (Sweden)
A. Moataz
2017-12-01
Conclusions: Les lésions urétérales post-traumatiques non diagnostiquées à temps sont corrélées à une morbidité et une mortalité élevée. Un index de suspicion élevé permettrait un diagnostic rapide et une prise en charge à temps.
Síndrome hemolítico-urêmica esporádica pós-parto Sporadic postpartum hemolytic uremic syndrome
Directory of Open Access Journals (Sweden)
Elza M. Moreira
2008-08-01
Full Text Available Anemia hemolítica microangiopática associado à trombocitopenia participa de um grupo de doenças que freqüentemente apresentam suas características clínicas muito semelhantes, sendo difícil distingui-las. A síndrome hemolítico-urêmica é dividida em duas apresentações: a forma não esporádica, que acomete comumente crianças após infecção bacteriana causando diarréia sanguinolenta, possui bom prognóstico; e a forma esporádica, que acomete adultos, sendo bem descritos casos em mulheres pósparto, é a forma sistêmica de trombocitopenia microangiopática de pior prognóstico com alta morbidade e mortalidade, cuja falência renal é o distúrbio predominante. Relatamos um caso de síndrome hemolítico-urêmica pós-parto em paciente previamente sadia, que apresentou quadro de insuficiência renal, anemia hemolítica e trombocitopenia. Instituída a terapêutica de suporte adequada e precocemente, a paciente evoluiu satisfatoriamente com normalização dos níveis pressóricos e recuperação da função renal.Microangiopathic hemolytic associated with thrombocytopenia is part of a disease group that frequently show likeness and that's why become difficult to separate them. There are two types of hemolytic uremic syndrome (HUS; the non sporadic type and the epidemic or "typical" type that is common on childreen that is associated with diarrhea and infection caused by verotoxinaproducing E. coli with a good prognostic; and the sporadic postpartum period. It is the systemic type of mocroangiophatic thrombocytopenia of poor prognostic with high morbidity and mortality which renal failure is the main disturb. We reported a case of HUS occuring in postpartum previously healthy, that showed abrupt renal failure, hemolytic anemia and thrombocytopenia. After proper therapy the patient developed a normal blood pressure and recovery renal function.
Directory of Open Access Journals (Sweden)
Labant Slavomír
2013-03-01
Full Text Available V súčasnej geodetickej praxi je nevyhnutnosťou používať moderné geodetické prístroje a rôzne CAD (Computer Aided Design softvéry pre proces spracovania a vizualizácie priestorových údajov. Tento príspevok sa zaoberá geodetickým zameraním povrchového lomu Kecerovce za účelom určenia objemu nevyťažených zásob andezitu pre znovu otvorenie lomu a začatie ťažby andezitu. Predmetný lom je situovaný na upätí Slanských vrchov. Určenie pomocných geodetických bodov a okolia lomu sa vykonalo technológiou GNSS RTK metódou. Podrobné zameranie lomu bolo realizované univerzálnou meracou stanicou. Priestorové údaje získané z meraní sa spracovali v príslušných firemných softvéroch. Následne získané priestorové súradnice boli importované do graficko-vypočtových softvérov pre ďalšie spracovanie a vizualizáciu. Tieto graficko-výpočtové softvéry ponúkajú okrem 3D modelovania povrchov a vizualizácie aj ich analýzu, najmä určenie objemových údajov reprezentujúcich rôzne aspekty pre posudzovanie činností v daných odvetviach s možným ďalším rozvojom.
Directory of Open Access Journals (Sweden)
Francisco Mendoza Duarte
2007-06-01
Full Text Available A primeira adubação nitrogenada em cobertura para o arroz irrigado por alagamento pode ser realizada em solo seco ou em lâmina de água, afetando a taxa de volatilização de amônia e, conseqüentemente, a eficiência da adubação nitrogenada. O objetivo deste trabalho foi avaliar as perdas de N por volatilização de amônia com a aplicação de uréia em solo de várzea com diferentes níveis de umidade. O experimento foi conduzido em casa-de-vegetação, utilizando-se vasos contendo 5kg de um Planossolo Hidromórfico que recebeu os tratamentos: N0 - testemunha sem aplicação de uréia (solo úmido; USSE - aplicação de uréia em solo seco; USUM - aplicação de uréia em solo úmido; USSA - aplicação de uréia em solo saturado; e USLA - aplicação de uréia em solo com lâmina de água. As avaliações das perdas de amônia foram realizadas com coletores tipo semi-aberto estático após 10, 24, 34, 48, 72, 96, 144, 192 e 264 horas da aplicação de uréia. Ao final das 264 horas de avaliação, as perdas de amônia foram equivalentes para os tratamentos com aplicação em solo úmido, saturado ou sob lâmina de água, sendo os maiores picos de emissão de amônia entre 34 e 48 horas para o solo úmido e o saturado e 72 horas para a lâmina de água. A aplicação de N-uréia sobre a lâmina de água não evitou as perdas de N por volatilização de amônia.The first topdressing nitrogen (N application to flooded rice can be done on dry soil or soil after ponding water, affecting ammonia volatilization rate and, consequently, nitrogen fertilization efficiency. This study was aimed at quantifing N losses by ammonia volatilization after urea application in a wetland soil with different soil water status. The experiment was carried out in a greenhouse, using 5kg pots with a Albaqualf with following treatments: N0 - control without urea application (wet soil; USSE - urea application on dry soil; USUM - urea application on wet soil; USSA
Energy Technology Data Exchange (ETDEWEB)
Lynn Kidman
2009-02-01
This document constitutes an addendum to the September 1998, Closure Report for Corrective Action Unit 404: Roller Coaster Lagoons and Trench, Tonopah Test Range, Nevada as described in the document Recommendations and Justifications for Modifications for Use Restrictions Established under the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office Federal Facility Agreement and Consent Order (UR Modification document) dated February 2008. The UR Modification document was approved by NDEP on February 26, 2008. The approval of the UR Modification document constituted approval of each of the recommended UR modifications. In conformance with the UR Modification document, this addendum consists of: • This cover page that refers the reader to the UR Modification document for additional information • The cover and signature pages of the UR Modification document • The NDEP approval letter • The corresponding section of the UR Modification document This addendum provides the documentation justifying the modification of the UR for CAS TA-03-001-TARC Roller Coaster Lagoons. This UR was established as part of Federal Facility Agreement and Consent Order (FFACO) corrective actions and was based on the presence of contaminants at concentrations greater than the action levels established at the time of the initial investigation (FFACO, 1996; as amended August 2006). Since this UR was established, practices and procedures relating to the implementation of risk-based corrective actions (RBCA) have changed. Therefore, this UR was re-evaluated against the current RBCA criteria as defined in the Industrial Sites Project Establishment of Final Action Levels (NNSA/NSO, 2006c). This reevaluation consisted of comparing the original data (used to define the need for the UR) to risk-based final action levels (FALs) developed using the current Industrial Sites RBCA process. The re-evaluation resulted in a recommendation to modify the UR for CAS TA-03
Síndrome hemolítico-urêmica causada por gencitabina em uma paciente jovem com colangiocarcinoma
Directory of Open Access Journals (Sweden)
John Fredy Nieto-Ríos
2016-06-01
Full Text Available Resumo A gencitabina é um fármaco utilizado no tratamento de vários tipos de neoplasias malignas. Há poucas descrições de associação entre a droga e a síndrome hemolítico-urêmica (SHU, apesar de os pacientes em questão terem ido a óbito em pelo menos 50% dos casos. O presente artigo relata o caso de uma paciente com 25 anos de idade em remissão diagnosticada com colangiocarcinoma que apresentou anemia hemolítica microangiopática acompanhada de insuficiência renal aguda anúrica após cinco ciclos de quimioterapia com gencitabina; as manifestações eram condizentes com SHU causada pelos efeitos colaterais do medicamento. A administração de gencitabina foi interrompida, e a paciente foi tratada com hemodiálise, transfusões de sangue, trocas de plasma, corticosteroides, doxiciclina e rituximabe. Foi atingido um desfecho favorável; mais especificamente, a hemólise foi controlada e a função renal foi plenamente restabelecida.
Métaphores, paraboles et analogie: La référence à la théologie dans la pensée de Paul Ricœur
Directory of Open Access Journals (Sweden)
Gilbert Vincent
2012-12-01
Full Text Available Il est admis que l’étude de la métaphore représente une inflexion décisive dans l’herméneutique de Ricœur. On sait peut-être moins que cette étude est concomitante de celle de la parabole, qui représente une inflexion également notable dans la contribution ricœurienne à l’herméneutique biblique. Il arrive pourtant qu’on tire argument de cette concomitance pour prétendre que le transfert de certains présupposés théologiques (quant à la nature du langage et de la Vérité s’en trouve facilité, et l’on ne craint pas d’avancer que les pages consacrées à l’analogia entis, dans La métaphore vive, prouvent la prégnance d’intérêts théologiques douteux dans l’élaboration de la théorie de la métaphore. Pour contrer cette critique dévastatrice, nous nous appuierons sur certaines analyses d’Umberto Eco, qui impliquent que la question des rapports entre analogia entis et métaphore n’a rien d’épistémologiquement scandaleux, et sur celles d’Alain qui, voici un siècle, a esquissé une interprétation des paraboles très proche de celle de Ricœur.
International Nuclear Information System (INIS)
Lynn Kidman
2008-01-01
This document is part of an effort to re-evaluate all FFACO URs against the current RBCA criteria (referred to in this document as the Industrial Sites [IS] RBCA process) as defined in the Industrial Sites Project Establishment of Final Action Levels (NNSA/NSO, 2006c). Based on this evaluation, the URs were sorted into the following categories: (1) Where sufficient information exists to determine that the current UR is consistent with the RCBA criteria; (2) Where sufficient information exists to determine that the current UR may be removed or downgraded based on RCBA criteria; (3) Where sufficient information does not exist to evaluate the current UR against the RCBA criteria. After reviewing all the existing FFACO URs, the 49 URs addressed in this document have sufficient information to determine that these current URs may be removed or downgraded based on RCBA criteria. This document presents recommendations on modifications to existing URs that will be consistent with the RCBA criteria
Hsieh, C L; Tang, N Y; Chiang, S Y; Hsieh, C T; Lin, J G
1999-01-01
Uncaria rhynchophylla (Miq.) Jack (UR) and Gastrodia elata BI. (GE) are traditional Chinese herbs that are usually used in combination to treat convulsive disorders, such as epilepsy, in China. The aim of this study was to compare the anticonvulsive and free radical scavenging activities of UR alone and UR in combination with GE in rats. For the in vitro studies, brain tissues from 6 male Sprague-Dawley (SD) rats were treated with 120 microg/ml kainic acid (KA), with or without varied concentrations of UR or UR plus GE. For the in vivo studies, male SD rats (6 per group) received intraperitoneal (i.p.) injection of KA 12 mg/kg to induce epileptic seizures and generation of free radicals, with or without oral administration of UR 1 g/kg alone or UR 1 g/kg plus GE 1 g/kg. Epileptic seizures were verified by behavioral observations, and electroencephalography (EEG) and electromyography (EMG) recordings. These results showed that UR alone decreased KA-induced lipid peroxide levels in vitro, whereas UR plus GE did not produce a greater effect than UR alone. UR significantly reduced counts of wet dog shakes (WDS), paw tremor (PT) and facial myoclonia (FM) in KA-treated rats and significantly delayed the onset time of WDS, from 27 min in the control group to 40 min in the UR group. UR plus GE did not inhibit seizures more effectively than UR alone, but did further prolong the onset time of WDS to 63 min (P < 0.05 vs. UR alone). UR alone reduced the levels of free radicals in vivo, as measured by lipid peroxidation in the brain and luminol-chemiluminescence (CL) counts and lucigenin-CL counts in the peripheral whole blood, but the combination of GE and UR did not reduce free radical levels more markedly than UR alone. In conclusion, our results indicate that UR has anticonvulsive and free radical scavenging activities, and UR combined with GE exhibit greater inhibition on the onset time of WDS than UR alone. These findings suggest that the anticonvulsive effects of UR and
Directory of Open Access Journals (Sweden)
Pablo Leal Teixeira de Oliveira
2010-10-01
Full Text Available The objective of present trial was to evaluate the intake of supplement dry matter, productive performance, carcass traits, and weight and yields of commercial meat cuts of lambs grazing on dormant buffelgrass pastures and receiving multiple supplementation containing different urea levels. Urea levels used were: 5, 8, 11 and 14% on dry matter. Thirty-six male lambs were used, nine animals per treatment, with 18.0 �� 2.0 kg initial body weight, distributed into four groups. The experimental design was completely randomized with nine replications. Urea levels in supplement did not influence productive performance, cold and hot carcass weight and yield and commercial meat cuts weight and yield (leg, shoulder, rib and brisket. Use of multiple supplements containing 11 and 14% of urea levels for lambs in dormant grazing pastures during the dry season may increase bioeconomic performance of this activity, as they promoted lower supplement intake and similar productive performance.O objetivo do presente estudo foi avaliar o consumo de matéria seca de suplemento, o desempenho produtivo, os parâmetros de carcaça e os rendimentos de cortes cárneos comerciais de cordeiros mantidos em pastos diferidos de capim-búffel recebendo suplementos múltiplos com diferentes teores de uréia. Foram utilizados quatro teores de uréia, sendo 5, 8, 11 e 14% na matéria seca. Foram utilizados 36 cordeiros machos, nove animais por tratamento, com peso corporal inicial médio de 18,0 ± 2,0 kg, distribuídos em quatro grupos. O delineamento experimental adotado foi o inteiramente casualizado com nove repetições. Os teores de uréia no concentrado não influenciaram os ganhos médios diários, os ganhos de peso totais, os pesos corporais finais, os pesos e os rendimentos de carcaça quente e fria e os pesos e rendimentos de cortes cárneos comerciais (pernil, paleta, costela e carré. O fornecimento de suplementos múltiplos contendo 11 e 14% deuréia para ovinos
Directory of Open Access Journals (Sweden)
Ruimário Inácio Coelho
2007-04-01
Full Text Available Mudas do abacaxizeiro (Ananas comosus L., cultivar Smooth Cayenne, obtidas por seccionamento de caule, foram submetidas à adubação foliar com soluções em diferentes concentrações de uréia, KCl e H3BO3. O delineamento utilizado foi fatorial fracionado do tipo (1/55³, com três tipos de adubo e cinco concentrações, num total de 25 tratamentos, que consistiram de combinações de concentrações de 0; 2,5; 5,0; 7,5 e 10 g L-1 de uréia e KCl, e 0; 0,5; 1,0; 1,5 e 2,0 g L-1 de H3BO3. Os tratamentos foram iniciados nove semanas após o plantio das seções do caule, com 26 pulverizações semanais para a uréia e KCl e 4 pulverizações mensais para o H3BO3. Verificou-se crescimento linear positivo para as características: altura das brotações, número de folhas, área foliar, massa seca e fresca das mudas, em resposta a níveis crescentes de uréia. Não foi observado efeito do KCl e H3BO3 para nenhuma das características de crescimento avaliadas. As mudas adubadas com 10 g L-1 de uréia atingiram altura de 40 cm e massa fresca de 242 g no 9º mês após o plantio das seções.Suckers of the pineapple plant (Ananas comosus L., Smooth Cayenne cv., obtained by stem sectioning, were submitted to leaf fertilization with solutions at different concentrations of urea, KCl and H3BO3. The fractionated factorial design of the type (1/55³ was used, with three fertilizer types and five concentrations, totalizing 25 treatments that consisted of combination of concentrations (0; 2.5; 5.0; 7.5 and 10 g L-1 of urea and KCl, as well as 0; 0.5; 1.0; 1.5 and 2.0 g L-1 of H3BO3. The treatments began nine weeks after planting the stem sections. Twenty six sprays of urea and KCl were weekly applied as well as four monthly sprays of H3BO3. Positive linear growth was verified for the following characteristics: sprouting heights, leaf numbers, leaf area, dry and fresh matter of the suckers in response to increasing urea levels. No effect of KCl and H3BO3
Quinlan, Scott C; Cheng, Wendy Y; Ishihara, Lianna; Irizarry, Michael C; Holick, Crystal N; Duh, Mei Sheng
2016-04-01
The aim of this study was to develop and validate an insurance claims-based algorithm for identifying urinary retention (UR) in epilepsy patients receiving antiepileptic drugs to facilitate safety monitoring. Data from the HealthCore Integrated Research Database(SM) in 2008-2011 (retrospective) and 2012-2013 (prospective) were used to identify epilepsy patients with UR. During the retrospective phase, three algorithms identified potential UR: (i) UR diagnosis code with a catheterization procedure code; (ii) UR diagnosis code alone; or (iii) diagnosis with UR-related symptoms. Medical records for 50 randomly selected patients satisfying ≥1 algorithm were reviewed by urologists to ascertain UR status. Positive predictive value (PPV) and 95% confidence intervals (CI) were calculated for the three component algorithms and the overall algorithm (defined as satisfying ≥1 component algorithms). Algorithms were refined using urologist review notes. In the prospective phase, the UR algorithm was refined using medical records for an additional 150 cases. In the retrospective phase, the PPV of the overall algorithm was 72.0% (95%CI: 57.5-83.8%). Algorithm 3 performed poorly and was dropped. Algorithm 1 was unchanged; urinary incontinence and cystitis were added as exclusionary diagnoses to Algorithm 2. The PPV for the modified overall algorithm was 89.2% (74.6-97.0%). In the prospective phase, the PPV for the modified overall algorithm was 76.0% (68.4-82.6%). Upon adding overactive bladder, nocturia and urinary frequency as exclusionary diagnoses, the PPV for the final overall algorithm was 81.9% (73.7-88.4%). The current UR algorithm yielded a PPV > 80% and could be used for more accurate identification of UR among epilepsy patients in a large claims database. Copyright © 2016 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
Kovanič Ľudovít
2013-09-01
Full Text Available V príspevku sú prezentované výsledky geodetického merania a spracovania údajov na určenie geometrických parametrov výťahovej šachty použitím klasických a tiež moderných prístupov získavania meraných dát. Zámerom je overenie možnosti využitia terestrického laserového skenovania ako vhodnej, efektívnej a detailnej metódy pre zber priestorových údajov.
Modelling the carbonation of cementitious matrixes by means of the unreacted-core model, UR-CORE
International Nuclear Information System (INIS)
Castellote, M.; Andrade, C.
2008-01-01
This paper presents a model for the carbonation of cementitious matrixes (UR-CORE). The model is based on the principles of the 'unreacted-core' systems, typical of chemical engineering processes, in which the reacted product remains in the solid as a layer of inert ash, adapted for the specific case of carbonation. Development of the model has been undertaken in three steps: 1) Establishment of the controlling step in the global carbonation rate, by using data of fractional conversion of different phases of the cementitious matrixes, obtained by the authors through neutron diffraction data experiments, and reported in [M. Castellote, C. Andrade, X. Turrillas, J. Campo, G. Cuello, Accelerated carbonation of cement pastes in situ monitored by neutron diffraction, Cem. Concr. Res. (2008), doi:10.1016/j.cemconres.2008.07.002]. 2) Then, the model has been adapted and applied to the cementitious materials using different concentrations of CO 2 , with the introduction of the needed assumptions and factors. 3) Finally, the model has been validated with laboratory data at different concentrations (taken from literature) and for long term natural exposure of concretes. As a result, the model seems to be reliable enough to be applied to cementitious materials, being able to extrapolate the results from accelerated tests in any conditions to predict the rate of carbonation in natural exposure, being restricted, at present stage, to conditions with a constant relative humidity
Directory of Open Access Journals (Sweden)
Fernanda Henriques
2013-06-01
Full Text Available This paper explores the thought of Paul Ricœur from a feminist point of view. My goal is to show that it is necessary to narrate differently the history of our culture – in particular, the history of philosophy – in order for wommen to attain a self-representation that is equal to that of men. I seek to show that Ricoeur’s philosophy – especially his approach to the topics of memory and history, on the one hand, and the human capacity for initiative, on the other hand– can support the idea that it is possible and legitimate to tell our history otherwise by envisioning a more accurate truth about ourselves.
Hans Urs von Balthasar exégeta del Nuevo Testamento: Interpretación y acontecimiento de salvación
Directory of Open Access Journals (Sweden)
Andrés Ferrada
2009-01-01
Full Text Available Este artículo pretende iluminar el método exegético bíblico usado por Hans Urs von Balthasar en el estudio del Nuevo Testamento. Se siguen tres simples pasos argumentativos: Primero se describe el método recurriendo a definiciones y explicaciones del mismo autor a nivel más bien teórico. Luego se lo ilustra con un ejemplo de interpretación concreto: el comentario exegético y hermenéutico del de la petición de glorificación que Jesús hace a su Padre (Jn 17,1-5 en el volumen dedicado al Nuevo Testamento de la afamada obra Gloria (IV Parte, volumen 7 del teólogo suizo. Finalmente se recogen los principales aportes del método a la exégesis y a teología bíblica. Entre estos últimos cobra especial resonancia para las ciencias bíblicas la atención que Balthasar presta a la participación de los intérpretes en el acontecimiento de salvación. En efecto, solo quien vive el Misterio Pascual puede en último término comprenderlo y explicarlo convincentemente. En concreto, el creyente al hacer exégesis del NT y, luego, al reflexionar su contenido teológico, puede darle sentido preciso, pues él vive y posee su núcleo o centro.This article proposes to shed light upon the biblical exegetical method used by Hans Urs von Balthasar in his studies of the New Testament. Three simple argumentative steps are followed. First, the method is described by use of definitions and explanations of the author himself at a rather theoretical level. Then this is illustrated with an example of concrete interpretation: the exegetical and hermeneutic commentary on the petition for glorification that Jesus makes to his Father (Jn 17: 1-5 in the volume dedicated to the New Testament from the Swiss theologian´s famous work Glory of the Lord (Part IV, Volume seven. Finally, the principal contributions of his method to exegesis and biblical theology are treated. Among these latter, the attention Balthasar lends to the interpreters´ participation in the
Directory of Open Access Journals (Sweden)
Rafael Felippe Ratke
2011-06-01
Full Text Available Controlled-release nitrogen fertilizers enhance crop productivity and decrease nitrogen loss through volatilization and leaching. This study aimed at determining the effect of nitrogen treatments provided by controlled-release nitrogen fertilizers and urea. The following fertilizers were tested: 1 (agricultural urea, 2 (ammonium sulfonitrate + nitrification inhibitor, dimethylpyrazole phosphate (Entec 26®,3 (urea + Kimberlit polymer (Kimcoat N® and 4 (urea + NBPT (Super N - Agrotain®. Treatments corresponded to 0, 100, 200, 400 and 800 kg ha-1 of N with rocket salad grown inside a greenhouse, assessing the production of fresh and dry leaf mass as well as levels of foliar nitrogen. Doses of different controlled-release nitrogen fertilizers showed significant polynomial regressions for the production of rocket salad fresh leaf mass and levels of foliar nitrogen, whereby Entec 26® did not show significant polynomial regression, considering the last parameter evaluated. The production of rocket salad dry leaf mass did not display significant linear regressions. The maximal production of rocket salad fresh leaf mass was reached at doses of 600, 490, 765, and 462 kg ha-1 of N with the use of urea, Entec 26®, Kimcoat N® and Super N®, respectively.Os fertilizantes nitrogenados de liberação lenta aumentam a produtividade das culturas e diminuem as perdas de nitrogênio por volatilização e lixiviação. O objetivo deste trabalho foi determinar, no cultivo de rúcula, o efeito de doses de N fornecidas por fertilizantes nitrogenados de liberação lenta e pela uréia. Testaram-se os fertilizantes: 1 (uréia agrícola, 2 (sulfonitrato de amônio + inibidor de nitrificação Dimetil Pirazol Fosfato (Entec 26®,3 (uréia + polímero Kimberlit (kimcoat N® e 4 (uréia + NBPT (Super N - Agrotain®, e as doses de 0, 100, 200, 400 e 800 kg ha-1 de N em rúcula crescidas em casa de vegetação, avaliando-se a produtividade de matéria fresca de folhas
Directory of Open Access Journals (Sweden)
Agustín Ferrando
2011-06-01
Full Text Available The Estero de Urías coastal lagoon is subjected to several anthropogenic activities and has been characterized since 1997 through the study of benthic fauna. We analyzed the spatial and temporal distribution of annelids and their relationships with environmental variables (depth, sediment temperature, grain size and organic matter in order to determine the current degree of perturbation. Density, species richness, diversity, dominance, biomass, and the application of classification and ordination techniques allowed us to distinguish 5 zones: 1 a non-perturbed zone at the mouth of the lagoon, 2 a slightly perturbed zone surrounded by mangroves and shrimp farms, 3 a temporarily perturbed zone close to the effluent of the thermoelectric plant, 4 a perturbed zone in front of the slaughterhouse and fish factory, and 5 a very perturbed zone subjected to sewage and industrial input. Only minor changes in granulometry and faunal composition were observed in comparison with previous data from the same area, suggesting that the lagoon is still perturbed due to the effect of anthropogenic activities.
Directory of Open Access Journals (Sweden)
Veronaldo Souza de Oliveira
2007-08-01
Full Text Available O experimento foi conduzido com os objetivos de estimar a produção e a eficiência de síntese de proteína microbiana utilizando-se a excreção total de derivados de purinas (DP e avaliar as concentrações de uréia na urina, de uréia e N-uréia no plasma e no leite de vacas holandesas em lactação alimentadas com dietas formuladas com diferentes níveis (0; 12,0; 25,0; 38,0 e 51,0% de palma forrageira (Opuntia ficus indica Mill em substituição total ao milho (Zea mays L. e parcial ao feno de capim-tifton (Cynodon spp. Foram utilizadas cinco vacas holandesas distribuídas em um quadrado latino 5 x 5. Cada período experimental teve duração de 17 dias, dez para adaptação dos animais à dieta e sete para coleta de dados. O volume urinário foi estimado em amostras spot de urina obtidas 4 horas após a alimentação. O volume urinário (27,62 L, a excreção urinária de ácido úrico (35,78 mmol/dia, alantoína na urina (288,42 mmol/dia, alantoína no leite (18,11 mmol/dia e alantoína total (306,54 mmol/dia, a excreção de derivados de purina total (342,33 mmol/dia e de purinas absorvidas (350,03 mmol/dia, a síntese de proteína microbiana (1.376,07g/dia e a eficiência da síntese de proteína microbiana (115,38 g/kgNDTconsumido não foram afetados pela substituição do milho e do feno de tifton por palma na dieta. A excreção de uréia na urina (mg/kg PV e as concentrações de uréia e N-uréia no plasma (mg/dL decresceram de forma linear, enquanto a excreção e as concentrações de uréia e N-uréia no leite e de glicose plasmática não foram influenciadas pelos níveis de palma na dieta. O milho pode ser substituído integralmente e o feno, parcialmente, por palma forrageira em dietas para vacas holandesas em lactação, pois a substituição não afetou a produção de proteína microbiana ou as perdas do nitrogênio dietético pela excreção de uréia.The objective of this trial was to evaluate the effect of replacing
L. F. Sobral; M. L. S. Leal
1999-01-01
Foram realizados dois experimentos axiais no período de 1987 a 1992, visando estudar a resposta do coqueiro à adubação com uréia, superfosfato simples e cloreto de potássio em dois solos do nordeste do Brasil. Na Areia Quartzosa, houve resposta ao nitrogênio, para número de frutos. O nível crítico do nutriente na folha 14, de 17,18 g kg-1, foi atingido com a aplicação de 1,538 kg/plantaano-1 de N. No mesmo solo, o fósforo não influenciou a produção de frutos, enquanto o potássio a influenciou...
Hey Tow , Kenny; Besnard , Pascal; Brilland , Laurent; Toupin , Périne; Troles , Johann; Méchin , David; Trégoat , Denis
2011-01-01
National audience; Une étude expérimentale sur les propriétés de la rétrodiffusion Brillouin stimulée dans une fibre optique à cœur suspendu en verre de chalcogénure AsSe est présentée. Avec seulement un mètre de fibre, nous générons suffisamment de gain Brillouin pour obtenir un laser à fibre monomode de type Fabry-Perot. Nous démontrons aussi la génération du second ordre Brillouin dans ces fibres avec 0,5 W de pompe.
Directory of Open Access Journals (Sweden)
O. Neves
2010-01-01
Full Text Available Neste trabalho avalia-se e comparara-se a concentração e capacidade de bioconcentração (CB do urânio em diversas espécies vegetais (parte aérea que se desenvolveram em solos de escombreira (Pinus pinaster, Cytisus striatus, Cytisus multiflorus e cultivadas (Zea mays L., Phaseolus vulgaris L., Lactuca sativa L. em solos da zona agrícola, envolvente à área mineira da Cunha Baixa (Mangualde. As espécies colonizadoras da escombreira estão bem adaptadas ao substrato, sendo o Pinus pinaster aquela que mais urânio concentrou na parte aérea (13,9 mg kg-1 podendo, juntamente com as espécies do género Cytisus, contribuir para a estabilização dos resíduos mineiros, ainda com elevada concentrações em urânio total e disponível (118 mg kg-1 e 43 mg kg-1, respectivamente. Entre as espécies cultivadas destaca-se a Lactuca sativa que concentrou, em média, 5,37 mg kg-1 de urânio (peso seco. Nenhuma das espécies estudadas se revelou acumuladora deste elemento (CB The uranium concentration and the biococentration capacity (BC in several plant species (aboveground part were evaluated and compared among species grown on soils developed on waste materials (Pinus pinaster, Cytisus striatus, Cytisus multiflorus and agricultural soils (Zea mays L., Phaseolus vulgaris L., Lactuca sativa L. from the surrounding area of Cunha Baixa mine (Mangualde. The species colonizing waste materials are well adapted to the substratum, which contains high total and available uranium concentration (118 mg kg-1 and 43 mg kg-1 , respectively. Pinus pinaster concentrated more uranium (13.9 mg kg-1 than the species of genus Cytisus. As a consequence, and also due to the effective vegetation cover these plants can contribute to the stabilization of mining wastes dumps. Lactuca sativa concentrated more uranium (on average, 5.37 mg kg-1 dry weight than the other cultivated plants. None of the studied species was uranium accumulator (BC <1, even if
Le Procès des poètes : Flaubert contre « l’écume du cœur »
Directory of Open Access Journals (Sweden)
Aurélie Loiseleur
2009-12-01
Full Text Available Dans sa correspondance, si Flaubert prend peu les poètes pour destinataires premiers, il les vise pourtant en permanence. Ses lettres, en particulier celles qu’il écrit à la poétesse Louise Colet, sont en effet l’occasion pour lui de revenir sur son credo esthético-sentimental et de préciser ses propres positions (de poète de la prose dans une lutte déclarée contre les représentants de « la poésie du cœur ».In Flaubert’s correspondence poets are rarely his principal addressees, yet they are his main target. Indeed, his letters, specially those written to the poet Louise Colet, give him the opportunity to re-examine his esthetical-sentimental creed and specify his own position as a prose poet in an open war against those who represent “the poetry of the heart”.
Directory of Open Access Journals (Sweden)
Eduardo Henrique Bevitori Kling de Moraes
2009-04-01
Full Text Available Objetivou-se avaliar o consumo, a digestibilidade, o pH e a concentração de amônia do líquido ruminal, a concentração de nitrogênio sérico e urinário e a síntese microbiana em novilhos recebendo suplemento durante o período da seca. Utilizaram-se quatro novilhos mestiços Zebu × Holandês, castrados, com peso médio inicial de 430 kg, fistulados no esôfago, rúmen e abomaso e distribuídos em quatro piquetes de Brachiaria decumbens, cada um com 0,40 ha. Cada animal recebeu 4,0 kg/dia de suplemento, constituído de milho moído, farelo de algodão, mistura mineral e uréia/sulfato de amônia em quatro níveis (0; 1,2; 2,4 e 3,6% na matéria natural. Os consumos de matéria seca total, 2,0% (10,9 kg/dia, e de pasto, 2,3% (7,1 kg/dia, matéria orgânica, 2,2% (9,7 kg/dia, matéria orgânica do pasto, 2,3% (6,3 kg/dia, proteína bruta, 1,9% (1,3 kg/dia, extrato etéreo, 3,6% (0,4 kg/dia, fibra em detergente neutro, 1,9% (5,8 kg/dia, carboidratos totais, 2,3% (8,2 kg/dia, e carboidratos não-fibrosos, 2,9% (4,1 kg/dia, foram influenciados de forma quadrática pelos níveis de uréia nos suplementos. Apenas a digestibilidade total da matéria orgânica foi afetada, de forma linear positiva, pelos níveis de uréia no suplemento. Não foram observados efeitos dos níveis de uréia no suplemento sobre o pH ruminal, entretanto as concentrações de amônia aumentaram linearmente de acordo com os níveis de uréia, ocasionando aumento linear na excreção de nitrogênio sérico e urinário. A eficiência microbiana, em qualquer forma de expressão, não diferiu entre os níveis de uréia.Four Zebu × Holstein steers were fistulated in rumen, abomasums and esophagus, with 430 kg of live weight grazing in four paddocks of Brachiaria decumbens (.40 ha, feed supplements were used to evaluate intake, digestibility, pH and ammonia ruminal concentration, nitrogen in serum and urine and microbial yield. The animals received 4.0 kg/animal/day of
L’empathie comme outil herméneutique du soi: Note sur Paul Ricœur et Heinz Kohut
Directory of Open Access Journals (Sweden)
Michel Dupuis
2011-01-01
Full Text Available Le bref texte que Paul Ricœur consacre en 1986 à la psychanalyse développée par Heinz Kohut révèle une réinterprétation phénoménologique à la fois du contenu et des fonctions de l'empathie, au total considérée comme un véritable outil à l'œuvre dans l'herméneutique du soi. La vision kohutienne de la constitution du soi et du processus thérapeutique analytique produit une espèce de “dé-sentimentalisation” de l'empathie, en soulignant le rôle crucial du transfert intersubjectif, fort à distance de la théorie (freudienne solipsiste de l'ego.The short text published in 1986 by Paul Ricoeur about Heinz Kohut's psychoanalysis of the self reveals a phenomenological reinterpretation of the content and the functions of empathy, finally considered as an effective tool of the hermeneutics of the self. Kohut's model of constitution of the self and of the therapeutic analytical process produces a kind of “de-sentimentalization” of empathy, pointing to the crucial role of intersubjective transfer, far from a (Freudian solipsistic theory of the ego.
Polineuropatia urêmica: estudo clínico-eletroneurográfico de 33 casos
Directory of Open Access Journals (Sweden)
Lineu Cesar Werneck
1979-12-01
Full Text Available Neste estudo foram avaliados 33 pacientes com polineuropatia e insuficiência renal crônica. A idade dos pacientes variou entre 18 e 58 anos, sendo 26 do sexo masculino e 9 do feminino. Todos os pacientes apresentavam níveis de uréia acima de 100 mg/dl e creatinina acima de 5,0 mg/dl. 10 pacientes foram mantidos com hemodiálise crônica, 13 com diálise peritoneal semanal e 10 com tratamento clinico conservador (controles. Foram realizadas medidas da condução nervosa motora nos nervos mediano, ulnar e peroneiro em todos os pacientes, concomitante com a avaliação clínica. Os pacientes foram divididos em grupos, conforme a intensidade da neuropatia presente. Os sintomas mais freqüentes foram diminuição do senso de vibração, câimbras e hipoestesia distai para tacto. O nervo mais afetado foi o peroneiro (97,82%, seguido do mediano e ulnar. O procedimento dialítico alterou pouco a condução nervosa, quando as aferições eram realizadas antes e depois da mesma diálise. Não houve nenhuma diferença estatisticamente significante entre os grupos de hemodiálise e diálise peritoneal na avaliação clinica ou eletroneurográfica. Em 7 pacientes seguidos por vários anos, a condução nervosa manteve-se estável em dois, aumentou em dois e baixou em três, acompanhando a evolução dos sintomas. Nos três que pioraram, houve desenvolvimento paralelo de hiper-paratireoidismo secundário. Os autores concluem que o nervo peroneiro é o que melhores condições fornece para o seguimento e avaliação clinica dos pacientes com uremia, apresentando tendência para diminuir a condução nervosa, quando existe piora da sintomatologia, sem relação com o tipo de diálise empregado.
Directory of Open Access Journals (Sweden)
Jalison Lopes
2007-08-01
Full Text Available Objetivou-se com esta pesquisa avaliar os efeitos da utilização de aditivos sobre o valor nutritivo da silagem de cana-de-açúcar. Foram testadas diferentes quantidades de aditivos associadas à cana-de-açúcar no momento da ensilagem (com base na matéria verde da forragem: 1,5% uréia; 0,5% uréia + 4% fubá; 0,5% uréia + 4% de mandioca desidratada; 1,5% de amiréia; e cana-de-açúcar pura. A cana-de-açúcar da variedade RB-72454, com 18 meses de rebrota, foi armazenada em silos experimentais de concreto com capacidade de 500 kg, durante 180 dias. Cinco ovelhas com peso médio de 36,5 kg foram alojadas em gaiolas metabólicas individuais próprias para o ensaio de digestibilidade in vivo. Utilizou-se o delineamento em blocos casualizados, em que os blocos foram constituídos pelos períodos de coleta dos dados, em um total de quatro períodos. Avaliaram-se o consumo voluntário de MS, FDN, PB e NDT, a digestibilidade da MS, FDN, PB e CNF e o balanço de nitrogênio. O valor nutritivo da silagem de cana-de-açúcar foi aumentado com o uso de aditivos, implicando maior consumo e digestibilidade da PB.The research aimed to evaluate the use of additives on the nutritional value of the sugarcane silage. Treatments were expressed by additive type and amount added to the sugarcane silage at ensiling (fresh matter basis, as follows: urea 1.5%; urea 0.5% and corn meal 4%; urea 0.5% and dehydrated cassava 4%; starea 1.5%; sugar cane only. Sugarcane variety RB-72454, at 18 months of regrowth was stored for 180 days in experimental concrete silos (500 kg capacity. An in vivo digestibility trial was carried out using a complete randomized block design. Five sheeps with an average weight of 36.5 kg were housed in individual metabolic cages simultaneously to silage unloading. Data from four crop periods were used to form the blocks. Voluntary intake of the DM, CP, NDF, TDN, and digestibility of DM, NDF, NFC, CP and N retention were evaluated. In
Directory of Open Access Journals (Sweden)
Reinaldo Cunha de Oliveira Junior
2004-06-01
Full Text Available Seis novilhos da raça Nelore, não castrados, com peso médio inicial de 420 kg, distribuídos em delineamento em quadrado latino 3x3 duplicado, foram utilizados para avaliar a substituição total de uma fonte de proteína verdadeira (farelo de soja, em uma dieta deficiente em proteína degradável no rúmen (PDR, por uréia ou amiréia (fontes de nitrogênio não protéico, ambas em uma dieta adequada em PDR. As dietas foram isoprotéicas (13,0% utilizando-se o bagaço de cana-de-açúcar in natura (BIN como única fonte de volumoso (20% da MS. Foram avaliados: a concentração de amônia ruminal, nitrogênio uréico plasmático, glicose plasmática e o metabolismo do nitrogênio. Os tratamentos foram: 1 farelo de soja (FS; 2 uréia e 3 amiréia (A-150S. A concentração de nitrogênio amoniacal no fluido ruminal foi superior no tratamento com uréia, comparado ao tratamento com farelo de soja, sendo que o tratamento com amiréia não diferiu dos demais. O tratamento com amiréia apresentou maior perda de N urinário. A retenção de N (g/d e % do consumido e o valor biológico da proteína (N retido, % do N digerido foram superiores para o tratamento com uréia, comparado aos demais. A concentração de nitrogênio uréico no plasma e a concentração de glicose plasmática foram similares entre os tratamentos. A substituição total do farelo de soja por uréia, ajustando a PDR na dieta de bovinos de corte, demonstrou ser viável. A uréia na forma convencional apresentou vantagens em relação à amiréia.Six Nellore bulls, with initial body weight of 420 kg, were assigned to a duplicated 3x3 Latin square design to evaluate the effects of replacing a true protein source (soybean meal, of high biological value, in a rumen degradable protein (RDP deficient diet, by urea or starea (a supposedly slow release nonprotein nitrogen source, both in a RDP adjusted diet. In natura sugarcane bagasse as the only source of forage (20% of DM. Evaluated
Cœur elle y gît rouge (qui gît dans l’élégie ?
Directory of Open Access Journals (Sweden)
Benoît Conort
2012-08-01
Full Text Available Si le recueil Cœur élégie rouge de James Sacré fait bien apparaître l’ombre d’une femme aimée et perdue, ne voir dans cette élégie qu’une dimension autobiographique serait réducteur, et il faut peut-être y entendre aussi, selon une approche réflexive, le poème qui échoue à restituer le monde, le végétal, les visages. De la sorte, l’élégie serait aussi le deuil de ce rêve, avec le constat de l’incompatibilité du poème et du monde, pour peu que le sujet lyrique s’abandonne à un aveu naïf de son amour. Le poème doit donc se reconstruire comme espérance, projet incessamment relancé d’une écriture par quoi la vie continue. L’élégie ne se contente plus de chanter la perte ni de méditer sur l’inadéquation de la langue, elle tire sa force d’un espoir qui renaît toujours et dont témoigne la prégnance de la métaphore végétale.
Directory of Open Access Journals (Sweden)
Rubén Pérez-Álvarez
2016-02-01
Full Text Available Heritage tourism can increase incomes and stimulate the economy in former mining areas. Recreational tourism is one of the main sources of value of heritage. People from urban areas are willing to pay for access to these tourism options. The measurement of the economic impact of this availability is one of the main problems to confront, due to the immeasurable possibilities of heritage resources. The use of non-market values and their estimation by means of revealed preference methods should help to assess the economic value of this sort of resources from a recreational perspective. The travel cost method (TCM is widely used to value areas with recreational uses, such as lakes, beaches or forests, but there are not references to previous applications of this methodology in the field of mining heritage. In this work, TCM has been applied to obtain the economic value of El Soplao Cave (Geosite UR004, Cantabria, Spain as a recreational site, providing an estimated result of 34,961,162 euros.
Directory of Open Access Journals (Sweden)
Yvanka B. Raynova
2016-12-01
The aim of the following article is to reconstruct Paul Ricoeur's concepts of human rights and human dignity by exploring some little-known texts, and to exemplify how these concepts are connected to a specific philosophical conception of human being, which is grounded in a Dialectics between transcendence and incarnation, freedom and dependence, identity and difference, capability and fallibility (fragility. In doing so, I will argue that Ricœur interprets human dignity, which he has never explicitly defined, through the prism of human capabilities, especially of the capability of being responsible. This interpretation allows him to take a differentiated position in the current bioethical debates on the rights of "potential persons" (Embrio and to illustrate how the Aristotelian phronèsis can be used in (bioethical cases where decisions are difficult to take.
Directory of Open Access Journals (Sweden)
Ricardo Alexandre Silva Pessoa
2009-05-01
Full Text Available Objetivou-se avaliar o efeito da associação de palma forrageira ao bagaço de cana-de-açúcar e à uréia sobre o balanço de compostos nitrogenados e a produção de proteína microbiana em novilhas leiteiras recebendo ou não suplemento. Foram utilizadas 25 novilhas da raça Girolando, com peso vivo médio inicial de 227 kg, confinadas, distribuídas em delineamento experimental de blocos ao acaso, estabelecidos de acordo com o peso dos animais. A ração controle (sem suplemento foi composta de 64,0% de palma forrageira, 30,0% de bagaço de cana-de-açúcar, 4,0% de mistura uréia:sulfato de amônio (9:1 e 2,0% de mistura mineral, com base na matéria seca (MS, e as rações experimentais, de 57,0% de palma forrageira, 26,0% de bagaço de cana-de-açúcar, 3,5% de mistura uréia:sulfato de amônio, 1,8% de mistura mineral e 11,7% de suplemento (0,5% do PV dos animais. Os suplementos testados foram: farelo de trigo, farelo de soja, farelo de algodão ou caroço de algodão. O balanço de nitrogênio não foi influenciado pelas dietas e apresentou valor médio de 49,3 g/dia. A suplementação com farelo de algodão ou com farelo de soja aumentou a excreção de nitrogênio na urina, a concentração de uréia e nitrogênio uréico no plasma e a excreção urinária de uréia e nitrogênio uréico. A associação da palma forrageira ao bagaço de cana-de-açúcar e à uréia, sem o uso de suplementos, permite eficiência de síntese microbiana de 105 gPBmic/kg de NDT consumido. A suplementação com caroço de algodão proporciona maior excreção urinária de alantoína e derivados de purina e melhor eficiência de síntese microbiana, portanto, é a mais indicada nestas condições.The objective of this work was to evaluate the effect of association of forage cactus to sugar cane bagasse and urea on nitrogenous compounds balance and microbial protein synthesis in milk heifers supplemented or not. Twenty-five Holstein-Gir crossbred heifers
Closure Report for Corrective Action Unit 574: Neptune, Nevada National Security Site, Nevada
International Nuclear Information System (INIS)
2012-01-01
Corrective Action Unit (CAU) 574 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Neptune' and consists of the following two Corrective Action Sites (CASs), located in Area 12 of the Nevada National Security Site: (1) CAS 12-23-10, U12c.03 Crater (Neptune); and (2) CAS 12-45-01, U12e.05 Crater (Blanca). This Closure Report presents information supporting closure of CAU 574 according to the FFACO (FFACO, 1996 [as amended March 2010]) and the Streamlined Approach for Environmental Restoration Plan for CAU 574 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2011). The following activities were performed to support closure of CAU 574: (1) In situ external dose rate measurements were collected using thermoluminescent dosimeters at CAS 12-45-01, U12e.05 Crater (Blanca). (2) Total effective dose rates were determined at both sites by summing the internal and external dose rate components. (3) A use restriction (UR) was implemented at CAS 12-23-10, U12c.03 Crater (Neptune). Areas that exceed the final action level (FAL) of 25 millirems per year (mrem/yr) based on the Occasional Use Area exposure scenario are within the existing use restricted area for CAU 551. The 25-mrem/yr FAL is not exceeded outside the existing CAU 551 UR for any of the exposure scenarios (Industrial Area, Remote Work Area, and Occasional Use Area). Therefore, the existing UR for CAU 551 is sufficient to bound contamination that exceeds the FAL. (4) An administrative UR was implemented at CAS 12-45-01, U12e.05 Crater (Blanca) as a best management practice (BMP). The 25-mrem/yr FAL was not exceeded for the Remote Work Area or Occasional Use Area exposure scenarios; therefore, a UR is not required. However, because the 25-mrem/yr FAL was exceeded for the Industrial Area exposure scenario, an administrative UR was established as a BMP. UR documentation is included as Appendix B. The UR at CAS 12-23-10, U12c.03 Crater (Neptune
Energy Technology Data Exchange (ETDEWEB)
Krauss, Mark J
2007-03-01
The purpose of this Corrective Action Decision Document/Closure Report is to provide justification and documentation supporting the recommendation for closure of CAU 137 with no further corrective action. To achieve this, corrective action investigation (CAI) activities were performed from February 28 through August 17, 2006, as set forth in the Corrective Action Investigation Plan for Corrective Action Unit 137: Waste Disposal Sites. The purpose of the CAI was to fulfill the following data needs as defined during the data quality objective process: • Determine whether contaminants of concern (COCs) are present. • If COCs are present, determine their nature and extent. • Provide sufficient information and data to complete appropriate corrective actions. ROTC-1: Downgrade FFACO UR at CAU 137, CAS 07-23-02, Radioactive Waste Disposal Site to an Administrative UR. ROTC-2: Downgrade FFACO UR at CAU 137, CAS 01-08-01, Waste Disposal Site to an Administrative UR.
Directory of Open Access Journals (Sweden)
Jane Maria Bertocco Ezequiel
2001-02-01
Full Text Available Este trabalho foi conduzido com o objetivo de avaliar a digestibilidade da energia e da fibra de dietas contendo uréia, amiréia ou farelo de algodão como fontes protéicas exclusivas e silagem de milho como volumoso. Utilizaram-se 24 borregos com 11 meses de idade e peso médio 31 kg e o método da coleta total de fezes. A ingestão de matéria seca foi de 64,1; 68,8 e 71,4 g/kg PV0,75/dia e as digestibilidades da energia da FDN e da FB foram 63,0; 67,7 e 64,4%, 39,6; 55,7 e 50,0%, 47,0; 49,3 e 53,4%, respectivamente, para dietas com uréia, amiréia e farelo de algodão. Os ganhos em peso foram 278,5; 348,0; e 293,7 g/anim.dia, na mesma ordem. O uso da amiréia poderá ser o mais adequado, em relação a uréia e farelo de algodão, em dietas para borregos contendo silagem de milho como volumoso.This research was conducted to evaluate the energy and the fiber digestibility of diets containing urea, starea and cottonseed meal as nitrogen sources and corn silage as forage. Twenty-four lambs averaging 11 months old and initial 31 kg LW and total feces collection method were used. Dry matter intake was 64.1, 68.8 and 71.4 g /kg PV.75 /day and the energy, NDF and CF digestibilities were 63.0, 67.7 and 64.4%, 39.6, 55.7 and 50.0%, 47.0, 49.3 and 53.4%, for the diets with urea, starea and cottonseed meal, respectively. The average weights gain were 278.5, 348.0 and 293.7 g/anim./day, in the same above sequence. The use of starea would be more adequate in relation to urea and cottonseed meal in diets with corn silage as forage for lambs.
Directory of Open Access Journals (Sweden)
Yves De Maeseneer
2016-07-01
Full Text Available In this article we present a theological-anthropological exploration, interpreting the figure of the angel as a mirror of our human condition. The point of departure is an analysis of Hans Urs von Balthasar’s approach to two major sources of our imagination of the angel: Bonaventure (1221−1274 and Maria Rainer Rilke (1875−1926. A comparison of his accounts of the Franciscan theologian and the Modern poet, respectively, reveals remarkable parallels in discourse, clustered around the tensions between vulnerability and openness, immanence and transcendence, and love and loss. Both Rilke and Bonaventure reject the classical angel figure as a human ideal, as it cannot integrate the paradoxes of human existence. Their alternative visions of what it means to be human, have many terms in common: heart, vulnerability, mortality, openness, abyss, suspension, transparency, receptivity, descent (kenosis, humility, poverty, etc. However, their meaning is different because Rilke does not recognize an absolute transcendence as the source of love and the vis-a-vis of the human. This immanentism leaves him no other option than the vain attempt to exorcize the angel figure altogether, while Bonaventure’s vision preserves the angel as an anthropological mirror, albeit an angel radically transfigured by God’s wounded love.
Uncaria rhynchophylla (miq) Jack plays a role in neuronal protection in kainic acid-treated rats.
Tang, Nou-Ying; Liu, Chung-Hsiang; Su, Shan-Yu; Jan, Ya-Min; Hsieh, Ching-Tou; Cheng, Chin-Yi; Shyu, Woei-Cherng; Hsieh, Ching-Liang
2010-01-01
Uncaria rhynchophylla (Miq) Jack (UR) is one of many Chinese herbs. Our previous studies have shown that UR has both anticonvulsive and free radical-scavenging activities in kainic acid (KA)-treated rats. The aim of the present study was to use the effect of UR on activated microglia, nitric oxide synthase, and apoptotic cells to investigate its function in neuroproction in KA-treated rats. UR of 1.0 or 0.5 g/kg was orally administered for 3 days (first day, second day, and 30 min prior to KA administration on the third day), or 10 mg/kg (intraperitoneal injection, i.p.) N-nitro-L-arginine methyl ester (L-NAME) 30 min prior to KA (2 microg/2 microl) was injected into the right hippocampus region of Sprague-Dawly rats. ED1 (mouse anti rat CD68), neuronal nitric oxide synthase (nNOS), inducible nitric oxide synthase (iNOS) immunoreactive cells and apoptotic cells were observed in the hippocampus region. The results indicated that 1.0 g/kg, 0.5 g/kg of UR and 10 mg/kg of L-NAME reduced the counts of ED1, nNOS, iNOS immunoreactive cells and apoptotic cells in KA-treated rats. This study demonstrates that UR can reduce microglia activation, nNOS, iNOS and apoptosis, suggesting that UR plays a neuro-protective role against neuronal damage in KA-treated rats.
International Nuclear Information System (INIS)
Bellanger, G.
1994-11-01
The redox potential of 3 H 2 O, as well as the corrosion potentials in this medium are found, abnormally, in the trans-passive region. This is completely different from behavior in the chemical industry or in the water in nuclear powers. With such behavior, there will be breakdowns of the protective oxide layers, and in the presence of chloride there will be immediate pitting. Polarization and electrochemical impedance spectrometry curves are presented and discussed. These curves make it possible to ascertain the corrosion domains and to compare the kinetics of different stainless steel alloys. These corrosion kinetics and the corrosion potentials provide a classification of the steels studied here: Inconel 690, zircaloy 4, 316 Ti steel, 17-4-PH, UR52N et URSB8. From the results it can be concluded that URSB8 has the best corrosion resistance. (author). 13 refs., 522 figs., tabs
International Nuclear Information System (INIS)
Bellanger, G.
1994-11-01
The redox potential of 3 H 2 O, as well as the corrosion potentials in this medium are found, abnormally, in the trans-passive region. This is completely different from the behavior in the chemical industry or in the water in nuclear powers. With such behavior, there will be breakdowns of the protective oxide layers, and in the presence of chloride there will be immediate pitting. Polarization and electrochemical impedance spectrometry curves are presented and discussed. These curves make it possible to ascertain the corrosion domains and to compare the kinetics of different stainless alloys. These corrosion kinetics and the corrosion potentials provide a classification of the steels studied here: Inconel 690, zircaloy 4, 316 Ti steel, 17-4-PH, UR52N et URSB8. From the results it can be concluded that URSB8 has the best corrosion resistance. (author). 279 figs., tabs
Um caso de recuperação da função renal na síndrome hemolítico-urêmica tratada com eculizumab
Directory of Open Access Journals (Sweden)
João Samuel de Holanda Farias
2016-03-01
Full Text Available Resumo A síndrome hemolítico-urêmica atípica (SHUa é uma doença grave, pouco prevalente, com acometimento em qualquer idade e apresentação esporádica ou familiar. A SHUa é causada por uma ativação descontrolada do sistema complemento. A plasmaférese foi o tratamento padronizado por anos, com resultados desfavoráveis, levando à doença renal crônica terminal ou morte em aproximadamente 40% dos pacientes durante as primeiras manifestações clínicas. O Eculizumab é um anticorpo monoclonal humanizado contra o componente C5 do complemento e nos últimos anos vem sendo utilizado como novo arsenal terapêutico com resultados promissores. O presente caso descreve uma paciente adulta tratada com eculizumab em que se obteve resultados satisfatórios evitando-se potenciais riscos e aumento da morbidade com o procedimento de plasmaférese.
Directory of Open Access Journals (Sweden)
Armando de Andrade Rodrigues
1999-04-01
Full Text Available O efeito de diferentes suplementos protéicos no consumo de cana-de-açúcar com uréia foi avaliado em novilhas mestiças de Holandês-Zebu, durante a estação seca. Dezoito novilhas com peso médio inicial de 288 kg e idade variando entre 15 e 22 meses foram suplementadas com farelo de soja ou com concentrado contendo 28,7% de proteína bruta. A quantidade de suplemento oferecida foi de 1,0 kg/animal·dia. A cana-de-açúcar com uréia foi fornecida à vontade. As médias dos consumos diários de matéria seca e fibra em detergente neutro de cana-de-açúcar com uréia, em porcentagem do peso vivo, foram 2,33 e 2,43 e 1,19 e 1,23, respectivamente, para os animais suplementados com farelo de soja ou concentrado contendo 28,7% de proteína bruta. Os suplementos protéicos não influíram no consumo de matéria seca e fibra em detergente neutro da cana-de-açúcar com uréia. Não houve diferença no ganho de peso entre os tratamentos. As médias de ganho de peso foram 0,39+0,04 e 0,36+0,04 kg/animal·dia, respectivamente, para os animais suplementados com farelo de soja ou com concentrado contendo 28,7% de proteína bruta.The effect of different protein supplements on intake of sugar cane with urea by crossbred Holstein-Zebu heifers was evaluated during 12 weeks in the dry season. Eighteen heifers, averaging initial weight of 288 kg and age ranging from 15 to 22 months, were supplemented with soybean meal or concentrate with 28.7% crude protein. The amount of supplement fed was 1.0 kg/animal·day. Sugar cane with urea was fed ad libitum. The average intake of dry matter and neutral detergent fiber of sugar cane with urea in percent of live weight were 2.33 and 2.43; 1.19 and 1.23 for the animals supplemented with soybean meal or concentrate with 28.7% crude protein, respectively. The protein supplements did not affect intake of dry matter and neutral detergent fiber of sugar cane with urea. The supplements did not affect heifers weight gain
Directory of Open Access Journals (Sweden)
Christine Bourotte
2009-06-01
Full Text Available Anomalous concentrations of hexavalent chromium have been detected in ground-water of the Adamantina Aquifer inat least 54 municipalities located in the northwestern region of the State of São Paulo, southeast Brazil, occasionallyexceeding the permitted limit for human consumption (0.05 mg.L-1. An investigation was conducted in the municipality of Urânia, where the highest concentrations of chromium were detected regionally. It was defined that the originof this contamination is natural, since high concentrations of chromium were detected in aquifer sandstones (averageof 221 ppm and also in pyroxenes (6000 ppm, one of the main heavy minerals found in the sediments. Besides, noother possible diffuse or point sources of contamination were observed in the study area. Stratification of ground-waterquality was observed and the highest concentrations of Cr6+ were detected at the base of the aquifer (0.12 mg.L-1,where ground-water shows elevated values for redox potential (472.5 mV and pH (8.61. The origin of Cr6+ in water may be associated with the weathering of pyroxene (augite, followed by the oxidation of Cr3+ by manganese oxides. The highest concentrations of Cr6+ are probably related to desorption reactions, due to the anomalous alkaline pHfound in ground-water at the base of the aquifer.Concentrações anômalas de cromo hexavalente foram detectadas em águas subterrâneas do Aqüífero Adamantina em pelo menos 54 municipalidades localizadas na região noroeste do Estado de São Paulo, sudeste do Brasil, algumas vezes ultrapassando o limite máximo permitido para consumo humano (0,05 mg.L-1. Um estudo foi realizado no município de Urânia, onde as mais elevadas concentrações de cromo da região foram detectadas. A origem da contaminação foi definida como natural, pois foram detectadas concentrações de cromonos arenitos do aqüífero (média 221 ppm e em piroxênios (6000 ppm, um dos principais minerais pesados encontrados nos sedimentos
Directory of Open Access Journals (Sweden)
Adriana Augusto Aquino
2007-08-01
Full Text Available Avaliou-se o efeito de níveis crescentes de uréia na dieta de vacas em lactação sobre a produção e composição físico-química do leite. Foram utilizadas nove vacas holandesas em lactação, distribuídas em três quadrados latinos 3 x 3, com três tratamentos e três períodos de coleta. O experimento teve duração de 63 dias, divididos em três períodos de 21 dias. Os tratamentos consistiram de uma dieta controle, formulada para suprir 100% das exigências de PB, proteína degradável no rúmen (PDR e proteína não-degradável no rúmen (PNDR, composta de farelo de soja como principal fonte protéica e cana-de-açúcar como volumoso, e de duas outras dietas, semelhantes à dieta controle, mas com 0,75 ou 1,5% de uréia em substituição ao farelo de soja. As dietas foram isoenergéticas (1,53 Mcal/kg de energia líquida de lactação e isoprotéicas (16% de PB. Quando os resultados foram analisados por regressão polinomial simples, não houve efeitos das dietas sobre o consumo de MS, as produções de leite e de leite corrigida para 3,5% de gordura, os teores de proteína e gordura e a contagem de células somáticas do leite. Os níveis de substituição do farelo de soja por uréia não influenciaram o pH, a crioscopia ou a densidade do leite. No entanto, verificou-se efeito linear decrescente dos níveis de uréia na dieta sobre a acidez do leite. Os teores de proteína, gordura, lactose, uréia, extrato seco total e extrato seco desengordurado não foram afetados pelas dietas. Os resultados deste estudo sugerem que o uso de até 1,5% de uréia na MS da dieta de vacas em lactação não altera a produção, a composição e as características físico-químicas do leite.The objective of this trial was to evaluate the effects of three different dietary levels of urea on milk yield and composition. Nine lactating Holstein cows were randomly assigned to three replicated 3 x 3 Latin squares with three periods of 21 days each
Directory of Open Access Journals (Sweden)
Hugo Imaizumi
2005-03-01
Full Text Available Dois experimentos foram conduzidos para estudar a substituição parcial do farelo de soja (FS por uréia, na forma extrusada com milho (A150S ou convencional (U. No experimento 1 utilizou-se 38 vacas em final de lactação. A substituição não afetou (P > 0,05 a produção de leite e leite corrigido para gordura, o teor e produção de proteína, a produção de sólidos totais e as concentrações plasmáticas de glicose e N-uréico. O tratamento U aumentou (P 0,05. A substituição parcial do farelo de soja por uréia é uma alternativa viável para vacas em final de lactação. O processamento da uréia não apresentou vantagens em relação à forma convencionalTwo trials were conducted to study the partial replacement of soybean meal (FS by urea (U in diets for late lactation cows. Conventional urea was compared to extruded urea (A150S. In trial 1, 38 late lactation cows were used. The partial replacement of soybean meal by urea sources or the urea processing did not affect milk and 3.5% FCM yields, protein content and yield, total solids yield, and plasma urea N and glucose. Feeding U increased milk fat and total solids content. In trial 2, five dry cows, fitted with ruminal canulas were used. Dry matter intake, total tract nutrient digestibility’s, rumen VFA molar concentration, plasma urea-N and plasma glucose were not affected by treatments (p > 0.05. The partial replacement of soybean meal by urea is an alternative to reduce costs of diets for late lactating cows. Extrusion of urea did not show any advantage compared to conventional urea
Directory of Open Access Journals (Sweden)
Myriam Louviot
2010-12-01
Full Text Available En 2007, Wilfried N’Sondé, Franco-congolais vivant à Berlin, publie en France son premier roman, Le Cœur des enfants léopards. Le livre rencontre un certain succès. Un an plus tard, la traduction allemande, Das Herz der Leopardenkinder semble faire une carrière comparable en Allemagne. On serait donc tenté de conclure qu’il n’y a pas tant de différence entre le lectorat français et le lectorat allemand. Un bon roman est un bon roman et il semble normal qu’il trouve son public des deux côtés du Rhin... Mais à y regarder de plus près, il apparaît que la réception du roman de Wilfried N’Sondé en France et en Allemagne suit des voies bien différentes. En France, les littératures postcoloniales sont essentiellement considérées à l’intérieur du cadre conceptuel de la francophonie et le roman de N’Sondé apparaît effectivement d’abord comme un roman francophone ; en Allemagne, il est plutôt rattaché à la littérature de la migration et est compris en fonction des traditions d’analyse qui s’y rattachent.2007 veröffentlicht der in Berlin lebende und aus Kongo stammende Franzose Wilfried N’Sondé, seinen ersten Roman, Le cœur des enfants léopards. Das Buch erfreut sich in Frankreich einer regen Aufmerksamkeit. Ein Jahr später scheint die deutsche Übersetzung, Das Herz der Leopardenkinder, am französischen Erfolg anzuknüpfen : ein guter Roman bleibt ein guter Roman und so scheint es nur normal dass, er auf beiden Seiten des Rheins sein Publikum findet. Dennoch wäre es falsch, daraus auf eine sehr ähnliche Leserschaft in den beiden Sprachräumen zu schließen. Bei genauerem Hinsehen zeigt sich, dass die Rezeption von Wilfried N’Sondés Roman in Frankreich und in Deutschland sehr unterschiedlich verläuft. Während der Roman in Frankreich im Kontext der postkolonialen Literatur in erster Linie als frankophones Werk rezipiert wird, konzentriert sich die deutsche Rezeption vornehmlich auf den
Jinnai, Michio; Kawabuchi-Kurata, Takako; Tsuji, Masayoshi; Nakajima, Rui; Hirata, Haruyuki; Fujisawa, Kohei; Shiraki, Hiromi; Asakawa, Mitsuhiko; Nasuno, Toyohiko; Ishihara, Chiaki
2010-10-11
A frozen-stored blood clot of a wild brown bear cub Ursus arctos yesoensis that had been captured in Hokkaido, Japan was examined for piroplasma infection using polymerase chain reaction (PCR). Two 18S ribosomal RNA gene (SSU rDNA) sequences were generated. One 1565-bp sequence showed the highest similarity with B. gibsoni (95.9% identity) but, phylogenetically, was found to belong to a distinct lineage. The other sequence (1709-bp) could not be definitively assigned to a described taxon, sharing only limited homology to the closest named species (90.1% identity with C. felis). In order to enhance information obtained from the SSU rDNA sequence, further detection and sequence analysis of the CCTeta gene sequence were done revealing the simultaneous presence of three closely related genotypes (all in a monophyletic lineage) within a single bear host. This finding suggested the possibility that a new Babesia species (Babesia sp. UR1) might have been maintained in nature in wild brown bears. While the parasite's biology is yet unknown, to our knowledge, this is, excepting the single case documentation in 1910 of a hemoparasite in a bear at Russian zoo, the first reported case of piroplasms inhabiting a bear species. Copyright 2010 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Glauber José de Castro Gava
2006-01-01
Full Text Available Este trabalho teve como objetivo estudar as possíveis alterações na produção e partição da fitomassa vegetal, no acúmulo de nitrogênio total e do nitrogênio na planta proveniente do fertilizante (NPPF, utilizando-se uréia (15N aplicada em adubação de cobertura, na cultura do milho, na fase de implantação do manejo de semeadura direta. Com essa finalidade foi desenvolvido um experimento em campo, em Nitossolo localizado na Fazenda Água Sumida próximo ao município de Barra Bonita (SP. O delineamento experimental foi o de blocos completos ao acaso, com quatro repetições. Os tratamentos estudados foram: sistema de plantio convencional (uma aração e duas gradagens e sistema de semeadura direta, ambos adubados com uréia (15N, na dose de 100 kg ha-1 de N em cobertura. Em todos os tratamentos, foi feita adubação de semeadura, aplicando-se 25 kg ha-1 de N na forma de uréia, 80 kg ha-1 de P2O5 na forma de superfosfato simples e 60 kg ha-1 de K2O como cloreto de potássio. No fim do ciclo foram realizadas comparações entre os tratamentos, da produtividade da cultura; da acumulação de nitrogênio pela parte aérea e parte subterrânea; da utilização do nitrogênio da uréia (15N pela cultura do milho e do nitrogênio residual do fertilizante no solo. As modificações no solo causadas pela implantação da semeadura direta não restringiram a disponibilidade de N para as plantas de milho e, por conseguinte, a produção de material seco. A eficiência de utilização do fertilizante nitrogenado (EUFN pelo milho e a recuperação do fertilizante nitrogenado no solo (RFNS foram, respectivamente, em torno de 45% e 30% para o N-uréia aplicado em cobertura não havendo diferença entre os sistemas de cultivo convencional e direto. Independentemente do sistema, o nitrogênio não recuperado da uréia, aplicado em cobertura na cultura do milho (NNR foi em média de 25%.This work aimed to study possible alterations in the production
Energy Technology Data Exchange (ETDEWEB)
Mark Krauss
2004-08-01
The purpose of this CR is to document that closure activities have met the approved closure standards detailed in the NDEP-approved CAP for CAU 271. The purpose of the Errata Sheet is as follows: In Appendix G, Use Restriction (UR) Documentation, the UR form and drawing of the UR area do not reflect the correct coordinates. Since the original UR was put into place, the UR Form has been updated to include additional information that was not on the original form. This Errata Sheet replaces the original UR Form and drawing. In place of the drawing of the UR area, an aerial photograph is included which reflects the UR area and the correct coordinates for the UR area.
Directory of Open Access Journals (Sweden)
Ricardo Pimentel Ramalho
2006-06-01
Full Text Available Com o objetivo de avaliar os efeitos da substituição do farelo de soja pela mistura raspa de mandioca+uréia sobre o desempenho, o consumo e a digestibilidade dos nutrientes em dietas à base de palma forrageira (Opuntia ficus indica, Mill e silagem de sorgo, oito vacas mestiças Holandês:Gir (60±30 dias em lactação e 491 kg de PV inicial foram distribuídas em dois quadrados latinos (4 × 4. A mistura raspa de mandioca+uréia substituiu 0, 33, 67 e 100% do farelo de soja nas dietas. Os consumos de matéria seca (expressos em kg/dia, % do PV, g/kg0,75 do PV, MO, PB, EE, FDN e CHOT diminuíram linearmente com a inclusão da raspa de mandioca. As ingestões de FDN (%PV, FDA, CNF e NDT não foram afetadas pelos níveis de raspa de mandioca+uréia nas dietas. A inclusão de raspa de mandioca+uréia influenciou a digestibilidade aparente de todos os nutrientes, sendo descrita por função quadrática. A produção de leite, a produção de leite corrigida para 4,0% de gordura e a produção de gordura diminuíram linearmente em 30, 20 e 0,8 g/dia, respectivamente, enquanto o teor de gordura e a eficiência alimentar, em kg de leite corrigido para 4,0% de gordura/kg de MS, não foram influenciadas pelos níveis de substituição do farelo de soja na dieta.This trial was conducted to investigate the replacement of soybean meal with a mixture of urea plus cassava scrapings on nutrient intake, digestibility, and production of crossbred lactating cows fed diets containing forage cactus (Opuntia ficus indica, Mill, sorghum silage, and concentrate. Eight crossbred holstein:zebu cows averaging 60±30 days in milk and initial body weight (BW of 491 kg were randomly assigned to two replicated 4 × 4 Latin squares and were fed diets with increasing levels of urea plus cassava scrapings: 0, 33, 67 or 100%. Replacing soybean meal with urea plus cassava scrapings linearly decreased the intakes of DM (kg, % BW and g/BW kg0.75, OM, CP, EE, NDF, and TC. However
Singh, Amarinder; Arvinda, S; Singh, Surjeet; Suri, Jyotsna; Koul, Surinder; Mondhe, Dilip M; Singh, Gurdarshan; Vishwakarma, Ram
2017-03-01
The limiting factor for the use of Cisplatin in the treatment of different type of cancers is its toxicity and more specifically urogenital toxicity. Oxidative stress is a well-known phenomenon associated with Cisplatin toxicity. However, in Cisplatin treated group, abnormal animal behavior, decreased body weight, cellular and sub-cellular changes in the kidney and sperm abnormality were observed. Our investigation revealed that Cisplatin when administered in combination with a natural product derivative (Urs-12-ene-3α,24β-diol, labeled as IN0523) resulted in significant restoration of body weight and protection against the pathological alteration caused by Cisplatin to kidney and testis. Sperm count and motility were significantly restored near to normal. Cisplatin caused depletion of defense system i.e. glutathione peroxidase, catalase and superoxide dismutase, which were restored close to normal by treatment of IN0523. Reduction in excessive lipid peroxidation induced by Cisplatin was also found by treatment with IN0523. The result suggests that IN0523 is a potential candidate for ameliorating Cisplatin induced toxicity in the kidney and testes at a dose of 100mg/kg p.o. via inhibiting the oxidative stress/redox status imbalance and may be improving the efflux mechanism. Copyright © 2017 Elsevier Inc. All rights reserved.
Remoção e concentração de urânio de rejeito de mina
Directory of Open Access Journals (Sweden)
Elizângela Augusta Santos
2011-01-01
Full Text Available A utilização de agentes lixiviantes como citrato de sódio e carbonato de amônio foram estudados para a recuperação de urânio (U de um rejeito de mina. Técnicas de concentração como precipitação e troca iônica foram avaliadas. O rejeito estudado apresenta 0,25% de U. Resultados mostraram extração máxima de aproximadamente 40% para ambos os reagentes. 62% de U foram precipitados do licor da lixiviação empregando-se solução a 10 mol L-1 de NaOH. Os carregamentos máximos do metal obtidos a pH 3,9 apontaram uma maior capacidade de remoção empregando-se a resina IRA 910 U cujo valor de carregamento máximo foi de 126,9 mg g-1 e de 148,3 mg g-1 para a DOWEX RPU.Abstract The use of leaching agents, such as sodium citrateand ammonium carbonate, were assessed for the extraction ofuranium from one mining residue containing 0.25% U.Concentration techniques such as precipitation and ion exchangewere employed to recover the uranium from the leaching liquor.Leaching results showed maximum uranium extraction of about 40% for both reagents. The use 10 mol L-1 NaOH to precipitatethe uranium from the leach liquor leads to a recovery of 62%;what was considered not satisfactory. In view of this, resins wereused to concentrate the uranium from the liquor and the metalloading obtained at pH 3.9 was higher for the resin DOWEXRPU, whose maximum loading maximum capacity was148,3 mg g-1, compared to 126,9 mg g-1 presented by the resinIRA 910 U.
Frecuencia de secuela renal pos evento agudo en síndrome urémico hemolítico
Directory of Open Access Journals (Sweden)
Jose Antonio Lulli-Cantoni
2015-04-01
Full Text Available Objetivos: Determinar la frecuencia de secuela renal después del evento agudo de Síndrome Urémico Hemolítico (SUH en niños y los factores asociados a la presencia de secuelas. Material y métodos: Estudio descriptivo y retrospectivo. Se revisaron las historias clínicas de los pacientes con SUH en el HNCH de 1997 al 2012, y se registraron datos de características clínicas, hallazgos de laboratorio y parámetros de función renal al ingreso, al alta y a los seis meses después del alta. En los casos que no contaban con control a los 6 meses, se intentó contactar a los pacientes para tomar nuevos controles. Resultados: Siete de 12 pacientes presentaron disminución en la tasa de filtración glomerular (TFG o proteinuria o hipertensión a los 6 meses o más después del episodio agudo, con un promedio de 30,75 meses de seguimiento. Tanto en los pacientes con secuelas como con recuperación renal se encontró una distribución similar de los factores asociados a secuelas como hipertensión al alta, proteinuria al alta, necesidad de diálisis, oligoanuria, leucocitosis > 20 000 cel/mm3 y síntomas neurológicos. Sin embargo algunas variables como oligoanuria y necesidad de diálisis se encontraron a niveles por debajo de los descritos en la literatura. Conclusiones: Es claro que existen pacientes con secuelas renales luego del episodio agudo de SUH que además presentan varios factores predictores de secuelas descritos en la literatura.
L’ange de l’Annonciation, chef de chœur dans Il Vangelo secondo Matteo de Pasolini
Directory of Open Access Journals (Sweden)
Sandra Gorgievski
2012-07-01
Full Text Available Médiateur par excellence entre le divin et le terrestre, l’ange – et l’épisode biblique de l’Annonciation en particulier, stimulent l’imaginaire contemporain, le mystère de l’incarnation ne pouvant être représenté mais figuré. S’appuyant sur le monde de références du spectateur – des textes source aux thèmes iconographiques médiévaux et renaissants (par exemple Giotto, Fra Angelico, Limbourg, del Cossa, Crivelli, della Francesca, L’Évangile selon saint Matthieu de Pasolini a principalement recours au son. De la musique sacrée (Bach, Misa Luba, Negro Spiritual et profane (Mozart, Prokofiev, Blind Willie Johnson aux chœurs qui fonctionnent comme des voix over, le film fait ‘entendre’ la présence angélique au spectateur. L’hybridité même des codes cinématographiques interroge le statut de l’image, tout en évoquant la présence immanente de l’ange –métaphore de l’indicible et l’inintelligible.Arch-mediator between the divine and the mundane, the angelic icon - and the Biblical episode of the Annunciation in particular - stimulate the contemporary imagination, as the mystery of the incarnation itself cannot be represented, but rather figured. Relying on the viewer’s world of references – from Biblical texts to Medieval and Renaissance iconography (Giotto, Fra Angelico, Limbourg, del Cossa, Crivelli, della Francesca among others, Pasolini also extensively resorts to sound in his Gospel According to St. Matthew. The film seeks to allow the viewer ‘hear’ angels, from sacred music (Bach, Misa Luba, Negro Spiritual, profane music (Mozart, Prokofiev, Blind Willie Johnson to choirs used as voice over. Hybrid cinematic devices question the status of images while they evoke the immanent presence of angels – metaphorically the unspeakable and unintelligible.
Directory of Open Access Journals (Sweden)
Edson Cabral da Silva
2006-12-01
Full Text Available Geralmente, grande parte do N de fertilizantes minerais e de plantas de cobertura de solo não é aproveitada pelo milho no cultivo imediato à aplicação, o qual pode ser absorvido pelas culturas cultivadas subseqüentemente. O objetivo deste trabalho foi avaliar o aproveitamento pelo milho do N residual da uréia, da crotalária (Crotalaria juncea e do milheto (Pennisetum americanum marcados com 15N, aplicados ao milho cultivado em sistema plantio direto, no ano agrícola anterior, num Latossolo Vermelho distroférrico no Cerrado. O estudo foi desenvolvido na fazenda experimental da Faculdade de Engenharia de Ilha Solteira-UNESP, Selvíria (MS, em áreas distintas. O delineamento experimental foi de blocos ao acaso com 15 tratamentos e quatro repetições, aplicados ao milho em 2001/02 e 2002/03. Os tratamentos foram dispostos em esquema fatorial 3 x 5, compreendendo a combinação de três coberturas de solo: crotalária juncea, milheto e vegetação espontânea (pousio, e cinco doses de N-uréia: 0, 30, 80, 130 e 180 kg ha-1. Após a colheita do milho, as duas áreas permaneceram em pousio nas entressafras e, em seguida, cultivadas novamente com milho, safras 2002/03 (experimento 1 e 2003/04 (experimento 2, utilizando adubação similar em todas as parcelas, para distinguir o efeito do N residual. O aproveitamento médio do N residual da parte aérea do milheto e da crotalária pelo milho foi inferior a 3,5 e 3 %, respectivamente, da quantidade inicial. A quantidade de N residual da uréia absorvida pelo milho aumentou de forma quadrática, no experimento 1, e linear, no experimento 2, em relação à dose de N aplicada, sendo o aproveitamento desta inferior a 3 %. As coberturas de solo não influenciaram o aproveitamento pelo milho do N residual da uréia, e vice-versa.The majority of N from mineral fertilizers and cover crops is usually not used by the very next corn crop, but can be absorbed by follow-up crops. The objective of this
Directory of Open Access Journals (Sweden)
Linda S. Gaulke
2006-08-01
trees to support this accelerated growth.A fertilização nitrogenada de florestas com biosólidos constitui um meio de aceleração do crescimento das plantas potencialmente não impactante ao meio. Os efeitos de fertilização de nitrogênio atmosférico na relação simbiôntica e de fixação de nitrogênio Alnus rubra Bong. (amieiro vermelho e Frankia foram avaliados em um estudo de campo. Biosólidos classe B digeridos anaerobicamente e uréia sintética (46% N foram aplicados a taxas de 140, 280 e 560 kg ha-1 de N disponível em um solo tipo Areia Quartzosa. Ao contrário das plantas do grupo controle (17 µmol C2H4 g-1 hr-1 ou fertilizadas com biosólidos (26-45 µmol C2H4 g-1 hr-1, plantas fertilizadas com uréia não apresentavam fixação de nitrogênio após um ano de cultivo. Ao final do segundo ano, todas as árvores em todos os tratamentos fixavam N (7 µmol C2H4 g-1 hr-1; 4-16 µmol C2H4 g-1 hr-1; e 20-29 µmol C2H4 g-1 hr-1 para controle, uréia e biosólidos, respectivamente. Plantas cultivadas sob remediação com biosólidos apresentaram maior biomassa na parte aérea ao final do ano 2 (50 g; 51 g; e 190 g para controle, uréia, e biosólidos, respectivamente, e também maiores concentrações de nitrogênio foliar em ambos os períodos analisados (N foliar no ano 1 26 g kg-1, 27 g kg-1, e 40 g kg-1; N foliar no ano 2 17 g kg-1, 19 g kg-1, and 23 g kg-1, respectivamente para controle, uréia e biosólidos. A maior taxa de crescimento de A. rubra pode ter resultado em maior exigência em N e os biosólidos supriram quantidades adicionais de nutrientes capazes de sustentar o crescimento acelerado.
Factors affecting de novo urinary retention after Holmium laser enucleation of the prostate.
Directory of Open Access Journals (Sweden)
Sung Han Kim
Full Text Available OBJECTIVE: Patients can experience urinary retention (UR after Holmium laser enucleation of the prostate (HoLEP that requires bladder distension during the procedure. The aim of this retrospective study is to identify factors affecting the UR after HoLEP. MATERIALS AND METHODS: 336 patients, which underwent HoLEP for a symptomatic benign prostatic hyperplasia between July 2008 and March 2012, were included in this study. Urethral catheters were routinely removed one or two days after surgery. UR was defined as the need for an indwelling catheter placement following a failure to void after catheter removal. Demographic and clinical parameters were compared between the UR (n = 37 and the non-urinary retention (non-UR; n = 299 groups. RESULTS: The mean age of patients was 68.3 (±6.5 years and the mean operative time was 75.3 (±37.4 min. Thirty seven patients (11.0% experienced a postoperative UR. UR patients voided catheter free an average of 1.9 (±1.7 days after UR. With regard to the causes of UR, 24 (7.1% and 13 (3.9% patients experienced a blood clot-related UR and a non-clot related UR respectively. Using multivariate analysis (p0.05. CONCLUSIONS: De novo UR after HoLEP was found to be self-limited and it was not related to learning curve, patient age, diabetes, or operative time. Efficient morcellation and careful control of bleeding, which reduces clot formation, decrease the risk of UR after HoLEP.
Keller, Max; Pop, Nathalie; Hutzler, Christoph; Beck-Sickinger, Annette G; Bernhardt, Günther; Buschauer, Armin
2008-12-25
Synthesis and characterization of (R)-N(alpha)-(2,2-diphenylacetyl)-N-(4-hydroxybenzyl)-N(omega)-([2,3-(3)H]-propanoyl)argininamide ([(3)H]-UR-MK114), an easily accessible tritium-labeled NPY Y(1) receptor (Y(1)R) antagonist (K(B): 0.8 nM, calcium assay, HEL cells) derived from the (R)-argininamide BIBP 3226, is reported. The radioligand binds with high affinity (K(D), saturation: 1.2 nM, kinetic experiments: 1.1 nM, SK-N-MC cells) and selectivity for Y(1)R over Y(2), Y(4), and Y(5) receptors. The title compound is a useful pharmacological tool for the determination of Y(1)R ligand affinities, quantification of Y(1)R binding sites, and autoradiography.
Directory of Open Access Journals (Sweden)
Eduardo Henrique Bevitori Kling de Moraes
2007-12-01
Full Text Available Avaliaram-se níveis de inclusão de uréia em suplementos sobre o consumo, a digestibilidade e parâmetros do metabolismo dos compostos nitrogenados em bovinos, manejados em pastagem de Brachiaria brizantha cv. Marandu, no período de seca. Foram utilizados quatro novilhos Holandês x Zebu, não-castrados, com peso médio inicial de 250 kg, fistulados no esôfago, rúmen e abomaso. Foram fornecidos suplementos isoprotéicos (20% PB, constituídos de milho grão, farelo de algodão, mistura mineral e diferentes níveis de uréia, com base na matéria natural (0; 1,6; 3,2; e 4,8%, na quantidade de 1% do peso vivo. O experimento foi conduzido segundo delineamento em quadrado latino 4 x 4. Os níveis de uréia influenciaram de forma quadrática (p The effects of different urea levels in supplements evaluated on intake, digestibility, and metabolism of nitrogenous compounds of crossbreed steers grazing on a pasture of Brachiaria brizantha cv Marandu during dry season. Four Holstein x Zebu steers, with average initial live weight of 250 kg, fistulated in the esophagus, rumen, and abomasum, were used. The animals received supplement (1% of live weight, containing 20% CP, based on corn grain, cottonseed meal, mineral mix, and urea in four levels, as fed (0, 1.6, 3.2, and 4.8%. The experiment was carried out according a 4 x 4 Latin square design. The urea levels showed a quadratic response (p < 0.10 to total dry matter (DM intake and DM intake from pasture, with better response close to 1.6% of urea. Total and rumen digestibilities of DM, organic matter, and CP, rumen ammonia concentration, and urine excretion of urea showed a positive linear relationship (p < 0.10 with urea levels in the supplements.
International Nuclear Information System (INIS)
Singh, Amarinder; Arvinda, S; Singh, Surjeet; Suri, Jyotsna; Koul, Surinder; Mondhe, Dilip M.; Singh, Gurdarshan; Vishwakarma, Ram
2017-01-01
The limiting factor for the use of Cisplatin in the treatment of different type of cancers is its toxicity and more specifically urogenital toxicity. Oxidative stress is a well-known phenomenon associated with Cisplatin toxicity. However, in Cisplatin treated group, abnormal animal behavior, decreased body weight, cellular and sub-cellular changes in the kidney and sperm abnormality were observed. Our investigation revealed that Cisplatin when administered in combination with a natural product derivative (Urs-12-ene-3α,24β-diol, labeled as IN0523) resulted in significant restoration of body weight and protection against the pathological alteration caused by Cisplatin to kidney and testis. Sperm count and motility were significantly restored near to normal. Cisplatin caused depletion of defense system i.e. glutathione peroxidase, catalase and superoxide dismutase, which were restored close to normal by treatment of IN0523. Reduction in excessive lipid peroxidation induced by Cisplatin was also found by treatment with IN0523. The result suggests that IN0523 is a potential candidate for ameliorating Cisplatin induced toxicity in the kidney and testes at a dose of 100 mg/kg p.o. via inhibiting the oxidative stress/redox status imbalance and may be improving the efflux mechanism. - Highlights: • Synthesis of a novel boswellic acid derivative (IN0523) • Counter oxidative stress induced due to Cisplatin • Protect against urogenital toxicity induced by Cisplatin
Energy Technology Data Exchange (ETDEWEB)
Singh, Amarinder [Academy of Scientific & Innovative Research (AcSIR), New Delhi (India); PK-PD-Toxicology and Formulation Division, CSIR-Indian Institute of Integrative Medicine, Canal Road, Jammu 180001, J& K (India); Arvinda, S [Deptt. of Pathology, Govt. Medical College, Jammu 180001, J& K (India); Singh, Surjeet [PK-PD-Toxicology and Formulation Division, CSIR-Indian Institute of Integrative Medicine, Canal Road, Jammu 180001, J& K (India); Suri, Jyotsna [Deptt. of Pathology, Govt. Medical College, Jammu 180001, J& K (India); Koul, Surinder [Bio-Organic Chemistry Division, CSIR-Indian Institute of Integrative Medicine, Canal Road, Jammu 180001, J& K (India); Mondhe, Dilip M. [Cancer Pharmacology Division, CSIR-Indian Institute of Integrative Medicine, Canal Road, Jammu 180001, J& K (India); Singh, Gurdarshan, E-mail: singh_gd@iiim.ac.in [PK-PD-Toxicology and Formulation Division, CSIR-Indian Institute of Integrative Medicine, Canal Road, Jammu 180001, J& K (India); Vishwakarma, Ram [Bio-Organic Chemistry Division, CSIR-Indian Institute of Integrative Medicine, Canal Road, Jammu 180001, J& K (India)
2017-03-01
The limiting factor for the use of Cisplatin in the treatment of different type of cancers is its toxicity and more specifically urogenital toxicity. Oxidative stress is a well-known phenomenon associated with Cisplatin toxicity. However, in Cisplatin treated group, abnormal animal behavior, decreased body weight, cellular and sub-cellular changes in the kidney and sperm abnormality were observed. Our investigation revealed that Cisplatin when administered in combination with a natural product derivative (Urs-12-ene-3α,24β-diol, labeled as IN0523) resulted in significant restoration of body weight and protection against the pathological alteration caused by Cisplatin to kidney and testis. Sperm count and motility were significantly restored near to normal. Cisplatin caused depletion of defense system i.e. glutathione peroxidase, catalase and superoxide dismutase, which were restored close to normal by treatment of IN0523. Reduction in excessive lipid peroxidation induced by Cisplatin was also found by treatment with IN0523. The result suggests that IN0523 is a potential candidate for ameliorating Cisplatin induced toxicity in the kidney and testes at a dose of 100 mg/kg p.o. via inhibiting the oxidative stress/redox status imbalance and may be improving the efflux mechanism. - Highlights: • Synthesis of a novel boswellic acid derivative (IN0523) • Counter oxidative stress induced due to Cisplatin • Protect against urogenital toxicity induced by Cisplatin.
Directory of Open Access Journals (Sweden)
Maykel Franklin Lima Sales
2008-09-01
Full Text Available Avaliaram-se os efeitos de suplementos múltiplos com diferentes níveis de uréia sobre o desempenho produtivo e os parâmetros nutricionais de bovinos em fase de terminação mantidos em pastagem diferida de capim-braquiária (Brachiaria brizantha cv. Marandu no período de transição águas-seca. A disponibilidade estimada de matéria seca das pastagens variou de 16.360 a 9.358 kg/ha. Para avaliação do desempenho produtivo, utilizaram-se 20 novilhos mestiços não-castrados, com 20 meses de idade e 376 kg de peso vivo. Os animais foram agrupados em lotes com pesos semelhantes, segundo um delineamento inteiramente casualizado, em quatro piquetes de 1,5 ha, onde receberam 1,5 kg/dia de suplemento isoprotéico (20% de PB, constituído de grãos de milho e soja moídos, mistura mineral e uréia nos níveis 0,0; 1,6; 3,2 ou 4,8% na matéria natural. O ganho médio diário - valor médio foi de 0,570 kg/dia - não foi influenciado pelos níveis de uréia do suplemento. Os parâmetros nutricionais foram avaliados utilizando-se quatro animais mestiços Holandês × Zebu, não-castrados, com peso médio inicial de 320 kg, fistulados no esôfago, rúmen e abomaso. Os animais receberam as mesmas quantidades de suplemento fornecidas aos animais do experimento de desempenho. Os níveis de uréia não afetaram significativamente o pH e a concentração de amônia ruminal. Para obtenção de ganhos de 0,5 a 0,6 kg/dia, pode-se utilizar apenas milho, uréia e mistura mineral em suplementos múltiplos para terminação de bovinos em pasto diferido.The effects of multiple supplements with different urea levels on the productive performance and nutritional characteristics, for finishing beef cattle kept in deferred pasture of palisade grass (Brachiaria brizantha cv. Marandu in the transition period of rainy to dry season were evaluated. The estimated dry matter availability of the pasture ranged from 16,360 to 9,358 kg/ha. In the performance trial, 20
Directory of Open Access Journals (Sweden)
Manuela Silva Libanio Tosto
2008-10-01
Full Text Available Avaliou-se a influência da adição de 0; 0,5; 1 ou 1,5% de uréia no resíduo desidratado de vitivinícolas - utilizado em associação a palma forrageira na alimentação de caprinos - no consumo e na digestibilidade dos nutrientes. Foram utilizados 24 caprinos machos castrados, sem padrão racial definido, com peso vivo médio de 18 kg, distribuídos em blocos ao acaso, de acordo com o peso vivo. O período experimental foi de 20 dias: 15 para adaptação e 5 para coleta. A adição de teores crescentes de uréia ao resíduo desidratado de vitivinícola possibilitou aumento do consumo de matéria seca (MS, matéria orgânica (MO, proteína bruta (PB e fibra em detergente neutro (FDN, expressos em kg/dia, %PV e em g/kgPV0,75. Observou-se consumo linear crescente de nutrientes digest��veis totais (NDT, carboidratos totais (CT e carboidratos não-fibrosos (CNF, em %PV e g/kgPV0,75. Não houve diferença significativa nos consumos de NDT, CT e CNF expressos em kg/dia, cujos valores médios foram 0,363; 0,575 e 0,258, respectivamente. Entretanto, a adição de uréia ao resíduo não influenciou os coeficientes de digestibildade de MS, MO e FDN (médias de 48,13; 46,08 e de 20,37%, respectivamente. Os coeficientes de digestibilidade de CNF apresentaram crescimento linear, enquanto os de PB apresentaram comportamento quadrático, com valor máximo de 48,93%, com a adição de 1,3% de uréia ao resíduo. O uso de uréia no resíduo desidratado de vitivinícola elevou linearmente o consumo de nutrientes, contudo, o nível de 1,3% é o mais indicado, pois promove melhor digestibilidade da proteína bruta de dietas contendo esse alimento alternativo.The effect of the addition of 0.0, 0.5, 1.0 and 1.5% of urea to dehydrated vineyards residue, associated to forage cactus palm in the feeding of goats on intake and nutrient digestibility was evaluated. Twenty-four castrated crossbred goats, without defined breed, with average 18 kg of BW were
Guven, Selcuk; Basiri, Abbas; Varshney, Anil Kumar; Aridogan, Ibrahim Atilla; Miura, Hiroyasu; White, Mark; Kilinc, Mehmet; de la Rosette, Jean
2017-03-01
To evaluate the characteristics and outcomes of ureteroscopy (URS) in children treated in several hospitals participating in the Clinical Research Office of the Endourological Society (CROES) Study, and to present the overall results of pediatric URS compared with adults. The CROES Study collected data on consecutive patients treated with URS for urolithiasis at each participating center over a 1-year period. The collected prospective global database includes data for 11,885 patients who received URS at 114 centers in 32 countries. Of these URS-treated patients, 192 were ≤18 years old. Of the 114 centers participating in the study, 42% had conducted pediatric URS. Among the pediatric cases, 7 were infants, 53 were small children, 59 were school-aged children, and 73 were adolescents. A considerable number (37%) of the pediatric cases had previously undergone URS treatment. No differences in the surgical outcomes of the adults and children were reported. The URS-treated children had a greater number of positive preoperative urine cultures when compared with adult cases treated. A semirigid scope was used in the vast majority of pediatric cases (85%). According to the present data, within the group of URS-treated children, the younger the child, the more readmissions occurred. URS is as efficient and safe in children as it is in adults. The data suggest that readmissions among URS-treated children are associated with age, with the likelihood of readmissions greater among younger age groups. Copyright © 2016 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Pedro Paulo Sobolow de Souza
2004-08-01
Full Text Available A presente pesquisa teve por objetivo avaliar o desempenho, características das carcaças e componentes não constituintes da carcaça de cordeiros confinados, submetidos a uma dieta convencional, com outras três, que tiveram a fonte de proteína verdadeira substituída por níveis crescentes de uréia. Utilizaram-se 48 cordeiros inteiros, mestiços Ile de France x Corriedale, desmamados aos 70 dias de idade. A recria e a terminação foram efetuadas em regime de confinamento total, e os animais foram distribuídos, aleatoriamente, em quatro grupos com distintos níveis de uréia (0; 0,4; 0,8 e 1,2% da matéria seca total. Os animais foram abatidos ao redor de 32kg de peso vivo. Não foram observadas diferenças significativas entre os tratamentos para as variáveis: ganho de peso médio diário, peso vivo ao abate, pH muscular (0 e 45 minutos e 24 horas após o abate, pesos da carcaça quente e fria, porcentagem de perda de peso ao resfriamento, rendimentos comercial e verdadeiro, pesos dos componentes não constituintes da carcaça, condição corporal, conformação e acabamento. Entretanto, para peso da pele, o nível 0%, diferiu do nível 0,8%. Para as variáveis, morfometria e proporção dos cortes das carcaças, não foram observadas diferenças entre os níveis de uréia. O comprimento da perna(cm dos cordeiros com nível de 0,8%, foi inferior ao do nível 0%. Na variável índice de compacidade da perna, o nível 0,8% , diferiu dos níveis 0 e 0,4%. Concluiu-se que a utilização da uréia nos teores apresentados na presente pesquisa, é uma prática viável, não tendo afetado variáveis consideradas.This trial was carried out to evaluate performance, carcass traits and non-carcass components of lambs fed with a conventional diet plus other three diets with crescent levels of urea in substitution of a true protein source. 48 crossbred male lambs (Ile de France x Corriedale weaned at 70 days of age were used. They grew and were
Hall, Eric E.; Walkington, Helen; Shanahan, Jenny Olin; Ackley, Elizabeth; Stewart, Kearsley A.
2018-01-01
This study examines how Undergraduate Research (UR) mentoring fits into the career profile of award-winning UR mentors and the factors that motivate engagement as UR mentors. Twenty-four award-winning UR mentors in four countries were interviewed about their mentoring practices. Six themes emerged: (1) Academic Identity and Motivations; (2)…
Ten Salient Practices of Undergraduate Research Mentors: A Review of the Literature
Shanahan, Jenny Olin; Ackley-Holbrook, Elizabeth; Hall, Eric; Stewart, Kearsley; Walkington, Helen
2015-01-01
This paper identifies salient practices of faculty mentors of undergraduate research (UR) as indicated in the extensive literature of the past two decades on UR. The well-established benefits for students involved in UR are dependent, first and foremost, on high-quality mentoring. Mentorship is a defining feature of UR. As more and different types…
Directory of Open Access Journals (Sweden)
Luciana Brandão Torres
2003-06-01
Full Text Available Com o objetivo de avaliar diferentes níveis de bagaço e uréia como substituto ao farelo de soja em dietas para bovinos leiteiros em crescimento, dois experimentos foram realizados. No primeiro, 20 bezerros mestiços Holandês x Zebu foram distribuídos em quatro tratamentos em delineamento inteiramente casualizado. Os animais receberam dietas à base de palma forrageira e bagaço de cana em níveis de 5,5; 14,4; 24,4 e 34% da matéria seca total. O ganho de peso diminuiu, enquanto a conversão alimentar, e os consumos de FDN e FDA aumentaram linearmente com a inclusão de bagaço. O consumo máximo de MS foi estimado em 2,73% do peso vivo com 30% de bagaço de cana. No segundo experimento foi avaliada a substituição do farelo de soja (FS por uréia mais milho moído (UM, em dietas à base de palma forrageira, sobre o desempenho de novilhas mestiças Holandês x Zebu. Vinte animais foram alimentados de acordo com os níveis de substituição do FS por UM (0, 20, 40 e 60% distribuídos em blocos ao acaso. Não houve efeito da substituição parcial do farelo de soja por milho e uréia sobre o desempenho de novilhas mestiças.In order to evaluate different levels of sugar cane bagasse and urea as replacement of soybean meal in growing dairy cattle diets, two trials were conducted. In the first, twenty crossbreed bull calves (Holstein x Zebu were allotted in a completely randomized design with four treatments. The animals were fed forage cactus based diets, containing levels of 5.5, 14.4, 24.4 and 34% of sugar cane bagasse on the dry matter basis. The liveweight gain decreased while the feed: gain ratio, FDN and FDA intakes increased linearly in function of the increased level of sugar cane bagasse. The maximum daily dry matter intake of 2.73% of LW was estimated with 30% of sugar cane bagasse in the diet. In the second, was evaluated the partial replacement of soybean meal (SM by urea plus corn cracked (UC in forage cactus based diets on the
Directory of Open Access Journals (Sweden)
Valéria Cristina P. Zago
1999-11-01
Full Text Available O excesso de nitrato nos alimentos é indesejável devido à sua conversão a nitrito, composto conhecido por participar de reações formadoras de compostos cancerígenos e modificadores da hemoglobina.A influência da aplicação de esterco bovino, uréia e a associação destes nos teores de N-NO3- presente nos tecidos foliares de couve (Brassica oleracea var. acephala foi avaliada, com o objetivo de verificar o efeito de fontes e doses diferentes de nitrogênio no acúmulo deste composto. Para tanto, um experimento foi conduzido a campo, de março a agosto de 1995, na Embrapa Agrobiologia.O delineamento experimental adotado foi o de blocos ao acaso, com quatro repetições e seis tratamentos: adubação com esterco bovino (20 t/ha, aplicação de N-uréia (900 kg/ha, associação de esterco (20 t/ha com doses crescentes de N-uréia (225; 450 e 900 kg/ha e testemunha. O espaçamento foi de 0,6 m entre plantas, 0,6 m entre linhas e 0,8 m entre fileiras duplas, perfazendo um total de 24 parcelas com 9,6 m² cada. Verificou-se que as plantas adubadas exclusivamente com esterco apresentaram nos limbos foliares, menores conteúdos de nitrato que aquelas que receberam uréia complementar (17,6 mg/g M.F. e 303 a 579 mg/g M.F., respectivamente. Enquanto os teores de N-NO3- nos pecíolos de todos os tratamentos foram pelo menos três vezes maiores que os observados nos limbos foliares (1.830 e 561 mg/g M.F., respectivamente. AOMS recomenda uma dose diária aceitável (DDA de 53,3 mg de N-NO3-, para um adulto de 65 kg, isto é, a quantidade máxima deste composto que pode ser ingerida diariamente, através dos alimentos e da água. Considerando-se os dados obtidos no experimento, seria necessário o consumo de 2,67 kg de couve (limbos foliares quando produzida apenas com esterco (20 t/ha e 0,18 kg quando adubadas com esterco (20 t/ha + 111 kg/ha de uréia (próximo a dosagem recomendada pelo Manual de Adubação do Rio de Janeiro, para atingir a DDA
Directory of Open Access Journals (Sweden)
Paulo Roberto Ernani
2005-04-01
Full Text Available O método de aplicação dos resíduos vegetais e dos fertilizantes nitrogenados pode afetar as reações do nitrogênio no solo, principalmente no plantio direto. O presente trabalho objetivou avaliar esses efeitos na disponibilidade de N para o milho em dois solos, em casa-de-vegetação. Combinações de métodos (ausência, incorporada ou na superfície de adição de palha de aveia (0,4kg m-2 e uréia (50mg N kg-1 foram aplicadas em unidades experimentais (7dm³ vaso-1 de dois solos, perfazendo um fatorial 3 x 3 x 2. O milho foi semeado no dia da aplicação dos tratamentos e as plantas foram cultivadas durante trinta dias, sobre um Neossolo e um Nitossolo, respectivamente com 50 e 520g kg-1 de argila e 8 e 48g kg-1 de matéria orgânica. A aplicação de palha de aveia, principalmente sobre a superfície do solo, beneficiou o desenvolvimento das plantas, possivelmente pela manutenção de maior quantidade de umidade nos solos. A aplicação de uréia não afetou nenhum parâmetro vegetal no solo argiloso, talvez porque a decomposição da matéria orgânica liberou mais N do que a imobilização ocasionada durante a decomposição da palha; no solo arenoso, entretanto, a uréia foi benéfica quando incorporada ao solo, e prejudicial quando adicionada na superfície, provavelmente devido à toxidez de amônia. Dessa forma, o efeito da decomposição da palha de aveia na disponibilidade de N foi função do teor de matéria orgânica original do solo.Management of both crop residues and nitrogen fertilizers affects soil N reactions especially on no-till systems. The magnitude of these effects on N availability to maize was evaluated in a greenhouse study. Combinations of oat straw and urea (absence, soil incorporated or surface applied were added to experimental units (7-dm³ per pot of two soils, in a 3 x 3 x 2 factorial combination. Plants were sown just following treatments addition, and grown for thirty days in two soils (Typic
Tauber, Volkmar; Wohlmuth, Martin; Hochmuth, Andreas; Schimetta, Wolfgang; Schimetta, Wofgang; Krause, F Steffen
2015-01-01
To evaluate the efficacy of flexible ureterscopy (fURS) and extracorporal shockwave lithotripsy (SWL) in the treatment of urolithiasis, complemented by a subgroup analysis of lower pole calyx. Retrospective analysis of patients treated by fURS or SWL was performed by independent variables such as gender, age, nephrolith size, double-J stent (DJ stent) and stone localisation. Out of 326 patients, 165 were treated by SWL and 161 by fURS. Complete stone removal was achieved by fURS in 83.2% and by SWL in 43.0% (p auxillary DJ stent was performed more often preoperative before fURS. The subgroup analysis of lower pole calyx confirmed these evaluations. Complete stone-free removal was almost 8 times higher after fURS compared to SWL. The efficacy of fURS in treatment of urolithiasis is substantially higher than the efficacy of SWL. © 2015 S. Karger AG, Basel.
Cauchy inequality and uncertainty relations for mixed states
International Nuclear Information System (INIS)
Shirokov, M.I.
2004-01-01
Cauchy inequality (CI) relates scalar products of two vectors and their norms. I point out other similar inequalities (SI). Starting with CI Schroedinger derived his uncertainty relation (UR). By using SI other various UR can be obtained. It is shown that they follow from the Schroedinger UR. Two generalizations of CI are obtained for mixed states described by density matrices. Using them two generalizations of UR for mixed states are derived. Both differ from the UR generalization known from the literature. The discussion of these generalizations is given
Directory of Open Access Journals (Sweden)
S.T. Fernandes
2001-12-01
Full Text Available O trabalho teve como objetivos avaliar algumas condições de estocagem de soro e de plasma com EDTA 10% utilizados para determinação dos valores de uréia e creatinina em cães, e avaliar a possibilidade de substituir o soro pelo plasma conservado com EDTA 10%. Foram realizadas 3600 análises (1800 amostras de soro e 1800 de plasma com amostras que permaneceram em temperaturas ambiente, de refrigeração e de congelamento. As análises foram realizadas imediatamente após a obtenção da amostra (tempo 0 e após 2, 6, 12, 24, 72 horas e 30 e 60 dias após a coleta do sangue. Os resultados permitiram concluir que a uréia conservou-se por mais tempo na amostra sérica refrigerada até 30 dias e a creatinina na amostra sérica congelada até 72h. O soro mostrou mais estabilidade que o plasma em todas as condições de estoque estabelecidas.Aiming to evaluating some conditions of EDTA 10% serum and plasma storage for urea and creatinine values determinations in canines as well as analyzing the possibility of serum substitution by plasma, a total of 3600 samples (1800 serum and 1800 of plasma were analyzed at room, refrigeration and freezing temperatures. Different time intervals were used in the analysis: immediately after sampling (time 0, and at 2, 6, 12, 24, and 72 hours, and 30 and 60 days after the blood collection. The data showed that urea remains conserved for more time in the refrigerated serum sample until 30 days and the creatinine in the frozen serum sample until 72 hours. Serum showed more stability than plasma in all storage conditions established.
Raharison, Fidiniaina
2008-01-01
L'objectif de notre étude est d'élaborer un document de référence mettant en relation l'anatomie, l'imagerie et la clinique du lémurien brun (Eulemur fulvus) et débouchant sur des mesures échographiques normales des reins et du cœur. Les études anatomique et tomodensitométrique ont été effectuées sur deux lémuriens et l'étude échographique sous différents modes sur 16 animaux après anesthésie. Les coupes anatomiques et tomodensitométriques nous ont permis de préciser la position et la conform...
Ghali, Fady; Moses, Rachel A; Raffin, Eric; Hyams, Elias S
2016-10-01
This study sought to evaluate factors associated with unplanned hospital return (UR) following transurethral resection of bladder tumor (TURBT), the largest source of readmission among ambulatory urological procedures. A retrospective review of TURBTs at a single academic institution between April 2011 and August 2014 was performed. Demographics, comorbidities, length of stay, tumor size and multiple other factors were recorded. UR was recorded within 30 days of surgery. Bivariate and multivariable analyses were performed to determine factors associated with UR. Among 708 patients undergoing TURBT, 23.9% were female with a mean age of 70 years. The rate of UR was 10.9%. The most common cause of UR was gross hematuria, accounting for 70%. On bivariate analysis, Foley catheter placement in the operating room, non-aspirin anticoagulation and index length of stay longer than 24 h were associated with hematuria-related UR (p hematuria-related UR (p 0.05). On multivariable analysis, only Foley placement in the operating room remained associated with higher rates of hematuria-related UR, while preoperative antibiotics, female gender and aspirin therapy remained associated with a lower likelihood of this event. UR following TURBT is common and typically results from gross hematuria. Patients with postoperative Foley catheterization in the operating room may require additional counseling or supervision before discharge, and should be considered for discharge with a Foley rather than having a prompt voiding trial.
Allele mining across DREB1A and DREB1B in diverse rice ...
Indian Academy of Sciences (India)
1. Kba lum. UR8. Landrace. Upland. Meghalaya. 0.13. 9. 0.91. 15. 73.33. 2 khonorullo 1. UR9. Landrace. Upland. Nagaland. 0.05. 2. 0.78. 13. 80.00. 3. Nagaland. UR10. Landrace. Upland. Nagaland. 0.15. 11. 1.84. 24. 40.00 special. 4. Kba thang. UR11. Landrace. Upland. Meghalaya. 0.06. 3. 0.64. 7. 46.67 maw. 5.
Directory of Open Access Journals (Sweden)
Anna Leticia de O. Cestari
2008-03-01
Full Text Available OBJETIVO: A doença pneumocócica é importante problema de saúde pública e raramente há associação desta infecção com a síndrome hemolítico-urêmica (SHU grave. O objetivo deste artigo é relatar o caso de um paciente com esta associação. DESCRIÇÃO DO CASO: Criança do sexo masculino, com 17 meses de idade, admitida no hospital com insuficiência respiratória aguda e necessitando de suporte ventilatório. O exame radiológico mostrava extensa opacidade homogênea em hemitórax direito. A hemocultura foi positiva para Streptococcus pneumoniae. Nos exames de admissão, notaram-se: hemoglobina de 6,5g/dL, 38.000 plaquetas/mm³, uréia de 79mg/dL e creatinina de 1,64mg/dL. No primeiro dia, apresentou oligoanúria e hipervolemia, necessitando de hemodiafiltração. Evoluiu com disfunção de múltiplos órgãos e óbito no sétimo dia. A necrópsia mostrou áreas extensas de necrose cortical e tubular renal, com depósito de fibrina nas arteríolas. COMENTÁRIOS: A SHU associada ao pneumococo apresenta morbidade e mortalidade elevadas. Em crianças com doença pneumocócica invasiva e acometimento hematológico ou renal grave, deve-se estar atento a esta rara complicação. Merecem investigação os seguintes aspectos relacionados à doença: a função da detecção precoce de antígenos T ativados no diagnóstico e terapêutica, o papel do fator H na patogênese, o método ideal de substituição renal e a definição do prognóstico em longo prazo.OBJECTIVE: Pneumococcal diseases are a major public health problem. Severe hemolytic-uremic syndrome is an uncommon complication. The aim of this study is to report a child with this complication. CASE DESCRIPTION: A male child with 17 months old was admitted to the hospital, due to acute respiratory failure, needing ventilatory support. Roentgenogram demonstrated massive condensation of right lung and Streptococcus pneumonia was isolated from blood cultures. Laboratory tests showed
Directory of Open Access Journals (Sweden)
Ibrahim F. Ghalayini
2006-12-01
Full Text Available OBJECTIVE: We compared the efficacy of extracorporeal shock wave lithotripsy (ESWL and ureteroscopy (URS for the treatment of distal ureteral calculi with respect to patient satisfaction. MATERIALS AND MHETODS: This is a prospective study where a total of 212 patients with solitary, radiopaque distal ureteral calculi were treated with ESWL (n = 92 using Dornier lithotriptor S (MedTech Europe GmbH or URS (n = 120. Patient and stone characteristics, treatment parameters, clinical outcomes, and patient satisfaction were assessed for each group. RESULTS: The 2 groups were comparable in regard to patient age, sex, stone size, and side of treatment. The stone-free status for ESWL and URS at 3 months was 81.5% and 97.5%, respectively (p < 0.0001. In addition, 88% of patients who underwent ESWL versus 20% who underwent URS were discharged home the day of procedure. Minor complications occurred in 3.3% and 8.3% of the ESWL and URS groups, respectively (p = 0.127. No ureteral perforation or stricture occurred in the URS group. Postoperative flank pain and dysuria were more severe in the URS than ESWL group, although the differences were not statistically significant (p = 0.16. Patient satisfaction was high for both groups, including 94% for URS and 80% for ESWL (p = 0.002. CONCLUSIONS: URS is more effective than ESWL for the treatment of distal ureteral calculi. ESWL was more often performed on an outpatient basis, and showed a trend towards less flank pain and dysuria, fewer complications and quicker convalescence. Patient satisfaction was significantly higher for URS according to the questionnaire used in this study.
Directory of Open Access Journals (Sweden)
S. TAŞ
2014-06-01
Full Text Available The purpose of this study was to evaluate the effects of Ulva rigida C. Agardh, one of the green algae, on and antioxidative system in the propylthiouracil (PTU-induced hypothyroid rats. Thirty-two rats randomly divided into four groups: control (C, control+U. rigida extract (C+UR, hypothyroid (H and hypothyroid+U. rigida extract (H+UR. U. rigida (2% was administered in drinking water for 5 weeks after the induction of hypothyroidism. Hypothyroid rats were under oxidative stress as reflected by icreased plasma and tissue malondialdehyde (MDA levels. U. rigida reduced serum total cholesterol and,- triglyceride levels and plasma and heart skeletal muscle, liver and,- kidney tissue MDA levels in the H+UR group. Serum total cholesterol and tissues MDA levels were reduced in the C+UR group. Whole blood glutathione peroxidase and erythrocyte superoxide dismutase activities were increased in the H+UR and C+UR groups compared with those of te respective control groups. Paraoxonase and arylesterase activities were lower in the H group and U. rigida increased paraoxonase and arylesterase activities in C+UR and H+UR groups. We conclude that hypothyroidism is associated with oxidative stress and, U. rigida extract might have a potential use as a protective antioxidant agent in hypothroidism.
Use of hospital discharge data to monitor uterine rupture--Massachusetts, 1990-1997.
2000-03-31
Uterine rupture (UR), a potentially life-threatening condition for both mother and infant, occurs in vaginal birth after cesarean section (VBAC) (1-4). During 1990-1997, the proportion of vaginal deliveries among women who had previous cesarean sections (CS) in Massachusetts increased 50%, from 22.3% to 33.5% (5). Concern about a corresponding increase in UR prompted the Massachusetts Department of Public Health and CDC to initiate a state-wide investigation that included an assessment of the validity and reliability of International Classification of Diseases, Ninth Revision, Clinical Modification (ICD-9-CM) (6), codes in hospital discharge data to identify UR cases. This report summarizes the results of the investigation, which indicate that ICD-9-CM codes related to UR, designed before increased concern about UR, lack adequate specificity for UR surveillance and have not been applied consistently over time.
Liu, Chung-Hsiang; Lin, Yi-Wen; Tang, Nou-Ying; Liu, Hsu-Jan; Hsieh, Ching-Liang
2012-01-01
Uncaria rhynchophylla (UR), which is a traditional Chinese medicine, has anticonvulsive effect in our previous studies, and the cellular mechanisms behind this are still little known. Because of this, we wanted to determine the importance of the role of UR on kainic acid- (KA-) induced epilepsy. Oral UR for 6 weeks can successfully attenuate the onset of epileptic seizure in animal tests. Hippocampal mossy fiber sprouting dramatically decreased, while neuronal survival increased with UR treatment in hippocampal CA1 and CA3 areas. Furthermore, oral UR for 6 weeks significantly attenuated the overexpression of astrocyte proliferation and S100B proteins but not γ-aminobutyric acid A (GABA(A)) receptors. These results indicate that oral UR for 6 weeks can successfully attenuate mossy fiber sprouting, astrocyte proliferation, and S100B protein overexpression and increase neuronal survival in KA-induced epileptic rat hippocampus.
Chung-Hsiang Liu; Yi-Wen Lin; Nou-Ying Tang; Hsu-Jan Liu; Ching-Liang Hsieh
2012-01-01
Uncaria rhynchophylla (UR), which is a traditional Chinese medicine, has anticonvulsive effect in our previous studies, and the cellular mechanisms behind this are still little known. Because of this, we wanted to determine the importance of the role of UR on kainic acid- (KA-) induced epilepsy. Oral UR for 6 weeks can successfully attenuate the onset of epileptic seizure in animal tests. Hippocampal mossy fiber sprouting dramatically decreased, while neuronal survival increased with UR treat...
Photolytic transformation products and biological stability of the hydrological tracer Uranine
International Nuclear Information System (INIS)
Gutowski, Lukasz; Olsson, Oliver; Lange, Jens; Kümmerer, Klaus
2015-01-01
Among many fluorescence tracers, Uranine (sodium fluorescein, UR) has most widely been used in hydrological research. Extensive use of UR for tracing experiments or commercial use might cause a potential risk of long-term environmental contamination. As any organic substance released to the environment, also UR is subjected to chemical and physical reactions that can be chemical, biological and photolysis processes. These processes transform the parent compound (PC) and have not been extensively investigated for UR. This study applies two OECDs (301 D and 301 F) tests and a screening water sediment test (WST) to investigate the biodegradability of the PC. Photolysis in water was explored by Xe lamp irradiation. Subsequently, the biodegradability of the photolysis mixtures was examined. The primary elimination of UR was monitored and structures of its transformation products (TPs) were elucidated by HPLC–FLD–MS/MS. UR was found not readily biodegradable, although small degradation rates could be observed in the OECD 301 D and WST. HPLC–FLD analysis showed high primary elimination of the tracer during photolysis. However, the low degree of mineralization found indicates that the UR was not fully degraded, instead transformed to TPs. A total of 5 photo-TPs were identified. According to MS/MS data, chemical structures could be proposed for all identified photo-TPs. Likewise the parent compound it was demonstrated that photo-TPs were largely recalcitrant to microbial degradation. Although we did not find indications for toxicity, target-oriented studies on the environmental impact of these photo-TPs are warranted. Results obtained in this study show that deeper investigations are necessary to fully understand fate and risk connected to the use of UR. - Highlights: • Uranine (UR) was not biodegraded in water and water-sediment system (WST). • Only small degradation rate occurred in OECD 301 D and WST. • Photolysis leads to incomplete mineralization of UR.
Analysis of the Umbrella Roof for lifting
International Nuclear Information System (INIS)
Shaaban, A.
1983-01-01
In addition to supporting the dead loads and the operational loads, the Umbrella Roof (UR) has two major functions to which it was designed. First is to allow access for repair and removal of any of the TF coils, the upper PF coils and the Vacuum Vessel sections; and second, is to reproduce the exact positioning of the upper PF coils every time the UR is placed over the Tokamac. To provide these functions, the UR is designed to be lifted as one integrated structure to which the upper PF coils are attached. In order to ensure precise positioning of the UR, a redundant system of 13 guide pins were provided on the bottom of the radial beams, and four shear lugs were provided atop the central column. Mating reciprocals with very close tolerance for the guide pins were provided in the tops of the 13 peripheral columns. To meet close tolerances and to accommodate such high redundancy in match points, accurate analysis was necessary by which the center of gravity of the UR can be located and the deflection of all match points can be computed. Also stress analysis of the members of the UR was necessary because when the UR is lifted it is denied the midpoint support over the center column; and also the beams of the UR are not interconnected by moment-capable joints, thus if provisions are not made to support every radial beam, those which are not supported would yield and collapse. In this paper, the lifting schemes proposed for the UR are discussed and the results of the analysis performed for the elected scheme are presented. Also presented is a unique application of the NASTRAN code by which the center of gravity of the UR was located by allowing a refined model of the UR to swing until it came to rest under an arbitrary lift point
Directory of Open Access Journals (Sweden)
Chung-Hsiang Liu
2012-01-01
Full Text Available Uncaria rhynchophylla (UR, which is a traditional Chinese medicine, has anticonvulsive effect in our previous studies, and the cellular mechanisms behind this are still little known. Because of this, we wanted to determine the importance of the role of UR on kainic acid- (KA- induced epilepsy. Oral UR for 6 weeks can successfully attenuate the onset of epileptic seizure in animal tests. Hippocampal mossy fiber sprouting dramatically decreased, while neuronal survival increased with UR treatment in hippocampal CA1 and CA3 areas. Furthermore, oral UR for 6 weeks significantly attenuated the overexpression of astrocyte proliferation and S100B proteins but not γ-aminobutyric acid A (GABAA receptors. These results indicate that oral UR for 6 weeks can successfully attenuate mossy fiber sprouting, astrocyte proliferation, and S100B protein overexpression and increase neuronal survival in KA-induced epileptic rat hippocampus
Directory of Open Access Journals (Sweden)
Y. S. Zhi
2016-01-01
Full Text Available Both unipolar resistive switching (URS and bipolar resistive switching (BRS behaviors are observed in Cu2O/Ga2O3 stacked layer. The conversion between BRS and URS is controllable and reversible. The switching operations in BRS mode requires smaller voltage than that in the URS mode. The oxygen vacancies closed to the Cu2O/Ga2O3 interface contributes to the BRS, and the bias-controlling filament formation/rupture in depletion layer is considered to contribute to the URS. The URS happens only in the negative voltage part due to the nature of directionality of the p-n junction. The process reported here can be developed to design memory device.
Data of evolutionary structure change: 1A7LC-1URSA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1A7LC-1URSA 1A7L 1URS C A EGKLVIWIN-GDKGYNGLAEVGKKFEKDTGIKVTVEHP-...ntryChain> 1URS A 1URSA PDVVFGMPH...dbID>1URS A 1URSA DMVSKYHWMTP... 1URSA PWPTLPNGKHA A 1URSA ANAHG---FMYDQ
Directory of Open Access Journals (Sweden)
Gisele Fernanda Mouro
2002-07-01
Full Text Available O objetivo deste trabalho foi avaliar o efeito da substituição do milho pela farinha de mandioca de varredura, em dietas de cabras Saanen em lactação, sobre a degradabilidade potencial, efetiva e efetiva corrigida das rações, bem como sobre o pH ruminal e as concentrações de amônia ruminal, uréia plasmática e uréia no leite em cabras em lactação. Foram utilizadas quatro cabras há 100 dias em lactação. O delineamento utilizado foi o quadrado latino 4 x4, em que os tratamentos consistiram em níveis de 0, 33, 67 e 100% de substituição do milho pela farinha de mandiocade varredura. A degradabilidade das rações experimentais foi determinada em bovinos pela técnica in situ. Apesar de a degradabilidade potencial das dietas experimentais ter tido pequena variação para MS, PB e amido, a degradabilidade efetiva e a degradabilidade efetiva corrigida da MS, da PB e do amido aumentaram com a substituição do milho pela farinha de varredura de mandioca. Os tratamentos não influenciaram o pH ruminal, bem como as concentrações de NH3-ruminal, uréia plasmática e uréia do leite. Houve correlação positiva (PThe objectives of this work were to evaluate effects of replacing corn by cassava by-product meal, in diets of Saanen lactating goats, on potencial, effective and corrected effective degradability of diets with steers, and on ruminal pH and ruminal ammonia, plasma urea nitrogen (PUN and milk urea nitrogen (MUN concentrations in lactating goats. Two steers and four multiparous goats fitted with ruminal cannula and 100 days in milking were used. The design was a 4 x 4 Latin square and treatments as following: 0, 33, 67 and 100% replacement of corn by cassava by-product meal. Rations degradability was determined using in situ technique. Potential degradability of experimental diets showed small variation for dry matter (DM, crude protein (CP and starch (S but effective and corrected effective degradability increased as corn was
DEFF Research Database (Denmark)
Martov, Alexey; Gravas, Stavros; Etemadian, Masoud
2015-01-01
patients who did or did not receive antibiotic prophylaxis regarding the frequency of anticoagulation medication, previous treatment with URS, stone burden, previous presence of kidney stones, duration of current URS, and complications post-URS. The prevalence of fever and UTI was low (≤2.2%) and similar...
Effects of sulfur dioxide on conifers
Energy Technology Data Exchange (ETDEWEB)
Govi, G.; Tagliani, F.; Cimino, A.
1974-01-01
Trials on the resistance of several conifer and oak species to the effects of sulfur dioxide at different concentrations and moisture levels were conducted. 72 combinations were experimented. The damages began to appear under the following conditions: Abies alba: 0.3 ppm, 25/sup 0/C, 70% ur after 24 hours; Picea excelsa: 0.3 ppm, 15/sup 0/C, 70-95% ur after 24 hours; Cedrus deodara: 0.3 ppm, 15/sup 0/C, 95% ur after 48 hours; Pinus pinea: 0.3 ppm, 15/sup 0/C, 70-95% after 72 hours; Pinus strobus 0.3 ppm, 25/sup 0/C, 70-95%, after 48 hours; Pinus pinaster: similar to the former; Pinus nigra: 2 ppm, 25/sup 0/C, 70-95%, ur after 5 days; Cupressus arizonica and C. semperivirens: 2 ppm, 25%/sup 0/C, 90% ur after 72 hours; Quercus robur: 5 ppm, 25/sup 0/C, 90% ur, after 10 days. 6 references, 3 figures, 1 table.
Le changement perpétuel au cœur des rapports de domination
Directory of Open Access Journals (Sweden)
Jean-Luc Metzger
2012-05-01
Full Text Available Les sociétés contemporaines connaissent un accroissement des inégalités, en termes de richesse et d’accès au pouvoir. Le fait gestionnaire, par son emprise croissante, joue un rôle particulièrement important dans l’actualisation des rapports de domination. Il se situe, en effet, à l'articulation entre les décisions politiques majeures et les transformations des sphères d'activité sociale. Mais c'est aussi par le renouvellement permanent de ses différentes composantes que le fait gestionnaire agit : procédant par expérimentations successives, il assure ainsi la perpétuation de rapports de domination, au cœur même des sphères économiques et professionnelles. Pour montrer la pertinence de cette approche, l’article élabore, dans le prolongement des acquis de la sociologie du travail, un modèle pour analyser la volonté gestionnaire de changer. En appliquant ce modèle à un vaste éventail de contextes professionnels, nous pointons et expliquons les effets de polarisation sociale qu’engendre cette volonté.The constant change at the heart relations oh dominationContemporary societies are experiencing growing inequalities in wealth and access to power. The process of “managerialism”, by its increasing influence, plays a particularly important role in updating the relations of domination. It is, indeed, located at the joint between the major policy decisions and changes in social spheres. But this process acts also by the constant renewal of its various components: proceeding by successive experiments, it ensures the perpetuation of relations of domination, at the heart of economic and professional spheres. To show the relevance of this approach, the paper develops, following the achievements of the sociology of work, a model to analyze the managerial will of change. Applying this model to a wide range of advanced professional contexts, we point out and explain the effects of social polarization generated by this will
Interpretation of uncertainty relations for three or more observables
International Nuclear Information System (INIS)
Shirokov, M.I.
2003-01-01
Conventional quantum uncertainty relations (URs) contain dispersions of two observables. Generalized URs are known which contain three or more dispersions. They are derived here starting with suitable generalized Cauchy inequalities. It is shown what new information the generalized URs provide. Similar interpretation is given to generalized Cauchy inequalities
Evaluation of secondary environmental impacts of urban runoff pollution control
International Nuclear Information System (INIS)
Huibregtse, K.R.; Geinopolos, A.
1982-03-01
A generalized evaluation of the impacts associated with different urban stormwater runoff (UR) treatment techniques is presented. It addresses the definition of the problem, estimates the volume and characteristics of the UR and the sludges expected, evaluates six methods of UR sludge treatment, and examines alternatives and impacts for UR treatment sludge handling such as bleed/pump back to the dry weather plant, and land disposal. Regarding bleed/pump back of UR sludges, solids deposition in sewers and overload to the dry weather facilities are anticipated to cause problems. The most cost effective sludge treatment alternative appeared to be lime stabilization followed by thickening, pressure filter dewatering, and landfill disposal. Secondary impacts included costs, water quality, noise, energy consumption, air pollution, and land area requirements
Akbulut, Fatih; Kucuktopcu, Onur; Kandemir, Emre; Sonmezay, Erkan; Simsek, Abdulmuttalip; Ozgor, Faruk; Binbay, Murat; Muslumanoglu, Ahmet Yaser; Gurbuz, Gokhan
2016-01-01
To compare the outcomes of flexible ureterorenoscopy (F-URS) and mini-percutaneous nephrolithotomy (mini-PNL) in the treatment of lower calyceal stones smaller than 2 cm. Patients who underwent F-URS and mini-PNL for the treatment of lower calyceal stones smaller than 2 cm between March 2009 and December 2014 were retrospectively evaluated. Ninety-four patients were divided into two groups by treatment modality: F-URS (Group 1: 63 patients) and mini-PNL (Group 2: 31 patients). All patients were preoperatively diagnosed with intravenous pyelography or computed tomography. Success rates for F-URS and mini-PNL at postoperative first month were 85.7% and 90.3%, respectively. Operation time, fluoroscopy time, and hospitalization time for F-URS and mini-PNL patients were 44.40 min, 2.9 min, 22.4 h, and 91.9 min, 6.4 min, and 63.8 h, respectively. All three parameters were significantly shorter among the F-URS group (p PNL group (0.39 mg/dL vs. 1.15 mg/dL, p = 0.001). A comparison of complications according to the Clavien classification demonstrated significant differences between the groups (p = 0.001). More patients in the F-URS groups require antibiotics due to urinary tract infection, and more patients in the mini-PNL group required ureteral double J catheter insertion under general anesthesia. Although both F-URS and mini-PNL have similar success rates for the treatment of lower calyceal stones, F-URS appears to be more favorable due to shorter fluoroscopy and hospitalization times; and lower hemoglobin drops. Multicenter and studies using higher patient volumes are needed to confirm these findings.
Iqbal, Nadeem; Malik, Yashfeen; Nadeem, Utbah; Khalid, Maham; Pirzada, Amna; Majeed, Mehr; Malik, Hajra Arshad; Akhter, Saeed
2018-05-01
To evaluate and compare the effectiveness of ureteroscopic (URS) pneumatic lithotripsy versus extracorporeal shock wave lithotripsy (ESWL) in the management of the proximal ureteral stones in terms of stone- free rates, complications and costs involved. We included 200 patients in Group 1 who underwent ESWL and 200 patients in Group 2 who underwent URS intervention. We used Modulith SL X lithotripter 3 rd generation Storz medical for ESWL group while Swiss pneumatic lithoclast was used to break the stone in the URS group. Stone-free status was defined as stone fragment of less than 4 mm on follow- up kidney ureter and bladder X-ray after 3 months of procedure. SPSS version 16 was used for statistical analysis. The mean age in ESWL and URS groups were 39.21±13.36, and 43.13±13.65 years respectively. Mean stone size was 10.47±3.7 mm (ESWL) and 13.6±6.6 mm (URS). Stone- free rate after single procedure was (125/200 patients) 62.5% for ESWL and (168/200 patients) 84% for URS group (p=0.001). Complications included post procedure sepsis in 3 (1.5%) patient of ESWL, while 7 (3.5%) patients of URS groups. Steinstrasse was seen in 4 (2%) patients of ESWL group. No mortality was seen in both groups. Mean costs for ESWL were US $320±50 while US $1100±150 for URS group (p=0.001). The stone-free rates after single procedure were significantly higher for the URS group while the complication rates were comparable in both groups. Treatment costs were significantly lower for the ESWL group.
VizieR Online Data Catalog: VLBI Ecliptic Plane Survey: VEPS-1 (Shu+, 2017)
Shu, F.; Petrov, L.; Jiang, W.; Xia, B.; Jiang, T.; Cui, Y.; Takefuji, K.; McCallum, J.; Lovell, J.; Yi, S.-O.; Hao, L.; Yang, W.; Zhang, H.; Chen, Z.; Li, J.
2017-08-01
We began observations in the search mode in 2015 February. The participating stations included the three core stations of the Chinese VLBI Network (CVN): seshan25, kunming, and urumqi. Depending on the participating stations, the longest baseline length in each session can be varied from 3200km to 9800km. Our observations were performed at a 2048Mbps data rate, with 16 Intermediate Frequency (IF) channels and 2-bit sampling. The first eight IFs of 32MHz bandwidth were distributed in the range of [8.188, 8.444]GHz, and the remaining eight IFs of 32MHz bandwidth were in the range of [8.700, 8.956]GHz. Table 1: Summary of the VLBI Ecliptic Plane Survey (VEPS) observations in search mode: --------------------------------------------------- Date Dur. Code Stations Number of (Y/M/D) (h) Targets --------------------------------------------------- 2015 Feb 13 24 VEPS01 ShKmUr 293 2015 Feb 14 24 VEPS02 ShKmUr 338 2015 Apr 23 24 VEPS03 UrKv 300 2015 Apr 24 24 VEPS04 ShKmUrKv 400 2015 Aug 10 25 VEPS05 ShKmKvHo 252 2015 Aug 19 25 VEPS06 ShKmKvHo 277 2016 Mar 02 24 VEPS07 ShKmUrKb 333 2016 Mar 11 24 VEPS08 ShKmUrKb 477 2016 May 13 24 VEPS09 ShUrHo 291 2016 May 14 22 VEPS10 ShUrKv 322 2016 Jul 06 24 VEPS11 ShUrKb 307 2016 Sep 02 23 VEPS12 ShUr 424 2016 Sep 03 23 VEPS13 ShKmUr 344 --------------------------------------------------- Sh=Seshan25; Km=Kunming; Ur=Urumqi; Kv=Sejong; Kb=Kashim34; Ho=Hobart26. --------------------------------------------------- We ran two absolute astrometry dual-band VLBA programs that targeted ecliptic plane compact radio sources: the dedicated survey of weak ecliptic plane calibrators with the VLBA BS250 program in 2016 March-May, and the VLBA Calibrator Survey 9 (VCS-9) in 2015 August-2016 September. The International VLBI Service for Geodesy and Astrometry (IVS) runs a number of VLBI observing programs. We made an attempt to improve the coordinates of some VEPS sources detected in the search mode and provide additional measurements of telescope
Manley, P. L.; Ambos, E. L.
2012-12-01
Undergraduate research (UR) is one of the most authentic and effective ways to promote student learning, and is a high-impact educational practice that can lead to measurable gains in student retention and graduation rates, as well as career aspirations. In recent years, UR has expanded from intensive summer one-on-one faculty-student mentored experiences to application in a variety of educational settings, including large lower division courses. The Council on Undergraduate Research (CUR), founded in 1978, is a national organization of individual (8000) and institutional members (650) within a divisional structure that includes geosciences, as well as 10 other thematic areas. CUR's main mission is to support and promote high-quality undergraduate student-faculty collaborative research and scholarship that develops learning through research. CUR fulfills this mission through extensive publication offerings, faculty and student-directed professional development events, and outreach and advocacy activities that share successful models and strategies for establishing, institutionalizing, and sustaining undergraduate research programs. Over the last decade, CUR has worked with hundreds of academic institutions, including two-year colleges, to develop practices to build undergraduate research into campus cultures and operations. As documented in CUR publications such as Characteristics of Excellence in Undergraduate Research (COEUR), strategies institutions may adopt to enhance and sustain UR often include: (1) the establishment of a central UR campus office, (2) extensive student and faculty participation in campus-based, as well as regional UR celebration events, (3) development of a consistent practice of assessment of UR's impact on student success, and, (4) establishment of clear policies for recognizing and rewarding faculty engagement in UR, particularly with respect to mentorship and publication with student scholars. Three areas of current focus within the
Vandermaas-Peeler, Maureen; Miller, Paul C.; Peeples, Tim
2015-01-01
Although an increasing number of studies have examined students' participation in undergraduate research (UR), little is known about faculty perceptions of mentoring in this context. The purpose of this exploratory study was to investigate four aspects of mentoring UR, including how faculty define high-quality UR mentoring and operationalize it in…
Directory of Open Access Journals (Sweden)
Carmem Valéria de Araújo Cavalcanti
2006-04-01
Full Text Available Foi avaliado o efeito de quatro níveis (0%; 12,5%; 25%; 37,5%; e 50% de palma forrageira e uréia em substituição ao feno de capim tifton, na ração de vacas da raça holandesa em lactação sobre a digestibilidade aparente da matéria seca (DAMS, da matéria orgânica(DAMO, da fibra em detergente neutro (DAFDN, da proteína bruta (DAPB, dos carboidratos totais (DACHOT e dos carboidratos não fibrosos (DACNF. Foram utilizadas cinco vacas, com peso médio de 480 kg e produção média de leite de 20 kg/dia, distribuídas em um quadrado latino 5x5. As DAMS, DAMO, DACHOT e DACNF aumentaram, aDAFDN diminuiu linearmente e a DAPB não foi influenciada com o aumento dos níveis de palma e uréia na dieta. Os nutrientes digestíveis totais de mantença, a energia digestível de lactação, energia metabolizável de lactação e energia líquida de lactação aumentaram à medida que eram incluídas palma e uréia na dieta.The effect of five levels forage cactus and urea (0.0, 12.5, 25.0, 37.5 and 50% in replacement of tifton hay in lactating Holstein cows diets, on the apparent digestibility of dry matter (ADDM, organic matter (ADOM, neutral detergent fiber (ADNDF, crude protein (ADCP, total carbohydrates (ADTC and nonfiber carbohydrates (ADNFC were evaluated. Five Holstein cows weighing on average 480 kg and with an average milk yield of 20 kg of milk/day were used in a 5x5 Latin square design. The DM, OM, TC and NFC apparent digestibility increased while NDF apparent digestibility decreased linearly and the CP apparent digestibility was not affected by the inclusion of forage cactus and urea. The total digestible nutrients of maintenance,digestible energy of lactation, metabolizing energy of lactation and liquid energy of lactation increased as the forage cactus and urea levels increased.
Directory of Open Access Journals (Sweden)
F Aura Kullmann
Full Text Available Time- and vehicle-related variability of bladder and urethral rhabdosphincter (URS activity as well as cardiorespiratory and blood chemistry values were examined in the acetic acid-induced bladder irritation model in α-chloralose-anesthetized female cats. Additionally, bladder and urethra were evaluated histologically using Mason trichrome and toluidine blue staining. Urodynamic, cardiovascular and respiratory parameters were collected during intravesical saline infusion followed by acetic acid (0.5% to irritate the bladder. One hour after starting acetic acid infusion, a protocol consisting of a cystometrogram, continuous infusion-induced rhythmic voiding contractions, and a 5 min "quiet period" (bladder emptied without infusion was precisely repeated every 30 minutes. Administration of vehicle (saline i.v. occurred 15 minutes after starting each of the first 7 cystometrograms and duloxetine (1mg/kg i.v. after the 8(th. Acetic acid infusion into the bladder increased URS-EMG activity, bladder contraction frequency, and decreased contraction amplitude and capacity, compared to saline. Bladder activity and URS activity stabilized within 1 and 2 hours, respectively. Duloxetine administration significantly decreased bladder contraction frequency and increased URS-EMG activity to levels similar to previous reports. Cardiorespiratory parameters and blood gas levels remained consistent throughout the experiment. The epithelium of the bladder and urethra were greatly damaged and edema and infiltration of neutrophils in the lamina propria of urethra were observed. These data provide an ample evaluation of the health of the animals, stability of voiding function and appropriateness of the model for testing drugs designed to evaluate lower urinary tract as well as cardiovascular and respiratory systems function.
DEFF Research Database (Denmark)
De La Rosette, Jean; Denstedt, John D; Geavlete, Petrisor A
2013-01-01
Purpose: To assess the current indications for ureteroscopy (URS) treatment, outcome in terms of stone-free rate, and intra- and postoperative complications using the modified Clavien grading system. Patients and Methods: The Clinical Research Office of the Endourological Society (CROES) collected...... prospective data as part of the URS Global Study for consecutive patients treated with URS at centers around the world for 1 year. URS was performed according to study protocol and local clinical practice guidelines. Stone size and location were recorded and postoperative outcome and complications, graded...
International Nuclear Information System (INIS)
Veksler, A.M.; Ermekova, V.M.; Kozlovich, L.I.
1975-01-01
The dynamics of reversible unspecific reaction (UR) of chinese hamster fibroblast cell culture to hypothermia and cysteamine addition has been studied. A correlation between UR development and radioresistance has been established. The post-irradiation protection has been shown to grow undulatorilly o cysteamine addition at different times after irradiation. This is explained by superimposition of two processes: realization of latent lesions which is delayed by UR development, and repair of these lesions by the enzymatic system the activity of which changes periodicallY, also as a result of UR development
Uso de Eculizumab na síndrome hemolítica urêmica atípica após transplante renal
Directory of Open Access Journals (Sweden)
Claudia Iglesias Teixeira
2015-03-01
Full Text Available Descrever uso do Eculizumab na síndrome hemolítica urêmica atípica (SHUa após transplante renal. Paciente de 16 anos, com diagnóstico de doença renal crônica desde 2010, decorrente de SHUa, submetida à hemodiálise. Transplante renal por doador falecido: fevereiro de 2012. Apresentou boa evolução clínica até 14º DPO, quando iniciou quadro de febre, oligúria, piora da função renal [creatinina sérica (CRs: 4,0 mg/dl] e sinais de hemólise [plaquetas: 110.000 mm3; hemoglobina (Hb: 4,5 g/dL; LDH: 3366 U/L]. Biópsia do enxerto: microangiopatia trombótica. Realizado manejo com hemoderivados (plasma fresco e plasmaférese, com melhora da função renal (CRs: 1,46 mg/dl. Uma semana após esta intercorrência, reapresentou quadro de febre, anemia, sinais de hemólise e ITU, então manejados com ciprofloxacina, pulsoterapia com metilprednisolona e transfusão de plasma (plaquetas: 43.000 mm3; Hb: 6,0 mg/dl, reticulócitos: 1,3%, haptoglobina < 5,8 mg/dl, LDH: 1181 U/L. Após piora clínica, iniciada terapêutica com Eculizumab, 900 mg a cada cinco dias durante duas semanas. Evoluiu com boa resposta clínica, caracterizada pela melhora da função renal, normalização hematológica (plaquetas: 160.000 mm3; Hb: 11,4 g/dL e alta hospitalar em cinco dias. Desde então, mantém uso de Eculizumab 900 mg de 15/15 dias, com quadro renal e hematológico estável. O uso de Eculizumab foi de grande utilidade no controle da recidiva da SHUa e preservação do enxerto.
João Batista da Silva Neto
2008-01-01
O processamento químico a partir do hexafluoreto de urânio (UF6), permite uma flexibilidade na produção de combustíveis à base de siliceto de urânio (U3Si2) e octóxido de urânio (U3O8). Atualmente no IPEN-CNEN/SP desenvolvem-se trabalhos visando o processamento de combustíveis com alta concentração de urânio, por meio da substituição do U3O8 por U3Si2. Para a obtenção de U3Si2, duas possibilidades podem ser consideradas na preparação da matéria-prima utilizada, que é o tetrafluoreto de urânio...
Flexible ureterorenoscopy versus miniaturized PNL for solitary renal calculi of 10-30 mm size.
Knoll, Thomas; Jessen, Jan Peter; Honeck, Patrick; Wendt-Nordahl, Gunnar
2011-12-01
The value of flexible ureterorenoscopy (fURS) and miniaturized PNL (mPNL) for larger renal calculi is under discussion. This non-randomized prospective study aimed to evaluate fURS and mPNL for solitary renal stones of 10-30 mm size. fURS was carried out in 21 patients with last generation 7.5F endoscopes. Ureteral access sheaths were used in 19 patients. For mPNL, an 18F modified Amplatz sheath with a 14F nephroscope were used (n = 25). The procedure was performed either tubeless with an antegrade stent or a nephrostomy. Outcome and complications of both procedures were assessed. Patients' demographics and stone sizes were comparable (18 ± 5 vs. 19 ± 4 mm, P = 0.08). Patients in the fURS group had a higher mean BMI (31 vs. 27, P < 0.05). Total OR time was significantly longer for fURS (106 ± 51 vs. 59 ± 19 min., P < 0.001). More patients were stone-free after one single percutaneous treatment, while 2nd-stage treatments with fURS were common (total procedures 1.04 vs. 1.52, P < 0.001; immediate stone-free rate (SFR) 96% vs. 71.5%, P < 0.001). SFR after 4 weeks was 100% (mPNL) and 85.8% (fURS) (P < 0.01). Minor complications as classified by Clavien I or II occurred in 16 and 23.8%, mPNL and fURS, respectively, P = 0.13). No major complications (Clavien III-V) occured in both groups. Our series supports both the concept of either percutaneous or retrograde endoscopic treatment for renal calculi with both modalities offering excellent safety. However, while for fURS, a significantly higher rate of 2nd-stage procedures was necessary, and mPNL led to faster and higher SFR without increasing complication rate.
Kumar, Prashant; Fennell, Paul; Britter, Rex
2008-08-25
There have been many studies concerning dispersion of gaseous pollutants from vehicles within street canyons; fewer address the dispersion of particulate matter, particularly particle number concentrations separated into the nucleation (10-30 nm or N10-30) or accumulation (30-300 nm or N30-300) modes either separately or together (N10-300). This study aimed to determine the effect of wind direction and speed on particle dispersion in the above size ranges. Particle number distributions (PNDs) and concentrations (PNCs) were measured in the 5-2738 nm range continuously (and in real-time) for 17 days between 7th and 23rd March 2007 in a regular (aspect ratio approximately unity) street canyon in Cambridge (UK), using a newly developed fast-response differential mobility spectrometer (sampling frequency 0.5 Hz), at 1.60 m above the road level. The PNCs in each size range, during all wind directions, were better described by a proposed two regime model (traffic-dependent and wind-dependent mixing) than by simply assuming that the PNC was inversely proportional to the wind speed or by fitting the data with a best-fit single power law. The critical cut-off wind speed (Ur,crit) for each size range of particles, distinguishing the boundary between these mixing regimes was also investigated. In the traffic-dependent PNC region (UrUrwind speed and direction. In the wind speed dependent PNC region (UrUr>Ur,critUr,crit), concentrations were inversely proportional to Ur irrespective of any particle size range and wind directions. The wind speed demarcating the two regimes (Ur,critUr,crit) was 1.23+/-0.55 m s(-1) for N10-300, (1.47+/-0.72 m s(-1)) for N10-30 but smaller (0.78+/-0.29 m s(-1)) for N30-300.
Ho, Tin-Yun; Tang, Nou-Ying; Hsiang, Chien-Yun; Hsieh, Ching-Liang
2014-05-15
Uncaria rhynchophylla (UR) has been used for the treatment of convulsions and epilepsy in traditional Chinese medicine. This study reported the major anti-convulsive signaling pathways and effective targets of UR and rhynchophylline (RP) using genomic and immunohistochemical studies. Epileptic seizure model was established by intraperitoneal injection of kainic acid (KA) in rats. Electroencephalogram and electromyogram recordings indicated that UR and RP improved KA-induced epileptic seizures. Toll-like receptor (TLR) and neurotrophin signaling pathways were regulated by UR in both cortex and hippocampus of KA-treated rats. KA upregulated the expression levels of interleukin-1β (IL-1β) and brain-derived neurotrophin factor (BDNF), which were involved in TLR and neurotrophin signaling pathways, respectively. However, UR and RP downregulated the KA-induced IL-1β and BDNF gene expressions. Our findings suggested that UR and RP exhibited anti-convulsive effects in KA-induced rats via the regulation of TLR and neurotrophin signaling pathways, and the subsequent inhibition of IL-1β and BDNF gene expressions. Copyright © 2014 Elsevier GmbH. All rights reserved.
The effect of repair costs on the profitability of a ureteroscopy program.
Tosoian, Jeffrey J; Ludwig, Wesley; Sopko, Nikolai; Mullins, Jeffrey K; Matlaga, Brian R
2015-04-01
Ureteroscopy (URS) is a common treatment for patients with stone disease. One of the disadvantages of this approach is the great capital expense associated with the purchase and repair of endoscopic equipment. In some cases, these costs can outpace revenues and lead to an unprofitable and unsustainable enterprise. We sought to characterize the profitability of our URS program when accounting for endoscope maintenance and repair costs. We identified all URS cases performed at a single hospital during fiscal year 2013 (FY2013). Charges, collection rates, and fixed and variable costs including annual equipment repair costs were obtained. The net margin and break-even point of URS were derived on a per-case basis. For 190 cases performed in FY2013, total endoscope repair costs totaled $115,000, resulting in an average repair cost of $605 per case. The vast majority of cases (94.2%) were conducted in the outpatient setting, which generated a net margin of $659 per case, while inpatient cases yielded a net loss of $455. URS was ultimately associated with a net positive margin approaching $600 per case. On break-even analysis, URS remained profitable until repair costs reached $1200 per case. Based on these findings, an established URS program can sustain profitability even with large equipment repair costs. Nonetheless, our findings serve to emphasize the importance of controlling costs, particularly in the current setting of decreasing reimbursement. A multifaceted approach, based on improving endoscope durability and exploring digital and disposable platforms, will be critical in maintaining the sustainability of URS.
2006 Federal Emergency Management Agency (FEMA) Lidar: Nueces County, Texas
National Oceanic and Atmospheric Administration, Department of Commerce — Spectrum Mapping, LLC was tasked by MAPVI - URS Corporation, Albuquergue, to provide airborne Light Detection and Ranging (Lidar) of approximately 620 square miles...
Teacher self-efficacy in instruction and in parent involvement
Directory of Open Access Journals (Sweden)
Peter Gavora
2012-06-01
Full Text Available The study investigated self-efficacy of a sample of Slovak primary schoolteachers in two areas: area of instruction and area of parent involvement. Twoinstruments were used: the 16-item Slovak version of Teacher Efficacy Scale ofGibson and Dembo, and ZdUR, a 24-item scale to measure self-efficacy of teacherin parents’ involvement, developed by authors of the present study. The correlation between scores of personal teaching efficacy dimension of TES and ZdUR was 0.58 and between general teaching efficacy of TES and ZdUR was only 0.01. Teachers inthis sample had better scores in all dimensions of ZdUR than those of TES, with theexception of engaging parents in school activities. Scores of four teachers in TES andZdUR were analysed to document the possibility of making the individual profiles ofteacher self-efficacy.
Directory of Open Access Journals (Sweden)
Henning Reis
2018-01-01
Full Text Available Urachal cancer (UrC is a rare but aggressive cancer. Due to overlapping histomorphology, discrimination of urachal from primary bladder adenocarcinomas (PBAC and adenocarcinomas secondarily involving the bladder (particularly colorectal adenocarcinomas, CRC can be challenging. Therefore, we aimed to give an overview of helpful (immunohistochemical biomarkers and clinicopathological factors in addition to survival analyses and included institutional data from 12 urachal adenocarcinomas. A PubMed search yielded 319 suitable studies since 1930 in the English literature with 1984 cases of UrC including 1834 adenocarcinomas (92% and 150 nonadenocarcinomas (8%. UrC was more common in men (63%, showed a median age at diagnosis of 50.8 years and a median tumor size of 6.0 cm. No associations were noted for overall survival and progression-free survival (PFS and clinicopathological factors beside a favorable PFS in male patients (p=0.047. The immunohistochemical markers found to be potentially helpful in the differential diagnostic situation are AMACR and CK34βE12 (UrC versus CRC and PBAC, CK7, β-Catenin and CD15 (UrC and PBAC versus CRC, and CEA and GATA3 (UrC and CRC versus PBAC. Serum markers like CEA, CA19-9 and CA125 might additionally be useful in the follow-up and monitoring of UrC.
Directory of Open Access Journals (Sweden)
Hsin-Cheng Hsu
2013-01-01
Full Text Available Seizures cause inflammation of the central nervous system. The extent of the inflammation is related to the severity and recurrence of the seizures. Cell surface receptors are stimulated by stimulators such as kainic acid (KA, which causes intracellular mitogen-activated protein kinase (MAPK signal pathway transmission to coordinate a response. It is known that Uncaria rhynchophylla (UR and rhynchophylline (RP have anticonvulsive effects, although the mechanisms remain unclear. Therefore, the purpose of this study is to develop a novel strategy for treating epilepsy by investigating how UR and RP initiate their anticonvulsive mechanisms. Sprague-Dawley rats were administered KA (12 mg/kg, i.p. to induce seizure before being sacrificed. The brain was removed 3 h after KA administration. The results indicate that pretreatment with UR (1.0 g/kg, RP (0.25 mg/kg, and valproic acid (VA, 250 mg/kg for 3 d could reduce epileptic seizures and could also reduce the expression of c-Jun aminoterminal kinase phosphorylation (JNKp of MAPK signal pathways in the cerebral cortex and hippocampus brain tissues. Proinflammatory cytokines interleukin (IL-1β, IL-6, and tumor necrosis factor-α remain unchanged, indicating that the anticonvulsive effect of UR and RP is initially involved in the JNKp MAPK signal pathway during the KA-induced acute seizure period.
Hsu, Hsin-Cheng; Tang, Nou-Ying; Liu, Chung-Hsiang; Hsieh, Ching-Liang
2013-01-01
Seizures cause inflammation of the central nervous system. The extent of the inflammation is related to the severity and recurrence of the seizures. Cell surface receptors are stimulated by stimulators such as kainic acid (KA), which causes intracellular mitogen-activated protein kinase (MAPK) signal pathway transmission to coordinate a response. It is known that Uncaria rhynchophylla (UR) and rhynchophylline (RP) have anticonvulsive effects, although the mechanisms remain unclear. Therefore, the purpose of this study is to develop a novel strategy for treating epilepsy by investigating how UR and RP initiate their anticonvulsive mechanisms. Sprague-Dawley rats were administered KA (12 mg/kg, i.p.) to induce seizure before being sacrificed. The brain was removed 3 h after KA administration. The results indicate that pretreatment with UR (1.0 g/kg), RP (0.25 mg/kg), and valproic acid (VA, 250 mg/kg) for 3 d could reduce epileptic seizures and could also reduce the expression of c-Jun aminoterminal kinase phosphorylation (JNKp) of MAPK signal pathways in the cerebral cortex and hippocampus brain tissues. Proinflammatory cytokines interleukin (IL)-1 β , IL-6, and tumor necrosis factor- α remain unchanged, indicating that the anticonvulsive effect of UR and RP is initially involved in the JNKp MAPK signal pathway during the KA-induced acute seizure period.
Paulo Cesar Pires Rosa
2010-01-01
Resumo: Neste trabalho, desenvolveu-se uma nova fase estacionária (FE) (-NH-C(O)-NH-C8) capeada, contendo o grupo polar uréia inserido na cadeia alquila C8. Os estudos de análise elementar, espectroscopia infravermelho, ressonância magnética nuclear de C e Si confirmaram o sucesso da síntese da FE. A FE foi preparada e foi caracterizada cromatograficamente na separação de misturas testes e de diversas classes de fármacos, no desenvolvimento e validação de métodos para avaliação de misturas de...
Priority-Setting for Novel Drug Regimens to Treat Tuberculosis: An Epidemiologic Model.
Directory of Open Access Journals (Sweden)
Emily A Kendall
2017-01-01
Full Text Available Novel drug regimens are needed for tuberculosis (TB treatment. New regimens aim to improve on characteristics such as duration, efficacy, and safety profile, but no single regimen is likely to be ideal in all respects. By linking these regimen characteristics to a novel regimen's ability to reduce TB incidence and mortality, we sought to prioritize regimen characteristics from a population-level perspective.We developed a dynamic transmission model of multi-strain TB epidemics in hypothetical populations reflective of the epidemiological situations in India (primary analysis, South Africa, the Philippines, and Brazil. We modeled the introduction of various novel rifampicin-susceptible (RS or rifampicin-resistant (RR TB regimens that differed on six characteristics, identified in consultation with a team of global experts: (1 efficacy, (2 duration, (3 ease of adherence, (4 medical contraindications, (5 barrier to resistance, and (6 baseline prevalence of resistance to the novel regimen. We compared scale-up of these regimens to a baseline reflective of continued standard of care. For our primary analysis situated in India, our model generated baseline TB incidence and mortality of 157 (95% uncertainty range [UR]: 113-187 and 16 (95% UR: 9-23 per 100,000 per year at the time of novel regimen introduction and RR TB incidence and mortality of 6 (95% UR: 4-10 and 0.6 (95% UR: 0.3-1.1 per 100,000 per year. An optimal RS TB regimen was projected to reduce 10-y TB incidence and mortality in the India-like scenario by 12% (95% UR: 6%-20% and 11% (95% UR: 6%-20%, respectively, compared to current-care projections. An optimal RR TB regimen reduced RR TB incidence by an estimated 32% (95% UR: 18%-46% and RR TB mortality by 30% (95% UR: 18%-44%. Efficacy was the greatest determinant of impact; compared to a novel regimen meeting all minimal targets only, increasing RS TB treatment efficacy from 94% to 99% reduced TB mortality by 6% (95% UR: 1%-13%, half the
Directory of Open Access Journals (Sweden)
Carlos Eduardo Faroni
2007-06-01
Full Text Available O objetivo deste trabalho foi comparar três métodos de aplicação de solução de uréia marcada com15N (15N-uréia : pulverização foliar, injeção na base do colmo e imersão radicular, a fim de se definir qual seria o mais eficiente na marcação de fitomassa de cana-de-açúcar. O experimento foi instalado na Estação Experimental Apta - Pólo Regional Centro Sul, em Piracicaba, SP. A cana-de-açúcar, variedade SP80 3280, foi plantada em vasos preenchidos com aproximadamente 120 dm³ de Neossolo Quartzarênico de textura arenosa. O delineamento experimental foi inteiramente casualizado, com quatro repetições. A fitomassa de cana-de-açúcar dos três tratamentos, no 11º mês de desenvolvimento, não diferiu estatisticamente, e suas abundâncias de 15N foram superiores à natural, tendo-se verificado a seguinte ordem decrescente de marcação com 15N: parte aérea > rizoma > rizomas+raízes na camada de 0,0-0,2 m > raízes na camada de 0,2-0,4 m > raízes em profundidade maior que 0,4 m. Entre os métodos de aplicação de 15N-uréia, a injeção na base de colmos é o de mais fácil execução, o mais efetivo na marcação da fitomassa e o que apresentou a maior recuperação do traçador (96%. A aplicação foliar é comparável à injeção, somente na marcação e na recuperação do traçador no sistema radicular.The objective of this research was to compare three methods of 15N-urea solutions application: spray on leaf, injection in the plant base stem and root immersion, in order to define the most efficient labeling sugarcane phytomass with 15N method. The experiment was carried out at APTA - Pólo Regional Centro Sul, in Piracicaba, SP, Brazil, and the sugarcane variety SP80 3280 was planted in pots filled out with approximately 120 dm³ of a Typic Quartzipsamment soil. The experiment was conducted in a completely randomized design with four replicates. There were no difference between the methods in the plant parts dry
Qi, Haiping; Coplen, Tyler B; Mroczkowski, Stanley J; Brand, Willi A; Brandes, Lauren; Geilmann, Heike; Schimmelmann, Arndt
2016-04-15
The widely used l-glutamic acid isotopic reference material USGS41, enriched in both (13) C and (15) N, is nearly exhausted. A new material, USGS41a, has been prepared as a replacement for USGS41. USGS41a was prepared by dissolving analytical grade l-glutamic acid enriched in (13) C and (15) N together with l-glutamic acid of normal isotopic composition. The δ(13) C and δ(15) N values of USGS41a were directly or indirectly normalized with the international reference materials NBS 19 calcium carbonate (δ(13) CVPDB = +1.95 mUr, where milliurey = 0.001 = 1 ‰), LSVEC lithium carbonate (δ(13) CVPDB = -46.6 mUr), and IAEA-N-1 ammonium sulfate (δ(15) NAir = +0.43 mUr) and USGS32 potassium nitrate (δ(15) N = +180 mUr exactly) by on-line combustion, continuous-flow isotope-ratio mass spectrometry, and off-line dual-inlet isotope-ratio mass spectrometry. USGS41a is isotopically homogeneous; the reproducibility of δ(13) C and δ(15) N is better than 0.07 mUr and 0.09 mUr, respectively, in 200-μg amounts. It has a δ(13) C value of +36.55 mUr relative to VPDB and a δ(15) N value of +47.55 mUr relative to N2 in air. USGS41 was found to be hydroscopic, probably due to the presence of pyroglutamic acid. Experimental results indicate that the chemical purity of USGS41a is substantially better than that of USGS41. The new isotopic reference material USGS41a can be used with USGS40 (having a δ(13) CVPDB value of -26.39 mUr and a δ(15) NAir value of -4.52 mUr) for (i) analyzing local laboratory isotopic reference materials, and (ii) quantifying drift with time, mass-dependent isotopic fractionation, and isotope-ratio-scale contraction for isotopic analysis of biological and organic materials. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA.
Qi, Haiping; Coplen, Tyler B.; Mroczkowski, Stanley J.; Brand, Willi A.; Brandes, Lauren; Geilmann, Heike; Schimmelmann, Arndt
2016-01-01
RationaleThe widely used l-glutamic acid isotopic reference material USGS41, enriched in both 13C and 15N, is nearly exhausted. A new material, USGS41a, has been prepared as a replacement for USGS41.MethodsUSGS41a was prepared by dissolving analytical grade l-glutamic acid enriched in 13C and 15N together with l-glutamic acid of normal isotopic composition. The δ13C and δ15N values of USGS41a were directly or indirectly normalized with the international reference materials NBS 19 calcium carbonate (δ13CVPDB = +1.95 mUr, where milliurey = 0.001 = 1 ‰), LSVEC lithium carbonate (δ13CVPDB = −46.6 mUr), and IAEA-N-1 ammonium sulfate (δ15NAir = +0.43 mUr) and USGS32 potassium nitrate (δ15N = +180 mUr exactly) by on-line combustion, continuous-flow isotope-ratio mass spectrometry, and off-line dual-inlet isotope-ratio mass spectrometry.ResultsUSGS41a is isotopically homogeneous; the reproducibility of δ13C and δ15N is better than 0.07 mUr and 0.09 mUr, respectively, in 200-μg amounts. It has a δ13C value of +36.55 mUr relative to VPDB and a δ15N value of +47.55 mUr relative to N2 in air. USGS41 was found to be hydroscopic, probably due to the presence of pyroglutamic acid. Experimental results indicate that the chemical purity of USGS41a is substantially better than that of USGS41.ConclusionsThe new isotopic reference material USGS41a can be used with USGS40 (having a δ13CVPDB value of −26.39 mUr and a δ15NAir value of −4.52 mUr) for (i) analyzing local laboratory isotopic reference materials, and (ii) quantifying drift with time, mass-dependent isotopic fractionation, and isotope-ratio-scale contraction for isotopic analysis of biological and organic materials. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA.
Directory of Open Access Journals (Sweden)
Guenka Petrova
2016-05-01
Full Text Available The aim of this study was to explore the cost-effectiveness of short protocols including different types of gonadotropins for controlled ovarian hyperstimulation (COH for in vitro fertilization (IVF. A retrospective, observational study of the real-life practice in a specialized IVF gynaecology clinic in 2009–2013 was carried out. All women on short COH protocols were recruited into three groups: COH including recombinant follicle stimulating hormone (rFSH and urinary-FSH (urFSH (n = 173; including urFSH alone (n = 289; and including rFSH alone (n = 212. The cost-effectiveness of the COH protocols was explored in two different case scenarios for possible outcomes. The first case scenario took into consideration a successful live birth, and the second one, the women to achieve pregnancy with live birth. Decision modelling was done using the TreeAge 2014 Software. According to the results in the first case scenario, the rFSH plus urFSH COH approach showed the highest weighted probability (p = 0.38 of live birth, but the urFSH alternative was cost-effective. The results in the second case scenario demonstrated that the urFSH protocol was again the cost-effective alternative. These results suggest that the strategy with urFSH should be preferred in both cases, but rFSH could also be considered as a cost-effective alternative for successful live birth and achieving pregnancy and delivery, since the incremental cost-effectiveness ratio in comparison with the urFSH protocol is below the gross domestic product per capita. The combined approach of rFSH and urFSH was shown not to be cost-effective in both explored scenarios.
Directory of Open Access Journals (Sweden)
Gustavo Varela
2015-06-01
Full Text Available Introducción: El síndrome urémico hemolítico (SUH es una enfermedad de severidad variable que afecta sobre todo a niños menores de 5 años. Está definido por la tríada anemia hemolítica microangiopática, trombocitopenia e insuficiencia renal aguda. La mayoría de los casos aparecen luego de un episodio de diarrea aguda, causado por cepas de Escherichia coli productoras de toxina Shiga (STEC. Objetivo: Establecer las características de las cepas STEC recuperadas de niños con SUH, e informar sobre algunos aspectos clínicos y características epidemiológicas de estos casos. Materiales y métodos: Se realizó un estudio descriptivo que incluyó niños con SUH. La detección de las cepas STEC se realizó por PCR a partir de cultivos de materias fecales. En cada cepa se estableció el genotipo, serotipo y perfil de susceptibilidad a los antibióticos. Resultados: Se estudiaron 43 niños con SUH. Los casos ocurrieron predominantemente en los meses cálidos, afectando niños provenientes de hogares ubicados fuera de la capital y con cobertura privada de salud. La mayoría presentaban el antecedente de diarrea con sangre y 70% habían recibido antibióticos antes de obtener las muestras. En 7 niños se recuperaron 8 cepas STEC; 7 correspondieron a serogrupos no-O157. Todas portaban los genes eae y ehxA. Conclusiones: La mayoría de los casos ocurren en meses cálidos, en niños que cursaron diarrea con sangre, provenientes de hogares ubicados fuera de la ciudad capital. Los cultivos STEC no-O157 fueron los más prevalentes.
Directory of Open Access Journals (Sweden)
Amanat Ali, M. Fatahullah Khan and Muhmmad Ayaz
2002-03-01
Full Text Available Eight young male buffalo calves of Nili-Ravi breed, randomly divided into two groups A and B (4 animals in each with a mean initial body weight of 115.3 ± 12.4 and 117.0 ± 7.3 kg respectively, were used for this study. Three is nitrogenous and is energetic completely mixed rations based on untreated (UWSR, urea-treated (Ur- TWSR and ammonium bicarbonate treated (Am- TWSR wheat straw, were prepared. Treatment of chopped wheat straw in mud houses with either urea or ammonium bicarbonate increased its crude protein content tom 3.2 (untreated to 8.7 and 9.5% (for treated respectively. The feeding trials were conducted in the 2 phases. During the Fist phase, the animals were fed Ur- TWSR and Am- TWSR for a period of 63 days. In the 2nd phase UWSR and Ur- TWSR were compared for a period of 76 days. At the end of each experimental phase a digestion trial was conducted. The results indicated that the animals fed Ur- TWSR showed the best average daily live weight gain (0.72 kg as compared to both the UWSR (0.59 kg and Am- TWSR (0.41 kg. The performance of the animals on Am- TWSR was the poorest. No significant differences were observed in the average daily teed intake of animals fed UWSR and Ur- TWSR. The animals fed Am- TWSR consumed; significantly (P <0.05 less feed as compared to UWSR and Ur- TWSR. The best feed conversion ratio was observed for the Ur- TWSR. The apparent digestibility coefficients for dry matter, crude protein, crude fibre and ether extract measured by total collection method indicated that Ur- TWSR was significantly (P<0.05 better digestible as compared to other rations. The cost per kg live weight gain in animals fed Ur- TWSR was significantly (P <0.05 less as compared to other rations. It is concluded that buffalo calves can efficiently and. economically be raised on completely mixed urea treated wheat straw based rations.
Uranyl oxalate hydrates: structures and IR spectra
International Nuclear Information System (INIS)
Giesting, P.A.; Porter, N.J.; Burns, P.C.
2006-01-01
The novel compound (UO 2 ) 2 C 2 O 4 (OH) 2 (H 2 O) 2 (UrOx2A) and the previously studied compound UO 2 C 2 O 4 (H 2 O) 3 (UrOx3) have been synthesized by mild hydrothermal methods. Single crystal diffraction data collected at 125 K using MoK α radiation and a CCD-based area detector were used to solve and refine the crystal structures by full-matrix least-squares techniques to agreement indices (UrOx2A, UrOx3) wR 2 = 0.037, 0.049 for all data, and R1 0.015, 0.024 calculated for 1285, 2194 unique reflections respectively. The compound UrOx2A is triclinic, space group P1, Z = 1, a = 5.5353(4), b 6.0866(4), c = 7.7686(6) Aa, α = 85.6410(10) , β = 89.7740(10) , γ = 82.5090(10) , V = 258.74(3) Aa 3 . The compound UrOx3 is monoclinic, space group P2 1 /c, Z = 4, a = 5.5921(4), b = 16.9931(13), c = 9.3594(7) Aa, β = 99.5330(10) , V = 877.11(11) Aa 3 . The structures consist of chains of uranyl pentagonal bipyramids connected by oxalate groups and, in UrOx2A, hydroxyl groups; UrOx2A is also notable for its high (2:1) ratio of uranyl to oxalate groups, higher than any observed in other published structures of uranyl oxalates. The structure determined for UrOx3, previously studied by Jayadevan and Chackraburtty (1972); Mikhailov et al. (1999) is in agreement with the previous results; however, the increased precision of the present low-temperature structure refinement allows for the assignment of H atom positions based on the difference Fourier map of electron density. The infrared spectra of these two materials collected at room temperature are also presented and compared with previous work on uranyl oxalate systems. (orig.)
La qualité des plages au cœur des enjeux de développement : La situation des îles de l’océan Indien
Directory of Open Access Journals (Sweden)
Virginie Duvat
2009-02-01
Full Text Available La qualité des plages s’inscrit au cœur des enjeux de développement des petites îles tropicales en raison d’une part, de la place qu’elle occupe dans les stratégies de promotion touristique, et d’autre part, de l’importance que prend le littoral dans les pratiques récréatives et touristiques émergentes des populations locales. Dans ce contexte, l’objectif de cet article est de présenter les résultats d’une évaluation réalisée dans différentes îles des archipels des Seychelles et des Mascareignes, et de mettre en évidence la relation qui existe entre la qualité des plages, leurs attributs naturels et les politiques d’aménagement et de gestion des acteurs publics et privés.Today, the quality of the tropical beaches is closely linked to development challenges for two main reasons. At first, because sandy beaches play an important role in tourism development policies, and secondly because of the emergence of the touristic and recreative activities of the local communities. In this context, the purpose of this paper is to expose the results of an assessment which was done in the Seychelles and Mascarene islands and to highlight the relationship which can be observed between beach quality, natural assets and the strategies of public and private actors.
International Nuclear Information System (INIS)
Tanaka, Osamu; Hayashi, Shinya; Matsuo, Masayuki; Nakano, Masahiro; Kubota, Yasuaki; Maeda, Sunaho; Ohtakara, Kazuhiro; Deguchi, Takashi; Hoshi, Hiroaki
2007-01-01
No studies have yet evaluated the effects of a dosimetric analysis for different urethral volumes. We therefore evaluated the effects of a dosimetric analysis to determine the different urethral volumes. This study was based on computed tomography/magnetic resonance imaging (CT/MRI) combined findings in 30 patients who had undergone prostate brachytherapy. Postimplant CT/MRI scans were performed 30 days after the implant. The urethra was contoured based on its diameter (8, 6, 4, 2, and 0 mm). The total urethral volume-in cubic centimeters [UrV150/200 (cc)] and percent (UrV150%/200%), of the urethra receiving 150% or 200% of the prescribed dose-and the doses (UrD90/30/5) in Grays to 90%, 30%, and 5% of the urethral volume were measured based on the urethral diameters. The UrV150 (cc) and UrD30 were statistically different between the of 8-, 6-, 4-, 2-, and 0-mm diameters, whereas the UrD5 was statistically different only between the 8-, 6-, and 4-mm diameters. Especially for UrD5, there was an approximately 40-Gy difference between the mean values for the 8- and 0-mm diameters. We recommend that the urethra should be contoured as a 4- to 6-mm diameter circle or one side of a triangle of 5-7 mm. By standardizing the urethral diameter, the urethral dose will be less affected by the total urethral volume. (author)
Hsieh, Ching-Liang; Ho, Tin-Yun; Su, Shan-Yu; Lo, Wan-Yu; Liu, Chung-Hsiang; Tang, Nou-Ying
2009-01-01
Our previous studies have shown that Uncaria rhynchophylla (UR) can reduce epileptic seizures. We hypothesized that UR and its major component rhynchophylline (RH), reduce epileptic seizures in rats treated with kainic acid (KA) by inhibiting nuclear factor-kappaB (NF-kappaB) and activator-protein-1 (AP-1) activity, and by eliminating superoxide anions. Therefore, the level of superoxide anions and the DNA binding activities of NF-kappaB and AP-1 were measured. Sprague-Dawley (SD) rats were pre-treated with UR (1.0 g/kg, i.p.), RH (0.25 mg/kg, i.p.), or valproic acid (VA, 250 mg/kg, i.p.) for 3 days and then KA was administered intra-peritoneal (i.p.). The results indicated that UR, RH, and VA can reduce epileptic seizures and the level of superoxide anions in the blood. Furthermore, KA was demonstrated to induce the DNA binding activities of NF-kappaB and AP-1. However, these inductions were inhibited by pre-treatment with UR, RH, or VA for 3 days. Moreover, UR and RH were shown to be involved in the suppression of c-Jun N-terminal kinase (JNK) phosphorylation. This study suggested that UR and RH have antiepileptic effects in KA-induced seizures and are associated with the regulation of the innate immune system via a reduction in the level of superoxide anions, JNK phosphorylation, and NF-kappaB activation.
Tang, Nou-Ying; Lin, Yi-Wen; Ho, Tin-Yun; Cheng, Chin-Yi; Chen, Chao-Hsiang; Hsieh, Ching-Liang
2017-01-01
Epileptic seizures are crucial clinical manifestations of recurrent neuronal discharges in the brain. An imbalance between the excitatory and inhibitory neuronal discharges causes brain damage and cell loss. Herbal medicines offer alternative treatment options for epilepsy because of their low cost and few side effects. We established a rat epilepsy model by injecting kainic acid (KA, 12 mg/kg, i.p.) and subsequently investigated the effect of Uncaria rhynchophylla (UR) and its underlying mechanisms. Electroencephalogram and epileptic behaviors revealed that the KA injection induced epileptic seizures. Following KA injection, S100B levels increased in the hippocampus. This phenomenon was attenuated by the oral administration of UR and valproic acid (VA, 250 mg/kg). Both drugs significantly reversed receptor potentiation for advanced glycation end product proteins. Rats with KA-induced epilepsy exhibited no increase in the expression of metabotropic glutamate receptor 3, monocyte chemoattractant protein 1, and chemokine receptor type 2, which play a role in inflammation. Our results provide novel and detailed mechanisms, explaining the role of UR in KA-induced epileptic seizures in hippocampal CA1 neurons.
Akbulut, Makbule Bilge; Akman, Melek; Terlemez, Arslan; Magat, Guldane; Sener, Sevgi; Shetty, Heeresh
2016-01-01
The aim of this study was to evaluate the efficacy of Twisted File (TF) Adaptive, Reciproc, and ProTaper Universal Retreatment (UR) System instruments for removing root-canal-filling. Sixty single rooted teeth were decoronated, instrumented and obturated. Preoperative CBCT scans were taken and the teeth were retreated with TF Adaptive, Reciproc, ProTaper UR, or hand files (n=15). Then, the teeth were rescanned, and the percentage volume of the residual root-canal-filling material was established. The total time for retreatment was recorded, and the data was statistically analyzed. The statistical ranking of the residual filling material volume was as follows: hand file=TF Adaptive>ProTaper UR=Reciproc. The ProTaper UR and Reciproc systems required shorter periods of time for retreatment. Root canal filling was more efficiently removed by using Reciproc and ProTaper UR instruments than TF Adaptive instruments and hand files. The TF Adaptive system was advantageous over hand files with regard to operating time.
Directory of Open Access Journals (Sweden)
Douglas dos Santos Pina
2006-08-01
Full Text Available Foram utilizadas 12 vacas Holandesas puras e mestiças, distribuídas em três quadrados latinos 4 x 4, organizados de acordo com os dias em lactação, com o objetivo de avaliar o efeito de diferentes fontes protéicas sobre a síntese, a eficiência de síntese de proteína microbiana, a concentração de nitrogênio uréico no soro (NUS e no leite (NUL, a concentração de nitrogênio amoniacal e o pH ruminal. Utilizou-se silagem de milho como volumoso, na proporção de 60% da MS total. Os concentrados foram constituídos de diferentes fontes protéicas (FS - farelo de soja; FA38 - farelo de algodão 38%PB; FA28 - farelo de algodão 28%PB e FSU - farelo de soja + 5% de uréia/sulfato de amônia na MS do concentrado. As coletas spot de urina e de sangue foram realizadas no 18º dia do período experimental 4 horas após o fornecimento da alimentação aos animais, no período da manhã. Não foram observadas diferenças entre as dietas para o volume urinário (V, a excreção total de derivados de purinas (PT, a síntese e a eficiência de síntese de PB microbiana, expressa em g de PB/kg de NDT consumido. As concentrações de NUS e NUL também não diferiram entre as dietas. As concentrações de NUS e NUL e a síntese de PB microbiana não foram influenciadas pelas diferentes fontes de proteína dietéticas, inclusive com a adição de uréia (5% MS do concentrado.Twelve Holstein lactating dairy cows were blocked by days in milk and randomly assigned to three replicated 4 x 4 Latin square to evaluate the effect of different protein sources on efficiency of microbial protein synthesis, concentration of serum (NUS and milk (MUN urea nitrogen, and ruminal metabolism. A basal corn silage diet (60% of the total dry matter was fed plus one of the following proteins sources (DM basis: soybean meal (SBM, cottonseed meal with 38% of crude protein (CSM38, cottonseed meal with 28% of crude protein (CSM28, or soybean meal plus 5% of urea
2006 FEMA Lidar: Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — The FEMA Task Order 26 LiDAR data set was collected by Airborne 1 Corporation of El Segundo, California in September - December of 2006 for URS Corp.
Alkyne- and alkyl-tris(cyclopentadienyl) complexes of uranium(III)
International Nuclear Information System (INIS)
Foyentin, M.; Folcher, G.; Ephritkhine, M.
1987-01-01
Treatment of cp 3 U(THF) (1) (cp=eta-C 5 H 5 , THF=tetrahydrofuran) with diphenylacetylene affords the alkyne complex cp 3 U(Ph-C identical to C-Ph); (1) reacts with RLi (R = Me, Busup(n)) to give the alkyl compounds cp 3 URLi (3); hydrogenolysis of (3) in the presence of a terminal alkene R'(-H) leads to the formation of cp 3 UR'Li. (author)
On the stability of unique range sets for meromorphic functions
International Nuclear Information System (INIS)
Ha Huy Khoai; Nguyen Van Khue
2003-03-01
For a set S we construct a complex space Z S such that S is a unique range set for meromorphic functions (URS) if and only if Z S is hyperbolic. A consequence of this result is that the set of URS with n elements (considered as a subset of C n ) is open, and then the small deformations of Yi's and Frank-Reinders' sets are URS. (author)
2018-04-29T21:14:20Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
Lit urétral incisé et tubulisé (TIP): Extension des indications aux reintervention pour hypospadias Objectifs : Récemment, l'urétroplastie par Lit urétral incisé et tubulisé (TIP ou technique de Snodgrass) a gagné une popularité pour la réparation primaire des hypospadias distaux et proximaux. Cette étude a été effectuée pour ...
Söylemez, Haluk; Yıldırım, Kadir; Utangac, Mehmet Mazhar; Aydoğan, Tahsin Batuhan; Ezer, Mehmet; Atar, Murat
2016-06-01
To investigate the effectivity of 4.5F ultrathin ureteroscope (UT-URS) without any need for active or passive dilation in the treatment of adult patient population in whom ureteral orifices cannot be engaged using conventional URS. Among a total of 512 adult patients who had undergone URS between April 2012 and November 2015 in our department for diagnostic or therapeutic purposes, 43 (8.4%) patients required ureteral dilation because we could not engage ureteral orifice. In adult patients in whom we could not engage ureteral orifice with 7.5F and 8F semirigid URS, we tried to complete the operation using 4.5F UT-URS without resorting to dilation. Age and gender of the patients, indication for operation, stone size, location, operative times, laterality of stone(s), stone-free rates, length of hospital stay, and complications were recorded. Mean age of the patients was 34.5 ± 11.2 (21-66) years. The patients had undergone operations for ureteral stone (n = 39), unexplained hydronephrosis (n = 2), and ureteral stenosis (n = 2). Mean stone size was 8.2 ± 2.3 (4-18) mm. Mean operative time was 64.2 ± 13.5 minutes. In 37 of 39 patients, a complete stone-free rate (94.8%) was achieved. Mean length of hospital stay was 8.9 ± 5.8 hours. It has been demonstrated that in an adult patient population in whom ureteral orifices cannot be engaged using conventional URS, ureteral access could be achieved with 4.5F UT-URS without any need for dilation. At the same time, use of 4.5F UT-URS resulted in an acceptable treatment success and lower complication rates in most of these patients without the need for a second session.
2010-10-01
... ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Mental Hospitals Utilization Review (ur) Plan... requirements for a written utilization review (UR) plan for each mental hospital providing Medicaid services...
Cuneiform Documents from Various Dutch Collections
Boer, de R.; Dercksen, J.G.; Krispijn, Th.J.H.; J.G., Dercksen e.a.
2013-01-01
Publication of Sumerian and Akkadian cuneiform texts in private collections from various periods: * Presargonic: letter-unknown provenance in Northern Babylonia * Ur III: administrative document-Umma) * Old Assyrian: letters-Kaneš (Anatolia) * Old Babylonian: lexical series Ugumu-unknown
National Oceanic and Atmospheric Administration, Department of Commerce — Pre- and post-hurricane Katrina LiDAR datasets of Hancock, Harrison, and Jackson Counties, MS, were merged into a seamless coverage by URS. The pre-Katrina LiDAR...
International Nuclear Information System (INIS)
Sokolikova, B.
2001-01-01
Two repressoric regions are present in the AAC3 promoter, termed URS1 and URS2. URS1 region is responsible for a carbon source-dependent regulation and plays a role under both, aerobic and anaerobic conditions. By deletion analysis URS1 was localized into the -322/-244 region and was found that the regulation is likely exerted by the repression by non-fermentable or non-repressing fermentable carbon sources than by the activation by repressing carbon source. By computer analysis cis sequences for two potential transcription factors, Rap1 and ERA, were identified within URS1. Rap1 binding into its consensus sequence was proved, effort to find the protein binding to the ERA cis regulatory sequences has failed. By the means of mutational analysis we revealed that the regulation pathway mediating the carbon source-dependent regulation via URS1 differs according to the presence or absence of oxygen in the growth medium. Under aerobic conditions the carbon source-dependent repression is mediated by the ERA factor and the role of Rap1 is only marginal. On the contrary, under anaerobic conditions, the repression is mediated solely by Rap1. AAC1 gene product might be involved in the regulation of the AAC3 gene, the regulation pathway has not been characterized yet. (author)
Della Lucia, Ceres M; Vaz Tostes, Maria das Graças; Silveira, Carlos Mário M; Bordalo, Lívia A; Rodrigues, Fabiana C; Pinheiro-Sant'Ana, Helena Maria; Martino, Hércia S D; Costa, Neuza Maria B
2013-03-01
This study aimed to evaluate iron (Fe) bioavailability in Wistar rats fed with rice fortified with micronized ferric pyrophosphate (FP) by Ultra Rice (UR) technology with or without addition of yacon flour as a source of 7.5% of fructooligosaccharides (FOS). Diets were supplied with 12 mg iron/kg from the following sources: ferrous sulfate (FS - control diet), fortified rice with micronized ferric pyrophosphate (Ultra Rice) (UR diet), ferrous sulfate + yacon flour (FS + Y diet) or Ultra Rice + yacon flour (UR + Y diet). Blood samples were collected at the end of depletion and repletion stages for determination of hemoglobin concentration and calculation of the relative biological value (RBV). Also, the content of short chain fatty acids (SCFA) (acetic, propionic and butyric acids) from animals' stools and caecum weight were determined. The UR diet showed high iron bioavailability (RBV = 84.7%). However, the addition of yacon flour in the diet containing fortified rice (UR + Y diet) decreased RBV (63.1%) significantly below the other three groups (p flour showed higher acetic acid values compared to those who did not. In conclusion, fortified UR with micronized ferric pyrophosphate showed high iron bioavailability but the addition of yacon flour at 7.5% FOS reduced iron bioavailability despite increased caecum weight and SCFA concentration.
Directory of Open Access Journals (Sweden)
María G. Caletti
2005-12-01
Full Text Available La insuficiencia renal crónica es la complicación más grave del síndrome urémico hemolítico (SUH. En el año 1996 se publicó la secuencia histológica de su evolución en pacientes con períodos oligoanúricos prolongados. En los últimos años se han propuesto diferentes esquemas terapéuticos para enlentecer la evolución a la insuficiencia renal crónica terminal en distintas nefropatías, diabéticas y no diabéticas, cuya expresión puede comenzar aun en la adolescencia. En este trabajo se comenta la respuesta a dos esquemas terapéuticos de dos grupos de pacientes con SUH que presentaron proteinuria con o sin hipertensión arterial e insuficiencia renal. Se enfatiza la indicación de la dieta hiposódica y controlada en proteínas en el mismo momento del alta del paciente y la incorporación de un inhibidor de la enzima de conversión de angiotensina II, iECA, (enalapril al comienzo de la aparición de la proteinuria.Chronic renal failure (CRF is the most severe complication of hemolytic uremic syndrome (HUS. In 1996, the histological sequence of changes in patients with long lasting oligoanuric periods was clarified. In the last years different therapeutic schemes have been proposed in order to slacken the development of terminal CRF in different renal conditions secondary to diabetes and other diseases. Some of these cases can suffer the onset of renal failure at adolescence. In this review, response to two treatment schemes in different patients with HUS and proteinuria with or without hypertension or renal failure is commented. Early indication of poor sodium diet and strict control of protein intake at the very moment of hospital discharge is strongly recommended, as well as angiotensin II conversion inhibiting enzymes (iACE at the appearance of proteinuria.
African Journals Online (AJOL)
notre patient. Chez la femme, les tumeurs de l'urètre antérieur se manifestent plutôt par une urétrorragie, une dysurie, ou même par une masse perçue au méat ... Le traitement du cancer de l'urètre fait appel à la chirurgie, à la radiothérapie et à la chimiothérapie”. La Chirurgie”1o. Elle peut être conservatrice ou mutilante.
Respiratory inflammation and infections in high-performance athletes.
Gleeson, Maree; Pyne, David B
2016-02-01
Upper respiratory illness is the most common reason for non-injury-related presentation to a sports medicine clinic, accounting for 35-65% of illness presentations. Recurrent or persistent respiratory illness can have a negative impact on health and performance of athletes undertaking high levels of strenuous exercise. The cause of upper respiratory symptoms (URS) in athletes can be uncertain but the majority of cases are related to common respiratory viruses, viral reactivation, allergic responses to aeroallergens and exercise-related trauma to the integrity of respiratory epithelial membranes. Bacterial respiratory infections are uncommon in athletes. Undiagnosed or inappropriately treated asthma and/or allergy are common findings in clinical assessments of elite athletes experiencing recurrent URS. High-performance athletes with recurrent episodes of URS should undergo a thorough clinical assessment to exclude underlying treatable conditions of respiratory inflammation. Identifying athletes at risk of recurrent URS is important in order to prescribe preventative clinical, training and lifestyle strategies. Monitoring secretion rates and falling concentrations of salivary IgA can identify athletes at risk of URS. Therapeutic interventions are limited by the uncertainty of the underlying cause of inflammation. Topical anti-inflammatory sprays can be beneficial for some athletes. Dietary supplementation with bovine colostrum, probiotics and selected antioxidants can reduce the incidence or severity of URS in some athletes. Preliminary studies on athletes prone to URS indicate a genetic predisposition to a pro-inflammatory response and a dysregulated anti-inflammatory cytokine response to intense exercise as a possible mechanism of respiratory inflammation. This review focuses on respiratory infections and inflammation in elite/professional athletes.
Directory of Open Access Journals (Sweden)
Angélica de Cássia Oliveira Carneiro
2009-06-01
Full Text Available O principal objetivo deste trabalho foi produzir chapas de aglomerado substituindo-se parcial ou totalmente os adesivos à base de uréia-formaldeído por adesivos de taninos extraídos da casca de angico-vermelho (Anadenanthera peregrina e hidrolisados. As chapas de aglomerado foram fabricadas com partículas de Pinus elliottii e dimensões aproximadas de 40 x 40 x 1 cm, contendo 8% de sólidos de adesivo em relação à massa seca de partículas, sendo 100% de adesivo de uréia-formaldeído puro ou contendo 12,5, 25 e 37,5% de adesivo tânico. Foram produzidas, também, chapas com adesivos tânicos puros, constituindo um total de cinco tratamentos, com três repetições. As chapas foram fabricadas com densidade média de 0,7 g/cm³. As propriedades físicas e mecânicas das chapas foram determinadas em conformidade com a norma ASTM D-1037 (1993. Os resultados dos testes mecânicos foram comparados com os valores mínimos estabelecidos na norma ANSI/A 208.1-1993 (Wood Particleboard, enquanto os resultados dos testes de absorção de água e inchamento em espessura, comparados com os valores máximos estabelecidos na norma DIN 68m761 (1-1961. A resistência mecânica das chapas de aglomerado produzidas com adesivos contendo taninos de angico-vermelho, com exceção do módulo de elasticidade, ultrapassou os valores mínimos requeridos na norma ANSI/A1-280/93. A absorção de água e o inchamento em espessura, após 2 e 24 h de imersão, de todas as chapas excederam o valor máximo estabelecido. Conclui-se que os adesivos de taninos de angico-vermelho podem substituir parcial ou totalmente o adesivo comercial de uréia-formaldeído, e as suas misturas são indicadas para uso interior, em que a resistência à umidade não é requerida.The main objective of this work was to produce particleboards with hydrolysed "angico-vermelho" bark (Anadenanthera peregrina tannins as partial or total substitute of urea-formaldehyde. Particleboards with the
Verdensteatrets forhandling af fremmedhed
DEFF Research Database (Denmark)
Christoffersen, Erik Exe
2009-01-01
Om Odin Teatret forestilling Ur-Hamlet, Kronborg, 200. Iscenesættelse, dramaturgi og global kontekst......Om Odin Teatret forestilling Ur-Hamlet, Kronborg, 200. Iscenesættelse, dramaturgi og global kontekst...
Whitney, T R
2017-08-01
Ground woody products and urea are low-cost roughage and N sources. Rambouillet ewe lambs ( = 48, 6 lambs/treatment; initial BW = 42 kg ± 3.8) were used to evaluate effects of using ground (juniper) and urea in supplements on feedlot lamb growth traits, blood serum parameters, and fecal characteristics. In a randomized complete block design (40 d), lambs were individually fed an ad libitum basal sorghum-Sudangrass hay diet, which was fed separate from 1 of 8 supplemental diets (6 lambs/diet; 533 g of supplement/d, as-fed basis). Treatment structure was a 4 × 2 factorial: 4 concentrations of ground juniper (JN: 15%, 30%, 45%, or 60% of DM) and 2 concentrations of urea (UR: 1 or 3% of DM). Lamb growth traits were evaluated on d 0, 5, 12, 19, 26, 33, and 40; blood serum was evaluated on d 6 to 8, 20 to 22, and 34 (at h 3 and 6), and feces was evaluated on d 35. Compared to lambs fed all of the other treatments, lambs fed JN60UR1 or JN60UR3 had reduced supplement DMI (negative quadratic, = 0.007). Hay and total DMI were variable across day (JN × UR × day, 0.10). A JN × day interaction was detected ( 0.17) ADG and G:F. Lamb G:F fluctuated across day (JN × day, = 0.007), but the JN × day quadratic trend ( urea N quadratically increased ( urea N resulted from a greater decline from 3 to 6 h after feeding in lambs supplemented with UR1 vs. UR3. Increasing JN concentration tended to quadratically increase ( = 0.09) fecal DM and linearly decrease ( = 0.002) fecal N, but an effect due to dietary UR was not detected ( > 0.34). Results indicated that daily supplement DMI was restricted only by using JN60. However, a 60% JN-based supplement will not make an effective rangeland supplement for growing ewe lambs, and using 3% UR should not be considered, especially since daily UR intake was not restricted enough to be considered safe.
Qi, Haiping; Coplen, Tyler B.; Jordan, James A.
2016-01-01
Comparative measurements of stable hydrogen and oxygen isotopes in wood are hampered by the lack of proper reference materials (RMs). The U.S. Geological Survey (USGS) has prepared three powdered, whole-wood RMs, USGS54 (Pinus contorta, Canadian lodgepole pine), USGS55 (Cordia cf. dodecandra, Mexican ziricote), and USGS56 (Berchemia cf. zeyheri, South African red ivorywood). The stable isotopes of hydrogen, oxygen, carbon, and nitrogen in these RMs span ranges as δ2HVSMOW from –150.4 to –28.2 mUr or ‰, as δ18OVSMOW from + 17.79 to + 27.23 mUr, as δ13CVPDB from –27.13 to –24.34 mUr, and as δ15N AIR-N2 from –2.42 to + 1.8 mUr. These RMs will enable users to normalize measurements of wood samples to isotope–delta scales, and they are intended primarily for the normalization of δ2H and δ18O measurements of unknown wood samples. However, they also are suitable for normalization of stable isotope measurements of carbon and nitrogen in wood samples. In addition, these RMs are suitable for inter-laboratory calibration for the dual-water suilibration procedure for the measurements of δ2HVSMOW values of non-exchangeable hydrogen. The isotopic compositions with 1-σ uncertainties, mass fractions of each element, and fractions of exchangeable hydrogen of these materials are:USGS54 (Pinus contorta, Canadian Lodgepole pine)δ2HVSMOW = –150.4 ± 1.1 mUr (n = 29), hydrogen mass fraction = 6.00 ± 0.04 % (n = 10)Fraction of exchangeable hydrogen = 5.4 ± 0.6 % (n = 29)δ18OVSMOW = + 17.79 ± 0.15 mUr (n = 18), oxygen mass fraction = 40.4 ± 0.2 % (n = 6)δ13CVPDB = –24.43 ± 0.02 mUr (n = 18), carbon mass fraction = 48.3 ± 0.4 % (n = 12)δ15NAIR-N2 = –2.42 ± 0.32 mUr (n = 17), nitrogen mass fraction = 0.05 % (n = 4)USGS55 (Cordia cf. dodecandra, Mexican ziricote)δ2HVSMOW = –28.2 ± 1.7 mUr (n = 30), hydrogen mass fraction = 5.65 ± 0.06 % (n = 10)Fraction of exchangeable
Urvina Bay Stable Isotope (delta 18O) Data for 1600 to 1992
National Oceanic and Atmospheric Administration, Department of Commerce — A. URVCOMP.TXT Site: Urvina Bay, Galapagos Islands, 00 deg 24.52 min S, 91 deg 14.04 min W. Oxygen Isotopic time series averaged from 2 cores-UR-86 (Pavona clavus,...
Do the Uncertainty Relations Really have Crucial Significances for Physics?
Directory of Open Access Journals (Sweden)
Dumitru S.
2010-10-01
Full Text Available It is proved the falsity of idea that the Uncertainty Relations (UR have crucial significances for physics. Additionally one argues for the necesity of an UR-disconnected quantum philosophy.
Reconsideration of the Uncertainty Relations and Quantum Measurements
Directory of Open Access Journals (Sweden)
Dumitru S.
2008-04-01
Full Text Available Discussions on uncertainty relations (UR and quantum measurements (QMS persisted until nowadays in publications about quantum mechanics (QM. They originate mainly from the conventional interpretation of UR (CIUR. In the most of the QM literarure, it is underestimated the fact that, over the years, a lot of deficiencies regarding CIUR were signaled. As a rule the alluded deficiencies were remarked disparately and discussed as punctual and non-essential questions. Here we approach an investigation of the mentioned deficiencies collected in a conclusive ensemble. Subsequently we expose a reconsideration of the major problems referring to UR and QMS. We reveal that all the basic presumption of CIUR are troubled by insurmountable deficiencies which require the indubitable failure of CIUR and its necessary abandonment. Therefore the UR must be deprived of their statute of crucialpieces for physics. So, the aboriginal versions of UR appear as being in postures of either (i thought-experimental fictions or (ii simple QM formulae and, any other versions of them, have no connection with the QMS. Then the QMS must be viewed as an additional subject comparatively with the usual questions of QM. For a theoretical description of QMS we propose an information-transmission model, in which the quantum observables are considered as random variables. Our approach directs to natural solutions and simplifications for many problems regarding UR and QMS.
Lin, Chun-Hua; Zhang, Zuo-Fu; Wang, Jiahui; Yu, Lu-Xin; Wang, Wen-Ting; Shi, Lei; Lin, Xiang-Nan
2017-11-01
Here, we reported our clinical application of ureterorenoscope (URS) and flexible URS lithotripsy in stone removal on 10 cases of excised living donor kidney graft. After the extraction of donor kidney by retroperitoneal laparoscopy, the donor graft was perfused with 4 °C HCA solution. Calculus between 2-4 mm were removed intact with lithotomy forceps under direct vision of URS. Larger calculi of >4 mm were fractured with flexible URS combining holmium laser lithotripsy. Fragments of the calculus were extracted with basket extractor and lithotomy forceps. All operations were successful. The operation time was 14-31 min (average 21.2 ± 6.3 min). The kidneys were then transplanted to the recipients using routine procedure. The transplanted kidneys functioned well after transplantation. Gross hematuria resolved 1-4 d after operation (average 2.6 ± 0.9 d). The transplanted kidneys functioned well without early complications such as functional recovery delay and acute graft rejection. The donors and recipients were followed for 12 months. The size of the transplanted kidneys was normal and new stones or urinary obstruction was not seen upon urinary color Doppler ultrasound examination. In conclusion, we believe it is feasible, safe and effective to use URS or flexible URS combining holmium laser lithotripsy on extracorporeal living donor kidney.
Reconsideration of the Uncertainty Relations and Quantum Measurements
Directory of Open Access Journals (Sweden)
Dumitru S.
2008-04-01
Full Text Available Discussions on uncertainty relations (UR and quantum measurements (QMS persisted until nowadays in publications about quantum mechanics (QM. They originate mainly from the conventional interpretation of UR (CIUR. In the most of the QM literarure, it is underestimated the fact that, over the years, a lot of deficiencies regarding CIUR were signaled. As a rule the alluded deficiencies were remarked disparately and dis- cussed as punctual and non-essential questions. Here we approach an investigation of the mentioned deficiencies collected in a conclusive ensemble. Subsequently we expose a reconsideration of the major problems referring to UR and QMS. We reveal that all the basic presumption of CIUR are troubled by insurmountable deficiencies which require the indubitable failure of CIUR and its necessary abandonment. Therefore the UR must be deprived of their statute of crucial pieces for physics. So, the aboriginal versions of UR appear as being in postures of either (i thought-experimental fictions or (ii sim- ple QM formulae and, any other versions of them, have no connection with the QMS. Then the QMS must be viewed as an additional subject comparatively with the usual questions of QM. For a theoretical description of QMS we propose an information- transmission model, in which the quantum observables are considered as random vari- ables. Our approach directs to natural solutions and simplifications for many problems regarding UR and QMS.
Quality of urban runoff in wet and dry seasons: a case study in a semi-arid zone.
Ortiz-Hernández, Joyce; Lucho-Constantino, Carlos; Lizárraga-Mendiola, Liliana; Beltrán-Hernández, Rosa Icela; Coronel-Olivares, Claudia; Vázquez-Rodríguez, Gabriela
2016-12-01
Urban runoff (UR) is a promising new resource that may alleviate growing tensions in numerous arid and semi-arid regions of the world. However, it is precisely in these zones that the available UR quality characteristics are scarcer. This work aims to evaluate a wide set of parameters to establish a detailed approach to both the quality of UR in a midsized city in Central Mexico and the feasibility of using UR to recharge aquifers. UR from an institutional land use site was sampled during wet and dry seasons and assessed for suspended solids, organic matter, nutrients, microorganisms, metals, and persistent organic chemicals (i.e., polycyclic aromatic hydrocarbons, PAH). The results were analyzed using multivariate statistical methods to identify relationships among the variables, the sampling sites and the seasons. The soil erosion and the leaching of materials due to the water flow through vegetated areas were identified as the most influencing factor on the quality of the site runoff in both dry and wet seasons. Additionally, data were more heterogeneous during the dry season, and higher pollutant concentrations were found both during the dry season and in more pervious zones. We consider UR a promising water source for recharging aquifers in arid and semi-arid zones if a program is implemented that can integrate an adequate runoff treatment system, soil protection, and other non-structural measures.
Do the Uncertainty Relations Really have Crucial Significances for Physics?
Directory of Open Access Journals (Sweden)
Dumitru S.
2010-10-01
Full Text Available It is proved the falsity of idea that the Uncertainty Relations (UR have crucial signif- icances for physics. Additionally one argues for the necesity of an UR-disconnected quantum philosophy.
Fox, L. K.; Singer, J.
2015-12-01
Undergraduate Research (UR) is broadly accepted as a high impact educational practice. Student participation in UR contributes to measurable gains in content knowledge and skills/methodology, oral and written communication skills, problem solving and critical thinking, self-confidence, autonomy, among others. First-generation college students and students from underrepresented minorities that participate in UR are more likely to remain in STEM majors, persist to graduation, and pursue graduate degrees. While engagement in the research process contributes to these outcomes, the impact of the interaction with the faculty mentor is critical. A number of studies provide evidence that it is the relationship that forms with the faculty mentor that is most valued by students and strongly contributes to their career development. Faculty mentors play an important role in student development and the relationship between mentor and student evolves from teacher to coach to colleague. Effective mentoring is not an inherent skill and is generally not taught in graduate school and generally differs from mentoring of graduate students. Each UR mentoring relationship is unique and there are many effective mentoring models and practices documented in the literature. The Council on Undergraduate Research (CUR) has a long history of supporting faculty who engage in research with undergraduates and offers resources for establishing UR programs at individual, departmental, and institutional levels. The Geosciences Division of CUR leads faculty development workshops at professional meetings and provides extensive resources to support geosciences faculty as UR mentors (http://serc.carleton.edu/NAGTWorkshops/undergraduate_research/index.html). Examples of effective mentoring strategies are highlighted, including a model developed by SUNY- Buffalo State that integrates mentoring directly into the evaluation of UR.
Directory of Open Access Journals (Sweden)
Marcus J Drake
Full Text Available The emergence of urinary retention (UR, specifically acute urinary retention (AUR, has been a concern when treating men with lower urinary tract symptoms (LUTS with antimuscarinic drugs.In NEPTUNE (12-week, double-blind, men (≥45 years with LUTS were randomized to receive tamsulosin oral-controlled absorption system (TOCAS 0.4 mg, fixed-dose combination (FDC of solifenacin (Soli 6 mg + TOCAS 0.4 mg, FDC Soli 9 mg + TOCAS 0.4 mg, or placebo. In NEPTUNE II (40-week, open-label extension of NEPTUNE, continuing patients received 4-week FDC Soli 6 mg + TOCAS, then FDC Soli 6 mg or 9 mg + TOCAS for the remainder of the study, switchable every 3 months.Across both studies, 1208 men received ≥1 dose of FDC Soli 6 mg or 9 mg + TOCAS for up to 52 weeks; 1199 men completed NEPTUNE and 1066 received ≥1 dose in NEPTUNE II. In total, 13 men (1.1%; 95% CI, 0.6%-1.8% reported a UR event while receiving FDC, eight of which were AUR (0.7%; 95% CI, 0.3%-1.3%, incidence 7/1000 man-years. Six men reported UR events while taking Soli 6 mg + TOCAS (three AUR, and seven men reported a UR event while taking Soli 9 mg + TOCAS (five AUR. One man developed AUR while taking TOCAS alone and four reported UR (three AUR during placebo run-in. Most AUR/UR events occurred within 4 months of treatment initiation.FDC Soli and TOCAS was associated with a low rate of UR and AUR in men with LUTS.
Therapie des Harnleitersteins - extrakorporale Stoßwellenlithotripsie und Ureteroskopie im Vergleich
Directory of Open Access Journals (Sweden)
Strohmaier WL
1999-01-01
Full Text Available In einer prospektiven Studie wurden 146 Patienten mit nicht spontan abgehenden Harnleitersteinen behandelt. Sie wurden über Vor- und Nachteile der ESWL bzw. URS aufgeklärt. Die primäre Therapie erfolgte nach Wunsch des Patienten. 97 Patienten entschieden sich für eine primäre ESWL. Zweimal erfolgte sie sekundär. Wir führten 128 Behandlungen durch: Bei 71 Patienten eine, bei 21 zwei und bei 5 drei Sitzungen. Danach wurden 70 % der Patienten steinfrei, bei 30 % versagte die ESWL. Die Versagerrate war mit 41 % bei den distalen Steinen am höchsten. Bei den distalen Steinen waren nicht erfolgreich behandelte signifikant größer als erfolgreich therapierte. Bei 26 Therapieversagern lag eine Steinanalyse vor: 23 Patienten litten an einem Whewellitstein. Relevante Komplikationen nach ESWL beobachteten wir nicht. Die Therapieversager wurden sekundär der URS zugeführt. 49 Patienten entschieden sich primär für die URS. Sekundär wurde sie bei 29 Patienten eingesetzt. In 75 Fällen erfolgte die URS in einer Sitzung, dreimal in zwei Sitzungen. Danach waren 95 % der Patienten steinfrei. Distale Steine wiesen die höchste Erfolgsrate auf (97,5 %. Als Sekundärbehandlung war einmal eine ESWL und zweimal eine Ureterolithotomie erforderlich. Eine operationsbedürftige Komplikation beobachteten wir nur in einem Fall. Die URS wurde bei allen Patienten in Analgosedierung oder Spinalanästhesie durchgeführt. 75 % der ESWL-Behandlungen mußten in Analgosedierung erfolgen. Unsere Ergebnisse zeigen, daß die URS ein effektives und sicheres Verfahren mit niedriger Komplikationsrate ist. Größte Vorteile zeigt sie bei distalen Harnleitersteinen. Die ESWL zeigt eine geringere Steinfreiheitsrate mit höherer Anzahl von Wiederholungsbehandlungen auf. Whewellitsteine sind für die ESWL problematisch. Daher sollte die URS bei distalen Harnleitersteinen primär als Therapiealternative zur ESWL angeboten werden. Bei Whewellitsteinen ist die URS die Therapie der
Directory of Open Access Journals (Sweden)
Nou-Ying Tang
2017-01-01
Full Text Available Epileptic seizures are crucial clinical manifestations of recurrent neuronal discharges in the brain. An imbalance between the excitatory and inhibitory neuronal discharges causes brain damage and cell loss. Herbal medicines offer alternative treatment options for epilepsy because of their low cost and few side effects. We established a rat epilepsy model by injecting kainic acid (KA, 12 mg/kg, i.p. and subsequently investigated the effect of Uncaria rhynchophylla (UR and its underlying mechanisms. Electroencephalogram and epileptic behaviors revealed that the KA injection induced epileptic seizures. Following KA injection, S100B levels increased in the hippocampus. This phenomenon was attenuated by the oral administration of UR and valproic acid (VA, 250 mg/kg. Both drugs significantly reversed receptor potentiation for advanced glycation end product proteins. Rats with KA-induced epilepsy exhibited no increase in the expression of metabotropic glutamate receptor 3, monocyte chemoattractant protein 1, and chemokine receptor type 2, which play a role in inflammation. Our results provide novel and detailed mechanisms, explaining the role of UR in KA-induced epileptic seizures in hippocampal CA1 neurons.
Directory of Open Access Journals (Sweden)
Antonia Sherlânea Chaves Veras
2006-01-01
Full Text Available Foi avaliado o efeito de quatro níveis (0; 12,5; 25; 37,5; e 50% de palma forrageira e uréia em substituição ao feno de capim tifton, na ração de vacas da raça holandesa em lactação sobre a digestibilidade aparente da matéria seca (DAMS, da matéria orgânica (DAMO, da fibra em detergente neutro (DAFDN, da proteína bruta (DAPB, dos carboidratos totais (DACHOT e dos carboidratos não fibrosos (DACNF. Foram utilizadas cinco vacas, com peso médio de 480 kg e produção média de leite de 20 kg/dia, distribuídas em um quadrado latino 5x5. As DAMS, DAMO, DACHOT e DACNF aumentaram, a DAFDN diminuiu linearmente e a DAPB não foi influenciada com o aumento dos níveis de palma e uréia na dieta. Os nutrientes digestíveis totais de mantença, a energia digestível de lactação, energia metabolizável de lactação e energia líquida de lactação aumentaram à medida que eram incluídas palma e uréia na dieta.The effect of five levels forage cactus and urea (0.0, 12.5, 25.0, 37.5 and 50% in replacement of tifton hay in lactating Holstein cows diets, on the apparent digestibility of dry matter (ADDM, organic matter (ADOM, neutral detergent fiber (ADNDF, crude protein (ADCP, total carbohydrates (ADTC and nonfiber carbohydrates (ADNFC were evaluated. Five Holstein cows weighing on average 480 kg and with an average milk yield of 20 kg of milk/day were used in a 5x5 Latin square design. The DM, OM, TC and NFC apparent digestibility increased while NDF apparent digestibility decreased linearly and the CP apparent digestibility was not affected by the inclusion of forage cactus and urea. The total digestible nutrients of maintenance, digestible energy of lactation, metabolizing energy of lactation and liquid energy of lactation increased as the forage cactus and urea levels increased.
Sanguedolce, F; Liatsikos, E; Verze, P; Hruby, S; Breda, A; Beatty, J D; Knoll, T
2014-08-01
Treatment of renal stones using flexible ureteroscopy (fURS) is increasingly common despite the poor evidence in literature supporting its use and indications. With this study, we wanted to investigate the current use and indication of fURS for the treatment of renal stones in the clinical practice across the European countries. A survey was conducted using an emailed questionnaire consisting of 21 items; 2,894 recipients were selected via the EAU membership database. The questionnaires were collected through the SurveyMonkey system and the data were processed with the SPSS statistical package. Frequencies, cross tabs and Pearson correlation coefficients were applied as appropriate. 1,168 questionnaires were collected (response rate 40.4%). fURS was performed in 72.9% of the respondents' institutions, and 54.2% of the respondents were performing the procedure. For 95% of the users, fURS was considered first-line treatment, for stone of lower pole stone (45.9%) and <1 cm (44.2%) and 2 cm (43.8%) in size. The ureteral access sheaths were used routinely by more than 70% of the respondents. Lower pole stone repositioning technique was routinely performed by 45.9% of the surgeons. After fragmentation, 47.2% of the responders preferred to retrieve only the bigger fragments. At the end of fURS, lower volume surgeons were more likely to place routinely a double-J stent (p = 0.001). Higher volume surgeons estimated a higher durability of devices, both optical and digital ones (p < 0.001), and were more prone to consider fURS cost-effective when compared to other treatment modalities (p < 0.001). fURS is widely used for the treatment of renal stones and its use and indication can vary according to the age and surgeons' case volume. Higher volume surgeons are more prompt to extend international guidelines indications and to consider the technology cost-effective.
Hrbáček, Jan; Macek, Petr; Ali-El-Dein, Bedeir; Thalmann, George N; Stenzl, Arnulf; Babjuk, Marek; Shaaban, Atallah A; Gakis, Georgios
2015-01-01
The incidence, treatment, and outcome of urethral recurrence (UR) after radical cystectomy (RC) for muscle-invasive bladder cancer with orthotopic neobladder in women have rarely been addressed in the literature. A total of 12 patients (median age at recurrence: 60 years) who experienced UR after RC with an orthotopic neobladder were selected for this study from a cohort of 456 women from participating institutions. The primary clinical and pathological characteristics at RC, including the manifestation of the UR and its treatment and outcome, were reviewed. The primary bladder tumors in the 12 patients were urothelial carcinoma in 8 patients, squamous cell carcinoma and adenocarcinoma in 1 patient each, and mixed histology in 2 patients. Three patients (25%) had lymph node-positive disease at RC. The median time from RC to the detection of UR was 8 months (range 4-55). Eight recurrences manifested with clinical symptoms and 4 were detected during follow-up or during a diagnostic work-up for clinical symptoms caused by distant metastases. Treatment modalities were surgery, chemotherapy, radiotherapy, and bacillus Calmette-Guérin urethral instillations. Nine patients died of cancer. The median survival after the diagnosis of UR was 6 months. UR after RC with an orthotopic neobladder in females is rare. Solitary, noninvasive recurrences have a favorable prognosis when detected early. Invasive recurrences are often associated with local and distant metastases and have a poor prognosis. © 2014 S. Karger AG, Basel.
International Nuclear Information System (INIS)
Ahuja, Tarushee; Kumar, D.; Singh, Nahar; Biradar, A.M.; Rajesh
2011-01-01
A novel potentiometric urea biosensor has been fabricated with urease (Urs) immobilized multi-walled carbon nanotubes (MWCNTs) embedded in silica matrix deposited on the surface of indium tin oxide (ITO) coated glass plate. The enzyme Urs was covalently linked with the exposed free -COOH groups of functionalized MWCNTs (F-MWCNTs), which are subsequently incorporated within the silica matrix by sol-gel method. The Urs/MWCNTs/SiO 2 /ITO composite modified electrode was characterized by Fourier transform infrared (FTIR) spectroscopy, thermal gravimetric analysis (TGA) and UV-visible spectroscopy. The morphologies and electrochemical performance of the modified Urs/MWCNTs/SiO 2 /ITO electrode have been investigated by scanning electron microscopy (SEM) and potentiometric method, respectively. The synergistic effect of silica matrix, F-MWCNTs and biocompatibility of Urs/MWCNTs/SiO 2 made the biosensor to have the excellent electro catalytic activity and high stability. The resulting biosensor exhibits a good response performance to urea detection with a wide linear range from 2.18 x 10 -5 to 1.07 x 10 -3 M urea. The biosensor shows a short response time of 10-25 s and a high sensitivity of 23 mV/decade/cm 2 .
Directory of Open Access Journals (Sweden)
Marluce Teixeira Andrade Queiroz
Full Text Available RESUMO: Nesse estudo, o principal objetivo foi mensurar a concentração de tório, urânio e potássio aplicando a técnica da análise por Ativação Neutrônica Instrumental em dois compartimentos ambientais, águas superficiais e sedimento marginal, do rio Piracicaba, em Minas Gerais. Esse rio possui área de drenagem que inclui as regiões do Quadrilátero Ferrífero da Região do Vale do Aço, sujeitando-se a intensa ação antropogênica. As amostragens ocorreram em quatro pontos de coleta, localizados nos municípios de Fonseca, Rio Piracicaba, Nova Era e Ipatinga, nas estações seca e chuvosa. As concentrações determinadas para aqueles elementos no sedimento se apresentaram elevadas em comparação com os valores usualmente observados para o perfil geológico na região de estudo, denotando relação com o modelo de exploração econômica, notadamente com a mineração e siderurgia. Evidencia, também, a relação com a degradação do feldspato potássico e do quartzo. Na água superficial, constatou-se o incremento da concentração do tório e potássio em comparação com os valores do Conselho Nacional do Meio Ambiente (CONAMA, nº. 357/2005. Os achados desse estudo explicitaram a necessidade da adoção de medidas mitigadoras, visando a contenção dos danos ambientais.
Directory of Open Access Journals (Sweden)
Ana Cândida Primavesi
2005-03-01
Full Text Available Os processos fisiológicos das plantas são afetados pelo balanço de cátions e ânions absorvidos. O objetivo deste trabalho foi determinar a absorção de cátions e ânions quando plantas de capim-coastcross receberam doses elevadas de nitrogênio. O delineamento experimental foi o de blocos casualizados com quatro repetições, num esquema fatorial 2x5 - duas fontes de N: uréia e nitrato de amônio, e cinco doses de N: 0, 25, 50, 100, 200 kg ha-1 corte-1 . As doses de N foram aplicadas após cada corte num total de cinco cortes, durante a época das chuvas. A absorção de cátions e de ânions pelo capim-coastcross aumentou com o acréscimo das doses de N dos dois fertilizantes, sendo maior com o nitrato de amônio. Com doses crescentes de N, verificou-se entre os cátions maior absorção do K+, e do Cl- entre os ânions. Com exceção do N, a absorção do K+ foi superior à dos demais nutrientes, com redução no teor relativo de cálcio. Doses altas de N aplicadas em capim-coastcross, na forma de uréia ou de nitrato de amônio, favorecem a absorção de cátions e de ânions.Physiologic processes of plants are affected by uptake of cations and anions. The aim of this work was to determine the uptake of cations and anions when plants of coastcross grass received high doses of nitrogen. The experimental design was a randomized block, in a 2x5 factorial arrangement - two N sources: urea and ammonium nitrate and five N rates: 0, 25, 50, 100, and 200 kg ha-1 cutting-1 - with four replications. Treatments were applied after each of five consecutive cutting in the rainy season. Uptake of cations and anions by coastcross grass increased with increasing of N rates with both fertilizers, but was higher with ammonium nitrate. Increasing rates of N caused higher K+ uptake in relation to other cations, and in Cl- among the anions. Except for N, K+ uptake was greater than that of other nutrients, with a reduction on the relative content of Ca2
Asymptotic shape of solutions to the perturbed simple pendulum problems
Directory of Open Access Journals (Sweden)
Tetsutaro Shibata
2007-05-01
Full Text Available We consider the positive solution of the perturbed simple pendulum problem $$ u''(r + frac{N-1}{r}u'(r - g(u(t + lambda sin u(r = 0, $$ with $0 < r < R$, $ u'(0 = u(R = 0$. To understand well the shape of the solution $u_lambda$ when $lambda gg 1$, we establish the leading and second terms of $Vert u_lambdaVert_q$ ($1 le q < infty$ with the estimate of third term as $lambda o infty$. We also obtain the asymptotic formula for $u_lambda'(R$ as $lambda o infty$.
Directory of Open Access Journals (Sweden)
Angélica de Cássia Oliveira Carneiro
2004-10-01
Full Text Available Os taninos foram extraídos da casca de Eucalyptus grandis e Eucalyptus pellita, com água quente, à qual se adicionaram 4,5% de sulfito de sódio, durante três horas. As temperaturas da solução foram iguais a 70 e 100 ºC para Eucalyptus grandis e Eucalyptus pellita, respectivamente. Para a produção dos adesivos e com o intuito de reduzir a sua viscosidade, os taninos foram sulfitados com sulfito de sódio e ácido acético. Formulações adesivas foram preparadas adicionando-se 0, 25, 50, 75 ou 100% de adesivos tânicos ao adesivo comercial de uréia-formaldeído. Foram fabricadas chapas de flocos de Pinus elliottii Engelm. e Eucalyptus grandis, utilizando-se 8% da formulação adesiva. As propriedades das chapas foram determinadas segundo a norma ASTM D-1037, de 1993. Observou-se que as propriedades das chapas foram superiores ao mínimo estabelecido pela norma ANSI/A 280.1-93, exceto no caso da resistência à umidade. Verificou-se, ainda, que o emprego de uma formulação adesiva contendo resina à base de uréia-formaldeído e tanino-formaldeído pode melhorar algumas propriedades.Bark tannins of Eucalyptus grandis and Eucalyptus pellita were extracted with 4,5% sodium sulfite in hot water solution for a period of three hours. Solution temperatures were 70 and 100ºC, for Eucalyptus grandis and Eucalyptus pellita bark respectively. Tannins were reacted with acetic acid and sodium sulfite to reduce adhesive viscosity. Adhesive formulations were prepared adding 0, 25, 50, 75 or 100% of tannin adhesives to the commercial urea-formaldehyde adhesive. Flakeboards were fabricated with 8% resin content. Board properties were determined according to ASTM D-1037 standards. Except for humidity, all board properties were superior to the values established by ANSI.A 208.1-93 commercial standard. Addition of tannins to the urea-formaldehyde adhesive improved some properties.
'We zijn nu de beste in bioplastics'
Seventer, van E.
2012-01-01
‘Toen we begonnen was Wageningen UR landbouw en voeding. Nu zijn we ook goed in bioplastics’, zegt Erik van Seventer van Wageningen UR Food & Biobased Research. De investering in onderzoek voor een biobased economie heeft duidelijk zijn vruchten afgeworpen.
Valentini, Giseli; Gonçalves-Vidigal, Maria Celeste; Hurtado-Gonzales, Oscar P; de Lima Castro, Sandra Aparecida; Cregan, Perry B; Song, Qijian; Pastor-Corrales, Marcial A
2017-08-01
Co-segregation analysis and high-throughput genotyping using SNP, SSR, and KASP markers demonstrated genetic linkage between Ur-14 and Co-3 4 /Phg-3 loci conferring resistance to the rust, anthracnose and angular leaf spot diseases of common bean. Rust, anthracnose, and angular leaf spot are major diseases of common bean in the Americas and Africa. The cultivar Ouro Negro has the Ur-14 gene that confers broad spectrum resistance to rust and the gene cluster Co-3 4 /Phg-3 containing two tightly linked genes conferring resistance to anthracnose and angular leaf spot, respectively. We used co-segregation analysis and high-throughput genotyping of 179 F 2:3 families from the Rudá (susceptible) × Ouro Negro (resistant) cross-phenotyped separately with races of the rust and anthracnose pathogens. The results confirmed that Ur-14 and Co-3 4 /Phg-3 cluster in Ouro Negro conferred resistance to rust and anthracnose, respectively, and that Ur-14 and the Co-3 4 /Phg-3 cluster were closely linked. Genotyping the F 2:3 families, first with 5398 SNPs on the Illumina BeadChip BARCBEAN6K_3 and with 15 SSR, and eight KASP markers, specifically designed for the candidate region containing Ur-14 and Co-3 4 /Phg-3, permitted the creation of a high-resolution genetic linkage map which revealed that Ur-14 was positioned at 2.2 cM from Co-3 4 /Phg-3 on the short arm of chromosome Pv04 of the common bean genome. Five flanking SSR markers were tightly linked at 0.1 and 0.2 cM from Ur-14, and two flanking KASP markers were tightly linked at 0.1 and 0.3 cM from Co-3 4 /Phg-3. Many other SSR, SNP, and KASP markers were also linked to these genes. These markers will be useful for the development of common bean cultivars combining the important Ur-14 and Co-3 4 /Phg-3 genes conferring resistance to three of the most destructive diseases of common bean.
International Nuclear Information System (INIS)
Feng Yanlin; Tan Jiaju; Yang Jie; Zhu Zheng; Yu Fengwen; He Xiaohong; Huang Kemin; Yuan Baihong; Su Shaodi
2002-01-01
Objective: To evaluate the value of 99 Tc m -methoxyisobutylisonitrile (MIBI) lung imaging in diagnosing benign/malign pulmonary disease and the relation of 99 Tc m -MIBI uptake ratio (UR) with lung cancer DNA content. Methods: Early and delay imaging were performed on 27 cases of benign lung disease and 46 cases of malign lung disease. Visual analysis of the images and T/N uptake ratio measurement were performed on every case. Cancer cell DNA content and DNA index (DI) were measured in 24 cases of malign pulmonary disease. Results: The delay phase UR was 1.13 ± 0.19 in benign disease group, and the delay phase UR was 1.45 ± 0.21 in malign disease group (t6.51, P 99 Tc m -MIBI is not an ideal imaging agent for differentiating pulmonary benign/malign disease. Lung cancer DNA content may be reflected by delay phase UR
Cheng, Chih-Chia; Chang, Feng-Chih; Wang, Jui-Hsu; Chen, Jem-Kun; Yen, Ying-Chieh; Lee, Duu-Jong
2015-12-01
A novel urea-cytosine end-capped polypropylene glycol (UrCy-PPG) can self-assemble into a long-range ordered lamellar microstructure on the surface of graphene, due to the strong specific interactions between UrCy-PPG and graphene. In addition, the graphene composite produced exhibits a high conductivity (~1093 S m-1) with a dramatic thermo-responsive ON/OFF resistance-switching behavior (10 consecutive cycles).A novel urea-cytosine end-capped polypropylene glycol (UrCy-PPG) can self-assemble into a long-range ordered lamellar microstructure on the surface of graphene, due to the strong specific interactions between UrCy-PPG and graphene. In addition, the graphene composite produced exhibits a high conductivity (~1093 S m-1) with a dramatic thermo-responsive ON/OFF resistance-switching behavior (10 consecutive cycles). Electronic supplementary information (ESI) available. See DOI: 10.1039/c5nr07076g
Sahin, Selcuk; Resorlu, Berkan; Eksi, Mithat; Aras, Bekir; Atar, Arda; Tugcu, Volkan
2016-01-01
Objective: To compare the safety and effectiveness of flexible ureteroscopy (F-URS) with transperitoneal laparoscopic ureterolithotomy (TPLU) in cases of obstructive pyelonephritis secondary to large proximal ureteral stones. Methods: A series of 42 patients presenting with obstructive pyelonephritis due to proximal ureteral stones larger than 1.5 cm were included from April 2006 to February 2015 in this comparative study. After drainage of pyonephrosis and resolution of sepsis, 22 patients treated with TPLU (Group I), and 20 patients were treated with F-URS (Group II). Preoperative patient and stone characteristics, procedure-related parameters and clinical outcomes were assessed for each group. Results: It was seen that both methods were effective in the treatment of large proximal ureteral stones. However TPLU provided a higher stone- free rate (100% vs 80%. p=0.043) and lower retreatment rate. There was no difference between the groups for the operative time and complication rate. On the other hand, patients treated with F-URS had less postoperative pain (p=0.008), a shorter hospital stay (p<0.001) and a faster return to daily activities (p<0.001). Conclusions: The results of our study show that both F-URS and TPLU are safe and effective surgical procedures for treatment of large proximal ureteral stones after controlling obstructive pyelonephritis. However, TPLU has a higher stone-free rate with comparable operating time and complication rate as compared to F-URS. On the other hand F-URS has the advantages of less postoperative pain, shorter hospital stay and faster return to daily activities. PMID:27375691
African Journals Online (AJOL)
1 Department of Botany, SRNMN College of Applied Sciences, Balraj Urs Road, Shivamogga-577201,. Karnataka, India. 2 Department of Microbiology, SRNMN College of Applied Sciences, Balraj Urs Road, Shivamogga-. 577201, Karnataka, India. Abstract. Article Information. The present study was designed to study the ...
International collaboration in Endourology
DEFF Research Database (Denmark)
Jessen, Jan Peter; Breda, Alberto; Brehmer, Marianne
2016-01-01
INTRODUCTION: Semirigid and flexible ureterorenoscopy (URS) are safe and efficient treatment options for urolithiasis of all localizations. Sometimes, a JJ-stent is placed in preparation of definitive treatment. Aim of our study was to evaluate the influence of prestenting on the outcome of URS. ...
Success factors of social innovations by a community-based learning course (CBLC)
Wink, G.; Casimir, G.; Goris, M.
2014-01-01
This is the success story of a community-based learning course (CBLC) project addressing the concerns of the international community of students and staff of Wageningen University and Research Centre (WageningenUR). A joint effort of this community, WageningenUR and social entrepreneurs resulted in
Haan, de J.J.; Verhoeven, J.T.W.; Wolf, de P.L.
2016-01-01
The Dutch province of Limburg has asked Wageningen UR to develop an initial knowledge- and innovation agenda for the outdoor vegetable production sector, including three concrete project ideas for the POP3 framework. Besides this, Wageningen UR was asked to evaluate three innovation projects with
Bierkens, A. F.; Hendrikx, A. J.; de la Rosette, J. J.; Stultiens, G. N.; Beerlage, H. P.; Arends, A. J.; Debruyne, F. M.
1998-01-01
To determine the efficacy and costs of extracorporeal shock-wave lithotripsy (ESWL) compared with ureteroscopy (URS) in the treatment of mid- and lower ureteric calculi. The records of patients treated primarily by ESWL and URS were analysed retrospectively. Treatment with ESWL included 63 patients
2013-09-01
cœur vers le cerveau lors des compressions thoraciques et l’air est aspiré dans les poumons lors de la décompression active par traction sur la...maintenir une perfusion tissulaire adéquate. En nous basant sur ces observations dans le cœur et le cerveau , nous avons émis l’hypothèse que la...de la PIT pendant la phase de décompression avec une résistance inspiratoire double le débit sanguin vers le cœur et le cerveau , la PA et augmente
International Nuclear Information System (INIS)
Filesi, M.; Travascio, L.; Montesano, T.
2009-01-01
The objective of this study was to evaluate the role of 24 h/4 h uptake ratio (UR) in response to radioiodine-131 ( 131 I) therapy in patients with autonomously functioning thyroid nodules (AFTN). A total of 1402 consecutive hyperthyroid patients were treated with 131 I, between 1958 and 2005. Therapeutic doses (D) were calculated according to the formula: D=weight of nodule x dose per gram of nodular tissue (q)/24 h 131 I uptake. The ratios of the 24 and 4 h uptake were retrospectively calculated and the patients were grouped according to outcome and q into three groups of UR (≤1.25; 1.26-1.68; ≥1.69) by means of terziles. Of the 1402 patients, 95 did not respond to 131 I treatment while 93/1307 developed hypothyroidism. Most non-responders (55.8%) had UR ≤1.25, while many hypothyroid patients (66.7%) had UR ≥1.69 (χ 2 : P 131 I treatment, increasing to 13.9% at 5 years and 26.2% at 10 years. The 131 I UR can predict the outcome of 131 I treatment in AFTN and may have utility in modifying treatment in some patients to limit post-radioiodine induced hypothyroidism and treatment failures in order to achieve euthyroidism. (author)
Directory of Open Access Journals (Sweden)
Akar EC
2013-01-01
Full Text Available Erin Akar, Bodo E KnudsenDepartment of Urology, Ohio State University Wexner Medical Center, Columbus, OH, USAAbstract: The purpose of this review, based on the current evidence in the literature, is whether ureteroscopy (URS is a comparable primary treatment option to the current gold standard of percutaneous nephrolithotomy (PCNL for the treatment of large kidney stones 2 cm or greater. The lack of prospective randomized trials directly comparing URS and PCNL makes comparison challenging. The numerous studies are not standardized in terms of their definition of stone-free or how stone size is reported. In order to standardize comparison of results, we used a stone-free definition of <4 mm after one procedure per imaging of the author’s choice, since how each patient was imaged postoperatively was not reported. The results from the literature show that moderately large stones from 2 to 3 cm treated ureteroscopically have similar outcomes to PCNL. Stone-free rates with URS decrease when stone size is above 3 cm. Our interpretation of the literature suggests that a current limitation of URS is that multiple procedures for URS would be required to achieve comparable stone-free rates to PCNL, particularly for stones greater than 4 cm.Keywords: ureteroscopy, percutaneous nephrolithotomy, lithotripsy, urinary calculi
Endoscopic Stone Measurement During Ureteroscopy.
Ludwig, Wesley W; Lim, Sunghwan; Stoianovici, Dan; Matlaga, Brian R
2018-01-01
Currently, stone size cannot be accurately measured while performing flexible ureteroscopy (URS). We developed novel software for ureteroscopic, stone size measurement, and then evaluated its performance. A novel application capable of measuring stone fragment size, based on the known distance of the basket tip in the ureteroscope's visual field, was designed and calibrated in a laboratory setting. Complete URS procedures were recorded and 30 stone fragments were extracted and measured using digital calipers. The novel software program was applied to the recorded URS footage to obtain ureteroscope-derived stone size measurements. These ureteroscope-derived measurements were then compared with the actual-measured fragment size. The median longitudinal and transversal errors were 0.14 mm (95% confidence interval [CI] 0.1, 0.18) and 0.09 mm (95% CI 0.02, 0.15), respectively. The overall software accuracy and precision were 0.17 and 0.15 mm, respectively. The longitudinal and transversal measurements obtained by the software and digital calipers were highly correlated (r = 0.97 and 0.93). Neither stone size nor stone type was correlated with error measurements. This novel method and software reliably measured stone fragment size during URS. The software ultimately has the potential to make URS safer and more efficient.
Virus activation and immune function during intense training in rugby football players.
Yamauchi, R; Shimizu, K; Kimura, F; Takemura, M; Suzuki, K; Akama, T; Kono, I; Akimoto, T
2011-05-01
Epidemiological studies suggest that highly trained athletes are more susceptible to upper respiratory tract infections (URTI) compared with the general population. Upper respiratory symptoms (URS) often appear as either primary invasion of pathogenic organisms and/or reactivation of latent viruses such as Epstein-Barr virus (EBV). The purpose of this study was to examine the relationship between EBV reactivation and the appearance of URS during intensive training in collegiate rugby football players. We evaluated EBV-DNA expression in saliva and examined the relationship between onset of URS and daily changes in EBV-DNA as well as secretory immunoglobulin A (SIgA) levels among 32 male collegiate rugby football players during a 1-month training camp. The EBV-DNA expression tended to be higher in subjects who exhibited sore throat (p=0.07) and cough (p=0.18) than that of those who had no symptoms, although their differences were not significant. The SIgA level was significantly lower 1 day before the EBV-DNA expression (p<0.05). The number of URS increased along with the EBV-DNA expression and decrease of SIgA levels. These results suggest that the appearance of URS is associated with reactivation of EBV and reduction of SIgA during training. © Georg Thieme Verlag KG Stuttgart · New York.
Nebot-Cegarra, Josep; Fàbregas, Pere Jordi; Sánchez-Pérez, Inma
2005-10-01
In order to analyse the patterns of cellular proliferation both in the mesenchyme of the urorectal septum (URS) and in the adjacent territories (posterior urogenital mesenchyme, anterior intestinal mesenchyme and cloacal folds mesenchyme), as well as their contribution to the process of cloacal division, a computer-assisted method was used to obtain the nuclear area of 3874 mesenchymal cells from camera lucida drawings of nuclear contours of selected sections of human embryos [Carnegie stages (CSs) 13-18]. Based on changes in the size of the nucleus during the cellular cycle, we considered proliferating cells in each territory to be those with a nuclear area over the 75th percentile. The URS showed increasing cell proliferation, with proliferation patterns that coincided closely with cloacal folds mesenchyme, and with less overall proliferation than urogenital and intestinal mesenchymes. Furthermore, at CS 18, we observed the beginning of the rupture in the cloacal membrane; however, no fusion has been demonstrated either between the URS and the cloacal membrane or between the cloacal folds. The results suggest that cloacal division depends on a morphogenetic complex where the URS adjacent territories could determine septal displacement at the time that their mesenchymes could be partially incorporated within the proliferating URS.
Flexible ureterorenoscopy for lower pole stones: influence of the collecting system's anatomy.
Jessen, Jan Peter; Honeck, Patrick; Knoll, Thomas; Wendt-Nordahl, Gunnar
2014-02-01
The impact of renal anatomy on the success rate of flexible ureterorenoscopy (fURS) for lower pole stones is less clear than it is on shock wave lithotripsy, for which it is a recognized influence factor. We analyzed safety and efficiency of fURS using modern endoscopes for lower pole stones dependent on the collecting system's configuration. We retrospectively evaluated a consecutive sample of 111 fURS for lower pole stones at our tertiary care center between January 2010 and September 2012 from our prospectively kept database. All procedures were performed with modern flexible ureterorenoscopes, nitinol baskets, holmium laser lithotripsy, and ureteral access sheaths whenever needed. The infundibular length (IL) and width (IW) and infundibulopelvic angle (IPA) were measured and the data were stratified for stone-free status and complications classified by the Clavien-Dindo scale. Univariate and multifactorial statistical analyses were performed. Correlation of operation time (OR-time) with anatomical parameters was conducted. Ninety-eight (88.3%) of the 111 patients were stone free after a single fURS. On multifactorial analysis, the stone size and IL had significant influence on the stone-free rate (SFR) (panatomy. fURS is a safe and efficient treatment option for lower pole kidney stones. A long infundibulum and a very acute IPA (anatomy.
Lounès Matoub et ses chansons: l'Algérie embrase le cœur, l'Algérie attise la raison
Directory of Open Access Journals (Sweden)
Mohammed Yefsah
2013-11-01
Full Text Available Ténor de la chanson algérienne, Lounès Matoub est devenu une icône après son assassinat. Il est l'incarnation même de l'artiste au cœur de son peuple, lui qui s'est imposé dans le champ artistique avec son talent, son franc-parler, sa musique et sa poésie. Son parcours ne peut être dissocié de ses engagements politiques. Il combat les fondamentalistes islamistes et s'oppose au pouvoir en place. Il veut la reconnaissance du berbère, sa langue maternelle et celle de ses chansons, par l’État algérien. Il porte un regard sur l’histoire en reprenant des mythes tout en révélant des vérités. Il brise également des tabous de la société mais reprend des poncifs. Ses chansons, dans lesquelles se reconnaissent des milliers de personnes, disent les contradictions d'un individu tourmenté. L'imaginaire de ses poèmes est régional et rural. En revanche, son désir tend vers la nation entière et même vers l'universel. La tragédie de sa vie est indissociable des durs contextes politiques qu'expriment ses paroles. Algerian poet, singer and songwriter Lounès Matoub became an icon after his assassination. In the hearts of his people, he is the embodiment of an artist, having established himself with his talent, his outspokenness, his music and his poetry. His career cannot be dissociated from his political commitments. He fights against the Islamic fundamentalists and rebels against the governing power. He wants Berber, his mother language and that of his songs, recognized by the Algerian government. He examines history by recycling myths while revealing truths. He breaks societal taboos but unravels clichés. His songs tell of the trials of a tormented individual, but thousands of people recognize themselves in his songs. The scope of his poems is regional and rural. However, his desire extends to the whole nation, even to the universal. The tragedy of his life is inseparable from the tough political context that his words describe.
Tamsulosin therapy improved the outcome of ureterorenoscopy for ...
African Journals Online (AJOL)
Introduction: Tamsulosin is an α-1A-specific blocker inducing selective relaxation of ureteral smooth muscle and inhibition of ureteral spasms leading to ureteral dilatation that can facilitates retrograde ureterorenoscopy (URS). Objective: To assess the efficacy of tamsulosin in improving the outcome of URS management of ...
Tanabe, Hirofumi; Ikuta, Munehiro; Morita, Yoshifumi
2017-07-01
We have developed a rehabilitation training system called the Useful and Ultimate Rehabilitation System PARKO (UR System PARKO) to promote the recovery of motor function of the severe chronic plegic hand of stroke patients. This system was equipped with two functions to realize two conditions: (1) fixing of all fingers to a hyperextended position and (2) extending the elbow joint while applying resistance load to the fingertips. A clinical test was conducted with two patients to determine the therapeutic effect of the UR System PARKO for severe plegic hand. In both patients, the active ranges of motion of finger extension improved after training with the UR System PARKO. Moreover, the Modified Ashworth scale scores of finger extension increased. Thus, training reduced the spastic paralysis. These results suggest the effectiveness of training with the UR System PARKO for recovery of motor function as reflected in the finger extension of the severe plegic hand.
Supplemental Investigation Plan for FFACO Use Restrictions, Nevada Test Site, Nevada, Revision 0
Energy Technology Data Exchange (ETDEWEB)
Lynn Kidman
2008-02-01
This document is part of an effort to re-evaluate all FFACO URs against the current RBCA criteria (referred to in this document as the Industrial Sites [IS] RBCA process) as defined in the Industrial Sites Project Establishment of Final Action Levels (NNSA/NSO, 2006a). After reviewing all of the existing FFACO URs, the 12 URs addressed in this Supplemental Investigation Plan (SIP) could not be evaluated against the current RBCA criteria as sufficient information about the contamination at each site was not available. This document presents the plan for conducting field investigations to obtain the needed information. This SIP includes URs from Corrective Action Units (CAUs) 326, 339, 358, 452, 454, 464, and 1010, located in Areas 2, 6, 12, 19, 25, and 29 of the Nevada Test Site, which is approximately 65 miles northwest of Las Vegas, Nevada; and CAU 403, located in Area 3 of the Tonopah Test Range, which is approximately 165 miles north of Las Vegas, Nevada.
Armazenamento refrigerado de abacates 'Hass'
Directory of Open Access Journals (Sweden)
Juliana Rodrigues Donadon
2012-12-01
Full Text Available Este trabalho objetivou determinar a ocorrência de injúria pelo frio em abacates 'Hass'. Na primeira Etapa, os abacates foram armazenados a 5ºC (77% UR, 10ºC (79% UR e 15ºC (79% UR por até 21 dias. Aos 7; 14 e 21dias de armazenamento, um lote com 36 frutos foi levado ao ambiente (22°C e 77% UR para amadurecimento. Testou-se também o armazenamento a 2°C (74% UR e 4°C (77% UR por até 45 dias, sendo que aos 15; 30 e 45 dias, um lote com a mesma quantidade de frutos foi levado ao ambiente, mantido a 22°C e 77% UR. Frutos armazenados ao ambiente, desde o início, foram considerados testemunha. Avalaram-se a aparência e a luminosidade da polpa. Os frutos armazenados a 10°C e 15°C não apresentaram sintomas de injúrias pelo frio, que foram observados nos frutos armazenados a 2°C, por períodos superiores a 15 dias, e nos mantidos a 4°C, por 30 dias. Quando levados ao ambiente, os frutos armazenados a 2°C conservaram aparência aceitável para o consumo (nota = 3 por até10 dias, e os armazenados a 4°C, por até 12 dias. Na segunda Etapa, analisaram-se a intensidade respiratória e a atividade das enzimas peroxidase (POD, polifenoloxidase (PPO, poligalacturonase (PG e pectinametilesterase (PME nos frutos armazenados a 2ºC, por 45 dias, em comparação com os testemunha. A atividade das enzimas associadas ao escurecimento, POD e PPO, assim como das associadas ao amaciamento da polpa, PME e PG, foi inibida pelo armazenamento a 2ºC, mas readquiriram atividade mais elevada que nos frutos-testemunha, quando foram transferidos ao ambiente, indicando estímulo devido aos danos pelo frio.
Laursen, S. L.; Hunter, A.; Weston, T.; Thiry, H.
2009-12-01
Evidence-based thinking is essential both to science and to the development of effective educational programs. Thus assessment of student learning—gathering evidence about the nature and depth of students’ learning gains, and about how they arise—is a centerpiece of any effective undergraduate research (UR) program. Assessment data can be used to monitor progress, to diagnose problems, to strengthen program designs, and to report both good outcomes and strategies to improve them to institutional and financial stakeholders in UR programs. While the positive impact of UR on students’ educational, personal and professional development has long been a matter of faith, only recently have researchers and evaluators developed an empirical basis by which to identify and explain these outcomes. Based on this growing body of evidence, URSSA, the Undergraduate Research Student Self-Assessment, is a survey tool that departments and programs can use to assess student outcomes of UR. URSSA focuses on what students learn from their UR experience, rather than whether they liked it. Both multiple-choice and open-ended items focus on students’ gains from UR, including: (1) skills such as lab work and communication; (2) conceptual knowledge and linkages among ideas in their field and with other fields; (3) deepened understanding of the intellectual and practical work of science; (4) growth in confidence and adoption of the identity of scientist; (5) preparation for a career or graduate school in science; and (6) greater clarity in understanding what career or educational path they might wish to pursue. Other items probe students’ participation in important activities that have been shown to lead to these gains; and a set of optional items can be included to probe specific program features that may supplement UR (e.g. field trips, career seminars, housing arrangements). The poster will describe URSSA's content, development, validation, and use. For more information about
Energy Technology Data Exchange (ETDEWEB)
Zhao, B; Chiu, T; Gu, X; Lee, H; Nedzi, L; Jiang, S [UT Southwestern Medical Center, Dallas, TX (United States)
2016-06-15
Purpose: 3D printed custom bolus is regularly used in radiation therapy clinic as a compensator. However, usual method of bolus printing with 100% filling is very time-consuming. The purpose of this study is to evaluate the feasibility and benefit of 3D printed bolus filled with UR. Methods: Two boluses were designed on nose (9e electrons) and ear (6× photons) for a head phantom in treatment planning system (TPS) to achieve dose coverage to the skin. The bolus structures (56–167cc) were converted to STereoLithographic (STL) model using an in-house developed algorithm and sent to a commercial fused deposition modeling (FDM) printer. Only shells were printed with polylactic acid (PLA) material. Liquid UR was then placed in a vacuum pump and slowly poured into the hollow bolus from its top opening. Liquid UR hardened in around half an hour. The phantom was rescanned with custom boluses attached and the dosimetry was compared with original design in TPS. Basic CT and dose properties were investigated. GaF films were irradiated to measure dose profile and output of several open photon and electron beams under solid water and UR slabs of same thicknesses. Results: CT number was 11.2±7.3 and 65.4±7.8, respectively for solid water(∼1.04g/cc) and UR(∼1.08g/cc). The output measurement at dmax for 6× was within 2% for the two materials. The relative dose profiles of the two materials above dmax show 94–99% Gamma analysis passing rates for both photons and electrons. Dose distributions with 3D PUR boluses maintained great coverage on the intended skin regions and resembled that with computer generated boluses. Manufacturing 3D PUR boluses was 3–4 times faster than 100% printed boluses. The efficiency significantly improves for larger boluses. Conclusion: The study suggests UR has similar dose responses as solid water. Making custom bolus with UR greatly increases clinical workflow efficiency.
International Nuclear Information System (INIS)
Zhao, B; Chiu, T; Gu, X; Lee, H; Nedzi, L; Jiang, S
2016-01-01
Purpose: 3D printed custom bolus is regularly used in radiation therapy clinic as a compensator. However, usual method of bolus printing with 100% filling is very time-consuming. The purpose of this study is to evaluate the feasibility and benefit of 3D printed bolus filled with UR. Methods: Two boluses were designed on nose (9e electrons) and ear (6× photons) for a head phantom in treatment planning system (TPS) to achieve dose coverage to the skin. The bolus structures (56–167cc) were converted to STereoLithographic (STL) model using an in-house developed algorithm and sent to a commercial fused deposition modeling (FDM) printer. Only shells were printed with polylactic acid (PLA) material. Liquid UR was then placed in a vacuum pump and slowly poured into the hollow bolus from its top opening. Liquid UR hardened in around half an hour. The phantom was rescanned with custom boluses attached and the dosimetry was compared with original design in TPS. Basic CT and dose properties were investigated. GaF films were irradiated to measure dose profile and output of several open photon and electron beams under solid water and UR slabs of same thicknesses. Results: CT number was 11.2±7.3 and 65.4±7.8, respectively for solid water(∼1.04g/cc) and UR(∼1.08g/cc). The output measurement at dmax for 6× was within 2% for the two materials. The relative dose profiles of the two materials above dmax show 94–99% Gamma analysis passing rates for both photons and electrons. Dose distributions with 3D PUR boluses maintained great coverage on the intended skin regions and resembled that with computer generated boluses. Manufacturing 3D PUR boluses was 3–4 times faster than 100% printed boluses. The efficiency significantly improves for larger boluses. Conclusion: The study suggests UR has similar dose responses as solid water. Making custom bolus with UR greatly increases clinical workflow efficiency.
Quantifiable impact on poverty in Trinidad And Tobago of the Uruguay Round Agreement On Agriculture.
Pemberton, Carlisle; Ramnarine, Deokie
2006-09-01
The agreement on agriculture and the World Trade Organization were major outcomes of the 1986-1994 Uruguay Round (UR) negotiations within the General Agreement on Tariffs and Trade (GATT). The measures under the UR were predicted to increase poverty in developing countries, a serious cause for concern since poverty alleviation is a major goal of developing countries. Thus this paper simulated the impact on poverty of the UR for a net food importing country, Trinidad and Tobago. The objectives of the study were to determine the changes in poverty levels in Trinidad and Tobago that we expected would result from changes in the price levels of food commodities after the removal of trade protection following the UR, and to examine recent trends in poverty in Trinidad and Tobago and the prices of major agricultural exports from the United States, its principal trading partner. A regression model (poverty model) was used to determine the relationship between poverty levels and the prices of sensitive imported food commodities (SIFCs) and other key economic variables. Impact models were used to project changes in world market prices of the SIFCs due to the UR, and these price changes were used to predict changes in poverty in Trinidad and Tobago. The results showed a positive elasticity between poverty and the prices of SIFCs. The study also predicted that the average projected increase in price levels of the SIFCs of less than 9% by the year 2000 would cause an increase in poverty in Trinidad and Tobago of less than 4%. There has been, in fact, a small decline in poverty in Trinidad and Tobago since 1996. The prices of major agricultural exports from the United States have also been falling since 1995. Thus, so far the UR has had no perceptible effects in increasing the prices of food exports from the United States. Also, so far the UR has had no perceptible effect on the poverty level in Trinidad and Tobago.
Yuri, Prahara; Hariwibowo, Rinto; Soeroharjo, Indrawarman; Danarto, Raden; Hendri, Ahmad Z; Brodjonegoro, Sakti R; Rasyid, Nur; Birowo, Ponco; Widyahening, Indah S
2018-01-01
the optimal management of lower calyceal stones is still controversial, because no single method is suitable for the removal of all lower calyceal stones. Minimally invasive procedures such as extracorporeal shock wave lithotripsy (ESWL), percutaneous nephrolithotomy (PCNL) and flexible ureteroscopy (fURS) are the therapeutic methods for lower calyceal stones. The aim of this study was to identify the optimal management of 10-20 mm lower pole stones. a meta-analysis of cohort studies published before July 2016 was performed from Medline and Cochrane databases. Management of 10-20 mm lower pole stone treated by fURS, ESWL and PCNL with follow-up of residual stones in 1-3 months after procedure were include and urinary stone in other location and size were excluded. A fixed-effects model with Mantzel-Haenzel method was used to calculate the pooled Risk Ratio (RRs) and 95% Confidence Interval (CIs). We assessed the heterogeneity by calculating the I2 statistic. All analyses were performed with Review manager 5.3. we analized 8 cohort studies. The stone free rate from 958 patients (271 PCNL, 174 fURS and 513 ESWL), 3 months after operation, was 90.8% (246/271) after PCNL; 75.3% (131/174) after fURS; and 64.7% (332/513) after ESWL. Base on stone free rate in 10-20 mm lower pole stone following management, PCNL is better than fURS (overall RR was 1.32 (95% CI 1.13 - 1.55); pESWL (overall risk ratio 1.42 (95% CI 1.30 - 1.55); p=ESWL, fURS is better than ESWL base on stone free rate in 10-20 mm lower pole stone management with overall RR 1.16 (95% CI 1.04 - 1.30; p=0.01 and I2=40%). percutaneus nephrolithotomy provided a higher stone free rate than fURS and ESWL. This meta-analysis may help urologist in making decision of intervention in 10-20 mm lower pole stone management.
2013-05-16
The Deputy Administrator of the Drug Enforcement Administration (DEA) is issuing this final order to temporarily schedule three synthetic cannabinoids under the Controlled Substances Act (CSA) pursuant to the temporary scheduling provisions of 21 U.S.C. 811(h). The substances are (1-pentyl-1H-indol-3-yl)(2,2,3,3-tetramethylcyclopropyl)methanone (UR-144), [1-(5-fluoro-pentyl)-1H-indol-3-yl](2,2,3,3-tetramethylcyclopropyl)methanone (5-fluoro-UR-144, XLR11) and N-(1-adamantyl)-1-pentyl-1H-indazole-3-carboxamide (APINACA, AKB48). This action is based on a finding by the Deputy Administrator that the placement of these synthetic cannabinoids and their salts, isomers and salts of isomers into Schedule I of the CSA is necessary to avoid an imminent hazard to the public safety. As a result of this order, the full effect of the CSA and the Controlled Substances Import and Export Act (CSIEA) and their implementing regulations including criminal, civil and administrative penalties, sanctions and regulatory controls of Schedule I substances will be imposed on the manufacture, distribution, possession, importation, and exportation of these synthetic cannabinoids.
African Journals Online (AJOL)
Samina Shahid, Shafiq ur Rehman, Ahmad Adnan. Vol 7, No 25 (2008), Sucrose assimilation and ... Abdul Mateen, Shaukat Hussain, Shams Ur Rehman, Basharat Mahmood, Muhammad Aslam Khan, Abdul Rashid, Majid Sohail, Muhammad Farooq, S Jawad Ahmed Shah. Vol 8, No 22 (2009), Sulfuric acid and hot water ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
Table 2. Therapeutic Procedures and Postoperative Recommendations of Patients who Underwent URS for ureteric stone. Procedure. Frequency. Percent. Post-operative recommendation. Frequency. Percent. None. 6. 15.8. Discharge. 24. 63.2. Only J stenting. 9. 23.7. Repeat URS. 2. 5.3. Stone extraction 19. 50. ESWL. 4.
Proficiency test for heavy metals in compound feed
Pereboom, D.P.K.H.; Elbers, I.J.W.; Jong, de J.; Lee, van der M.K.; Nijs, de W.C.M.
2016-01-01
The here described proficiency test for heavy metals in compound feed was organised by RIKILT, Wageningen UR in accordance with ISO 17043. RIKILT Wageningen UR has an ISO/IEC 17043 accreditation for proficiency tests of residues in products of animal origin. However, this specific test is not part
Incidence and Predictors for Ipsilateral Hydronephrosis Following Ureteroscopic Lithotripsy.
Barbour, Meredith L; Raman, Jay D
2015-09-01
To review our experience in using ureteroscopy (URS) with lithotripsy for renal or ureteral calculi to determine the incidence and predictors of postprocedural ipsilateral hydronephrosis. Records of 324 URS cases for renal or ureteral calculi with imaging performed 4-12 weeks postprocedure were reviewed. Ipsilateral hydronephrosis was determined by computed tomography scan or renal ultrasound. Univariate and multivariate analyses determined the factors associated with hydronephrosis. 176 men and 148 women with a median age of 50 years were included. Median stone size was 6 mm and operative duration was 60 minutes; 30% of patients had multiple calculi; and 35% had undergone a prior ipsilateral URS. Overall, 49 of 324 patients (15%) had evidence of hydronephrosis, with 65% of these patients having symptoms and 40% requiring ancillary procedures. On multivariate analysis, increasing stone diameter (odds ratio [OR] 8.9, 95% confidence interval [CI] 1.9-23.8, P = .03), prior ipsilateral URS (OR 7.7, 95% CI 1.8-28.2, P = .006), longer operative duration (OR 6.5, 95% CI 1.8-16.3, P = .02), and renal colic symptoms (OR 48.3, 95% CI 14.7-71.4, P hydronephrosis. Conversely, other factors including stone impaction at procedure, ureteral dilation, use of an access sheath, intraoperative perforation, or use of a stent did not associate with ipsilateral hydronephrosis. In this contemporary cohort study, 15% of patients undergoing URS had evidence of ipsilateral hydronephrosis. Larger stone size, longer OR duration, prior ipsilateral URS, and recurrent colic were associated with an increased likelihood for this observation. Patients and stone cases with such characteristics likely warrant imaging modalities beyond plain radiography. Copyright © 2015 Elsevier Inc. All rights reserved.
Philippou, Prodromos; Payne, David; Davenport, Kim; Timoney, Anthony G; Keeley, Francis X
2013-11-01
This study aims to evaluate the outcome of ureteroscopy/ureterorenoscopy (URS) as a salvage procedure for stones resistant to extracorporeal shock wave lithotripsy (ESWL). Between January 2009 and January 2012, 313 patients with upper tract lithiasis were treated by URS. Among them, 87 (27.8 %) had undergone URS after prior ESWL failed to achieve stone clearance (Salvage group). These patients were matched with a group of patients who underwent URS as first-line modality (Primary group). Stone-free rates and adjuvant procedures represented the primary points for comparison. Secondary points for comparison included complications, procedure duration, total laser energy used and length of hospitalization. Matching was possible in all cases. Stone clearance rates were 73.6 and 82.8 % for the Salvage and Primary group, respectively. The difference in stone clearance rates between the two groups was not statistically significant (p = 0.186). A total of 11 patients (12.6 %) in the Primary group and 18 patients (20.7 %) in the Salvage group underwent an adjuvant procedure (p = 0.154). No statistically significant differences were noted in terms of complications, procedure duration and length of hospitalization. In the Primary group, the laser energy used for stone fragmentation was higher (p = 0.043). The rate of ureteric stenting at the end of the procedure was higher for the Salvage group (p = 0.030). Previous failed ESWL is not a predictor for unfavorable outcome of URS. Salvage URS is associated, however, with an increased need for ureteric stenting at the end of the procedure.
Electrical and magnetic properties of n-alkylurotropinium-polyiodides
International Nuclear Information System (INIS)
Fuellbier, H.; Stegemann, H.; Schmidt, L.; Mittag, H.; Petrovskis, G.; Cikmacs, P.; Lusis, A.
1986-01-01
Alkylurotropinium polyiodides, UrRI x with Ur=urotropine, x3 and R=C n H 2n+1 with 1 ≥ n ≤ 6; x=5 and n=2; 3; 4; 6; x=7 and n=2; 3; 4 and (UrR) 2 I 8 with n=1;5 were chemically prepared by conversion of the corresponding monoiodides with aqueous solution of KI 3 . The polyiodides were measured with ac- and dc-techniques. The electric conductivity of the polyiodides increases with increasing iodine contents (triiodides are insulators, penta- and heptaiodides are bad semiconductors). The magnetic susceptibility doesn't depend on the magnetic field strength and on temperature
Audit of cases with uterine rupture: A process indicator of quality of ...
African Journals Online (AJOL)
Audit of uterine rupture (UR) used as a process indicator, can identify factors considered avoidable to improve future quality of obstetric care. Records of UR cases at a referral maternity in Luanda were studied retrospectively (n=43) and prospectively (n=67) including basic obstetric information, maternal and foetal outcome, ...
Directory of Open Access Journals (Sweden)
Ramón Felipe Méndez Larrosa
2001-10-01
Full Text Available Com o objetivo de avaliar a eficiência de três modalidades de aplicação de nitrogênio (N na cultura de arroz foi conduzido um experimento, no ano agrícola 1998/99, na Universidade Federal de Santa Maria (RS. O delineamento experimental foi bifatorial 3 x 5 em blocos ao acaso com parcelas subdivididas e quatro repetições. Nas parcelas principais, foram estabelecidas, no início do perfilhamento do arroz, três modalidades de aplicação da uréia: 1 Uréia + banho, na qual a uréia foi aplicada superficialmente e, no dia seguinte, deu-se um banho, inundando-se a área 14 dias depois; 2 Uréia + inundação, na qual a uréia foi aplicada um dia antes da inundação definitiva; e 3 Inundação + uréia, com a aplicação da uréia um dia após a inundação. Nas subparcelas, foram aplicadas quatro doses de N (0, 20, 40 e 60kg ha-1 de N e uma testemunha absoluta, sem aplicação de N durante todo o ciclo da cultura. Em todos os tratamentos que receberam N, foram aplicados 10kg ha-1 de N na semeadura e 23kg ha-1 de N no início do alongamento de entrenós. Concluiu-se que o N aplicado na etapa vegetativa até o início de alongamento de entrenós incrementa a quantidade de perfilhos e o N acumulado total. Este incremento depende das modalidades de aplicação da uréia, sendo maior nos tratamentos "uréia + banho" e "uréia + inundação", em relação à aplicação da uréia na água. O incremento das doses de nitrogênio proporciona elevação na produção de grãos enquanto as modalidades de aplicação de uréia no perfilhamento não afetam a produção de grãos, utilizando-se nitrogênio na iniciação do primórdio floral.Having the objective of evaluating the efficiency of three nitrogen aplication systems in the tillering stage of rice, there was an experiment installed in the Federal University of Santa Maria (RS, Brazil, during 1998/99 growing season. The experimental design was two-factorial 3 x 5 in complete randomized block
Sancak, Eyup Burak; Kılınç, Muhammet Fatih; Yücebaş, Sait Can
2017-01-01
The decision on the choice of proximal ureteral stone therapy depends on many factors, and sometimes urologists have difficulty in choosing the treatment option. This study is aimed at evaluating the factors affecting the success of semirigid ureterorenoscopy (URS) using the "decision tree" method. From January 2005 to November 2015, the data of consecutive patients treated for proximal ureteral stone were retrospectively analyzed. A total of 920 patients with proximal ureteral stone treated with semirigid URS were included in the study. All statistically significant attributes were tested using the decision tree method. The model created using decision tree had a sensitivity of 0.993 and an accuracy of 0.857. While URS treatment was successful in 752 patients (81.7%), it was unsuccessful in 168 patients (18.3%). According to the decision tree method, the most important factor affecting the success of URS is whether the stone is impacted to the ureteral wall. The second most important factor affecting treatment was intramural stricture requiring dilatation if the stone is impacted, and the size of the stone if not impacted. Our study suggests that the impacted stone, intramural stricture requiring dilatation and stone size may have a significant effect on the success rate of semirigid URS for proximal ureteral stone. Further studies with population-based and longitudinal design should be conducted to confirm this finding. © 2017 S. Karger AG, Basel.
Zhu, Shengwei; Srebric, Jelena; Rudnick, Stephen N; Vincent, Richard L; Nardell, Edward A
2013-01-01
This study investigated the disinfection efficacy of the upper-room ultraviolet germicidal irradiation (UR-UVGI) system with ceiling fans. The investigation used the steady-state computational fluid dynamics (CFD) simulations to solve the rotation of ceiling fan with a rotating reference frame. Two ambient air exchange rates, 2 and 6 air changes per hour (ACH), and four downward fan rotational speeds, 0, 80, 150 and 235 rpm were considered. In addition, the passive scalar concentration simulations incorporated ultraviolet (UV) dose by two methods: one based on the total exposure time and average UV fluence rate, and another based on SVE3* (New Scale for Ventilation Efficiency 3), originally defined to evaluate the mean age of the air from an air supply opening. Overall, the CFD results enabled the evaluation of UR-UVGI disinfection efficacy using different indices, including the fraction of remaining microorganisms, equivalent air exchange rate, UR-UVGI effectiveness and tuberculosis infection probability by the Wells-Riley equation. The results indicated that air exchange rate was the decisive factor for determining UR-UVGI performance in disinfecting indoor air. Using a ceiling fan could also improve the performance in general. Furthermore, the results clarified the mechanism for the ceiling fan to influence UR-UVGI disinfection efficacy. © 2013 The Authors Photochemistry and Photobiology © 2013 The American Society of Photobiology.
Nine Unpublished Texts in the Collection of the British Museum
Czech Academy of Sciences Publication Activity Database
Alivernini, Sergio
-, č. 1 (2017) E-ISSN 1540-8760 Institutional support: RVO:68378009 Keywords : Sumerian * Ur III * administrative texts Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings) https://cdli.ucla.edu/files/ publications /cdlb2017_001.pdf
Directory of Open Access Journals (Sweden)
Samsó, Julio
2009-06-01
Full Text Available A quick revision of the available information on the life and works of Ibn Abī l-Rijāl (fl. Tunis ca. 996-1048 and an analysis of the contents of his Urjūza fī aḥkām al-nuŷūm which are compared to those of his better known Kitāb al- Barī‘ fī aḥkām al-nujūm. The conclusion is that both works are independent and that the Urjūza is not a summary of the Barī‘. The paper continues with biobibliographical data of the historian, mathematician and astrologer Ibn Qunfudh al-Qusanṭīnī (1339-1407, who is the author of a commentary of Ibn Abī l-Rijāl’s Urjūza dedicated to Abū Bakr b. Abī Mujāhid Gazī Ibn al-Kās, vizier of the Merinid sultans Abū Fāris (1366-1372 and Abū Zayyān (1372-1374. The work was probably written during the latter’s brief reign and before 1375, the date in which the dedicatee was exiled to Majorca. The work continues with an analysis of the contents of the commentary, the sources quoted, the astrological techniques used both by Ibn Qunfudh and by Ibn Abī l-Rijāl, and the use by the commentator of a set of astronomical tables derived from the zīj of Ibn Isḥāq. We find, finally, a detailed commentary of the horoscopes contained in Ibn Qunfudh’s work which includes one corresponding to the vernal equinox of the year 571 AD, in which there was a conjunction of Saturn and Jupiter which announced the arrival of Islam. There are eleven more horoscopes (two of them published previously which constitute an astrological history of Merinid Morocco between 1348 and 1366. Concerning the nine horoscopes analysed here, in six of them it has been possible to identify the subject or the event motivating the prediction, while three remain unidentified.
Tras una rápida revisión de los escasos datos conocidos sobre la vida y la obra de Ibn Abī l-Riŷāl (fl. Túnez c. 996-1048, se analiza el contenido de su Urŷūza fī aḥkām al-nuŷūm compar
Pentavalent 99Tcm - DMSA SPECT in primary brain tumours of glial cell origin
International Nuclear Information System (INIS)
Chung, D.K.; Evans, S.G.; Larcos, G.; Gruenewald, S.; Kumar, V.; Barton, M.
1999-01-01
Full text: 99 Tc m (V)-DMSA [DMSA(V)] has shown promise in brain tumour imaging. This study aimed to assess the role of DMSA(V) brain SPET in glioma for: (1) predicting the histopathological grade of malignancy, (2) monitoring response to therapy and (3) discriminating recurrent tumour from post-radiotherapy necrosis. Twenty-three patients (pts) (14 men, 9 women) of mean age 57 years (range 20-79) were referred with a lesion on CT/MRI (14 new presentations, 5 known and 4 suspected tumour recurrence). Up to 555 MBq of 99 Tc m (V)DMSA were administered and SPET was acquired at 3 h. Tumour uptake ratio (UR) was calculated by the ratio of activity in the tumour to a region in the contralateral brain. All 19 pts with known tumour showed DMSA(V) uptake. The 14 pts with new tumours (10 grade IV, I grade III, 2 grade II and 1 necrotic tumour) had a pre-therapy mean UR of 7.7 (range 2.8-13.6). The 3 lower-grade tumours were scattered widely within this range. Four pts completed radiotherapy and returned for a post-therapy scan, where the UR was less than the pre-therapy UR in 2, unchanged in 1 and greater in 1. The 5 known recurrent tumours had a mean UR of 13.5 (range 7.3-24.9). In the 4 pts with suspected recurrence, the DMSA(V) scan result agreed with clinical course or PET in 3 but was falsely positive in 1. In summary, 99 Tc m (V)-DMSA: (1) showed uptake in all known glial cell tumours in this series, however the UR did not correlate with the histopathological grade; (2) may be useful for discriminating tumour recurrence from post-radiotherapy necrosis; and (3) may have a role in predicting post-therapy prognosis
Directory of Open Access Journals (Sweden)
Siddhesh Aras
2009-06-01
Full Text Available Epstein-Barr Nuclear Antigen 1 (EBNA1 is essential for Epstein-Barr virus to immortalize naïve B-cells. Upon binding a cluster of 20 cognate binding-sites termed the family of repeats, EBNA1 transactivates promoters for EBV genes that are required for immortalization. A small domain, termed UR1, that is 25 amino-acids in length, has been identified previously as essential for EBNA1 to activate transcription. In this study, we have elucidated how UR1 contributes to EBNA1's ability to transactivate. We show that zinc is necessary for EBNA1 to activate transcription, and that UR1 coordinates zinc through a pair of essential cysteines contained within it. UR1 dimerizes upon coordinating zinc, indicating that EBNA1 contains a second dimerization interface in its amino-terminus. There is a strong correlation between UR1-mediated dimerization and EBNA1's ability to transactivate cooperatively. Point mutants of EBNA1 that disrupt zinc coordination also prevent self-association, and do not activate transcription cooperatively. Further, we demonstrate that UR1 acts as a molecular sensor that regulates the ability of EBNA1 to activate transcription in response to changes in redox and oxygen partial pressure (pO(2. Mild oxidative stress mimicking such environmental changes decreases EBNA1-dependent transcription in a lymphoblastoid cell-line. Coincident with a reduction in EBNA1-dependent transcription, reductions are observed in EBNA2 and LMP1 protein levels. Although these changes do not affect LCL survival, treated cells accumulate in G0/G1. These findings are discussed in the context of EBV latency in body compartments that differ strikingly in their pO(2 and redox potential.
Mucosal immunity and upper respiratory tract symptoms in recreational endurance runners.
Ihalainen, Johanna K; Schumann, Moritz; Häkkinen, Keijo; Mero, Antti A
2016-01-01
The present study investigated the effects of a 12-week endurance-training intervention on salivary proteins and upper respiratory tract symptoms (URS) in 25 young men. Saliva samples of 25 recreational male endurance runners (age 34.6 years, body mass index = 23.8 kg·m(-2), peak aerobic capacity = 47.2 mL·kg(-1)·min(-1)) were collected before (PRE) and after (POST) the training intervention, in a fasting state, as well as both before and after a maximal incremental treadmill run. The training consisted of both continuous and interval training sessions, 4-6 times per week based on the polarized training approach. Participants filled in Wisconsin Upper Respiratory Symptom Survey-21 and were retrospectively divided into 2 groups according to whether they reported URS (URS group, n = 13) or not (HEALTHY group, n = 12). Basal salivary immunoglobulin A (sa-sIgA) levels were significantly higher (+70%, p < 0.05) in the HEALTHY group both at PRE and POST whereas no significant differences were observed in salivary immunoglobulin M, salivary immunoglobulin G, lysozyme, or salivary α-amylase activity (sAA). Sa-sIgA concentration at PRE significantly correlated with the number of sick-days (R = -0.755, p < 0.001) in all subjects. The incremental treadmill run acutely increased sAA significantly (p < 0.05) at PRE (200%) and POST (166%) in the HEALTHY group but not in the URS group. This study demonstrated that subjects, who experienced URS during the 12 weeks of progressive endurance training intervention, had significantly lower basal sa-sIgA levels both before and after the experimental endurance training period. In addition to sa-sIgA, acute sAA response to exercise might be a possible determinant of susceptibility to URS in endurance runners.
Lo, Wan-Yu; Tsai, Fuu-Jen; Liu, Chung-Hsiang; Tang, Nou-Ying; Su, Shan-Yu; Lin, Shinn-Zong; Chen, Chun-Chung; Shyu, Woei-Cherng; Hsieh, Ching-Liang
2010-01-01
Uncaria rhynchophylla (Miq) Jack (UR) is a traditional Chinese herb and is used for the treatment of convulsive disorders, including epilepsy. Our previous study has shown that UR, as well as its major component rhynchophylline (RH), has an anticonvulsive effect and this effect is closely related to its scavenging activities of oxygen free radicals. The purpose of the present study was to investigate the effect of (UR) on the expression of proteins using a proteomics analysis in Sprague-Dawley (SD) rats with kainic acid (KA)-induced epileptic seizures. We profiled the differentially expressed proteins on two-dimensional electrophoresis (2-DE) maps derived from the frontal cortex and hippocampus of rat brain tissue 24 hours after KA-induced epileptic seizures. The results indicated that macrophage migration inhibitory factor (MIF) and cyclophilin A were under expressed in frontal cortex by an average of 0.19- and 0.23-fold, respectively. In the frontal cortex, MIF and cyclophilin A were significantly decreased in the KA group and these decreases were confirmed by the Western blots. However, in the hippocampus, only cyclophilin A was significantly decreased in the KA group. In addition, in real-time quantitative PCR (Q-PCR), MIF and cyclophilin A gene expressions were also significantly under expressed in the frontal cortex, and only the cyclophilin A gene was also significantly under expressed in the hippocampus in the KA group. These under expressions of MIF and cyclophilin A could be overcome by the treatment of UR and RH. In conclusion, the under expressions of MIF and cyclophilin A in the frontal cortex and hippocampus in KA-treated rats, which were overcome by both UR and UH treatment, suggesting that both MIF and cyclophilin A at least partly participate in the anticonvulsive effect of UR.
Alignment - SAHG | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...e URL: ftp://ftp.biosciencedbc.jp/archive/sahg/LATEST/sahg_alignment.zip File size: 12.0 MB Simple search UR...s Database Database Description Download License Update History of This Database Site Policy | Contact Us Alignment - SAHG | LSDB Archive ...
Abdel-Waged, Khaled; Uzhinskii, V V
2011-01-01
We describe how various hadronic cascade models, which are implemented in the GEANT4 toolkit, describe proton and charged pion transverse momentum spectra from p + Cu and Pb collisions at 3, 8, and 15 GeV/c, recently measured in the hadron production (HARP) experiment at CERN. The Binary, ultrarelativistic quantum molecular dynamics (UrQMD) and modified FRITIOF (FTF) hadronic cascade models are chosen for investigation. The first two models are based on limited (Binary) and branched (UrQMD) binary scattering between cascade particles which can be either a baryon or meson, in the three-dimensional space of the nucleus, while the latter (FTF) considers collective interactions between nucleons only, on the plane of impact parameter. It is found that the slow (p(T) 0.3 GeV/c) proton spectra are not strongly affected by the differences between the FTF and UrQMD models. It is also shown that the UrQMD and FTF combined with Binary (FTFB) models could reproduce both proton and charged pion spectra from p + Cu and Pb...
International Nuclear Information System (INIS)
Bhaduri, Partha Pratim; Chattopadhyay, Subhasis
2010-01-01
Differential elliptic flow v 2 (p T ) for identified hadrons is investigated in the FAIR energy regime, employing a hadronic-string transport model (UrQMD) as well as a partonic transport model (AMPT). It is observed that both models show a mass ordering of v 2 at low p T and a switch-over resulting in a baryon-meson crossing at intermediate p T . AMPT generates higher v 2 values compared to UrQMD. In addition, constituent quark number scaling behavior of elliptic flow is addressed. Scaling behavior in terms of the transverse momentum p T is found to be absent for both the partonic and the hadronic model. However, UrQMD and AMPT with a string melting scenario do exhibit an NCQ scaling of v 2 to varying degrees, with respect to the transverse kinetic energy KE T . But the default AMPT, where partonic scatterings are not included, does not show any considerable scaling behavior. A variable α is defined to quantify the degree of KE T scaling. We found that UrQMD gives better scaling than AMPT at FAIR.
Directory of Open Access Journals (Sweden)
Nguyen Thanh Long
2005-12-01
Full Text Available In this paper we consider the nonlinear wave equation problem $$displaylines{ u_{tt}-Big(|u|_0^2,|u_{r}|_0^2ig(u_{rr}+frac{1}{r}u_{r} =f(r,t,u,u_{r},quad 0less than r less than 1,; 0 less than t less than T, ig|lim_{ro 0^+}sqrt{r}u_{r}(r,tig| less than infty, u_{r}(1,t+hu(1,t=0, u(r,0=widetilde{u}_0(r, u_{t}(r,0=widetilde{u}_1(r. }$$ To this problem, we associate a linear recursive scheme for which the existence of a local and unique weak solution is proved, in weighted Sobolev using standard compactness arguments. In the latter part, we give sufficient conditions for quadratic convergence to the solution of the original problem, for an autonomous right-hand side independent on $u_{r}$ and a coefficient function $B$ of the form $B=B(|u|_0^2=b_0+|u|_0^2$ with $b_0$ greater than 0.
Thiry, Heather; Weston, Timothy J.; Laursen, Sandra L.; Hunter, Anne-Barrie
2012-01-01
This mixed-methods study explores differences in novice and experienced undergraduate students’ perceptions of their cognitive, personal, and professional gains from engaging in scientific research. The study was conducted in four different undergraduate research (UR) programs at two research-extensive universities; three of these programs had a focus on the biosciences. Seventy-three entry-level and experienced student researchers participated in in-depth, semi-structured interviews and completed the quantitative Undergraduate Research Student Self-Assessment (URSSA) instrument. Interviews and surveys assessed students’ developmental outcomes from engaging in UR. Experienced students reported distinct personal, professional, and cognitive outcomes relative to their novice peers, including a more sophisticated understanding of the process of scientific research. Students also described the trajectories by which they developed not only the intellectual skills necessary to advance in science, but also the behaviors and temperament necessary to be a scientist. The findings suggest that students benefit from multi-year UR experiences. Implications for UR program design, advising practices, and funding structures are discussed. PMID:22949423
Armazenamento refrigerado de Physalis¹
Directory of Open Access Journals (Sweden)
Renata Padilha Bolzan
2011-10-01
Full Text Available Este trabalho teve como objetivo avaliar o armazenamento refrigerado de Physalis angulata L. e Physalis peruviana L. com e sem cálice. Os frutos foram colhidos com coloração externa da casca alaranjada e armazenados por até 90 dias, com e sem a presença de cálice, nas temperaturas de 2±1 ºC e UR 90±5% ou 10±1 ºC e UR 90±5%. Posteriormente, eles foram mantidos em condição de prateleira a 22±2 ºC e UR 70± 5 %, durante três dias, e avaliados quanto à coloração externa da casca, relação SST/ATT, perda de peso e firmeza de polpa. Melhores resultados foram obtidos armazenando ambas as espécies de Physalis a 2±1 ºC e UR 90±5% com cálice por até 90 dias e sem cálice por até 58 dias.
Impact of Case Volume on Outcomes of Ureteroscopy for Ureteral Stones
DEFF Research Database (Denmark)
Kandasami, Sangam V; Mamoulakis, Charalampos; El-Nahas, Ahmed R
2014-01-01
of case volume on the outcomes of URS for ureteral stones. DESIGN, SETTING, AND PARTICIPANTS: The URS Global Study collected prospective data on consecutive patients with urinary stones treated with URS at 114 centres worldwide for 1 yr. Centres were identified as low or high volume based on the median...... overall annual case volume. OUTCOME MEASUREMENTS AND STATISTICAL ANALYSIS: Pre- and intraoperative characteristics, and postoperative outcomes in patients at low- and high-volume centres were compared. The relationships between case volume and stone-free rate (SFR), stone burden, complications...... SFR was 91.9% and 86.3% at high- and low-volume centres, respectively (pstone-free outcome increased with increasing case volume (p
QUAFRINOIC ACIDS: TWO NEW TRITERPENIODS FROM ...
African Journals Online (AJOL)
From the stem bark of Quassia africana, two new triterpenoids with the ursolic acid skeleton, characterized as 3-oxo-urs-12-en-27a, 28di-oic acid and its dihydro derivative, 3β-urs-12-en-27α, 28di-oic acid have been isolated. The structures were determined using spectroscopic techniques. KEY WORDS: Quassia africana; ...
Knoll, Thomas; Buchholz, Noor; Wendt-Nordahl, Gunnar
2012-01-01
Objectives To review previous reports and discuss current trends in extracorporeal shockwave lithotripsy (ESWL), percutaneous nephrolithotomy (PCNL) and ureterorenoscopy (URS). ESWL was recommended as the first-line treatment for small and intermediate-sized stones in the lower pole, while it is the standard treatment for large stones. However, the stone clearance rate after ESWL seems to be lower than that of stones in other locations. This seems to result from a lower rate of fragment passage, due to anatomical factors. Methods Reports on urinary stone disease were reviewed, assessing only publications in peer-reviewed, Medline-listed journals in the English language (publication years 1990–2011). Results Recent experience with flexible URS (fURS) for intrarenal stones showed that excellent stone-free rates can be achieved. With increasing experience and technically improved equipment, fURS has become an alternative to ESWL for small and intermediate-sized renal stones. Furthermore, several authors reported successful retrograde treatment for large renal stones, proposing fURS as an alternative to PCNL. However, the major drawbacks are long operating times and commonly, staged procedures, which is why PCNL remains the method of choice for such stones. Conclusions Considering the currents trends and evidence, the 2012 update of the European Association of Urology Guidelines on Urolithiasis has upgraded the endourological treatment of kidney stones. Individual factors such as body habitus, renal anatomy, costs and patient preference must be considered. PMID:26558046
Directory of Open Access Journals (Sweden)
Romina J. Fernández-Brando
2011-08-01
Full Text Available La forma típica o post-diarreica del síndrome urémico hemolítico (SUH es la complicación más grave de las infecciones por cepas de Escherichia coli productoras de toxina Shiga (STEC. En la Argentina el SUH es un problema crítico de salud pública, ya que representa la principal causa de falla renal aguda en la infancia, la segunda causa de falla renal crónica, y aporta el 20% de los casos de transplante renal durante la infancia y la adolescencia. A pesar de los avances en el conocimiento de su patogénesis, el único tratamiento actual de los pacientes con SUH es de sostén, y no existen terapias específicas ni preventivas. En la presente revisión expondremos los conocimientos básicos de los mecanismos patogénicos y discutiremos los enfoques terapéuticos tradicionales e innovadores, con especial foco en la situación nacional y los aportes hechos por grupos de la Argentina.
Directory of Open Access Journals (Sweden)
Ćurčić Srećko B.
2003-01-01
Full Text Available A new species of endogean carabid beetles (Javorella suvodolensis n. sp has been described from under stones, village Debelja, near Nova Varoš, Mt. Javor, southwestern Serbia. This new species is easily distinguished from all other phenetically close congeners in many important respects such as the body size, body shape, shape of head, form and size of eyes, number of ommatidia, length of antennae, shape of pronotum, shape of elytra, relative position of humeral setae, structure and form of female genitalia and the shape of the gonosternite. Javorella suvodolensis n. sp. is the first known endogean species of the genus Javorella S. B. Ćurčić, M. M. Brajković & B. P. M. Ćurčić [apart from the cavernicolous species Javorella suvoborensis (Pavićević & Popović and Javorella javorensis Ćurčić, Brajković & Ćurčić]. This new species and its congeners belong to an old separate phyletic lineage, distinct from all other related species groups. Additionally, J. suvodolensis n. sp. is relic and endemic to the mountains of southwest Serbia.
Bas, Okan; Ozyuvali, Ekrem; Aydogmus, Yasin; Sener, Nevzat Can; Dede, Onur; Ozgun, Serhat; Hizli, Fatih; Senocak, Cagri; Bozkurt, Omer Faruk; Basar, Halil; Imamoglu, Abdurrahim
2015-04-01
To compare the outcomes in patients who have been treated with flexible ureterorenoscopy (f-URS) and percutaneous nephrolithotomy (PNL) in managing stone-bearing caliceal diverticula. Between April 2007 and October 2013, we performed a retrospective analysis of 54 evaluable patients (28 women and 26 men) with symptomatic stone-bearing caliceal diverticula, who underwent PNL (n = 29) or F-URS (n = 25) in four referral hospitals in Turkey. The groups were compared with respect to demographics, stone location/size, success rate, stone-free status, symptom-free status, complication rates, and hospital stay. The average stone burden preoperatively was significantly larger in patients who were treated with PNL, with the average size for f-URS being 154 ± 77 mm(2) and that for PNL being 211 ± 97 mm(2) (p = 0.023). Symptom-free rates, success rates, stone-free rates and clinically insignificant residual fragments were similar between the groups (p = 0.880 vs. p = 0.537 vs. p = 0.539, and p = 0.877, respectively). There was no statistical difference between the groups for minor complications (p = 0.521) but no major complication (Clavien III-V) occured in the f-URS group; although there were three major complications (10.3 %) (Clavien III) in the PNL group (p PNL group (p PNL. The f-URS procedure is advantageous with respect to a shorter hospital stay and absence of major complications. Therefore, it should be emphasized that the location of the stone and diverticula is an important factor for the selection of the procedure.
Utilização de nitrogênio de adubos verde e mineral pelo milho
Directory of Open Access Journals (Sweden)
W. B. Scivittaro
2000-12-01
Full Text Available Desenvolveu-se, na Estação Experimental de Piracicaba - Instituto Agronômico (SAA-SP, de março/94 a setembro/95, um experimento para avaliar o potencial de fornecimento de nitrogênio de adubos, verde e mineral, aplicados, de forma exclusiva ou combinada, na cultura do milho. Em uma primeira fase, produziram-se, simultaneamente, mucuna-preta sem marcação isotópica no campo e adubo verde marcado com 15N em casa de vegetação e, na segunda, a mucuna-preta foi incorporada ao solo, cultivando-se, em seguida, milho. O experimento constou dos seguintes tratamentos: testemunha, 15N-mucuna-preta (4,4 t ha-1 de matéria seca e 25,8 g kg-1 de N, 15N-uréia (50 e 100 kg ha-1 de N e as possíveis combinações de mucuna-preta e uréia marcadas ou não com 15N. Esses foram dispostos em delineamento experimental de blocos ao acaso com quatro repetições. O solo forneceu a maior parte do N acumulado nas plantas de milho, seguido, em ordem decrescente, pela uréia e mucuna-preta. A contribuição da uréia para o N acumulado nas plantas de milho foi proporcional à dose aplicada. O aproveitamento de nitrogênio da uréia pelo milho foi maior que o da mucuna-preta, sendo os melhores efeitos proporcionados pela combinação das duas fontes.
Gökce, Mehmet Ilker; Telli, Onur; Özkıdık, Mete; Akıncı, Aykut; Hajıyev, Perviz; Soygür, Tarkan; Burgu, Berk
2016-07-01
To identify the incidence and associated factors of the postoperative hydronephrosis in pediatric patients who underwent ureterorenoscopy (URS) for renal or ureteral stones. We evaluated the results of 116 patients who underwent semirigid or flexible URS retrospectively. Primary end points of the study were to determine the incidence of postoperative hydronephrosis and factors associated with the development of postoperative hydronephrosis. Logistic regression analysis was used to define factors associated with the presence of hydronephrosis. Mean age of the population was 9.5 years and mean stone size was 9.4 mm. Hydronephrosis was detected in 32 (27.6%) patients. Stone-free status was achieved in 101 (87%) patients. Univariate analysis revealed history of ipsilateral URS, duration of operation, presence of impacted stone, development of ureteral injury during operation, and presentation with a renal colic episode as the parameter associated with increased risk of hydronephrosis. History of ipsilateral URS (odds ratio: 1.664, P = .027), presence of impacted stones (odds ratio: 1.788, P = .014), and development of ureteral injury during operation (odds ratio: 1.106, P = .039) were found to be the independent markers of developing postoperative hydronephrosis in a multivariate analysis. Ipsilateral hydronephrosis following URS develops in a significant portion of patients. In patients with history of ipsilateral procedure and those with an impacted stone and had ureteral injury, the risk of postoperative hydronephrosis is higher; therefore, physicians should keep these parameters in mind in the decision-making process of selective imaging postoperatively. Copyright © 2016 Elsevier Inc. All rights reserved.
Three New Ring-A Modified Ursane Triterpenes from Davidia involucrata
Directory of Open Access Journals (Sweden)
Qing-Wei Tan
2014-04-01
Full Text Available Three new ursane triterpenes, 3α,19α-dihydroxy-2-nor-urs-12-en-23,28-dioic acid-23-methyl ester (1, 19α,23-dihydroxy-3-oxo-2-nor-urs-12-en-28-oic acid (2, and 2,3-seco-3-methoxy-3,19α,23-trihydroxy-urs-12-en-2-al-28-oic acid (3, were isolated from the MeOH extract of the branch barks of Davidia involucrata, together with six known compounds. Their structures were elucidated by means of various spectroscopic analyses. The isolated triterpenes provide important evolutionary and chemotaxonomic knowledge about the monotypic genus Davidia. Five of the identified compounds showed moderate cytotoxicities against the cell proliferation of SGC-7901, MCF-7, and BEL-7404 with IC50 range from 7.26 to 47.41 μM.
Stable isotope analysis (δ (13)C and δ (15)N) of soil nematodes from four feeding groups.
Melody, Carol; Griffiths, Bryan; Dyckmans, Jens; Schmidt, Olaf
2016-01-01
Soil nematode feeding groups are a long-established trophic categorisation largely based on morphology and are used in ecological indices to monitor and analyse the biological state of soils. Stable isotope ratio analysis ((13)C/(12)C and (15)N/(14)N, expressed as δ (13)C and δ (15)N) has provided verification of, and novel insights into, the feeding ecology of soil animals such as earthworms and mites. However, isotopic studies of soil nematodes have been limited to date as conventional stable isotope ratio analysis needs impractically large numbers of nematodes (up to 1,000) to achieve required minimum sample weights (typically >100 µg C and N). Here, micro-sample near-conventional elemental analysis-isotopic ratio mass spectrometry (μEA-IRMS) of C and N using microgram samples (typically 20 µg dry weight), was employed to compare the trophic position of selected soil nematode taxa from four feeding groups: predators (Anatonchus and Mononchus), bacterial feeders (Plectus and Rhabditis), omnivores (Aporcelaimidae and Qudsianematidae) and plant feeder (Rotylenchus). Free-living nematodes were collected from conventionally and organically managed arable soils. As few as 15 nematodes, for omnivores and predators, were sufficient to reach the 20 µg dry weight target. There was no significant difference in δ (15)N (p = 0.290) or δ (13)C (p = 0.706) between conventional and organic agronomic treatments but, within treatments, there was a significant difference in N and C stable isotope ratios between the plant feeder, Rotylenchus (δ (15)N = 1.08 to 3.22 mUr‰, δ (13)C = -29.58 to -27.87 mUr) and all other groups. There was an average difference of 9.62 mUr in δ (15)N between the plant feeder and the predator group (δ (15)N = 9.89 to 12.79 mUr, δ (13)C = -27.04 to -25.51 mUr). Isotopic niche widths were calculated as Bayesian derived standard ellipse areas and were smallest for the plant feeder (1.37 mUr(2)) and the predators (1.73 mUr(2)), but largest for
A series of sheet-structured alkali metal uranyl oxalate hydrates: structures and IR spectra
International Nuclear Information System (INIS)
Giesting, P.A.; Porter, N.J.; Burns, P.C.
2006-01-01
The novel compounds K[(UO 2 ) 2 (C 2 O 4 ) 2 OH] . 2 H 2 O (KUrO x ), Rb[(UO 2 ) 2 (C 2 O 4 ) 2 OH] . 2 H 2 O (RbUrO x ), and Cs[(UO 2 ) 2 (C 2 O 4 ) 2 OH] . H 2 O (CsUrO x ) have been synthesized by mild hydrothermal methods. Single crystal diffraction data collected at 125 K using MoK α radiation and a CCD-based area detector were used to solve and refine the crystal structures by full-matrix least-squares techniques to agreement indices (KUrO x , RbUrO x , CsUrO x ) wR 2 = 0.045, 0.062, 0.042 for all data, and R1 = 0.023, 0.030, 0.022 calculated for 1834, 1863, 1821 unique reflections respectively. The compounds KUrO x , RbUrO x , and CsUrO x are all monoclinic, space group P2 1 /m, Z = 2. The unit cell of KUrO x has the dimensions a = 5.6427(4), b = 13.7123(9), c = 9.2669(6) Aa, β = 98.7490(10) , V = 708.68(8) Aa 3 . The unit cell of RbUrO x has the dimensions a = 5.6225(4), b = 13.8339(9), c = 9.3308(6) Aa, β = 98.1590(10) , V = 718.41(8) Aa 3 . The unit cell of CsUrO x has the dimensions a = 5.4688(3), b = 13.5710(8), c = 9.5408(5) Aa, β = 97.5830(10) , V = 701.90(7) Aa 3 . The structures consist of chains of uranyl pentagonal bipyramids connected by oxalate groups and hydroxyl groups, and are isotypic with the compound NR 4 [(UO 2 ) 2 (C 2 O 4 ) 2 OH] . 2 H 2 O studied by Artem'eva et al. (2003); all four of these compounds are structurally composed of sheets made by polymerizing the chains of UO 2 C 2 O 4 (H 2 O) . 2 H 2 O (Jayadevan and Chackraburtty, 1972; Mikhailov et al., (1999)), this being achieved by removing a H atom from an H 2 O group in the coordination sphere of the uranyl ion to form a hydroxyl vertex that is shared by two uranyl ions. Compensating positive charges are provided by the inclusion of large monovalent cations in channels that run through the sheets; these channels also contain hydrogen-bound H 2 O groups. The positions of the cations and H 2 O groups change in relation to the uranyl oxalate sheets and to each other through the
Stable isotope analysis (δ13C and δ15N of soil nematodes from four feeding groups
Directory of Open Access Journals (Sweden)
Carol Melody
2016-09-01
Full Text Available Soil nematode feeding groups are a long-established trophic categorisation largely based on morphology and are used in ecological indices to monitor and analyse the biological state of soils. Stable isotope ratio analysis (13C/12C and 15N/14N, expressed as δ13C and δ15N has provided verification of, and novel insights into, the feeding ecology of soil animals such as earthworms and mites. However, isotopic studies of soil nematodes have been limited to date as conventional stable isotope ratio analysis needs impractically large numbers of nematodes (up to 1,000 to achieve required minimum sample weights (typically >100 µg C and N. Here, micro-sample near-conventional elemental analysis–isotopic ratio mass spectrometry (μEA–IRMS of C and N using microgram samples (typically 20 µg dry weight, was employed to compare the trophic position of selected soil nematode taxa from four feeding groups: predators (Anatonchus and Mononchus, bacterial feeders (Plectus and Rhabditis, omnivores (Aporcelaimidae and Qudsianematidae and plant feeder (Rotylenchus. Free-living nematodes were collected from conventionally and organically managed arable soils. As few as 15 nematodes, for omnivores and predators, were sufficient to reach the 20 µg dry weight target. There was no significant difference in δ15N (p = 0.290 or δ13C (p = 0.706 between conventional and organic agronomic treatments but, within treatments, there was a significant difference in N and C stable isotope ratios between the plant feeder, Rotylenchus (δ15N = 1.08 to 3.22 mUr‰, δ13C = –29.58 to –27.87 mUr and all other groups. There was an average difference of 9.62 mUr in δ15N between the plant feeder and the predator group (δ15N = 9.89 to 12.79 mUr, δ13C = –27.04 to –25.51 mUr. Isotopic niche widths were calculated as Bayesian derived standard ellipse areas and were smallest for the plant feeder (1.37 mUr2 and the predators (1.73 mUr2, but largest for omnivores (3.83 mUr2
Laursen, S. L.; Weston, T. J.; Thiry, H.
2012-12-01
URSSA is the Undergraduate Research Student Self-Assessment, an online survey instrument for programs and departments to use in assessing the student outcomes of undergraduate research (UR). URSSA focuses on what students learn from their UR experience, rather than whether they liked it. The online questionnaire includes both multiple-choice and open-ended items that focus on students' gains from undergraduate research. These gains include skills, knowledge, deeper understanding of the intellectual and practical work of science, growth in confidence, changes in identity, and career preparation. Other items probe students' participation in important research-related activities that lead to these gains (e.g. giving presentations, having responsibility for a project). These activities, and the gains themselves, are based in research and thus constitute a core set of items. Using these items as a group helps to align a particular program assessment with research-demonstrated outcomes. Optional items may be used to probe particular features that are augment the research experience (e.g. field trips, career seminars, housing arrangements). The URSSA items are based on extensive, interview-based research and evaluation work on undergraduate research by our group and others. This grounding in research means that URSSA measures what we know to be important about the UR experience The items were tested with students, revised and re-tested. Data from a large pilot sample of over 500 students enabled statistical testing of the items' validity and reliability. Optional items about UR program elements were developed in consultation with UR program developers and leaders. The resulting instrument is flexible. Users begin with a set of core items, then customize their survey with optional items to probe students' experiences of specific program elements. The online instrument is free and easy to use, with numeric results available as raw data, summary statistics, cross-tabs, and
Laparoscopic transperitoneal adrenalectomy: оur experience
Directory of Open Access Journals (Sweden)
B. G. Guliev
2014-01-01
Full Text Available Objective: to evaluate the efficiency of laparoscopic adrenalectomy (LAE in the surgical treatment of patients with adrenal tumors.Subjects and methods. In 2011 to 2014, the Clinic of Urology, I.I. Mechnikov North-Western State Medical University, performed LAE in 14 patients (8 men and 6 women. The patients’ mean age was 48.0±4.6 years. Right-, left-sided, and bilateral LAEs were carried out in 7, 5, and 2 cases, respectively. Thus, a total of 16 LAEs were performed in 14 patients. The indications for LAE were mainly primary and metastatic adrenal tumors in our series.Results. The operations were successfully made in all the 14 patients. There were no conversions. Early postoperative complications, such as bleeding requiring blood transfusion, hypotension, and trocar wound infections, were not observed. The mean volume of intra- and postoperative blood losses was 160 (120-280 ml; the time of surgery was 120 (100-150 min. Postoperative analgesia was conducted within 36 (24-48 hours; intramuscular tramadol 50 mg was used twice daily. The mean time of hospitalization was 4 (3-5 days. Histological examination of the adrenal removed revealed adenocarcinoma in 13 (92.8% patients and adenoma in 1 (7.2% case.Conclusion. LAE is the method of choice in the surgical treatment of patients with adrenal tumors. This operation during a laparoscopic access is as effective as open adrenalectomy and the duration of analgesia, the length of hospital stay and the duration of rehabilitation are comparatively shorter.
Laparoscopic transperitoneal adrenalectomy: оur experience
Directory of Open Access Journals (Sweden)
B. G. Guliev
2014-12-01
Full Text Available Objective: to evaluate the efficiency of laparoscopic adrenalectomy (LAE in the surgical treatment of patients with adrenal tumors.Subjects and methods. In 2011 to 2014, the Clinic of Urology, I.I. Mechnikov North-Western State Medical University, performed LAE in 14 patients (8 men and 6 women. The patients’ mean age was 48.0±4.6 years. Right-, left-sided, and bilateral LAEs were carried out in 7, 5, and 2 cases, respectively. Thus, a total of 16 LAEs were performed in 14 patients. The indications for LAE were mainly primary and metastatic adrenal tumors in our series.Results. The operations were successfully made in all the 14 patients. There were no conversions. Early postoperative complications, such as bleeding requiring blood transfusion, hypotension, and trocar wound infections, were not observed. The mean volume of intra- and postoperative blood losses was 160 (120-280 ml; the time of surgery was 120 (100-150 min. Postoperative analgesia was conducted within 36 (24-48 hours; intramuscular tramadol 50 mg was used twice daily. The mean time of hospitalization was 4 (3-5 days. Histological examination of the adrenal removed revealed adenocarcinoma in 13 (92.8% patients and adenoma in 1 (7.2% case.Conclusion. LAE is the method of choice in the surgical treatment of patients with adrenal tumors. This operation during a laparoscopic access is as effective as open adrenalectomy and the duration of analgesia, the length of hospital stay and the duration of rehabilitation are comparatively shorter.
Unit Reference Sheet (URS) Cost Methodology.
1980-08-01
LAUNCHER MONORAIL GUIDED MISSILE: W/E (NIKE-HERCULES) L45740 LAUNCHER TUBULAR GUIDED MISSILE: (TOW) L45757 LAUNCHER ZERO LENGTH GUIDED MISSILE: (IMP-HAWK...L76762 LOADER TRANSPORTER GUIDED MISSILE: W/E (HAWK) M57503 MOBILE TARGET TRACKING SYSTEM: USED TO SUPPORT MQM 34 ( FIRE BEE) M57549 MOBILITY KIT GUIDED...HIGH RATE THREE BARREL W/E J96479 GUN AUTOMATIC 20 MILLIMETER: GAS OPERATED MANUAL OR ELECT FIRED J96481 GUN AUTOMATIC 20 MILLIMETER: ELECTRIC J96694 GUN
Un lettore rozzo dell'Ur-Novellino
DEFF Research Database (Denmark)
Toftgaard, Anders
2007-01-01
tilfældige tegn på tekstens modtagelsen blandt lokale handelsmænd. Det vises derimod her, hvordan tegnene ikke stammer fra grove 1300-tals læsere af Il Novellino, men er blevet tilføjet af Vincenzio Borghini i forbindelse med hans arbejde med at lave den nye, "censurerede" udgave af Il Novellino, som han...
Ureteroscopie Retrograde: Expérience de l'Hôpital Général Grand ...
African Journals Online (AJOL)
L. Niang
urétéroscopie à l'Hôpital Général Grand Yoff (HOGGY) de. Dakar (Sénégal). Sujets et méthodes : Il s'agit d'une étude descriptive de 91 urétéroscopies effectuées dans le service d'Urologie de l'Hôpital Général Grand Yoff de janvier 2012 à décembre ...
Joint Forces Command - United Assistance Fiscal Triad
2016-05-17
determine the division of labor and any additional training that would be required before deploying. The Logistics Civil Augmentation Program (LOGCAP...had established for operations in Afghanistan and Iraq. AFRICOM did not have a dedicated funds cen- ter in the General Fund Enterprise Business ...AT UR ES FE AT UR ES al U.S. military personnel and their equipment. Commercial Shipping Demands to ship test, measure- ment, and diagnostic
Directory of Open Access Journals (Sweden)
Ingi Rúnar Eðvarðsson
2010-12-01
Full Text Available The aim of the paper is to examine the process of decision-making among public administrators and answer the question of whether this differs from the way decisions is arrived at in the private sector. Interviews were conducted at three private companies and three public institutions. The results indicate that the administrators of public bodies and private enterprises appear to use similar methods in their decision-making process. The differences which were revealed relate to the size of the companies or institutions in question, rather than to form of ownership; i.e. the larger the operation, the more people are involved in the decision-making process. An analysis of the interviews reveals that the administrators of public bodies have a weaker mandate to make decisions than is the case in private enterprises, especially with regard to matters involving strategy. Otherwise there is little difference between small private businesses and small public institutions - their management often apply the rational approach and bounded rationality model to solve problems. The decision making process is very similar in larger private businesses and public institutions. Decisions take longer to make in public institutions where more momentous issues are involved, such as the construction of new buildings and strategy formation, in which case the process is characterised by staged decisions, often resulting in compromises between parties with contrasting interests. It should also be mentioned that many kinds of state legislation, e.g. relating to equal opportunities, information act and public employees, as well as strategies of district councils, often restrict the decision-making authority of public administrators. Such restraints do not apply to the same extent to private sector management. The consequences of the economic collapse exercised a considerably stronger impact on decision-making among public administrators than was the case with their
International Nuclear Information System (INIS)
Xie, Ziang; Sun, Shuren; Yan, Yu; Wang, Wei; Qin, Laixiang; Qin, G G
2016-01-01
For a novel kind of solar cell (SC) material, it is critical to estimate how far the power conversion efficiencies (PCEs) of the SCs made of it can go. In 2010 Han and Chen proposed the equation for the ultimate efficiency of SCs without considering the carrier recombination η un . η un is capable of estimating the theoretical upper limits of the SC efficiencies and has attracted much attention. However, carrier recombination, which is one of the key factors influencing the PCEs of the SCs, is ignored in the equation for η un . In this paper, we develop a novel equation to calculate the ultimate efficiency for the SCs, η ur , which considers both the bulk and the surface carrier recombinations. The novel equation for η ur can estimate how much the bulk and the surface carrier recombinations influence the PCEs of the SCs. Moreover, with η ur we can estimate how much PCE improvement space can be gained only by reducing the influence of the carrier recombination to the least. The perovskite organometal trihalide SCs have attracted tremendous attention lately. For the planar CH 3 NH 3 PbI 3 SCs, in the material depth range from 31.25–2000 nm, we apply the equation of η ur to investigate how the bulk and the surface carrier recombinations affect PCE. From a typically reported PCE of 15% for the planar CH 3 NH 3 PbI 3 SC, using the equation of η ur , it is concluded that by reducing the influence of carrier recombination to the least the improvement of PCE is in the range of 17–30%. (paper)
Directory of Open Access Journals (Sweden)
João Ricardo Rebouças Dórea
2013-09-01
Full Text Available Avaliaram-se os efeitos da inclusão de fubá de milho (5% e uréia (1% sobre a composição bromatológica e o perfil fermentativo da silagem de jaca, utilizando-se delineamento experimental inteiramente casualisado em arranjo fatorial 3x7 (tratamentos x dia de abertura, com duas repetições. Foram utilizados silos experimentais de PVC, 10 cm de diâmetros x 40 cm de comprimento. A abertura dos silos seguida da avaliação da composição bromatológica e do perfil fermentativo da silagem ocorreu aos 1, 3, 5, 7, 14, 28 e 56 dias após a ensilagem. Os teores de matéria seca (MS e proteína bruta (PB foram elevados significativamente (P<0,05 com a adição de 5% de milho e 1% de uréia, respectivamente. O pH encontrado em todos os tratamentos foi considerado ideal para silagens de boa qualidade. A adição de uréia aumentou significativamente (P<0,05 os valores de nitrogênio amoniacal (N-NH3/NT. A adição de 1% uréia funcionou como álcali na parede celular do material ensilado, demonstrado pela redução nos teores das frações fibrosas. A jaca apresenta potencial de conservação na forma de silagem e a utilização de milho e uréia como aditivos melhora o perfil fermentativo e a qualidade da silagem.
Holsheimer, Jan; Buitenweg, Jan R; Das, John; de Sutter, Paul; Manola, Ljubomir; Nuttin, Bart
2011-05-01
In spinal cord stimulation for the management of chronic, intractable pain, a satisfactory analgesic effect can be obtained only when the stimulation-induced paresthesias cover all painful body areas completely or partially. To investigate the effect of stimulus pulse width (PW) and contact configuration (CC) on the area of paresthesia (PA), perception threshold (VPT), discomfort threshold (VDT), and usage range (UR) in spinal cord stimulation. Chronic pain patients were tested during a follow-up visit. They were stimulated monopolarly and with the CC giving each patient the best analgesia. VPT, VDT, and UR were determined for PWs of 90, 210, and 450 microseconds. The paresthesia contours at VDT were drawn on a body map and digitized; PA was calculated; and its anatomic composition was described. The effects of PW and CC on PA, VPT, VDT, and UR were tested statistically. Twenty-four of 31 tests with low thoracic stimulation and 8 of 9 tests with cervical stimulation gave a significant extension of PA at increasing PW. In 14 of 18 tests (low thoracic), a caudal extension was obtained (primarily in L5-S2). In cervical stimulation the extension was predominantly caudal as well. In contrast to VPT and VDT, UR is not significantly different when stimulating with any CC. PA extends caudally with increasing PW. The mechanism includes that the larger and smaller dorsal column fibers have a different mediolateral distribution and that smaller dorsal column fibers have a smaller UR and can be activated only when PW is sufficiently large. A similar effect of CC on PA is unlikely as long as electrodes with a large intercontact distance are applied.
Quelles pratiques sémiotiques pour quelles médiations ?
Directory of Open Access Journals (Sweden)
Anne Hénault
2017-06-01
ABSTRACT: In January 1963, Paul Ricœur was very interested in structuralism to which he had already devoted important readings (Rome, Entretiens Castelli. In June 1963, during a heated debate with C. Levi-Strauss, under the Esprit Journal, Ricœur developed a violent rejection of structural thought, and his resentment will endure until his last work, devoted to History, in 2002. Initially (up to 1979, this anathema was also aimed at A. J. Greimas and his semiotics. Then, following a series of university meetings and public debates with Greimas, Ricœur came to a complete change of view of Greimas's works, to the point of intimacy, at the last public debate between them (In 1989, not to use the pretext of his research on the semiotics of the passions to distance himself from his first semiotics (that which from the Sémantique structurale to the Dictionnaire comes to be known as "standard semiotics". After this, Ricœur explicitly formulated the idea that standard semiotics had elaborated a new rationality, the explanatory power of which was authentically "theoretical" and therefore scientific, which led him to admit that the semiotic explanation could be revealed necessary even in the field of Hermeneutics, in order to reach a more exact level of understanding.
Xiong, Zhengqin; Liu, Yinglie; Wu, Zhen; Zhang, Xiaolin; Liu, Pingli; Huang, Taiqing
2015-01-01
Double rice (DR) and upland crop-single rice (UR) systems are the major rice-based cropping systems in China, yet differences in net global warming potential (NGWP) and greenhouse gas intensity (GHGI) between the two systems are poorly documented. Accordingly, a 3-year field experiment was conducted to simultaneously measure methane (CH4) and nitrous oxide (N2O) emissions and changes in soil organic carbon (SOC) in oil rape-rice-rice and wheat-rice (representing DR and UR, respectively) systems with straw incorporation (0, 3 and 6 t/ha) during the rice-growing seasons. Compared with the UR system, the annual CH4, N2O, grain yield and NGWP were significantly increased in the DR system, though little effect on SOC sequestration or GHGI was observed without straw incorporation. Straw incorporation increased CH4 emission and SOC sequestration but had no significant effect on N2O emission in both systems. Averaged over the three study years, straw incorporation had no significant effect on NGWP and GHGI in the UR system, whereas these parameters were greatly increased in the DR system, i.e., by 108% (3 t/ha) and 180% (6 t/ha) for NGWP and 103% (3 t/ha) and 168% (6 t/ha) for GHGI. PMID:26626733
Rosas, Alejandro; Viciana, Hugo; Caviedes, Esteban; Arciniegas, Alejandra
2018-04-18
Research on moral judgment with moral dilemmas suggests that "utilitarian" responses (UR) to sacrificial high-conflict dilemmas are due to decreased harm aversion, not only in individuals with clinical conditions, but also in healthy participants with high scores in antisocial personality traits. We investigated the patterns of responses to different dilemma types in healthy participants and present evidence that some URs to sacrificial dilemmas are morally motivated, as indicated by their empathic concern (EC) or primary psychopathy (PP) scores. In study 1 (N = 230) we tested students with four categories of sacrificial dilemmas featuring innocent victims. In study 2 (N = 590) we tested students with two categories of sacrificial dilemmas and two "real-world" moral dilemmas, where the agent can improve the lot of strangers by making a personal sacrifice. Results in both studies showed no decreased harm aversion in a pattern where the only UR is to the sacrificial dilemma where the number of saved people is very high, and significantly lower harm aversion only in the pattern of all-deontological respondents in Study 2. The analysis by response patterns allowed a better discrimination of the moral motivations of participants and showed that at least some of them express moral concerns in their URs.
2014-01-01
Background Diet therapies including calorie restriction, ketogenic diets, and fish-oil supplementation have been used to improve health and to treat a variety of neurological and non-neurological diseases. Methods We investigated the effects of three diets on circulating plasma metabolites (glucose and β-hydroxybutyrate), hormones (insulin and adiponectin), and lipids over a 32-day period in C57BL/6J mice. The diets evaluated included a standard rodent diet (SD), a ketogenic diet (KD), and a standard rodent diet supplemented with fish-oil (FO). Each diet was administered in either unrestricted (UR) or restricted (R) amounts to reduce body weight by 20%. Results The KD-UR increased body weight and glucose levels and promoted a hyperlipidemic profile, whereas the FO-UR decreased body weight and glucose levels and promoted a normolipidemic profile, compared to the SD-UR. When administered in restricted amounts, all three diets produced a similar plasma metabolite profile, which included decreased glucose levels and a normolipidemic profile. Linear regression analysis showed that circulating glucose most strongly predicted body weight and triglyceride levels, whereas calorie intake moderately predicted glucose levels and strongly predicted ketone body levels. Conclusions These results suggest that biomarkers of health can be improved when diets are consumed in restricted amounts, regardless of macronutrient composition. PMID:24910707
Gutiérrez-Gamboa, Gastón; Garde-Cerdán, Teresa; Portu, Javier; Moreno-Simunovic, Yerko; Martínez-Gil, Ana M
2017-06-01
Wine quality greatly depends on its chemical composition. Among the most important wine chemical compounds, flavonoids are the major contributors to wine organoleptic properties while amino acids have a huge impact on fermentation development and wine volatile profile. Likewise, nitrogen applications are known to have an impact on wine composition. Therefore, the aim of this work was to study the effects of foliar nitrogen applications on wine flavonoid and amino acid composition. The experiment involved five foliar nitrogen applications at veraison time: urea (Ur), urea plus sulphur (Ur+S), arginine (Arg), and two commercial fertilizers Nutrimyr Thiols (NT) and Basfoliar Algae (BA). The results showed that nitrogen foliar treatments decreased wine flavonoid content although the effect varied according to each treatment. This could be related to a low vine nitrogen requirement, since must yeast assimilable nitrogen (YAN) was above acceptable threshold values for all samples. With regard to wine amino acid content, all treatments except for Ur increased its values after the applications. Finally, foliar nitrogen treatments greatly influenced wine composition. Among them, urea seemed to exert the most negative effect on both phenolics and amino acids. In addition, an inverse relationship between wine amino acid content and flavonol concentration was exhibited. Copyright © 2017. Published by Elsevier Ltd.
Xiong, Zhengqin; Liu, Yinglie; Wu, Zhen; Zhang, Xiaolin; Liu, Pingli; Huang, Taiqing
2015-12-02
Double rice (DR) and upland crop-single rice (UR) systems are the major rice-based cropping systems in China, yet differences in net global warming potential (NGWP) and greenhouse gas intensity (GHGI) between the two systems are poorly documented. Accordingly, a 3-year field experiment was conducted to simultaneously measure methane (CH4) and nitrous oxide (N2O) emissions and changes in soil organic carbon (SOC) in oil rape-rice-rice and wheat-rice (representing DR and UR, respectively) systems with straw incorporation (0, 3 and 6 t/ha) during the rice-growing seasons. Compared with the UR system, the annual CH4, N2O, grain yield and NGWP were significantly increased in the DR system, though little effect on SOC sequestration or GHGI was observed without straw incorporation. Straw incorporation increased CH4 emission and SOC sequestration but had no significant effect on N2O emission in both systems. Averaged over the three study years, straw incorporation had no significant effect on NGWP and GHGI in the UR system, whereas these parameters were greatly increased in the DR system, i.e., by 108% (3 t/ha) and 180% (6 t/ha) for NGWP and 103% (3 t/ha) and 168% (6 t/ha) for GHGI.
Hu, Xue-yong; Sun, An-sheng; Sui, Yu-xia
2007-11-01
To study the effects of combined use of total alkaloids (TA) of Uncaria rhynchophylla (UR) and Coryadlis ambailis migo (CAM) on cerebral ischemia/reperfusion injury in rats. Rat model of middle cerebral artery ischemia/reperfusion was established, the changes of neurological state was scored before and after treatment with the two kinds of TA, single or combined, and the changes of cerebral infarcted volume, cerebral water content, activities of NOS and SOD and content of MDA in rats' brain were estimated as well. After being treated with the combination of both TA, the average neurological score, cerebral infracted volume, cerebral water content, activity of NOS and content of MDA in the model rats significantly decreased, and the activity of SOD was significantly increased (all P < 0.05). The effect of combined use of the two TA was higher than that of use TA of UR or CAM alone (P <0.05). Moreover, the central nervous system inhibitory effect induced by combined TA was significantly weaker than that of UR. Combined use of TA of UR and CAM may facilitate the protection against cerebral ischemia/reperfusion damage, the action mechanism might be relevant to reducing the lipid peroxidation injury of brain cells through inhibiting the NOS activity and increasing the SOD activity.
On the Correct Formulation of the First Law of Thermodynamics
Kalanov, Temur Z.
2006-04-01
The critical analysis of the generally accepted formulation of the first law of thermodynamics is proposed. The purpose of the analysis is to prove that the standard formulation contains a mathematical error and to offer the correct formulation. The correct formulation is based on the concepts of function and differential of function. Really, if internal energy Uof a system is a function of two independent variables Q=Q(t) (describing of the thermal form of energy) and R=R(t) (describing non-thermal form of energy), then the correct formulation of the first law of thermodynamics is: dU(Q,R)dt=( UQ )RdQdt+( UR )QdRdt, where t and -( UR )Q / ( UR )Q ( UQ ) . - ( UQ )R are time and measure of mutual transformation of forms of energy, correspondingly. General conclusion: standard thermodynamics is incorrect.
أور في زمـن المـــلك (آبـي _ سيـن 2028 – 2004 ق.م Or in the time of King (Abe _ Sen 2028 - 2004 BC.
Directory of Open Access Journals (Sweden)
Ahmad Najee Sabba أحمد ناجي سبع
2012-12-01
Full Text Available The king Abe Sen is considered (2028 - 2004 the fifth and last king of Third Dynasty of Ur, and sources indicate cuneiform he was crowned king on the throne of the state of Ur III in the tenth month of the ninth year of the rule of his father, King Chusein (2037 - 2029 BC., And indicate sources also said that he was young when he was crowned on the throne. The sources said that some of the kings belonging to the authority of Ur III has rushed glorifying King Abe O, where raises sources cuneiform to the existence of a number of texts which concluded in the name of King Abe Sen texts still dated for years to rule Chusein, and this was confirmed by one of the texts that go back the Kododo writer son of Uma governor.
2016-10-01
Francisco San Francisco , CA...University of California, San Francisco 8. PERFORMING ORGANIZATION REPORT NUMBER 1855 Folsom St Ste 425 San Francisco CA 94103-4249 9...n fo r F ut ur e C lin ic al A pp lic at io n W 81 X W H -1 4- 1- 06 03 In se rt a pi ct ur e or g ra ph ic he re , w ith a c ap tio
Massami Shimokomaki; Clarice Fujiko Yonemitsu; Rosicler Balduino Nogueira; Simone Palma Favaro
2001-01-01
The possibility of Hazard Analysis and Critical Control Points – HACCP- system implementation was evaluated at University Restaurant (UR) of State University of Londrina (UEL). A study was designed to assure the safety of vegetables served as raw salad. Lettuce salad was taken as example. After checking the Good Manufacturing Practice it was verified further that UR presented the necessary conditions to allow the HACCP system implementation for this product. The chemical, physical and biologi...
DEFF Research Database (Denmark)
Aktor, Mikael
2016-01-01
Tantriske tekster benævner ofte Gudinden, Śakti, som en lavkastekvinde, en Cāṇḍālī eller Ḍombī. I disse sammenhænge kan logikken vedrørende urørlighed være vendt på hovedet: Kvinden er urørlig for at beskytte hende mod mænds urene begær, ikke for at beskytte mændenes renhed. Ikke desto mindre er ...
Directory of Open Access Journals (Sweden)
Josep M. Campistol
2015-09-01
Full Text Available El síndrome hemolítico urémico (SHU es una entidad clínica definida por la tríada anemia hemolítica no inmune, trombocitopenia e insuficiencia renal aguda, en la que las lesiones subyacentes están mediadas por un proceso de microangiopatía trombótica (MAT sistémico. Distintas causas pueden desencadenar el proceso de MAT que caracteriza el SHU. En este documento consideramos SHU atípico (SHUa como el subtipo de SHU en el que los fenómenos de MAT son fundamentalmente consecuencia del daño producido en el endotelio de la microvasculatura renal y de otros órganos por desregulación de la actividad del sistema del complemento. En los últimos años se han identificado diversas mutaciones en genes del sistema del complemento asociados a SHUa, que explicarían aproximadamente el 60% de los casos de SHUa, y se han caracterizado funcionalmente numerosas mutaciones y polimorfismos asociados a SHUa que han permitido determinar que la patología se produce como consecuencia de la deficiente regulación de la activación del complemento sobre las superficies celulares y que lleva al daño endotelial mediado por la activación del C5 y de la vía terminal del complemento. Eculizumab es un anticuerpo monoclonal humanizado que inhibe la activación del C5, bloqueando la generación de la molécula proinflamatoria C5a y la formación del complejo de ataque de membrana. En estudios prospectivos en pacientes con SHUa su administración ha demostrado la interrupción rápida y sostenida del proceso de MAT, con una mejora significativa de la función renal a largo plazo y una reducción importante de la necesidad de diálisis y el cese de la terapia plasmática. En función de las evidencias científicas publicadas y la experiencia clínica acumulada, el Grupo Español de SHUa publicamos un documento de consenso con recomendaciones para el tratamiento de la enfermedad (Nefrología 2013;33(1:27-45. En la presente versión online del documento se
Access to chlamydia testing in remote and rural Scotland.
Hawkins, Katherine E; Thompson, Lucy; Wilson, Philip
2016-01-01
The aim of this study was to assess access to sexual health care in remote and rural settings using Chlamydia testing as a focus by measuring the extent of Chlamydia testing and positivity across the Scottish Highlands in relation to the Scottish Index of Multiple Deprivation Quintile (SIMD) and Urban Rural 8-fold index (UR8). Tests processed through Raigmore Hospital in Inverness, the main testing laboratory for microbiology tests in North and West and South and Mid Highlands, were studied. Where people are tested in relation to where they live was assessed, as well as the type of test they opt for. Also assessed was the rate of positivity in male and female patients in rural compared with urban settings using the Scottish Government UR8 and in relation to the SIMD. 9644 results were analysed. 77.2% of the results were for females and 22.4% for males. 8.1% of the results were positive and 84.4% were negative. There were proportionately more positive tests from the sexual health sources than from general practice. The proportion of men who had positive tests was almost double that for women (12.7% vs 6.6%) although men made up only 27.9% of the total number of tests. There was no significant difference in positivity when compared with UR8 index or SIMD. 37.7% of people living in the most rural areas (UR8 7-8) had their test performed in a more urban setting (UR8 1-6), and 20.4% people had their test performed in a very urban setting (UR8 1-2). Of these tests, there was a tendency for UR8 7-8 patients to be more likely to have a positive test if tested in an urban setting. These results are similar to previous results in other countries that suggest that Chlamydia positivity is similar in rural and urban settings. A large proportion of people living in more rurally classified areas, and perhaps those with a higher risk, have their test in a central setting, suggesting that they may be bypassing local resources to get a test. The reason for this is not clear. The
EMI StAR – Definition of a Storage Accounting Record
Nilsen, J.K.; Müller-Pfefferkorn, R.; Molnar, Z.; Zappi, R.
2011-01-01
In this document the EU-project European Middleware Initiative (EMI) describes a storage accounting record (StAR), defined to reflect practical, financial and legal requirements of storage location, usage and space and data flow. The defined record might be the base for a standardized schema or an extension of an existing record like the OGF UR and this document is intended as information to be taken as input for incorporating storage resources into the OGF UR.
1989-07-25
nwdas Green Seaturtle PK E E 1,19 FISH Acipenser oxyrhynchus &esotoi Gulf Sturgeon SR SSC UR2 17,19 Mustela vison lutensis Florida Mink P - UR2 13...immediately dangerous to life and health (IDLH) with respect to respiratory irritation. This represents the maximum concentration from which one could...Threshold 0.004 mg/m3 ACGIH’ Median effective concentration 1-5 mg/m3 ACGIH Respiratory irritation Permissible exposure limit (PEL) 0.4 mg/m3
DEFF Research Database (Denmark)
Schultz, Majken
2014-01-01
Virksomheder kan bruge historien til at være kraftfulde ressourcer for innovation og række langt ind i fremtiden. Tim Cook og Apple viste – igen – vejen ved præsentationen af det nye ur.......Virksomheder kan bruge historien til at være kraftfulde ressourcer for innovation og række langt ind i fremtiden. Tim Cook og Apple viste – igen – vejen ved præsentationen af det nye ur....
Initial Orbit Determination Based on Propagation of Admissible Regions with Differential Algebra
2017-01-19
Politecnico di Milano LAURA PIROVANO, ROBERTO ARMELLIN, JUAN FELIX SAN JUAN Universidad de la Rioja ALEXANDER WITTIG Advanced concepts team, ESA...report has detailed the work of the team in the period June, 16 2016 - January, 16 2017. The Universidad de la Rioja (UR) team has completed the...release: distribution unlimited. TSA too short arc UR Universidad de la Rioja VO virtual observatory VSA very short arc 53 DISTRIBUTION A. Approved for public release: distribution unlimited.
PAEDIATRIC URETERIC CALCULI: IN-SITU EXTRACORPOREAL ...
African Journals Online (AJOL)
Il navait ni obstruction urétérale ni infection urinaire. De légères hématuries et coliques transitoires ont été observées après la lithotripsie. Conclusion Chez lenfant, la lithotripsie extra-corporelle in situ est une procédure efficace dans le traitement des calculs urétéraux quelque soit le siège. Il ny a aucune morbidité liée à la ...
International Nuclear Information System (INIS)
Chang, Hong Lae; Ko, Won Il
2008-01-01
Within the International Project on Innovative Nuclear Reactors and Fuel Cycles (INPRO) of the IAEA, a methodology for evaluating proliferation resistance (INPRO PR methodology) has been developed in order to provide guidance in using the INPRO methodology. However, it remains to develop the methodology to evaluate User Requirements (UR) 4 regarding multiplicity and robustness of barriers against proliferation (innovative nuclear energy systems should incorporate multiple proliferation resistance features and measures). To develop the assessment procedure and metrics for User Requirement 4 (UR4), the coarse acquisition/ diversion pathway analysis of the DUPIC Fuel Cycle has been performed. The most plausible pathways for the acquisition of weapons-usable nuclear material were identified and analyzed using a systematic approach herein, and future work to complete the assessment approach for the UR4 of the INPRO methodology regarding the multiplicity and robustness of barriers against proliferation are also proposed
Neuroscientific Research on the Self
DEFF Research Database (Denmark)
Runehov, Anne Leona Cesarine
2008-01-01
models are suggested: ES((NS ¿ (SNS n STS)); STS > (NS n SNS) Where ES stands for one Emergent Self comprising a Neural Self (NS), a Subjective Neural Self (SNS) and a Subjective Transcendent Self (STS). There is mutual causation between the neural and subjective selves. Furthermore, the subjective...... transcendent is bigger than both the neural and subjective neural self. EU(UR ¿ (NR ¿ ES)); ES > NR and UR > (NR n ES) Where EU stands for one Emergent Universe comprising Ultimate Reality (UR; GOD), Natural Reality (NR; world) and all Emergent selves (ES). There is mutual causation between God and the world...... millions of religious believers of a satisfactory explanation. The present paper deals with this neglect. It asks the question, if God exists, how then can we understand God's relationship to the world in a scientific age? From contemporary neuroscientific research on the self, the following explanatory...
Single use disposable digital flexible ureteroscopes: an ex-vivo assessment and cost analysis.
Hennessey, D B; Fojecki, G; Papa, N; Lawrentschuk, N; Bolton, D
2018-04-15
The single use flexible ureteroscope (fURS), the LithoVue is an important recent development. We aim to measure the capability of this instrument and to assess if there is a benefit to switching to single use instruments. The LithoVue was compared to Olympus URF-V and Stortz Flex Xc ex-vivo. An analysis of reusable fURS usage was performed to evaluate damage, durability and maintenance costs. This was then compared to the projected costs of using single use instruments. Flexion, deflection and irrigation flow of the LithoVue was equivalent, if not better than reusable instruments. An analysis of 234 procedures with 7 new Olympus URF-V scopes, revealed 15 scope damages. Staghorn stones and lower pole/midzone stones were significant risk factors for damage, p=0.014. Once damage occurred, it was likely to occur again. Total repair costs were $162,628 (£92,411), the mean cost per case is $695 (£395). Factoring in the purchase cost, cleaning and repair costs, and the cumulative cost of 28 reusable fURS cases is approximately $50,000 (£28,412). If the LithoVue was priced at $1200 AUD, switching to a single use scope would cost approximately $35,000 (£19,888). The LithoVue is analogous to reusable fURS scopes in regard to standard technical metrics. Depending on its purchase cost it may also represent a cost saving for hospitals when compared to the cumulative costs of maintaining reusable fURS. Additionally, urologist may consider to use the scope in cases in which reusable scope damage is anticipated. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
Langer, P; Földes, O; Macho, L; Kvetnanský, R
1983-01-01
Groups of 6-8 male Wistar Olac SPF rats weighing about 300 g were subjected to unforced restriction (UR) in small cages with a metallic bottom and a Plexiglas cover for various intervals from 2 min to 72 h. An acute activation of the pituitary-thyroid axis was found which was manifested by an increase of thyrotropin (TSH) and thyroxine (T4) levels at 2-5 min of UR. This was presumably due to the emotional effect of a rapid transfer and to the placing of the animals into restriction cages. Later, between 3 and 6 h of UR, another, and more pronounced period of activation of the pituitary-thyroid axis and of the peripheral thyroid hormone metabolism was repeatedly observed which lasted until about 36-48 h and was manifested by a highly significant increase of TSH, T4, 3,5,3'-triiodothyronine (T3) and 3,3',5'-triiodothyronine (rT3) levels. It was concluded that this phenomenon presumably may be a component of nonshivering thermogenesis resulting from a decreased muscular activity and resembling the conditions occurring under cold stress. Such a view was supported by findings of highly increased nonesterified fatty acid levels in plasma in restricted animals, by unchanged levels of TSH and thyroid hormones found in unrestricted animals kept individually in regular group cages and, finally, by a preventive effect of ambient temperature of 32 degrees C on the pituitary-thyroid activation at 6 h of UR. In some experiments, no substantial differences in hormone levels were found between the animals kept in Plexiglas or stainless wire-mesh restriction cages. Finally, a multifold increase of prolactin level in plasma was found as early as 2 min of UR, the peak being observed between 5 and 20 min and a decrease to about the initial level at about 360 min.
Scotland, Kymora B; Rudnick, Benjamin; Healy, Kelly A; Hubosky, Scott G; Bagley, Demetrius H
2018-06-06
Advances in flexible ureteroscope design and accessory instrumentation have allowed for more challenging cases to be treated ureteroscopically. Here, we evaluate our experience with ureteroscopy (URS) for the management of large renal calculi (≥2 cm) and provide a concise review of recent reports. A retrospective review was undertaken of all URS cases between 2004 and 2014 performed by the endourologic team at a single academic tertiary care institution. We identified patients with at least one stone ≥2 cm managed with retrograde URS. Stone size was defined as the largest linear diameter of the index stone. Small diameter flexible ureteroscopes were used primarily with holmium laser. Patient demographics, intraoperative data, and postoperative outcomes were evaluated. We evaluated 167 consecutive patients who underwent URS for large renal stones ≥2 cm. The initial reason for choosing URS included patient preference (29.5%), failure of other therapies (8.2%), anatomic considerations/body habitus (30.3%), and comorbidities (28.8%). Mean patient age was 55.5 years (22-84). The mean stone size was 2.75 cm with mean number of procedures per patient of 1.65 (1-6). The single session stone-free rate was 57.1%, two-stage procedure stone-free rate was 90.2% and three-stage stone-free rate was 94.0%. Access sheaths were used in 47% of patients. An association was identified between stone size and patient outcomes; smaller stones correlated with decreased number of procedures. Postoperative complications were minor. Single or multi-stage retrograde ureteroscopic lithotripsy is a safe and effective mode of surgical management of large renal calculi. Total stone burden is a reliable predictor of the need for a staged procedure and of stone-free rate.
Directory of Open Access Journals (Sweden)
Ronaldo Lopes Oliveira
2009-03-01
Full Text Available Os efeitos da suplementação de fontes lipídicas sobre o consumo, a digestibilidade dos nutrientes e o N-uréico plasmático foram avaliados em 12 búfalas lactantes, em três quadrados latinos simultâneos, cada um com quatro animais, quatro períodos e quatro dietas contendo uma das fontes de lípideo estudadas (sem lipídeo adicional; grão de soja; óleo de soja ou caroço de algodão. O período experimental foi de 84 dias, com quatro períodos de 21 dias, divididos em 14 dias para a adaptação e 7 para coleta. A dieta foi fornecida à vontade, duas vezes ao dia, na forma de mistura completa. Nos dias de coleta de cada período, os alimentos fornecidos e as sobras foram pesados e amostrados para análise bromatológica. Amostras de fezes foram coletadas diretamente no reto dos animais para estimativa da produção de matéria seca fecal, utilizando-se a fibra em detergente neutro indigestível como indicador, e para o cálculo de digestibilidade aparente. Os consumos de matéria seca, proteína bruta, fibra em detergente neutro e fibra em detergente ácido foram semelhantes entre as dietas. Os consumos de extrato etéreo e nutrientes digestíveis totais (NDT foram maiores para a dieta com óleo de soja. Os coeficientes de digestibilidade de matéria seca, proteína bruta e carboidratos não-fibrosos e as concentrações de N-uréico plasmático foram semelhantes entre as dietas. A utilização das fontes de lipídeos nas dietas de búfalas em lactação não influenciou o consumo e coeficiente de digestibilidade da matéria seca. Entretanto, as digestibilidades do extrato etéreo da dieta com grão de soja e das frações fibrosas da dieta com caroço de algodão foram as mais baixas.The effects of fat sources on intake, nutrient digestibility and plasma urea nitrogen were evaluated in lactating water buffalo. Twelve females were randomly distributed into four treatments: without additional lipid, soybean grain, soybean oil and
Bramante, Clovis Monteiro; Fidelis, Natasha Siqueira; Assumpção, Tatiana Santos; Bernardineli, Norberti; Garcia, Roberto Brandão; Bramante, Alexandre Silva; de Moraes, Ivaldo Gomes
2010-11-01
This ex vivo study evaluated the heat release, time required, and cleaning efficacy of MTwo (VDW, Munich, Germany) and ProTaper Universal Retreatment systems (Dentsply/Maillefer, Ballaigues, Switzerland) and hand instrumentation in the removal of filling material. Sixty single-rooted human teeth with a single straight canal were obturated with gutta-percha and zinc oxide and eugenol-based cement and randomly allocated to 3 groups (n = 20). After 30-day storage at 37 °C and 100% humidity, the root fillings were removed using ProTaper UR, MTwo R, or hand files. Heat release, time required, and cleaning efficacy data were analyzed statistically (analysis of variance and the Tukey test, α = 0.05). None of the techniques removed the root fillings completely. Filling material removal with ProTaper UR was faster but caused more heat release. Mtwo R produced less heat release than the other techniques but was the least efficient in removing gutta-percha/sealer. ProTaper UR and MTwo R caused the greatest and lowest temperature increase on root surface, respectively; regardless of the type of instrument, more heat was released in the cervical third. Pro Taper UR needed less time to remove fillings than MTwo R. All techniques left filling debris in the root canals. Copyright © 2010 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Ercan Ogreden
2018-03-01
Full Text Available Objective: To evaluate the impact of ureteral stent insertion following semirigid ureterorenoscopy (URS in patients with perirenal fat stranding (PFS due to ureteral stones. Material and methods: Data of 600 patients who underwent URS were analyzed retrospectively. Seventy-two patients detected to have PFS accompanying ureteral stone were included. Patients who did not undergo double J (DJ stent insertion following semirigid URS were classified as Group I (n: 52, while those who underwent stent insertion were classified as Group II (n: 20. Side distribution; localization of the stones, stone size, presence of fever, urinary tract infection (UTIs and urosepsis rates were compared in the two groups. Results: The average age of the patients was 44.4 (20-71 years. Male/female ratio and side of the stone location showed similar distribution in both groups (p > 0.05. Fever occurred in 23 cases (44.2% in Group I and in 15 cases (75% in Group II (p = 0.038. UTIs occurred in 15 cases (28.9% in Group I and in 12 cases (60% in Group II (p = 0.03. Urosepsis presented in 3 (5.8% and 5 (25% of the patients in Group I and II, respectively (p = 0.033. Conclusions: According to our results, ureteral DJ stent insertion following URS in patients with PFS due to ureteral stone caused an increase on postoperative infection related complications.
Lee, Jason Young; McDougall, Elspeth M; Lineberry, Matthew; Tekian, Ara
2016-08-01
Provision of expert feedback is widely acknowledged to be an essential component of simulation-based training. However, little is known about the most effective and efficient ways to provide feedback to novices. Optimizing the timing of expert feedback may improve outcomes while reducing resource requirements. The main objective of this study was to determine the impact of providing early versus late expert feedback to novice learners engaged in a flexible ureteroscopy (fURS) training curriculum. Senior medical students were recruited to participate in this study. Each student participated in a comprehensive fURS training curriculum that included 3 deliberate, independent practice sessions. Baseline and postcourse fURS skill was assessed for each student using a standardized fURS test task. Each student was randomized to either an early feedback group (EFG) or late feedback group (LFG). The EFG participants were provided expert feedback immediately after the baseline skill test, whereas LFG participants were given feedback before their final deliberate, independent practice session. Eighteen senior medical students completed the study (9 EFG and 9 LFG participants). There were no discernible demographic differences between the groups at baseline. When controlling for pretest performance, early rather than late feedback was associated with both shorter postcourse time to completion of the task (19.2 vs. 21.5 minutes, P feedback when learning a novel skill. Further study is required.
Closure Report for Corrective Action Unit 139: Waste Disposal Sites, Nevada Test Site, Nevada
Energy Technology Data Exchange (ETDEWEB)
NSTec Environmental Restoration
2009-07-31
Corrective Action Unit (CAU) 139 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Waste Disposal Sites' and consists of the following seven Corrective Action Sites (CASs), located in Areas 3, 4, 6, and 9 of the Nevada Test Site: CAS 03-35-01, Burn Pit; CAS 04-08-02, Waste Disposal Site; CAS 04-99-01, Contaminated Surface Debris; CAS 06-19-02, Waste Disposal Site/Burn Pit; CAS 06-19-03, Waste Disposal Trenches; CAS 09-23-01, Area 9 Gravel Gertie; and CAS 09-34-01, Underground Detection Station. Closure activities were conducted from December 2008 to April 2009 according to the FFACO (1996, as amended February 2008) and the Corrective Action Plan for CAU 139 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2007b). The corrective action alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls. Closure activities are summarized. CAU 139, 'Waste Disposal Sites,' consists of seven CASs in Areas 3, 4, 6, and 9 of the NTS. The closure alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls. This CR provides a summary of completed closure activities, documentation of waste disposal, and confirmation that remediation goals were met. The following site closure activities were performed at CAU 139 as documented in this CR: (1) At CAS 03-35-01, Burn Pit, soil and debris were removed and disposed as LLW, and debris was removed and disposed as sanitary waste. (2) At CAS 04-08-02, Waste Disposal Site, an administrative UR was implemented. No postings or post-closure monitoring are required. (3) At CAS 04-99-01, Contaminated Surface Debris, soil and debris were removed and disposed as LLW, and debris was removed and disposed as sanitary waste. (4) At CAS 06-19-02, Waste Disposal Site/Burn Pit, no work was performed. (5) At CAS 06-19-03, Waste Disposal Trenches, a native soil cover was installed
Closure Report for Corrective Action Unit 139: Waste Disposal Sites, Nevada Test Site, Nevada
International Nuclear Information System (INIS)
2009-01-01
Corrective Action Unit (CAU) 139 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Waste Disposal Sites' and consists of the following seven Corrective Action Sites (CASs), located in Areas 3, 4, 6, and 9 of the Nevada Test Site: CAS 03-35-01, Burn Pit; CAS 04-08-02, Waste Disposal Site; CAS 04-99-01, Contaminated Surface Debris; CAS 06-19-02, Waste Disposal Site/Burn Pit; CAS 06-19-03, Waste Disposal Trenches; CAS 09-23-01, Area 9 Gravel Gertie; and CAS 09-34-01, Underground Detection Station. Closure activities were conducted from December 2008 to April 2009 according to the FFACO (1996, as amended February 2008) and the Corrective Action Plan for CAU 139 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2007b). The corrective action alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls. Closure activities are summarized. CAU 139, 'Waste Disposal Sites,' consists of seven CASs in Areas 3, 4, 6, and 9 of the NTS. The closure alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls. This CR provides a summary of completed closure activities, documentation of waste disposal, and confirmation that remediation goals were met. The following site closure activities were performed at CAU 139 as documented in this CR: (1) At CAS 03-35-01, Burn Pit, soil and debris were removed and disposed as LLW, and debris was removed and disposed as sanitary waste. (2) At CAS 04-08-02, Waste Disposal Site, an administrative UR was implemented. No postings or post-closure monitoring are required. (3) At CAS 04-99-01, Contaminated Surface Debris, soil and debris were removed and disposed as LLW, and debris was removed and disposed as sanitary waste. (4) At CAS 06-19-02, Waste Disposal Site/Burn Pit, no work was performed. (5) At CAS 06-19-03, Waste Disposal Trenches, a native soil cover was installed, and a UR was
Teacher self-efficacy in instruction and in parent involvement
Peter Gavora; Jana Majerčíková
2012-01-01
The study investigated self-efficacy of a sample of Slovak primary schoolteachers in two areas: area of instruction and area of parent involvement. Twoinstruments were used: the 16-item Slovak version of Teacher Efficacy Scale ofGibson and Dembo, and ZdUR, a 24-item scale to measure self-efficacy of teacherin parents’ involvement, developed by authors of the present study. The correlation between scores of personal teaching efficacy dimension of TES and ZdUR was 0.58 and between general teach...
Search for the production of single top quarks using the OPAL detector
Leins, Axel; Dunnweber, W.
2002-01-01
Innerhalb des sogenannten Standardmodells (SM) der Teilchenphysik ist der Prozess der Flavour-andernden neutralen Str ¨ ome (FCNC) auf Born-Niveau verboten, und nur ¨ uber Prozesse h ¨ oherer Ordnung m ¨ oglich. FCNC-Prozesse sind daher extrem unter- ¨ druckt und sehr selten. Experimentell konnte dies f ¨ ur die ersten beiden Generationen ¨ von Quarks bestatigt werden. F ¨ ur die dritte Generation, speziell f ¨ ur das Top-Quark, ¨ existieren bisher nur wenige experimentelle Erkenntnisse uber FCNC-Prozesse. Durch ¨ theoretische Erweiterungen des SM konnen, aufgrund der extrem großen Masse des ¨ Top-Quarks und der damit verbundenen Sonderstellung, FCNC-Prozesse fur Top- ¨ Quarks vorhergesagt werden, die um mehrere Großenordnungen gegen ¨ uber dem SM ¨ erhoht sind. ¨ In dieser Arbeit wird nach der Produktion einzelner Top-Quarks uber ¨ Flavourandernde neutrale Str ¨ ome mit den Daten des OPAL-Detektors am e ¨ e -Speicherring LEP gesucht. Hierzu wird im hadronischen Zerfallskanal des W-Bosons...
International Nuclear Information System (INIS)
Cerny, R.
2007-01-01
The paper is structured as follows: History of linear accelerators worldwide (beginnings); Development of the Czechoslovak high-frequency linear electron accelerator (Layout and working principle; The first model of the accelerator and the Faculty of Technical and Nuclear Physics and cooperation with the Research Institute for Vacuum Electronics (VUVET); Continuing development of the accelerator at VUVET); Construction of linear accelerators at VUVET and their application (Construction of the accelerating unit; UR 4/1200 accelerator for radiation technology tests at VUVET; UR 4PR ('LUPUR') accelerator for the Nuclear Research Institute at Rez; UR 4/1200 technological accelerator for the Nuclear Research Institute at Rez; LPR4 accelerator for the Hungarian Academy of Sciences; L 4/1200 accelerators for the Research Institute of Cables and Insulators in Bratislava, CKD Semiconductors in Prague, Animal Feed Research Institute at Ivanka pri Dunaji, and Synthesia Semtin). Appendix contains paragraphs devoted to the Accelerator Dept. staff and equipment, key accelerator spare parts, and radiation safety at the accelerator department, (P.A.)
The Later Wittgenstein and the Later Husserl on Language
Directory of Open Access Journals (Sweden)
Paul Ricoeur
2014-07-01
Full Text Available This article presents an edited version of lectures given by Paul Ricœur at Johns Hopkins University in April 1966. Ricœur offers a comparative analysis of Wittgenstein’s and Husserl’s late works, taking the problem of language as the common ground of investigation for these two central figures of phenomenology and analytic philosophy. Ricœur develops his study in two parts. The first part considers Husserl’s approach to language after the Logical Investigations and concentrates on Formal and Transcendental Logic; leaving a transcendental reflection on language behind it re-examines a phenomenological conception, according to which the sphere of logic is not separable from that of experience. The main focus of the second part is Wittgenstein’s later philosophy as it moved on from the conception of an isomorphic relation between language and the world, as set out in the picture theory in the Tractatus Logico-Philosophicus, to the more pragmatic notion of a language-game in the Philosophical Investigations. In order to get beyond the irrevocable differences between the two philosophies and the unresolved theoretical issues on both sides, Ricœur suggests turning to a semiological paradigm based on the Saussurean distinction between “language” and “speaking.” Keywords: Analytic Philosophy, Husserl, Phenomenology, Semiology, Wittgenstein.Résumé Cet article est une version éditée de conférences données par Paul Ricœur à la Johns Hopkins University en avril 1966. Ricœur propose une analyse comparée des dernières œuvres de Wittgenstein et Husserl, avec le problème du langage comme sol commun d’investigations pour ces deux figures centrales de la phénoménologie et la philosophie analytique. Cette analyse de Ricœur se joue à travers deux parties. La première partie revient sur l'approche du langage chez Husserl depuis Recherches logiques avec une attention particulière aux développements de Logique formelle et
Directory of Open Access Journals (Sweden)
Eduardo Fabian Aragón Vásquez
2003-08-01
Full Text Available Foi pesquisada a influência da suplementação com cromo (Cr sobre a concentração plasmática de cortisol, uréia, cálcio e fósforo em vacas zebu mantidas a pasto e numa situação de estresse calórico durante a estação de monta. Foram utilizadas trinta vacas primíparas com peso entre 380 e 385kg. Os animais foram divididos em grupos de 15 vacas, formando o tratamento suplementado com Cr e o tratamento não suplementado (controle. As vacas pastorearam em piquetes formados por Brachiaria brizanta cv. Marandu. A fonte de Cr foi levedura enriquecida (1g Cr kg-1 de produto comercial e foi adicionado à mistura mineral aportando 0,017% de Cr. Amostras de sangue foram tomadas em três períodos através de venipunção jugular e coletadas em tubos contendo heparina. As amostras de plasma foram analisadas para fósforo, cálcio, uréia e cortisol. Os dados foram analisados como um desenho de blocos ao acaso. O consumo médio diário de mistura mineral foi de 72,92g no grupo suplementado com Cr (12,40mg Cr/cabeça/dia e 77,84g no grupo controle (0,78mg Cr/cabeça/dia. A concentração plasmática de cortisol, no grupo suplementado com Cr, foi menor que no tratamento controle (2,11mg dl-1 vs. 3,29mg dl-1. As concentrações plasmáticas de fósforo (6,36mg dl-1 vs 3,56mg dl-1 e de cálcio (12,87mg dl-1 vs 9,02mg dl-1 foram maiores no grupo suplementado com Cr durante o primeiro período, mas não existiram diferenças no segundo e terceiro períodos de colheita. Os níveis plasmáticos de uréia (17,13mg dl-1 vs. 17,70mg dl-1 não foram diferentes entre os grupos experimentais.The influence of supplemental chromium (Cr on plasma cortisol, urea, calcium and phosphorus concentration were investigated in grazing cattle in caloric stress situation during the breeding season. Thirty primiparous zebu cows with 380 to 385kg of body weight were assigned to the following treatments: 15 cows fed supplemental Cr and 15 cows without supplemental Cr (Control
Ribeiro, Reginaldo Vicente; Bieski, Isanete Geraldini Costa; Balogun, Sikiru Olaitan; Martins, Domingos Tabajara de Oliveira
2017-06-09
Currently, in many traditional communities, such as the riverine community in the North Araguaia microregion (Mato Grosso, Brazil), plant knowledge and use represent the main, if not the only, therapeutic resource for the maintenance of health and/or treatment of diseases. This study aimed to identify and document species of medicinal plants used by local experts from riverine communities in the North Araguaia microregion in Mato Grosso State, and to further chemical and pharmacological studies on species selected based on searches in the relevant literature. This is a cross-sectional ethnobotanical study, with non-probabilistic sampling (n =60), that applied the snowball method to select local riverine experts who understand medicinal plant use. Socio-demographic, ethnobotanical and ethnopharmacological data (vernacular name, uses, geographical origin, habit, method of preparation and part used) on medicinal plants were collected during semi-structured interviews. The results were analyzed by descriptive and quantitative means: indices of use-report (UR) were used to select plant species with therapeutic potential. In total, 309 plant species belonging to 86 botanical families were cited; 73% were native to Brazil, and Fabaceae was the most representative family (11.3%). Arboreal was the predominant life form (37.2%). The leaf was the most used part (28.9%). Infusion was the most commonly reported method of preparation (31.3%). The plants reported in the survey were indicated for 18 of the 22 ICD-10 disease categories. The disease categories most commonly cited were the infectious and parasitic diseases (IPD, 718 UR), digestive system diseases (DSD, 565 UR) and respiratory system diseases (RSD, 504 UR), representing 16.6%, 13.1% and 11.7%, respectively of the total UR. Dysphania ambrosioides L. was the most sighted in the IPD category 50 UR. Copaifera langsdorffii Desf. (133), Lafoensia pacari A. St.-Hil. (131), and Cecropia pachystachya Trécul (126) were the
Directory of Open Access Journals (Sweden)
Ricardo Andrade Reis
2001-06-01
Full Text Available O experimento foi conduzido para se avaliarem as alterações na composição química e na digestibilidade in vitro da matéria seca (DIVMS dos fenos de Brachiaria decumbens Stapf, Brachiaria brizantha (Hochst ex. A. Rich Stapf e jaraguá (Hyparrhenia rufa Ness Stapf, colhidos no estádio de maturação das sementes e tratados com amônia anidra (3,0% MS ou uréia (5,4% MS. A análise dos dados demonstra que a amonização diminuiu os conteúdos de FDN e hemicelulose com a mesma eficiência. Os tratamentos químicos não alteraram os teores de FDA, celulose e lignina. Observou-se aumento nos teores de compostos nitrogenados, como N total e N insolúvel em detergente ácido (NIDA em resposta à amonização. A relação NIDA/NT diminuiu com a amonização, aumentando a quantidade de N disponível para a digestão. A DIVMS aumentou em resposta às alterações observadas na composição química da fração fibrosa e incremento no conteúdo de N prontamente digestível dos fenos tratados.The experiment was conducted to evaluate the changes on the chemical composition and in vitro dry matter digestibility (IVDMD of the Brachiaria decumbens Stapf, Brachiaria brizantha (Hochst ex. A. Rich Stapf, jaragua (Hyparrhenia rufa Ness Stapf hays, harvested following the seed ripening stage and treated with anhydrous ammonia (3.0% DM or urea (5.4% DM. The data showed that anhydrous ammonia and urea decreased NDF and hemicellulose contents with the same efficiency. The treatments did not change ADF, cellulose, and lignin contents. It was observed an increase in the nitrogen as compounds, TN and ADIN due to the ammoniation. The ADIN/TN ratio was reduced due to the ammoniation. The IVDMD increased due to the changes observed in the chemical composition of the fiber, and the increase of the readily digestible nitrogen of the hays.
A GAME THEORETIC ANALYSIS OF U.S. RICE EXPORT POLICY: THE CASE OF JAPAN AND KOREA
Lee, Dae-Seob; Kennedy, P. Lynn
2002-01-01
As a result of the Uruguay Round (UR), the impact on the international rice market is dramatic.The major U.S. benefit of the UR has been the access to the Japanese market. However, the U.S. share of this import market has been unstable and the share of Korean rice market is nearly zero prior to February 2002. Econometric estimation and Political Preference Function (PPF) approach are incorporated into a game theoretic analysis to analyze U.S. export potential to Japan and Korea.
ZADOVOLJSTVO ZAPOSLENIH NA NAJEMNEM BENCINSKEM SERVISU PETROL D.D.
Ravnihar, Petra
2010-01-01
Namen diplomske naloge je ugotoviti zadovoljstvo zaposlenih na najemnem bencinskem servisu Šenčur. Za celovit prikaz je predstavljeno podjetje Petrol d. d. kot celota, njihova vizija za prihodnost ter delovanje posameznih franšiz, kamor spada tudi najemni servis Šenčur. Zaposleni lahko predstavljajo za podjetja konkurenčno prednost. Upravljanje človeških virov in zavedanje o potrebi po tem lahko pomeni odločilno prednost določenega podjetja. V današnjem času zgolj upravljanje organizacij n...
International Nuclear Information System (INIS)
Lee Jialing; Klase, Zachary; Gao Xiaoqi; Caldwell, Jeremy S.; Stinski, Mark F.; Kashanchi, Fatah; Chao, S.-H.
2007-01-01
An AT-rich region of the human cytomegalovirus (CMV) genome between the UL127 open reading frame and the major immediate-early (MIE) enhancer is referred to as the unique region (UR). It has been shown that the UR represses activation of transcription from the UL127 promoter and functions as a boundary between the divergent UL127 and MIE genes during human CMV infection [Angulo, A., Kerry, D., Huang, H., Borst, E.M., Razinsky, A., Wu, J., Hobom, U., Messerle, M., Ghazal, P., 2000. Identification of a boundary domain adjacent to the potent human cytomegalovirus enhancer that represses transcription of the divergent UL127 promoter. J. Virol. 74 (6), 2826-2839; Lundquist, C.A., Meier, J.L., Stinski, M.F., 1999. A strong negative transcriptional regulatory region between the human cytomegalovirus UL127 gene and the major immediate-early enhancer. J. Virol. 73 (11), 9039-9052]. A putative forkhead box-like (FOX-like) site, AAATCAATATT, was identified in the UR and found to play a key role in repression of the UL127 promoter in recombinant virus-infected cells [Lashmit, P.E., Lundquist, C.A., Meier, J.L., Stinski, M.F., 2004. Cellular repressor inhibits human cytomegalovirus transcription from the UL127 promoter. J. Virol. 78 (10), 5113-5123]. However, the cellular factors which associate with the UR and FOX-like region remain to be determined. We reported previously that pancreatic-duodenal homeobox factor-1 (PDX1) bound to a 45-bp element located within the UR [Chao, S.H., Harada, J.N., Hyndman, F., Gao, X., Nelson, C.G., Chanda, S.K., Caldwell, J.S., 2004. PDX1, a Cellular Homeoprotein, Binds to and Regulates the Activity of Human Cytomegalovirus Immediate Early Promoter. J. Biol. Chem. 279 (16), 16111-16120]. Here we demonstrate that two additional cellular homeoproteins, special AT-rich sequence binding protein 1 (SATB1) and CCAAT displacement protein (CDP), bind to the human CMV UR in vitro and in vivo. Furthermore, CDP is identified as a FOX-like binding protein
Directory of Open Access Journals (Sweden)
Jean-Luc Amalric
2014-07-01
Full Text Available The aim of this article is to analyse the meaning and the implications of the comparative interpretation of Sartre’s and Ryle’s theses on imagination that Ricœur undertook in the still unpublished text of his Lectures on Imagination. These lectures were delivered at the University of Chicago in 1975. First, the article shows how Ricœur brings out a strong convergence, both in the method and in the presuppositions, of the Sartrean and Rylean conceptions of imagination : the choice of a descriptive method leads the two philosophers to a common critique of the mental image. Secondly, the article analyses the properly critical side of the Ricœurian interpretation by showing how it eventually brings to light the common theoretical limitation of Sartre’s and Ryle’s theses on imagination. According to Ricœur, those theses lead to a conception of image as picture and fail to consider the image as fiction, and so they remain locked in a theory of reproductive imagination and of the primacy of perception.RésuméCet article se propose d’analyser le sens et les enjeux de la lecture croisée des thèses de Sartre et Ryle sur l’imagination à laquelle se livre Ricœur dans le texte encore inédit des Lectures on imagination professées en 1975 à l’Université de Chicago. Dans un premier temps, il montre comment Ricœur met en relief une convergence forte, de méthode et de présupposés entre les conceptions sartrienne et rylienne de l’imagination : le choix d’une méthode descriptive conduisant les deux philosophes à une commune critique de l’image mentale. Puis, dans un second temps, il analyse le versant proprement critique de la lecture ricœurienne en montrant comment elle en vient à dénoncer une commune limitation théorique des thèses de Sartre et Ryle sur l’imagination. Selon Ricœur, ces thèses débouchent sur une conception de l’image comme tableau qui échoue à penser l’image comme fiction et elles restent
Due tavolette neo-sumeriche di ricevute di orzo e di argento
Directory of Open Access Journals (Sweden)
Pomponio, Francesco
2004-12-01
Full Text Available The two Neo-Sumerian texts from the British Museum published here have to be added to the dossier of Ur-Bau, a moneylender of unknown origin. In the first tablet a certain Šeškalla receives silver for one-month harvest work as well as barley on loan. In the second text, the same Šeškalla receives from Ur-Bau an amount of barley, in this case probably also on loan, at the unusually high value of 210 sìla for 1 shekel of silver, the usual value being 300 sìla for 1 shekel.
Los dos textos neo-sumerios del British Museum que aquí se editan se suman a los que conforman el dossier de documentos del prestamista Ur-Bau, de origen desconocido. En la primera tablilla, un tal Šeškalla recibe una cantidad de plata para un trabajo de recolección por un mes, además de una cantidad de cebada en préstamo. En la segunda, el mismo Šeškalla recibe de Ur-Bau una cantidad de cebada, también probablemente en este caso como préstamo, al poco habitual y elevado precio de 210 sìla por siclo de plata, en lugar del valor más normal de 300 sìla por siclo de plata.
Xie, Shuanglu; Shi, Yuanyuan; Wang, Yixiang; Wu, Chunyong; Liu, Wenyuan; Feng, Feng; Xie, Ning
2013-01-01
Uncaria rhynchophylla (UR) is a species of Uncaria that is distributed mainly in China and Japan. In this study, the chemical constituents, including alkaloids, flavonoids, and quinic acids, in UR have been systematically identified and quantified by a developed method of high-performance liquid chromatography coupled with diode-array detection and quadrupole time-of-flight mass spectrometry (Q-TOF-MS). Tetracyclic monoterpenoid oxindole alkaloids (TMOAs) are characteristic compounds in this herb, and their fragmentations in Q-TOF-MS have been investigated. Diagnostic fragmentation ions (DFIs) were first delineated for isorhynchophylline-type (7S, C20-ethyl) and corynoxeine-type (7R, C20-vinyl) TMOAs, and these were used for identification of these alkaloids in UR. In this study, a total of 29 compounds, comprising 18 alkaloids, six flavonoids, and five quinic acids, were identified. Among them, there are four novel TMOAs, named as 22-O-β-glucopyranosyl isorhynchophyllic acid (10), 22-O-β-glucopyranosyl rhynchophyllic acid (11), 9-hydroxy isocorynoxeine (16), and 9-hydroxy corynoxeine (20), which have not been reported previously. Furthermore, eight marker compounds, namely chlorogenic acid (3), catechin (8), epicatechin (9), isocorynoxeine (24), rhynchophylline (25), isorhynchophylline (27), vincoside lactam (28), and corynoxeine (29), have been simultaneously quantified. The developed method has been validated and successfully applied to analyze three samples of UR from Jiangxi Province. The contents of the marker compounds have been detected and compared. Copyright © 2013 Elsevier B.V. All rights reserved.
Tillit till externa projektledare ur projektdeltagares perspektiv
Sundgren, Patrik; Bärneman, Sara
2014-01-01
The motivation to conduct the study was that external project managers have become more common the last decades. At the same time trust is considered to be a key factor for efficiency and good results for the organisation. The group members’ trust in the leader is built on past experiences of both the leader at a personal level, and the leaders’ relationship to the task. Trust can also be built over time, when the leader earns trust from the group members. Those conditions make it hard for ex...
Bonussystem -Sett ur anställdas perspektiv-
Ilhed, Markus; Nilsson, Sofie
2004-01-01
Background: Different forms of reward systems have been more common in Sweden and are used in purpose to motivate employees to work in accordance with a company’s goals. By creating work motivation among the employees, a more congruent situation can appear between them and the managers, and the company can perform better results. Purpose: The purpose with this thesis is to study and analyse a reward system from the employees perspective, regarding it’s affect on work motivation. Demarcation...
Directory of Open Access Journals (Sweden)
Mariana A. Rivero
2004-08-01
Full Text Available El síndrome urémico hemolítico (SUH.es un desorden multisistémico caracterizado por presentar insuficiencia renal aguda, anemia hemolítica microangiopática y trombocitopenia. Constituye la principal causa de insuficiencia renal aguda y la segunda causa de insuficiencia renal crónica y de transplante renal en niños en la Argentina. Actualmente, nuestro país presenta el registro más alto de SUH en todo el mundo, con aproximadamente 420 casos nuevos declarados anualmente y una incidencia de 12.2/100 000 niños menores de 5 años de edad. Se reconocen múltiples agentes etiológicos, aunque se considera a la infección por Escherichia coli enterohemorrágica (EHEC como la principal etiología de SUH. La gran mayoría de brotes epidémicos y casos esporádicos en humanos se han asociado con el serotipo O157:H7, aunque otros serotipos han sido también aislados, y éstos son un subgrupo de E. coli verocitotoxigénico (VTEC..El bovino es considerado el principal reservorio de VTEC. El contagio al hombre frecuentemente se debe al consumo de alimentos cárneos y lácteos contaminados, deficientemente cocidos o sin pasteurizar, o al contacto directo con los animales o con sus heces, consumo de agua, frutas o verduras contaminadas. También puede producirse contagio mediante el contacto interhumano.The hemolytic-uremic syndrome (HUS is a multisystemic disorder that is characterized by the onset of acute renal failure, microangiopathic hemolytic anemia and thrombocytopenia. It is the most common cause of acute renal failure and the second cause of chronic renal failure and renal transplantation in children in Argentina. Our country has the highest incidence of HUS in the world, with approximately 420 new cases observed each year with an incidence of 12.2 cases per 100 000 children in the age group 0-5 years. Numerous etiologic factors have been associated with HUS but the infection with enterohemorrhagic Escherichia coli (EHEC is considered the
La riqueza del narcotráfico y la desigualdad en Colombia, 1976-2012
Ricardo Rocha García
2014-01-01
Buscando comprender la trascendencia económica del narcotráfico sobre la concentración del ingreso en Colombia, se estima la magnitud de la repatriación de riqueza del narcotráfico (W) desde la mitad de la década de los setenta, considerando las Utilidades Repatriables (UR) y su absorción mediante Flujos de Capitales Encubiertos (FCE), a través del contrabando, la sobre/subfacturación del comercio y la inversión extranjera originada en paraísos fiscales. Las UR se calculan contablemente utili...
International Nuclear Information System (INIS)
March, Norman H.; Akbari, Ali; Rubio, Angel
2007-01-01
For arbitrary interparticle interaction u(r 12 ), the model two-electron atom in the title is shown to be such that the ground-state electron density ρ(r) is determined uniquely by the correlated kinetic energy density t R (r) of the relative motion. Explicit results for t R (r) are presented for the Hookean atom with force constant k=1/4, and also for u(r 12 )=(λ)/(r 12 2 ) . Possible relevance of the Hookean atom treatment to the ground state of the helium atom itself is briefly discussed
Seismic damage assessment for high-rise buildings
Scholl, Roger E.
1980-01-01
The problem considered in this project, conducted by URS/John A. Blume & Associates, Engineers (URS/Blume), for the U.S. Geological Survey, is the identification, evaluation, and correlation of ground-motion and structural parameters in order to improve procedures for predicting dollar losses for high-rise structures damaged by earthquakes. Ground-motion data bases, analytical techniques, and known motion-damage relationships already developed for high-rise buildings and for other classes of structures will be refined and extended so that reliable quantitative seismic risk evaluations can be made.
Pakola Monsen, Rebecca
2013-01-01
Det är inget nytt att undersöka interaktioner på Facebook, dock är det oftast ur privatpersoners synvinkel Facebook undersöks och inte lika ofta ur en organisations synvinkel. Den här studien syftar till att fylla en del av gapet i medie- och kommunikationsforskningen om hur ideella organisationer beter sig på Facebook genom att undersöka den narrativa processen hos två ideella organisationer och hur delaktiga användare är i organisationernas berättelse beroende på organisationens storlek, Kv...
Total-Count Calibration Blocks for use in uranium Exploration
DEFF Research Database (Denmark)
Løvborg, Leif
Transportable calibration blocks for field scintillometers and borehole probes were manufactured from concrete and installed at calibration sites in Denmark and Greece. The concrete mixes were prepared from aggregates of quartz sand and crushed uranium-thorium ore. Hater-reducing agents and silica...... dust added to the cement paste produced concretes of acceptable porosity and pore structure. The content of ore was adjusted to provide block grades of approximately 2, 140, and 540 units of radioelement concentration (Ur). Thorium was estimated to contribute 0.39 ± 0.02 Ur per ppm Th. The adopted...
Maria Aparecida Schenki; Cláudio Roberto Madruga; Aguemi Kohayagawa; Carla Lopes Mendonça; Dirson Vieira; Raul Kessler
2006-01-01
Avaliaram-se a parasitemia, o hematócrito e os níveis séricos de bilirrubina total, creatinina, uréia e colesterol de bezerros Nelore (Bos indicus) inoculados com isolados de Babesia bigemina das cinco regiões fisiográficas do Brasil. Constatou-se que os diferentes isolados desenvolveram baixa parasitemia, nos animais experimentalmente inoculados, diminuição do colesterol sérico, e que não houve variações nos níveis de bilirrubina, creatinina e uréia sérica. PALAVRAS-CHAVE: Bos indicus, ...
In memoriam: PROF. DR. BOŽIDAR ĆURČIĆ (1946-2015)
Dimitrijević, Rajko
2015-01-01
Professor Dr. Božidar Ćurčić was born on 3rd July 1946 in Belgrade. After graduating at the Faculty of Science (Biology), University of Belgrade, in 1969, his career at the university began where he spent 44 years teaching and conducting scientific research. It is a difficult task to encapsulate almost five decades of a person’s fruitful scientific research and teaching activity. Professor Ćurčić succeeded in both areas, leaving behind a vast opus of scientific achievements, and several y...
Invariance analysis and conservation laws of the wave equation on ...
Indian Academy of Sciences (India)
in [7], the more interesting case being the latter since these lead to conservation laws via ... obtained and, hence, more conservation laws are classified. .... −2r2 sin θurt − 2r sin θut + 2r sin θ. (. 1 −. 2t r. ) ur + 2t sin θur. +r2 sin θ. (. 1 −. 2t r. ) urr + cos θuθ + sin θuθθ = 0,. (15) and then ¯X2 = u∂u + t∂t + r∂r leads to dt t. = dr.
Zhang, Jing Sheng; Wang, Chang Quan; Li, Bing; Liang, Jing Yue; He, Jie; Xiang, Hao; Yin, Bin; Luo, Jing
2017-06-18
A field experiment was conducted to investigate the effect of controlled-release fertilizer (CRF) combined with urea (UR) on the soil fertility and environment in wheat-rice rotation system. Changes in four forms of nitrogen (total nitrogen, ammonium nitrogen, nitrate nitrogen, and microbial biomass nitrogen) and in activities of three soil enzymes participating in nitrogen transformation (urease, protease, and nitrate reductase) were measured in seven fertilization treatments (no fertilization, routine fertilization, 10%CRF+90%UR, 20%CRF+80%UR, 40%CRF+60%UR, 80%CRF+20%UR, and 100%CRF). The results showed that soil total nitrogen was stable in the whole growth period of wheat and rice. There was no significant difference among the treatments of over 20% CRF in soil total nitrogen content of wheat and rice. The soil inorganic nitrogen content was increased dramatically in treatments of 40% or above CRF during the mid-late growing stages of wheat and rice. With the advance of the growth period, conventional fertilization significantly decreased soil microbial biomass nitrogen, but the treatments of 40% and above CRF increased the soil microbial biomass nitrogen significantly. The soil enzyme activities were increased with over 40% of CRF in the mid-late growing stage of wheat and rice. By increasing the CRF ratio, the soil protease activity and nitrate reductase activity were improved gradually, and peaked in 100% CRF. The treatments of above 20% CRF could decrease the urease activity in tillering stage of rice and delay the peak of ammonium nitrogen, which would benefit nitrogen loss reduction. The treatments of 40% and above CRF were beneficial to improving soil nitrogen supply and enhancing soil urease and protease activities, which could promote the effectiveness of nitrogen during the later growth stages of wheat and rice. The 100% CRF treatment improved the nitrate reductase activity significantly during the later stage of wheat and rice. Compared with the
Stable isotope deltas: Tiny, yet robust signatures in nature
Brand, Willi A.; Coplen, Tyler B.
2012-01-01
Although most of them are relatively small, stable isotope deltas of naturally occurring substances are robust and enable workers in anthropology, atmospheric sciences, biology, chemistry, environmental sciences, food and drug authentication, forensic science, geochemistry, geology, oceanography, and paleoclimatology to study a variety of topics. Two fundamental processes explain the stable isotope deltas measured in most terrestrial systems: isotopic fractionation and isotope mixing. Isotopic fractionation is the result of equilibrium or kinetic physicochemical processes that fractionate isotopes because of small differences in physical or chemical properties of molecular species having different isotopes. It is shown that the mixing of radioactive and stable isotope end members can be modelled to provide information on many natural processes, including 14C abundances in the modern atmosphere and the stable hydrogen and oxygen isotopic compositions of the oceans during glacial and interglacial times. The calculation of mixing fractions using isotope balance equations with isotope deltas can be substantially in error when substances with high concentrations of heavy isotopes (e.g. 13C, 2H, and 18O ) are mixed. In such cases, calculations using mole fractions are preferred as they produce accurate mixing fractions. Isotope deltas are dimensionless quantities. In the International System of Units (SI), these quantities have the unit 1 and the usual list of prefixes is not applicable. To overcome traditional limitations with expressing orders of magnitude differences in isotope deltas, we propose the term urey (symbol Ur), after Harold C. Urey, for the unit 1. In such a manner, an isotope delta value expressed traditionally as−25 per mil can be written as−25 mUr (or−2.5 cUr or−0.25 dUr; the use of any SI prefix is possible). Likewise, very small isotopic differences often expressed in per meg ‘units’ are easily included (e.g. either+0.015 ‰ or+15 per meg
Directory of Open Access Journals (Sweden)
F.C.F. Lopes
2002-04-01
Full Text Available Em delineamento inteiramente ao acaso, estudou-se o efeito da defaunação em ovinos que receberam cana-de-açúcar e uréia sobre o consumo e digestibilidade aparente de nutrientes, dinâmica da fase sólida, parâmetros de fermentação ruminal e de degradação in situ. As taxas de passagem no rúmen foram, respectivamente, de 3,05 e 1,97%/h, para ovinos faunados e defaunados. Valores mais elevados para taxa (5,4%/h e extensão (46,7% da digestão ruminal e de degradabilidade efetiva da FDN da cana (31,5% foram obtidos nos ovinos faunados. Seus consumos diários (57,7 e 32,3 g/kg0,75, respectivamente para MS e FDN foram superiores (PThe defaunation effect on feed intake, nutrient apparent digestibilities, solid phase dynamics, ruminal fermentation parameters and in situ degradation in sheep fed on sugar cane plus urea was studied in a completely randomized design with three replicates. Ruminal passage rates of 3.05 and 1.97%/h were observed for the faunated and defaunated groups, respectively. Higher values for sugar cane NDF ruminal digestion rate (5.41%/h, extension (46.7% and effective degradability (31.53% were observed for the faunated group. The faunated group daily intake (57.7 and 32.3 g/kg0.75 for dry matter and NDF residue, respectively was higher (P<0.06 than that for the defaunated group. Total VFA, acetate and propionate concentrations were higher (P<0.05 in the faunated group and were dependent on sampling time. Defaunated sheep showed higher (P<0.04 post prandial decrease in pH. Relative to apparent digestibility difference (P<0.05 between treatments was observed only for dry matter.
Resistivity switching properties of Li-doped ZnO films deposited on LaB_6 electrode
International Nuclear Information System (INIS)
Igityan, A.; Kafadaryan, Y.; Aghamalyan, N.; Petrosyan, S.; Badalyan, G.; Vardanyan, V.; Nersisyan, M.; Hovsepyan, R.; Palagushkin, A.; Kryzhanovsky, B.
2015-01-01
Current–voltage (I–V) characteristics of Al/p-ZnO:Li/LaB_6 device, measured in voltage sweep mode, show unipolar resistive switching and monostable threshold switching (URS and MTS) for different bias voltage polarities. URS could be transformed to MTS by application of reverse bias voltage. With increasing number of cycles, URS is converted to bipolar resistive switching mode which is lost after certain number of cycles, and device turns into an ordinary resistor. Analysis of linear fitting I–V curves suggests that ohmic and space charge limited current laws are responsible for conductivity mechanism of Al/p-ZnO:Li/LaB_6 device. - Highlights: • Al/p-ZnO:Li/LaB_6 memristive device is fabricated using an e-beam evaporation technique. • Current–voltage (I–V) characteristics are studied. • Type of resistive switching mode depends on the bias voltage polarity and number of switching cycles. • Resistive switching in Al/ZnO:Li/LaB_6 has an interfacial effect. • Ohmic and SCLC laws are responsible for conductivity mechanism of resistive states.
The effects of unilateral and bilateral ECT on verbal and visual spatial memory.
Jackson, B
1978-01-01
Investigated the effects of unilateral left (UL), unilateral right (UR), and bilateral (B) ECT on the performance of right-handed male patients on the Wechsler Memory Scale and two tests of the Williams battery, which provided eight independent measures of verbal memory and two of visual-spatial memory. Patients were tested three times: (1) within 1 week prior to ECT; (2) within 30 minutes after the sixth ECT; (3) 10 days after the sixty ECT. Double blind procedures were maintained carefully. Results showed a significant loss on second testing followed by a significant improvement 10 days later for all ECT groups compared with matched controls. There was some tendency for the UR group to show the least impairment on verbal measures and the UL group to show the least impairment on visual-spatial memory test of the WMS, but most of the differences between UL and UR groups and between each of these and the B group were not significant. The most sensitive test in differentiating among the ECT groups was the brief Verbal Learning subtest of the Williams battery.
VIGOR DAS SEMENTES DE Apeiba tibourbou Aubl. SOB DIFRENTES CONDIÇÕES DE ARMAZENAMENTO E EMBALAGENS
Directory of Open Access Journals (Sweden)
Elane Grazielle Borba de Sousa Ferreira
2010-01-01
Full Text Available This study had the objective of evaluating the vigor of Apeiba tibourbou seeds submitted to different storage and packaging conditions, during 225 days. After processing, the Apeiba tibourbou seeds were conditioned in the following packages: transparent glass containers, Kraft paper bags and transparent polyethylene bags and stored under the following conditions: room temperature in a laboratory (24.8ºC to 28ºC; UR 68.9 to 82.5%, in a freezer (-20ºC; UR 90% and in a chamber (18.5 ± 1ºC; UR 71 ± 3%. At the beginning and every 45 days, during 225 days of storage, the seed moisture content was determined and a vigor test was carried out (percentage and index of speed of emergence, length (cm and dry weight matter (mg of seedling. Among the storage conditions studied, the most suitable for conservation of Apeiba tibourbou seeds for 180 days, with less loss of vigor was the natural environment of the laboratory, when using the polyethylene bag packaging.
Moufid, Kamal; Abbaka, Najib; Touiti, Driss; Adermouch, Latifa; Amine, Mohamed; Lezrek, Mohammed
2013-07-01
The treatment for patients with large impacted proximal ureteral stone remains controversial, especially at institutions with limited resources. The aim of this study is to compare and to evaluate the outcome and complications of two main treatment procedures for impacted proximal ureteral calculi, retrograde ureterolithotripsy (URS), and percutaneous antegrade ureterolithotripsy (Perc-URS). Our inclusion criteria were solitary, radiopaque calculi, >15 mm in size in a functioning renal unit. Only those patients in whom the attempt at passing a guidewire or catheter beyond the calculus failed were included in this study. Between January 2007 and July 2011, a total of 52 patients (13 women and 39 men) with large impacted upper-ureteral calculi >15 mm and meeting the inclusion criteria were selected. Of these, Perc-URS was done in 22 patients (group 1) while retrograde ureteroscopy was performed in 30 patients (group 2). We analyzed operative time, incidence of complications during and after surgery, the number of postoperative recovery days, median total costs associated per patient per procedure, and the stone-free rate immediately after 5 days and after 1 month. Bivariate analysis used the Student t-test and the Mann-Whitney test to compare two means and Chi-square and Fisher's exact tests to compare two percentages. The significance level was set at 0.05. The mean age was 42.3 years (range 22-69). The mean stone sizes (mm) were 34 ± 1.2 and 29.3 ± 1.8 mm in group 1 and 2, respectively. In the Perc-URS group, 21 patients (95.45%) had complete calculus clearance through a single tract in one session of percutaneous surgery, whereas in the URS group, only 20 patients (66.7%) had complete stone clearance (P = 0.007). The mean operative time was higher in the Perc-URS group compared to group 2 (66.5 ± 21.7 vs. 52.13 ± 17.3 min, respectively; P = 0.013). Complications encountered in group 1 included transient postoperative fever (2 pts) and simple urine outflow (2
A Novel PCR Assay for Detecting Brucella abortus and Brucella melitensis.
Alamian, Saeed; Esmaelizad, Majid; Zahraei, Taghi; Etemadi, Afshar; Mohammadi, Mohsen; Afshar, Davoud; Ghaderi, Soheila
2017-02-01
Brucellosis is a major zoonotic disease that poses a significant public health threat worldwide. The classical bacteriological detection process used to identify Brucella spp. is difficult and time-consuming. This study aimed to develop a novel molecular assay for detecting brucellosis. All complete sequences of chromosome 1 with 2.1-Mbp lengths were compared among all available Brucella sequences. A unique repeat sequence (URS) locus on chromosome 1 could differentiate Brucella abortus from Brucella melitensis . A primer set was designed to flank the unique locus. A total of 136 lymph nodes and blood samples were evaluated and classified by the URS-polymerase chain reaction (PCR) method in 2013-2014. Biochemical tests and bacteriophage typing as the golden standard indicated that all Brucella spp. isolates were B. melitensis biovar 1 and B. abortus biovar 3. The PCR results were the same as the bacteriological method for detecting Brucella spp. The sensitivity and specificity of the URS-PCR method make it suitable for detecting B. abortus and B. melitensis . Quick detection of B. abortus and B. melitensis can provide the most effective strategies for control of these bacteria. The advantage of this method over other presented methods is that both B. abortus and B. melitensis are detectable in a single test tube. Furthermore, this method covered 100% of all B. melitensis and B. abortus biotypes. The development of this URS-PCR method is the first step toward the development of a novel kit for the molecular identification of B. abortus and B. melitensis .
Lukishova, Svetlana G.; Zavestovskaya, Irina N.; Zhang, Xi-Cheng; Aleshchenko, Yury A.; Konov, Vitaly I.
2017-08-01
A collaboration in education between the oldest and one of the most comprehensive Optics schools in U.S., the Institute of Optics (IO), University of Rochester (UR), and one of the most recognized Russian university, National Research Nuclear University MEPhI (Moscow Engineering Physics Institute) was started in 2015 by signing an agreement on a double-Master's degree program in optics. It was based on earlier collaboration between research groups in both universities. In summer of 2016, nine UR Optics undergraduate students participated with MEPhI students at the International School on Optics and Laser Physics in MEPhI. During five days they were immersed into the world of cutting edge research, technologies and ideas that Russian, European and U.S. scientists offered them. This School also included tours of MEPhI Nanotechnologies and Lasers Centers and Nano-bioengineering Laboratory as well as of scientific laboratories of the leading institutes in optics, photonics and laser physics of the Russian Academy of Sciences. In December of 2015, one MEPhI Master student visited IO UR for one month for a research project with results presented later at a MEPhI conference. Samples prepared by MEPhI researchers are used in IO students teaching laboratories. One Master student from MEPhI is working now towards the Master's degree at the IO UR. In this paper benefits and pitfalls of a cross-border collaboration are discussed as well as different directions of such a collaboration to provide a high-quality specialization for the students of the 21 century which includes international cooperation.
Hoshi, Akio; Tamaki, Tetsuro; Tono, Kayoko; Okada, Yoshinori; Akatsuka, Akira; Usui, Yukio; Terachi, Toshiro
2008-06-15
Postoperative damage of the urethral rhabdosphincter (URS) and neurovascular bundle (NVB) is a major operative complication of radical prostatectomy. It is generally recognized to be caused by unavoidable surgical damage to the muscle-nerve-blood vessel units around the urethra. We attempted to treat this damage using skeletal muscle-derived stem cells, which are able to reconstitute muscle-nerve-blood vessel units. Cells were enzymatically extracted and sorted by flow cytometry as CD34/45 (Sk-34) and CD34/45 (Sk-DN) cells from green fluorescent protein transgenic mice and rats. URS-NVB damage was induced by manually removing one-third of the total URS and unilateral invasion of NVB in wild-type Sprague-Dawley and node rats. Freshly isolated Sk-34, Sk-34+Sk-DN cells, and cultured Sk-DN cells were directly transplanted into the damaged portion. At 4 and 12 weeks after transplantation, urethral pressure profile by electrical stimulation through the sacral surface (L6-S1) was evaluated as functional recovery. The recovery ratio in the control and transplanted groups was 37.6% and 72.9%, at 4 weeks, and 41.6% and 78.4% at 12 weeks, respectively (Pcells differentiated into numerous skeletal muscle fibers having neuromuscular junctions (innervation) and nerve bundle-related Schwann cells and perineurium, and blood vessel-related endothelial cells and pericyte around the urethra. Thus, we conclude that transplantation of skeletal muscle-derived multipotent Sk-34 and Sk-DN cells is potentially useful for the reconstitution of postoperative damage of URS and NVB after radical prostatectomy.
Population-level impact of active tuberculosis case finding in an Asian megacity.
Directory of Open Access Journals (Sweden)
David W Dowdy
Full Text Available BACKGROUND: The potential population-level impact of private-sector initiatives for tuberculosis (TB case finding in Southeast Asia remains uncertain. In 2011, the Indus Hospital TB Control Program in Karachi, Pakistan, undertook an aggressive case-finding campaign that doubled notification rates, providing an opportunity to investigate potential population-level effects. METHODS: We constructed an age-structured compartmental model of TB in the intervention area. We fit the model using field and literature data, assuming that TB incidence equaled the estimated nationwide incidence in Pakistan (primary analysis, or 1.5 times greater (high-incidence scenario. We modeled the intervention as an increase in the rate of formal-sector TB diagnosis and evaluated the potential impact of sustaining this rate for five years. RESULTS: In the primary analysis, the five-year intervention averted 24% (95% uncertainty range, UR: 18-30% of five-year cumulative TB cases and 52% (95% UR: 45-57% of cumulative TB deaths. Corresponding reductions in the high-incidence scenario were 12% (95% UR: 8-17% and 27% (95% UR: 21-34%, although the absolute number of lives saved was higher. At the end of five years, TB notification rates in the primary analysis were below their 2010 baseline, incidence had dropped by 45%, and annual mortality had fallen by 72%. About half of the cumulative impact on incidence and mortality could be achieved with a one-year intervention. CONCLUSIONS: Sustained, multifaceted, and innovative approaches to TB case-finding in Asian megacities can have substantial community-wide epidemiological impact.
Directory of Open Access Journals (Sweden)
Shashikant Mishra
2011-01-01
Full Text Available Objective: We performed a comparative study of high-fidelity training models for flexible ureteroscopy (URS. Our objective was to determine whether high-fidelity non-virtual reality (VR models are as effective as the VR model in teaching flexible URS skills. Materials and Methods: Twenty-one trained urologists without clinical experience of flexible URS underwent dry lab simulation practice. After a warm-up period of 2 h, tasks were performed on a high-fidelity non-VR (Uro-scopic Trainer TM ; Endo-Urologie-Modell TM and a high-fidelity VR model (URO Mentor TM . The participants were divided equally into three batches with rotation on each of the three stations for 30 min. Performance of the trainees was evaluated by an expert ureteroscopist using pass rating and global rating score (GRS. The participants rated a face validity questionnaire at the end of each session. Results: The GRS improved statistically at evaluation performed after second rotation (P<0.001 for batches 1, 2 and 3. Pass ratings also improved significantly for all training models when the third and first rotations were compared (P<0.05. The batch that was trained on the VR-based model had more improvement on pass ratings on second rotation but could not achieve statistical significance. Most of the realistic domains were higher for a VR model as compared with the non-VR model, except the realism of the flexible endoscope. Conclusions: All the models used for training flexible URS were effective in increasing the GRS and pass ratings irrespective of the VR status.
Radiation exposure to staff and patients during two endocrinological procedures
International Nuclear Information System (INIS)
Hristova-Popova, J.; Vassileva, J.; Saltirov, I.; Petkova, K.
2012-01-01
The purpose of the present work is to obtain information about the exposure to patient and staff during percutaneous nephrolithotripsy and ureteroscopy with intracorporeal lithotripsy and to search for a correlation between these parameters. The collected data for each procedure consist of the total air kerma-area product, P KA , cumulative dose, CD, fluoroscopy time, FT, number of images acquired, as well as clinical patient data. Average, minimum, maximum and median values were calculated for 38 patients. Mean values and median in parentheses were as follows: 355 (383) cGy cm 2 (P KA for PCNL); 433 (286) cGy cm 2 (P KA for URS); 42 (37) mGy (CD for PCNL); 12 (7) mGy (CD for URS); 3.5 (3.0) min (FT for PCNL); 1.4 (1.3) min (FT for URS). The typical operator doses for PCNL and URS were assessed to be 66.1 μSv and 34.3 μSv, respectively, while the maximum doses for the same type of procedures were 152.6 μSv and 124.1 μSv. Good correlation was observed between the staff dose and P KA for both procedures, while the correlation of staff dose with CD and FT was found to be weak. While applying principles of radiation protection and normal load in the clinic, there is no possibility to exceed the new annual dose limit for eye lens of 20 mSv per year averaged over 5 years. The correlation of P KA with FT and CD was also explored and no significant interconnection was observed. (authors)
Evaluating the Ergonomics of Flexible Ureteroscopy.
Ludwig, Wesley W; Lee, Gyusung; Ziemba, Justin B; Ko, Joan S; Matlaga, Brian R
2017-10-01
To date, the ergonomics of flexible ureteroscopy (URS) have not been well described. We performed a study to assess the biomechanical stresses on urologists performing URS and to investigate the effect of ureteroscope type on these parameters. Electromyography (EMG) was used to quantify the activation level of muscle groups involved in URS. Surface EMG electrodes (Delsys, Boston, MA) were placed on the right and left thenar, flexor carpi ulnaris (FCU), extensor carpi ulnaris (ECU), biceps, triceps, and deltoid. Three endoscopes were studied: single-use digital (Boston Scientific LithoVue), reusable digital (Karl Storz Flex-X c ), and reusable fiber-optic (Karl Storz Flex-X 2 ). Each ureteroscope was used to perform a set sequence of navigation and procedural tasks in a training model. EMG data were processed and normalized to compare the maximum voluntary contractions between muscle groups. Cumulative muscular workload (CMW) and average muscular work per second (AWS) were used for comparative analysis. For navigational tasks, CMW and AWS were greatest for the ECU, followed in descending order by right and left thenar, FCU, biceps, deltoid, and triceps. For procedural tasks, CMW and AWS were greatest for the right thenar, followed in descending order by the left thenar, ECU, FCU, triceps, biceps, and deltoid. During navigational tasks, both LithoVue and Flex-X c had lower CMWs for every muscle group than Flex-X 2 (p ergonomics of URS. Both the single-use and reusable digital ureteroscopes have similar profiles, and both have significantly better ergonomic metrics than the reusable fiber-optic ureteroscope.
Ergin, Giray; Kirac, Mustafa; Kopru, Burak; Ebiloglu, Turgay; Biri, Hasan
2018-04-22
To compare the pain status and stone free rates of flexible ureterorenoscopy (F-URS) versus mini-percutaneousnephrolithotomy (mini-PNL) for the treatment of 1-to 2-cm renal stones. This study was retrospectively designed with match paired method. Between January 2013 and December 2016, 387 patients underwent stone surgery for renal stones, 45 patients underwent FURS and 45 patients underwent mini-PNL. 90 patients were divided into two groups according to the surgical procedures. Group 1 patients underwent F-URS, and Group 2 patients underwent mini-PNL. During the intraoperative andpostoperative periods, pain management for all patients was standardized. Pain scores were determined using a visual analogue scale (VAS) completed at 2, 6, 12 and 24 hours postoperatively. The stone free status, hemoglobin levels, fluoroscopy time (FT), operation time (OT), hospitalization time (HT), return to work time (RWT), and complications were noted for each patient. Of all patients, the mean age was 41.1 ± 12.1 years and the mean stone size was 13.9 ± 2.9 mm. The VAS scores were significantly higher in the mini-PNL group at 2, 6, 12 and 24 hours (P .05); however, the hemoglobin decreases and the fluoroscopy, operation, hospitalization and return to work times were higher in the mini-PNL group than in the F-URS group (P work duration. We think that F-URS is more comfortable and less painful than mini-PNL and achieves a similar stone free rate for the treatment of 1- to 2-cm renal stones.
The dynamics of utilization review: a case study of 44 Massachusetts hospitals.
Gertman, P M; Egdahl, R E
1978-10-01
Utilization review programs have existed on a national basis for over a decade, but relatively little is known about the patients who are scrutinized and what actions are taken to correct unnecessary use. In the fall of 1976, 44 of the 122 Massachusetts hospitals participated in a two-week in depth study of their utilization review activities. Over 22,000 admission and extended stay reviews were performed during this time period, and of these, 2,120 patients' continued stays in the hospital were questioned. In five admission review cases and 79 extended stay review cases, the UR committee formally terminated continued health insurance benefits, and in 12 admission reviews and 74 extended stay reviews, questioning by the UR committee led the attending physician to discharge the patient earlier than would have otherwise occurred. Ninety-four percent of the terminations occurred in Medicare patients and the median age of these patients exceeded 80 years. For medical patients, a disproportionate share of all those cases questioned and of those terminated occurred in chronic illness categories, such as cancer, heart failure, and organic brain syndromes. A higher than expected percentage of surgical cases questioned by the UR committee were in neurosurgical, cardiovascular and orthopedic procedure groups. The frequency with which UR committees identified and acted upon cases suggests that effective self-policing is occurring. A large portion of the utilization problem, however, may be related to the unavailability of appropriate sub-acute care for patients with chronic medical illness or surgical procedures which require long postoperative rehabilitation and recuperation.
Generating Artificial Plant Morphologies for Function and Aesthetics through Evolving L-Systems
DEFF Research Database (Denmark)
Veenstra, Frank; Faina, Andres; Støy, Kasper
2016-01-01
Due to the replacement of natural flora and fauna with ur- ban environments, a significant part of the earth’s organisms that function as primary consumers have been dispelled. To compensate for the reduction in the amount of primary con- sumers, robotic systems that mimic plant-like organisms...... are interesting to mimic for their potential functional and aes- thetic value in urban environments. To investigate how to utilize plant developmental strategies in order to engender ur- ban artificial plants, we built a simple evolutionary model that applies an L-System based grammar as an abstraction of plant...
Revisiting Frequency Reuse towards Supporting Ultra-Reliable Ubiquitous-Rate Communication
DEFF Research Database (Denmark)
Park, Jihong; Kim, Dong Min; Popovski, Petar
2017-01-01
One of the goals of 5G wireless systems stated by the NGMN alliance is to provide moderate rates (50+ Mbps) everywhere and with very high reliability. We term this service Ultra-Reliable Ubiquitous-Rate Communication (UR2C). This paper investigates the role of frequency reuse in supporting UR2C...... in the downlink. To this end, two frequency reuse schemes are considered: user-specific frequency reuse (FRu) and BS-specific frequency reuse (FRb). For a given unit frequency channel, FRu reduces the number of serving user equipments (UEs), whereas FRb directly decreases the number of interfering base stations...
Kozić, Ružica; Meštrić, Lucija
2013-01-01
Projekt studentske radionice bio je kontrola DOF-a u mjerilu 1:2000 na području općine Đurđevac. Proveden je terenski dio kontrole točnosti DMR-a, DOF-a, izvedene signalizacije te načina signalizacije. Mjerenja su obavljena 19.travnja 2013. godine. Obavljena je ponovna izmjera GPS točaka homogenog polja Đurđevac RTK metodom u sustavu CROPOS s ciljem kontrole tih točaka, čije su koordinate već određene u sklopu izrade DOF2. Uz trajno stabilizirane točke homogenog polja, RTK metodom snimane su ...
Rodionova, Valeria V.; Kurlyandskaya, Galina V.
2016-10-01
This special issue of Journal of Magnetism and Magnetic Materials contains selected peer-reviewed papers from the International Baltic Conference on Magnetism: focus on biomedical aspects (IBCM-2015) held in Svetlogorsk, Kaliningrad region, Russia on the base of Immanuel Kant Baltic Federal University (IKBFU, Kaliningrad, Russia) during August 30-September 03, 2015. Ural Federal University named after the first President of Russia B.N. Yeltsin (UrFU, Yekaterinburg, Russia) acted as a co-organizer of the IBCM-2015. IKBFU and UrFU vice-rectors for science - Prof. Artyom V. Yurov and Prof. Vladimir V. Kruzhaev - took a special care for the IBCM-2015.
International Nuclear Information System (INIS)
2011-01-01
This addendum to the Closure Report for Corrective Action Unit 113: Area 25, Reactor Maintenance, Assembly, and Disassembly Facility, Building 3110, Nevada Test Site, Nevada, DOE/NV--891-VOL I-Rev. 1, dated July 2003, provides details of demolition, waste disposal, and use restriction (UR) modification for Corrective Action Unit 113, Area 25 R-MAD Facility. Demolition was completed on July 15, 2010, when the last of the building debris was disposed. Final field activities were concluded on August 30, 2010, after all equipment was demobilized and UR signs were posted. This work was funded by the American Recovery and Reinvestment Act.
International Nuclear Information System (INIS)
Matthews, Patrick
2009-01-01
CAU 107, ''Low Impact Soil Sites'', consists of 15 CASs in Areas 1, 2, 3, 4, 5, 9, 10, and 18 of the NTS. The closure alternatives included No Further Action and Closure in Place with Administrative Controls. This CR provides a summary of completed closure activities. ROTC Justification: The FFACO UR as published in the Closure Report for Corrective Action Unit 107: Low Impact Soil Sites, Nevada Test Site, Nevada (NNSA/NSO, 2009) states that the UR for CAS 18-23-02, U-18d Crater (Sulky), was implemented for assumed radioactive contamination that could cause a dose greater that 25 millirems per year. This document further clarifies that this was based on particulate releases of radionuclides identified in Radiological Effluents Released from U.S. Continental Tests, 1961 through 1992 (DOE/NV, 1996). The radionuclides listed in this document are krypton (Kr)-85, Kr-85m, Kr-87, Kr-88, rubidium (Rb)-87, strontium (Sr)-89, Sr-91, yttrium (Y)-91, iodine (I)-131, I-132, I-133, I-134, I-135, xeon (Xe)-133, Xe-135, Xe-138, cesium (Cs)-135, Cs-138, barium (Ba)-139, and Ba-140.
Directory of Open Access Journals (Sweden)
Ruimário Inácio Coelho
2010-12-01
Full Text Available Mudas do abacaxizeiro ‘Smooth Cayenne’ obtidas por seccionamento de caule foram submetidas à adubação foliar com soluções em diferentes concentrações de uréia, KCl e H3BO3, em pulverizações semanais, num total de vinte e seis para a uréia e o KCl e aplicações mensais num total de quatro, para o H3BO3. Todos os tratamentos foram iniciados na nona semana após o plantio das secções. O delineamento utilizado foi fatorial fracionado do tipo (1/553, com três tipos de adubo (uréia, KCl e H3BO3 e cinco concentrações num total de 25 tratamentos. Cada parcela constituiu-se de 50 secções. Os tratamentos consistiram nas combinações das seguintes concentrações em g L-1: 0; 2,5; 5; 7,5 e 10 para a uréia e o KCl, e 0; 0,5; 1; 1,5 e 2,0 de H3BO3. Análises das amostras de folhas “D” revelam efeitos da uréia e H3BO3 sobre os teores foliares de S, Cl e B e efeito do KCL sobre K e Cl foliar. A uréia não apresentou efeito sobre o teor de N foliar, porém influencia significativamente o conteúdo de N nas mudas.‘Smooth Cayenne’ planting material obtained through stem sectioning were trea-ted with foliar fertilization with different concentrations of urea, KCl, in weekly pulverizations, and H3BO4, totalizing twenty-six for urea and KCL pulverizations and four for H3BO3, which was applied monthly The treatments were began nine weeks after planting thestem sections. The experimental scheme was a fractionated factorial (1/55³ with three types of fertilizers (urea, KCl and H3BO3 and five concentrations in a total of 25 treatments. There were 50 sections per plot. Treatments were a combination of concentrations in g L-1: 0, 2.5, 5.0, 7.5 and 10 of urea and KCl, and 0, 0.5, 1.0, 1.5 and 2,0 of H3BO3. Sample analyses of ‘D’ leaves showed urea and H3BO3 effect on S, Cl and B leaf contents whereas KCL affected leaf K and Cl contents. Urea did not affect N leaf content, however it strongly influenced N content in planting material.
The Convergence of Ricoeur’s and Von Wright’s Complex Models of History
Directory of Open Access Journals (Sweden)
Linda L. Cox
2014-07-01
Full Text Available The relationship between the structural identity of narrative and the truth claim of the historical narrative work is one of importance to Ricœur. He considers the attempts of two interwoven models of history emerging from analytic philosophy—explanatory and narrative—to articulate this relationship. This paper explores the trajectories of these models as well as the epistemological and ontological crises culminating from the “simple” theses of each model. The solution to these crises requires a more complex method to account for the nature of the connections underlying historical understanding. Georg Henrik von Wright’s provisional or “hybrid” model of explanation and understanding revises the simple explanatory model and is foundational for Ricœur’s own complex revision of narrativist models through his notion of questioning back. The present paper argues that the structure of this hybrid model was unsatisfactory for von Wright, and leads in the direction of Ricœur’s own narrative method. Keywords: Ricœur, von Wright, Narrative, History, Questioning back. Résumé La relation entre l’identité structurale du récit et la prétention à la vérité de l’œuvre de récit historique est fondamentale chez Ricœur. Il considère que les deux modèles historiographiques de provenance analytique – le modèle explicatif et le modèle narratif – peuvent s’articuler. Cet article explore les trajectoires de ces modèles autant que les crises épistémologiques et ontologiques qui culminent dans chacune des thèses prise dans un sens unilatéral. La solution pour remédier à ces crises requiert une méthode plus complexe pour tenir compte de la nature des liens qui sous-tendent la compréhension historique. Le modèle d’explication et de compréhension, provisoire et “hybride,” de Georg Henrik von Wright permet de réviser le simple modèle explicatif. Ceci est fondamental pour comprendre la révision complexe que
Directory of Open Access Journals (Sweden)
Lopez WO
2015-12-01
Full Text Available William Omar Contreras Lopez,1,2 Joacir Graciolli Cordeiro,1 Ulrich Albicker,3 Soroush Doostkam,4 Guido Nikkhah,1,5 Robert D Kirch,6 Michael Trippel,1 Thomas Reithmeier1,7 1Department of Stereotactic and Functional Neurosurgery, University Medical Center Freiburg, Freiburg im Breisgau, Germany; 2Division of Functional Neurosurgery, Department of Neurology, Hospital das Clinicas, University of São Paulo Medical School, São Paulo, Brazil; 3Inomed, Emmendingen, 4Department of Neuropathology, University Medical Center Freiburg, Freiburg im Breisgau, 5Department of Neurosurgery, University Clinic Erlangen, Erlangen, 6Neuroelectronic Systems, Department of Neurosurgery, University Medical Center Freiburg, Freiburg im Breisgau, 7Department of Neurosurgery, Schwabing Academic Teaching Hospital of Technical University and Ludwig Maximilian University of Munich, Munich, Germany Background: Magnetic resonance imaging (MRI is the standard neuroimaging method to diagnose neoplastic brain lesions, as well as to perform stereotactic biopsy surgical planning. MRI has the advantage of providing structural anatomical details with high sensitivity, though histological specificity is limited. Although combining MRI with other imaging modalities, such as positron-emission tomography (PET, has proven to increment specificity, exact correlation between PET threshold uptake ratios (URs and histological diagnosis and grading has not yet been described.Objectives: The aim of this study was to correlate exactly the histopathological criteria of the biopsy site to its PET uptake value with high spatial resolution (mm3, and to analyze the diagnostic value of PET using the amino acid O-(2-[18F]fluoroethyl-L-tyrosine (18F-FET PET in patients with newly diagnosed brain lesions in comparison to histological findings obtained from stereotactic serial biopsy.Patients and methods: A total of 23 adult patients with newly diagnosed brain tumors on MRI were enrolled in this study
Directory of Open Access Journals (Sweden)
Rosângela Maria Nunes da Silva
2001-10-01
Full Text Available Este trabalho foi conduzido, utilizando 15 vacas lactantes (Holandês x Gir alimentadas à vontade com rações isoprotéicas, constituídas na base da matéria seca (MS de 60% de silagem e 40% de concentrado, contendo 0; 0,7; 1,4; e 2,1% de uréia, correspondentes aos teores de 2,08; 4,01; 5,76; e 8,07% de proteína bruta na forma de compostos nitrogenados não-protéicos (NNP, com o objetivo de avaliar os consumos e as digestibilidades aparentes de matéria seca (MS, matéria orgânica (MO, proteína bruta (PB, extrato etéreo (EE, carboidratos totais (CHO e fibra em detergente neutro (FDN e os consumos de nutrientes digestíveis totais (NDT. Também foram avaliadas possíveis alterações na produção e composição do leite. As vacas apresentaram peso vivo médio inicial de 511,8 kg e foram distribuídas ao acaso entre tratamentos. O período experimental teve duração de 90 dias para cada vaca, iniciando-se imediatamente após o parto. A fibra em detergente ácido indigestível (FDAI foi usada como indicador para a determinação da digestibilidade aparente dos nutrientes. Os resultados obtidos foram interpretados estatisticamente por análises de variância e regressão. A adição de quantidades crescentes de NNP à dieta apresentou efeito linear decrescente sobre os consumos de MS, MO, FDN, PB, EE, CHO e NDT. Não foram observados efeitos dos níveis de NNP sobre as digestibilidades aparentes de MS, MO, PB, CHO e FDN. Para o EE, foi observado efeito quadrático, sendo a máxima digestibilidade de 89,12% obtida com teor estimado de 4,73% de NNP na MS. A produção máxima de leite, de 20,10 kg/dia, foi obtida com o teor estimado de 4,79% de NNP, ou 0,7% de uréia na MS total das rações. Observou-se redução linear do teor de gordura com o aumento dos teores de NNP nas rações, enquanto a proteína se comportou de forma quadrática, sendo o teor máximo de 3,4% estimado com 3,88% de NNP.This work was carried out, using 15 dairy cows
Directory of Open Access Journals (Sweden)
Humberto Luiz Wernersbach Filho
2006-06-01
Full Text Available O objetivo neste estudo foi avaliar a influência do tipo de processamento do concentrado sobre o pH e a amônia ruminal, a concentração de uréia no plasma e as excreções urinárias de vacas leiteiras alimentadas com dietas contendo diferentes relações volumoso:concentrado. Foram utilizadas 16 vacas da raça Holandesa, puras e mestiças, em dois níveis de produção de leite (30 e 20 kg/dia, distribuídas em quatro quadrados latinos (dois para cada nível de produção, com quatro períodos de 15 dias. As dietas experimentais, isoprotéicas, foram constituídas à base de silagem de milho com relações volumoso:concentrado 50:50 e 60:40 na MS, visando produções de 30 e 20 kg de leite/dia, respectivamente. Imediatamente antes e 3 horas após a alimentação matinal, não houve diferenças nos valores de pH e amônia ruminal nos diferentes níveis de produção. Contudo, nas vacas alimentadas com a dieta com concentrado extrusado, a concentração de amônia ruminal foi menor 3 horas após a alimentação. Não houve diferença nas concentrações de uréia plasmática entre os tratamentos e as excreções urinárias de nitrogênio diferiram somente com o concentrado contendo alto teor de energia parcialmente processado.The objective of this trial was to study the effects of different forms of concentrate processing on ruminal pH and ammonia as well as on plasma concentration of urea. Sixteen dairy cows, pure Holstein and crossbred, were blocked by production level (30.0 and 20.0 kg/day and randomly assigned to two Latin squares with four periods of 15 days each. Diets were isonitrogenous and contained the following forage (corn silage:concentrate ratios: 50:50 and 60:40 (% of DM for cows yielding 30.0 and 20.0 kg of milk/day, respectively. Ruminal pH and ammonia (N-NH3 did not differ at 0 h (pre-feeding and at 3 h after the morning feeding in the different production levels. However, it was observed lower ruminal ammonia concentration
Directory of Open Access Journals (Sweden)
Natália Guarino Souza Barbosa
2001-07-01
Full Text Available Avaliaram-se os efeitos da fermentação in vitro de seis alimentos: fubá de milho (FM, farelo de soja (FS, farelo de trigo (FT, sorgo (SO, glúten de milho (GM e uréia (UR, incubados puros ou com o antibiótico monensina, esse na forma pura para análise (Monensina ou comercial (Rumensin®. O experimento constituiu-se de 18 unidades experimentais [três alimentos energéticos ou protéicos × três tratamentos (controle, monensina ou rumensin × duas repetições], em que foram analisados os parâmetros ruminais: pH, produção de amônia (NH3, proteína bacteriana (PM, proteína solúvel (PS e degradabilidade da proteína. As incubações foram feitas por 96 horas, em que as amostras foram coletadas às zero, 24, 48, 72 e 96 horas de fermentação. A leitura do pH foi realizada por um potenciômetro, enquanto as análises de amônia, proteínas microbiana e solúvel foram analisadas por técnicas colorimétricas. Não houve variações significativas no pH ao longo das incubações (6,94 inicial e 7,03 final. Não houve diferença entre as duas fontes de ionóforo testadas, contudo houve efeitos de interação entre antibiótico e alimento. A maior produção de NH3 nos alimentos protéicos foi encontrada para a UR, seguida do FS e GM, sendo reduzida na presença do ionóforo. A PS foi semelhante para os alimentos protéicos, aumentada pelo uso do ionóforo, exceto para a uréia. A PM decresceu para a UR e o FS, porém aumentou para o GM, sem ocorrer efeito de ionóforo. Nos alimentos energéticos a PM foi semelhante para os três alimentos e os ionóforos apenas reduziram a PM do SO. A maior produção de NH3 nos alimentos energéticos, foi encontrada para o FT, seguida do FM e SO. A PS foi semelhante para os alimentos energéticos. Houve correlações significativas das concentrações de NH3 com o pH final e %PB dos alimentos.The in vitro fermentation of the following food sources were evaluated: corn meal (CM, soybean meal (SM, wheat
Directory of Open Access Journals (Sweden)
Airon Aparecido Silva de Melo
2007-08-01
Full Text Available Objetivou-se avaliar o efeito da inclusão de caroço de algodão em substituição parcial à silagem de sorgo e ao farelo de soja em dietas à base de palma forrageira sobre a produção de proteína microbiana, a eficiência de síntese de proteína microbiana e as concentrações de uréia na urina e de uréia e N-uréia no plasma e no leite de vacas holandesas em lactação. Foram utilizados cinco animais aos 50 dias de lactação, distribuídos em quadrado latino 5 × 5. Os tratamentos consistiram de cinco níveis (0,0; 6,25; 12,50; 18,75 e 25,00% de inclusão de caroço de algodão na MS da dieta. A inclusão de caroço de algodão na dieta não influenciou a síntese de nitrogênio ou proteína microbiana, cujos valores médios foram 295,08 e 1.844,27 g/dia, respectivamente. As eficiências de síntese de nitrogênio e proteína microbiana diminuíram linearmente, em proporções de 0,30 e 1,43 g para cada 1% de caroço de algodão na dieta, respectivamente. Os níveis de uréia na urina e de uréia e N-uréia no plasma e no leite não foram afetados pela inclusão de caroço de algodão na dieta. Portanto, em dietas à base de palma forrageira, a inclusão de caroço de algodão em níveis de até 25% da MS não interfere na síntese de proteína microbiana e nas concentrações de uréia.The objective of this trial was to investigate the effects of partial replacement of sorghum silage and soybean meal with whole cottonseed on microbial protein synthesis and efficiency and nitrogen metabolism in lactating Holstein cows receiving forage cactus based diets. Five animals were randomly assigned to a 5 × 5 Latin square design and were fed diets containing (% of DM: 0.0, 6.25, 12.50, 18.75, and 25.00% of whole cottonseed. Inclusion of whole cottonseed in the diet did not affect microbial nitrogen and microbial protein synthesis, which averaged 295.08 and 1844.27 g/day, respectively. Microbial protein synthesis and microbial nitrogen
Propriedade de barreira à umidade de embalagens plásticas para produtos oftálmicos
Directory of Open Access Journals (Sweden)
Sandra Balan Mendoza Jaime
2014-01-01
Full Text Available As propriedades de barreira à umidade de embalagens plásticas para produtos oftálmicos de capacidade nominal de 20 mL e terminação 15 mm nos formatos cilíndrico e oval, de diferentes composições (100% Polietileno de Baixa Densidade (PEBD, 100% Polipropileno (PP e blendas com percentuais 10% e 40% de Polietileno de Alta Densidade (PEAD em PEBD, foram estudadas neste trabalho. Foi verificada também a influência do batoque gotejador (de maior ou menor orifício de dosagem e a influência do fechamento na taxa de transmissão de vapor d’água. O trabalho foi conduzido sob duas condições de estocagem a 25 ºC/40% UR e a 40 ºC/75% UR. Verificou-se que o diâmetro do orifício gotejador não interferiu significativamente na perda de peso da embalagem avaliada a 25 ºC/40% UR. Sob a condição de estocagem a 40 ºC/75% UR verificouse um aumento da taxa de transmissão de vapor d’água das embalagens comparativamente as mesmas embalagens avaliadas a 25 ºC/40% UR. O sistema de fechamento não favoreceu um acréscimo significativo da taxa de transmissão de vapor d’água, o que indica que a permeação ocorreu principalmente através do corpo da embalagem plástica. A propriedade de barreira foi influenciada pela composição da embalagem plástica chegando a uma redução média de 47% na taxa de transmissão de vapor d’água para a embalagem de PEBD com 40% PEAD em relação à embalagem com 100% PEBD de formato cilíndrico. Verificou-se ainda que o formato oval, por apresentar uma maior área superficial exposta comparativamente à embalagem de formato cilíndrico, com regiões de menor espessura de parede, pode favorecer um ligeiro aumento da taxa de transmissão de vapor d’água da embalagem.
Maddali, Manoj V; Gupta, Amita; Shah, Maunank
2016-07-07
Recent UNAIDS '90-90-90' targets propose that to end the HIV epidemic by 2030, 90% of persons living with HIV (PLWH) worldwide should know their diagnosis, 90% of diagnosed PLWH should be on antiretroviral therapy (ART) and 90% of PLWH on ART should be virally suppressed by 2020. We sought to quantify the epidemiological impact of achieving these targets in India. We constructed a dynamic-transmission model of the Indian HIV epidemic to project HIV infections and AIDS-related deaths that would occur in India over 15 years. We considered several scenarios: continuation of current care engagement (with early ART initiation), achieving 90-90-90 targets on time and delaying achievement by 5 or 10 years. In the base case, assuming continuation of current care engagement, we project 794 000 (95% uncertainty range (UR) 571 000-1 104 000) HIV infections and 689 000 (95% UR 468 000-976 000) AIDS-related deaths in India over 15 years. In this scenario, nearly half of PLWH diagnosed would fail to achieve viral suppression by 2030. With achievement of 90-90-90 targets, India could avert 392 000 (95% UR 248 000-559 000) transmissions (48% reduction) and 414 000 (95% UR 260 000-598 000) AIDS-related deaths (59% reduction) compared to the base-case scenario. Furthermore, fewer than 20 000 (95% UR 12 000-30 000) HIV infections would occur in 2030. Delaying achievement of targets resulted in a similar reduction in HIV incidence by 2030 but at the cost of excess overall infections and mortality. India can halve the epidemiological burden of HIV over 15 years with achievement of the UNAIDS 90-90-90 targets. Reaching the targets on time will require comprehensive healthcare strengthening, especially in early diagnosis and treatment, expanded access to second-line and third-line ART and long-term retention in care. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/
Xian, Jia Wen; Choi, Angus Yiu-Ting; Lau, Clara Bik-San; Leung, Wing Nang; Ng, Chun Fai; Chan, Chun Wai
2016-01-01
Gastrodia and Uncaria decoction (tianma gouteng yin) is commonly used in Chinese medicine to treat cerebral ischemia. The aim of this study was to investigate the neuroprotective effects of a water extract (GUW) of Gastrodia elata (tianma; GE) and Uncaria rhynchophylla (gouteng; UR) against ischemic insult using oxygen-glucose-deprived neuronal differentiated PC12 cells and rats subjected to middle cerebral artery occlusion (MCAO). GUW was prepared by boiling raw GE and UR in water, followed by the lyophilization of the resulting extract. Neuronal differentiated PC12 cells were subjected to oxygen-glucose deprivation with or without GUW. The neuroprotective effects of GUW were compared with those of the corresponding GE and UR extracts to tease apart the effects of the different herbs. The synergistic effect of GE and UR in GUW was measured using a modified version of Burgi's formulae. The neuroprotective mechanisms via Nrf2 and anti-apoptotic pathways were investigated using real time PCR and enzyme activity assays. The neuroprotective effects of GUW were studied in vivo using a rat MCAO model. Neurofunctional outcome and brain infarct volume we assessed. H&E staining, cresyl violet staining and immunohistochemistry were performed to assess the histological outcome. The results of lactate dehydrogenase assay showed that GUW protected cells in a concentration-dependent manner (P < 0.001). Moreover, the neuroprotective effects of GUW were greater than those of GE + UR (P = 0.018). Burgi's formula showed that the herbs in GUW acted synergistically to protect cells from ischemic injury. GUW significantly upregulated Bcl-2 expression (P = 0.0130) and reduced caspase-3 activity by 60 % (P < 0.001). GUW upregulated Nrf-2 expression (P = 0.0066) and the antioxidant response element pathway genes. The infarct volume was reduced by 55 % at day 7 of reperfusion (P < 0.001), and significant improvements were observed in the neurological deficit score and beam
Posritong, Sumana; Borges, Alexandre Luiz Souto; Chu, Tien-Min Gabriel; Eckert, George J; Bottino, Marco A; Bottino, Marco C
2013-11-01
To evaluate the null hypotheses that hydrofluoric (HF) acid etching time would neither decrease the biaxial flexural strength of a glass-based veneering ceramic nor enhance it after silane and unfilled resin (UR) applications. Disc-shaped IPS e.max ZirPress specimens were allocated into 12 groups: G1-control (no-etching), G2-30 s, G3-60 s, G4-90 s, G5-120 s, G6-60 s+60 s. Groups (G7-G12) were treated in the same fashion as G1-G6, but followed by silane and UR applications. Surface morphology and roughness (Ra and Rq) of the ceramics were assessed by means of scanning electron microscopy (SEM) and profilometry, respectively. Flexural strength was determined by biaxial testing. Data were analyzed by two-way ANOVA and the Sidak test (α=0.05). Weibull statistics were estimated and finite element analysis (FEA) was carried out to verify the stress concentration end areas of fracture. The interaction (etching time vs. surface treatment) was significant for Ra (p=0.008) and Rq (0.0075). Resin-treated groups presented significantly lower Ra and Rq than non-treated groups, except for the 60s group (pceramic microstructure and that the UR was able to penetrate into the irregularities. A significant effect of etching time (p=0.029) on flexural strength was seen. G7-G12 presented higher strength than G1-G6 (pceramic flexural strength. Moreover, the flexural strength could be enhanced after UR treatment. Copyright © 2013 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Silvana Darcie
Full Text Available CONTEXT AND OBJECTIVE: Very low birth weight (VLBW infants have special nutritional needs. There is a current tendency to individualize their protein needs. The objective of this study was to determine the suitability of serum and urinary urea as indicators for protein intake in adequate-for-gestational-age (AGA and small-for-gestational-age (SGA VLBW infants. DESIGN AND SETTING: Prospective study in the nursery attached to the Maternity Ward of the "Prof. Pedro de Alcântara" Children's Institute, Hospital das Clínicas, Department of Pediatrics, Faculdade de Medicina da Universidade de São Paulo, Brazil. METHODS: Seventy-two VLBW infants (mean protein intake = 3.7 mg/kg/day were enrolled in a prospective cohort study in two groups: AGA (n = 34 and SGA (n = 38. Blood samples, six-hour urine (6hUr collections and urine sample tests (STUr were obtained for urea and creatinine assays at three and five weeks of life. Statistical analysis: Student's t test, Pearson correlation and linear regression (p < 0.05. RESULTS: There were no differences between groups for serum urea, 6hUr and STUr, or between two assessments within each group. Serum urea correlated with 6hUr in both AGA and SGA, and to STUr in SGA; 6hUr correlated with STUr in both AGA and SGA. There was no correlation between protein intake and serum or urine urea. CONCLUSIONS: Serum and urinary urea did not reflect protein intake when mean intakes of 3.7 g/kg/day were used. Sample tests of urinary urea can be as reliable as urea from urine collected over longer periods.
International Nuclear Information System (INIS)
Siidra, Oleg I.; Nazarchuk, Evgeny V.; Krivovichev, Sergey V.
2012-01-01
Single crystals of Cs 2 (UO 2 )(CrO 4 ) 2 and Rb 2 (UO 2 )(CrO 4 ) 2 were prepared by solid state reactions. The structures are based upon the [(UO 2 )(CrO 4 ) 2 ] 2− chains. Within the chains, UrO 5 pentagonal bipyramids (Ur=uranyl) form Ur 2 O 8 dimers, which are linked via CrO 4 tetrahedra into one-dimensional chains. The CrO 4 tetrahedra coordinate uranyl ions in both mono- and bidentate fashion, which is unusual for uranyl chromates. The bidentate coordination has a strong influence upon geometrical parameters of both U and Cr coordination polyhedra. The conformation of the chains in 1 and 2 is different due to the different size of the Cs + and Rb + cations. - Graphical abstract: Uranyl chromate chain with monodentate and bidentate coordination mode of uranyl cations by CrO 4 tetrahedra in Cs 2 (UO 2 )(CrO 4 ) 2 . Highlights: ► Single crystals of novel uranyl chromates were prepared by solid state reactions. ► The CrO 4 tetrahedra coordinate uranyl ions in both mono- and bidentate fashion. ►The bidentate coordination has a strong influence upon geometrical parameters.
Characterization of Periodic Variations in the GPS Satellite Clocks
2008-08-08
la tin g th e M D EV . F or s at el lit es , t he le ge nd in di ca te s th e N av st ar v eh ic le n um be r/P R N c...10 Senior, Ray, and Beard Fi g. 3 — T im e- va ry in g am pl itu de s o f t he 1 2- ho ur (b la ck ), 6- ho ur (b lu e) , 4...Transfer and Time Scale Formation,” Metrologia 40, S270-S288. Ray, J.R., and K.L. Senior, 2005, “Geodetic
Directory of Open Access Journals (Sweden)
Maria Aparecida Schenki
2006-10-01
Full Text Available Avaliaram-se a parasitemia, o hematócrito e os níveis séricos de bilirrubina total, creatinina, uréia e colesterol de bezerros Nelore (Bos indicus inoculados com isolados de Babesia bigemina das cinco regiões fisiográficas do Brasil. Constatou-se que os diferentes isolados desenvolveram baixa parasitemia, nos animais experimentalmente inoculados, diminuição do colesterol sérico, e que não houve variações nos níveis de bilirrubina, creatinina e uréia sérica. PALAVRAS-CHAVE: Bos indicus, Babesia bigemina, parasitemia, bioquímica sérica.
La conception ricœurienne de la raison pratique: Dialectique ou éclectique?
Directory of Open Access Journals (Sweden)
Laurent Jaffro
2012-06-01
Full Text Available This article examines and discusses the presuppositions behind the answer that Paul Ricœur brought to the question “What is practical reason?” in a series of studies that led to the “little ethics” of Oneself as Another. The conception defended by Ricœur is presented as a sort of reconciliation, or composition, of Aristotelian ethics and Kantian morality. Two problems in particular are raised: the first is raised by the questionable nature of Ricœur’s interpretation of the positions that he synthesizes; the second concerns the model - dialectic or eclectic – of this synthesis.
Directory of Open Access Journals (Sweden)
Ylwa Li Hast
2016-04-01
Full Text Available Title: Teaching about sexuality and relation within science education analysed from the perspective of heteronormativityIn Sweden, a new subject syllabus for Science Studies (Naturkunskap in upper secondary school was introduced in 2011. In this syllabus knowledge about norms concerning sexualities and relations was brought to the fore as a core content. The aim of this paper is to explore how norms concerning sexuality guide the teaching, through a case study where three upper secondary school teachers were observed and their teaching was analysed from the perspective of companion meanings. All three observed teachers did teach about homosexuality, bisexuality, and transgender identities, often using genetics or evolution as their explanatory model. The teaching most often assumed that all students in the class were heterosexual, positioning LGBT-people as the Other, and did at no times take power perspectives into account.
Marie Nimier, au cœur du silence
Directory of Open Access Journals (Sweden)
Joëlle Papillon
2012-01-01
Full Text Available Dans La Reine du silence, Marie Nimier se confronte à la figure de son père, l’écrivain Roger Nimier, mort lorsqu’elle avait cinq ans. Elle y montre le poids qui pèse sur l’enfant d’écrivain, mais aussi celui de l’héritage du secret familial et de l’injonction au silence. La difficulté de l’élaboration de son récit de filiation se révèle dans les constants recommencements et reformulations, qui constituent la marque de la tension angoissante entre l’obligation de dire et celle de taire. In La Reine du silence, Marie Nimier confronts her father’s memory – the writer Roger Nimier, who died when she was five years old. The novel describes the burden of being a writer’s child, along with that of inheriting family secrets and submitting to a code of silence. The difficulty of recounting her relationship with her late father is evidenced by the narrator’s numerous “false starts” and her constant rewritings. The hesitant nature of the narration captures an anguish born of two irreconcilable obligations : the need to put things into words and the pressure to remain silent.
W3C Geolocation API ur ett utvecklarperspektiv
Jönsson, Jesper
2012-01-01
The goal of this thesis is to investigate the W3C Geolocation API from a developer’s perspective, focused on whether it makes development of location-based applications more accessible to developers. This has been investigated by looking at available ways to locate, possible uses, the functionality offered, the necessary level of prior knowledge needed for a developer and requirements on developer tools. This has been achieved through studies in relevant areas, a thorough introduction to W3C ...
Un lettore rozzo dell'Ur-Novellino
DEFF Research Database (Denmark)
Toftgaard, Anders
2007-01-01
Håndskriftet Panciatichi 32 fra Nationalbiblioteket i Firenze, den ældste og vigtigste tekstkilde til 'Il Novellino', indeholder nogle tegn i margenen, som hidtil er blevet set som tilfældige tegn på tekstens modtagelsen blandt lokale handelsmænd. Det vises derimod her, hvordan tegnene ikke stammer...
Culture du résultat et pilotage par les indicateurs dans le secteur public
Chatelain-Ponroy, Stéphanie; Sponem, Samuel
2008-01-01
Depuis 20 ans, la question de la gestion de l’État est au cœur des réformes de l’administration dans tous les pays de l’OCDE. À cet égard, l’introduction d’une culture du résultat et des dispositifs de contrôle de gestion qui l’accompagnent dans l’administration publique telle qu’elle est mise en avant dans la LOLF, si elle peut avoir des effets positifs en termes d’évaluation des politiques publiques et d’incitation des agents, peut aussi engendrer des effets pervers. En la matière, l’expéri...
International Nuclear Information System (INIS)
Yang Aimin; Deng Huixing; Li Jie; Yu Yan; Li Xu; Chen Wei; Luo Wei
2010-01-01
To investigate the relationship between radiotherapy effect and 99 Tc m - HL-91 and 18 F-FDG imaging in S180 mouse. Methods: Animal: twenty male Kunming mice (27±3 g), obtained from animal center of medical school of Xi'an Jiaotong university, were randomly divided into two groups of radiotherapy and non-radiotherapy control group. Cells: S180 cell lines, obtained from molecular and biology center of medical school of Xi'an Jiaotong university, were thawed injected into peritoneal cavity of the 5 mouse. When the S180 tumor liquid developed, l ml liquid were dripped and dilute to the suspension solution of 2 × 106 cells. Then, 0.2 ml of it was injected into the hippo of right rear leg of mouse. The mouse model was used to experiment while the tumor dimension developed to 1-1.5 cm. 99 Tc m -HL-91 imaging: 37 MBq 99 Tc m -HL-91, obtained from Guangdong Xiai Radio-pharmaceutical Center, was injected into mouse models by tail vein. After for 4h, SPECT imaging were taken before and after radiotherapy at the time of 1 h, 2 d and 10 d. GE Hawkeye VG SPECT, equipped with low energy collimator, matrix 128 × 128, zoom 1.3, was used to acquire images for 150 seconds. Radiotherapy: Two groups mouse was irradiated to 0 Gy and 8 Gy X-ray after the first 99 Tc m -HL-91 and 18 F-FDG imaging. Images analysis: the ROI region, in tumor and lung site, was drawn for calculating the UR (uptake ratio). Results: After 1 h, 2 d and 10 d of radiation exposure, the UR values in 99 Tc m -HL-91 imaging were 3.53±1.62, 3.41±1.42, 2.5% 1.57 and 1.26±0.03, respectively, while the UR values were 3.62±1.65. 3.02±1.94, 4.10±1.48 and 2.96±2.02 in control group. This revealed that tumors hypoxic level was decreased after radiation and suggested that tumors develop re-oxygenation. After 11 d of radiation exposure, the UR values in 18 F-FDG imaging were 2.49±1.29 and 1.49±0.56, while the UR values were 2.22±0.45 and 1.89±0.08, expressing a coincident trend with 99 Tc m -HL-91 imaging. This
Directory of Open Access Journals (Sweden)
José Olimpio de Souza Júnior
2008-12-01
Full Text Available O N é o nutriente mais demandado pelas plantas. Contudo, para produção de mudas enraizadas de cacaueiro em substratos e sob irrigação freqüente não existem estudos de calibração de adubação nitrogenada. Os objetivos deste trabalho foram comparar a eficiência das adubações no substrato e foliar com uréia para mudas clonais de cacau e definir doses recomendáveis e nível crítico foliar de N. O experimento foi instalado em viveiro de produção de mudas do Instituto Biofábrica de Cacau, em Ilhéus, Bahia, em julho de 2006, envolvendo 10 tratamentos (duas formas de adubação, combinadas com cinco doses de uréia, em blocos casualizados, com quatro repetições. A parcela útil constituiu-se de 12 mudas clonais de cacaueiro cultivadas em tubetes, contendo 288 cm³ de substrato (50 % de fibra de coco e 50 % de Plantmax®. O substrato foi corrigido com 3,20 kg m-3 de calcário e adubado com 2,68 kg m-3 de superfosfato simples. Os tratamentos foram aplicados entre o 82º até o 138º dia, com as seguintes doses semanais de N: 0, 20, 40, 60 e 80 mg dm-3 via substrato e 0,0; 2,25; 4,5; 9,0; e 13,5 g L-1 via foliar. Em todos os tratamentos, fez-se a adubação complementar com P, K, S, Zn e B via substrato. Aos 145 dias, as plantas foram colhidas, sendo avaliados: diâmetro da haste principal, altura, área foliar, matéria seca da parte aérea (MSPA, teor de nutrientes na folha diagnóstica e conteúdo de nutrientes na parte aérea. As variáveis biométricas e nutricionais responderam aos tratamentos. A adubação via substrato proporcionou produção máxima superior à adubação foliar, para MSPA, altura e área foliar. As doses recomendáveis de N, calculadas para obtenção de 99 % da produção máxima, variaram de acordo com a variável biométrica de 43 a 76 mg dm-3 para adubação via substrato e de 9,1 a 11,7 g L-1 para adubação foliar. O nível crítico foliar de N, para obtenção de 99 % da produção máxima da MSPA
Directory of Open Access Journals (Sweden)
Mantis John G
2004-10-01
Full Text Available Abstract Background The high fat, low carbohydrate ketogenic diet (KD was developed as an alternative to fasting for seizure management. While the mechanisms by which fasting and the KD inhibit seizures remain speculative, alterations in brain energy metabolism are likely involved. We previously showed that caloric restriction (CR inhibits seizure susceptibility by reducing blood glucose in the epileptic EL mouse, a natural model for human multifactorial idiopathic epilepsy. In this study, we compared the antiepileptic and anticonvulsant efficacy of the KD with that of CR in adult EL mice with active epilepsy. EL mice that experienced at least 15 recurrent complex partial seizures were fed either a standard diet unrestricted (SD-UR or restricted (SD-R, and either a KD unrestricted (KD-UR or restricted (KD-R. All mice were fasted for 14 hrs prior to diet initiation. A new experimental design was used where each mouse in the diet-restricted groups served as its own control to achieve a 20–23% body weight reduction. Seizure susceptibility, body weights, and the levels of plasma glucose and β-hydroxybutyrate were measured once/week over a nine-week treatment period. Results Body weights and blood glucose levels remained high over the testing period in the SD-UR and the KD-UR groups, but were significantly (p Conclusions The results indicate that seizure susceptibility in EL mice is dependent on plasma glucose levels and that seizure control is more associated with the amount than with the origin of dietary calories. Also, CR underlies the antiepileptic and anticonvulsant action of the KD in EL mice. A transition from glucose to ketone bodies for energy is predicted to manage EL epileptic seizures through multiple integrated changes of inhibitory and excitatory neural systems.
Directory of Open Access Journals (Sweden)
Danielly Cristina Gomes da Trindade
2015-09-01
Full Text Available Resumo:O objetivo deste trabalho foi avaliar o efeito da aplicação de 1-metilciclopropeno (1-MCP em manga 'Palmer' (Mangifera indica, nos estádios de maturação 2 e 3, para a conservação pós-colheita do fruto durante o período de armazenamento. Foram realizados dois experimentos em delineamento inteiramente casualizado, com quatro repetições. No primeiro, mangas no estádio de maturação 2 foram submetidas a diferentes doses de 1-MCP (controle, 300, 600 e 1.000 nL L-1, por 12 horas, e tempos de armazenamento refrigerado de 0, 8 e 15 dias a 14,5±2°C e 85±6% UR, seguidos de 3, 5, 7 e 9 dias a 24±2°C e 60±6% UR. No segundo experimento, mangas no estádio de maturação 3 foram submetidas aos mesmos tratamentos do primeiro, porém com aplicação de 1-MCP durante 14 horas e com armazenamento a 13±0,6°C e 87±2% UR, e 24,4±1,9°C e 47±8% UR. O uso de 1-MCP nas doses de 300 e 600 nL L-1, no estádio de maturação 2, melhora a aparência dos frutos, embora se restrinja a efeitos temporários sobre a firmeza de polpa e a degradação de amido. Nas doses de 600 e 1.000 nL L-1, no estádio de maturação 3, o 1-MCP limita a perda de firmeza e mantém a aparência comercial do fruto até o vigésimo quarto dia.
Directory of Open Access Journals (Sweden)
Amelia Pietropaolo
2017-12-01
Full Text Available Objective: To ascertain the publication trends of interventions for paediatric kidney stone disease (KSD we conducted a systematic review of literature over the last 16â¯years. Patients and methods: With a rise of paediatric KSD and related interventions, a systematic review using PubMed was done over the last 16â¯years for all published papers on âPaediatric stone disease intervention â ureteroscopy (URS, shockwave lithotripsy (SWL, percutaneous nephrolithotomy (PCNL, open stone surgery, and laparoscopic stone surgeryâ. The search was limited to English language articles with a published abstract, whilst case reports, animal and laboratory studies, were excluded. We also analysed the data in two time periods, period-1 (2000â2007 and period-2 (2008â2015. Results: During the last 16-years, 339 papers were published on paediatric stone disease intervention on PubMed. This included papers on URS (95, PCNL (97, SWL (102, open stone surgery (34 and laparoscopic stone surgery (11. During period-1 and period-2 there were 30 and 65 papers on URS, 16 and 81 papers on PCNL, 33 and 60 papers on SWL, nine and 25 papers on open surgery, respectively. When comparing the two periods, there were 92 published papers for all interventions in period-1 and this had risen almost threefold to 247 papers in period-2. Conclusions: Our systematic review shows that intervention for KSD in the paediatric age group has risen over the last 8â¯years. Whilst URS, SWL, open surgery and laparoscopic surgery have all doubled, PCNL has risen fivefold reflecting an increase in the new minimally invasive PCNL techniques. Keywords: Publication trends, Urolithiasis, Stone, Ureteroscopy, Paediatrics
Energy Technology Data Exchange (ETDEWEB)
Gibson, J. [ed.
1998-12-01
During this period, General Atomics (GA) and their partner Schafer Corporation were assigned 17 formal tasks in support of the Inertial Confinement Fusion (ICF) program and its five laboratories. A portion of the effort on these tasks included providing direct ``On-site Support`` at Lawrence Livermore National Laboratory (LLNL), Los Alamos National Laboratory (LANL), and Sandia National Laboratory Albuquerque (SNLA). They fabricated and delivered over 1,200 hohlraum mandrels and numerous other micromachined components to LLNL, LANL, and SNLA. They produced more than 1,300 glass and plastic target capsules for LLNL, LANL, SNLA, and the University of Rochester/Laboratory for Laser Energetics (UR/LLE). They also delivered nearly 2,000 various target foils and films for Naval Research Lab (NRL) and UR/LLE in FY98. This report describes these target fabrication activities and the target fabrication and characterization development activities that made the deliveries possible. During FY98, great progress was made by the GA/Schafer-UR/LLE-LANL team in the design, procurement, installation, and testing of the OMEGA Cryogenic Target System (OCTS) that will field cryogenic targets on OMEGA. The design phase was concluded for all components of the OCTS and all major components were procured and nearly all were fabricated. Many of the components were assembled and tested, and some have been shipped to UR/LLE. The ICF program is anticipating experiments at the OMEGA laser and the National Ignition Facility (NIF) which will require targets containing cryogenic layered D{sub 2} or deuterium-tritium (DT) fuel. They are part of the National Cryogenic Target Program and support experiments at LLNL and LANL to generate and characterize cryogenic layers for these targets. They also contributed cryogenic support and developed concepts for NIF cryogenic targets. This report summarizes and documents the technical progress made on these tasks.
International Nuclear Information System (INIS)
Gibson, J.
1998-12-01
During this period, General Atomics (GA) and their partner Schafer Corporation were assigned 17 formal tasks in support of the Inertial Confinement Fusion (ICF) program and its five laboratories. A portion of the effort on these tasks included providing direct ''On-site Support'' at Lawrence Livermore National Laboratory (LLNL), Los Alamos National Laboratory (LANL), and Sandia National Laboratory Albuquerque (SNLA). They fabricated and delivered over 1,200 hohlraum mandrels and numerous other micromachined components to LLNL, LANL, and SNLA. They produced more than 1,300 glass and plastic target capsules for LLNL, LANL, SNLA, and the University of Rochester/Laboratory for Laser Energetics (UR/LLE). They also delivered nearly 2,000 various target foils and films for Naval Research Lab (NRL) and UR/LLE in FY98. This report describes these target fabrication activities and the target fabrication and characterization development activities that made the deliveries possible. During FY98, great progress was made by the GA/Schafer-UR/LLE-LANL team in the design, procurement, installation, and testing of the OMEGA Cryogenic Target System (OCTS) that will field cryogenic targets on OMEGA. The design phase was concluded for all components of the OCTS and all major components were procured and nearly all were fabricated. Many of the components were assembled and tested, and some have been shipped to UR/LLE. The ICF program is anticipating experiments at the OMEGA laser and the National Ignition Facility (NIF) which will require targets containing cryogenic layered D 2 or deuterium-tritium (DT) fuel. They are part of the National Cryogenic Target Program and support experiments at LLNL and LANL to generate and characterize cryogenic layers for these targets. They also contributed cryogenic support and developed concepts for NIF cryogenic targets. This report summarizes and documents the technical progress made on these tasks
Transport of pesticides and artificial tracers in vertical-flow lab-scale wetlands
Durst, Romy; Imfeld, Gwenaël.; Lange, Jens
2013-01-01
Wetland systems can be hydrologically connected to a shallow aquifer and intercept upward flow of pesticide-contaminated water during groundwater discharge. However, pesticide transport and attenuation through wetland sediments (WSs) intercepting contaminated water is rarely evaluated quantitatively. The use of artificial tracers to evaluate pesticide transport and associated risks is a fairly new approach that requires evaluation and validation. Here we evaluate during 84 days the transport of two pesticides (i.e., isoproturon (IPU) and metalaxyl (MTX)) and three tracers (i.e., bromide (Br), uranine (UR), and sulforhodamine B (SRB)) in upward vertical-flow vegetated and nonvegetated lab-scale wetlands. The lab-scale wetlands were filled with outdoor WSs and were continuously supplied with tracers and the pesticide-contaminated water. The transport of IPU and UR was characterized by high solute recovery (approximately 80%) and low retardation compared to Br. The detection of desmethylisoproturon in the wetlands indicated IPU degradation. SRB showed larger retardation (>3) and lower recovery (approximately 60%) compared to Br, indicating that sorption controlled SRB transport. MTX was moderately retarded (approximately 1.5), and its load attenuation in the wetland reached 40%. In the vegetated wetland, preferential flow along the roots decreased interactions between solutes and sediments, resulting in larger pesticide and tracer recovery. Our results show that UR and IPU have similar transport characteristics under the tested subsurface-flow conditions, whereas SRB may serve as a proxy for less mobile and more persistent pesticides. Since UR and SRB are not significantly affected by degradation, their use as proxies for fast degrading pollutants may be limited. We anticipate our results to be a starting point for considering artificial tracers for investigating pesticide transport in environments at groundwater/surface-water interfaces.
Directory of Open Access Journals (Sweden)
Ali Afshari
2017-01-01
Full Text Available Introduction: Heavy metals are found to be one of the major environmental hazardous contaminants, for human health, animal life, air quality and other components of environment. They can affect geochemical cycles and accumulate in animal tissues since physical processes are not able to remove them, so they are consistent in long term. The analysis of the total concentration of heavy metals in soil may provide information about soils enrichment but in general, it is widely used to determine the potential mobility of heavy metals in environmental behavior under chemical forms of metals in soils. Heavy metals existat several phases including water-soluble, exchangeable, bounded to organic matter, bounded to carbonates, bounded to Fe-Mn oxides, secondary clay minerals and residual fraction within primary minerals network. There is a dynamic equilibrium between different fractions of elements in soil. The main objectives of the present study were a The analysis of the total concentration of heavy metals such as Fe, Mn, Ni, Cr, Co, Pb, Zn, Cd and Cu and b The fractionations of heavy metals and identification of controlling factors to distribution and behavior of heavy metals in soils at different land uses. Materials and Methods: The study was performed at central area of Zanjan province (Iran. The study area was over 2000 km2 in coordinates 20´ 36° to 41´ 36° E and 19´ 48° to 53´ 48° N. The average altitudes were over 1500 meters above sea level. The major land uses of the study area included agriculture (AG, rangeland (RA and urban (UR. Sample collection was done based on the random grid method in August 2011. Surface soil samples (0-10 cm depth were taken from grid centers included 137, 77 and 27 samples from AG, RA and UR land uses, respectively. The samples were digested in Nitric acid 5 normal (Sposito et al., 1982 and total concentration of Pb, Zn, Ni, Mn, Cu, Cr, Fe and Co were measured by Perkin-Elmer: AA 200 atomic absorption
42 CFR 456.141 - Purpose and general description.
2010-10-01
... SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Hospitals Ur Plan...) Suggest appropriate changes needed to maintain consistently high quality patient care and effective and...
Mémoires et conflits: Conflits des mémoires, collision des durées
Directory of Open Access Journals (Sweden)
Jean-Louis Vieillard-Baron
2014-01-01
Full Text Available There is a collision between the durations and between the memories, every time that duration rythms are different. For Bergson there is a difference of degrees of tension between durations but the flow is unique. Ricœur distinguishes many degrees of passeity according to the proximity or the distance. As example he sets the Zauberberg of Thomas Mann. Forgetting and Forgiveness are forms of durations collision. The distensio animi of Saint Augustine means dissipation Ricœur misunderstands this expression what means for him phenomenological intratemporality, and he goes no further than tearing of soul distant from eternity. Normal 0 false false false EN-US JA X-NONE
Magnetic field simulation of wiggler on LUCX accelerator facility using Radia
Sutygina, Y. N.; Harisova, A. E.; Shkitov, D. A.
2016-11-01
A flat wiggler consisting of NdFeB permanent magnets was installed on a compact linear electron accelerator LUCX (KEK) in Japan. After installing the wiggler on LUCX, the experiments on the generation of undulator radiation (UR) in the terahertz wavelength range is planned. To perform the detailed calculations and optimization of UR characteristics, it is necessary to know the parameters of the magnetic field generated in the wiggler. In this paper extended simulation results of wiggler magnetic field over the entire volume between the poles are presented. The obtained in the Radia simulation magnetic field is compared with the field calculated by another code, which is based on the finite element method.
Exposição Humana a radiação Ionizante: Efeitos Biológicos e Impacto na Saúde
Silva, Maria João; Dias, Anabela; Monteiro-Gil, Octávia; Louro, Henriqueta; Boavida, Guida
2013-01-01
O homem encontra-se exposto a radiação ionizante de origem natural (raios cósmicos e radiação emanada dos solos) mas, alguns grupos populacionais, poderão ainda estar sujeitos a uma exposição em contexto ocupacional (e.g., médicos e trabalhadores de minas de urânio) ou ambiental (e.g., residentes em áreas de influência de minas de urânio). Estão bem documentados os efeitos nefastos da exposição a radiação ionizante na saúde humana incluindo, a longo prazo, um aumento da incidência de várias f...
Yilmaz, Secil
2012-01-01
Life Cycle Assesment, LCA, används för att sammanställa och utvärdera in- och utflöden ur ett system samt potentiell miljöpåverkan under en produkts livscykel. Beräkningarna görs genom att se hela produkten ur ett livscykelperspektiv, dvs. från det att produkten är en råvara till det att den hanteras som avfall. Beroende på måldefinition och systemgränser kan detaljgraden och tidsramen för LCA-studien varieras. LCA används för att identifiera möjligheter att förbättra produkten i olika delar ...
“Los francmasones franceses de la jurisdicción de Cuba al principio del siglo XIX”
Directory of Open Access Journals (Sweden)
Agnès Renault
2009-01-01
Full Text Available Con la técnica de la prosopografía, este artículo pro pone presentar las características de los masones franceses, antiguos colonos de Saint-Domingue refugiados en Santiago de Cuba, al principio del siglo XIX. Se destacan las principales logias representadas como Réunion des Cœurs de Jeremías que tenía 25 hermanos en Santiago de Cuba, y la Réunion des Cœurs Franco-Américains de Puerto Príncipe. La masonería francesa influyó directamente la masonería cubana. El estudio de las características de los primeros masones franceses permite conocer mejor la base de esta influencia.
2013-07-19
... Web site to view public comments. Comments received timely will also be available for public... Magnetic Stimulation Therapy TOPs Transitional Outpatient Payments UR Utilization review USPSTF United...
Harn, van J.
2009-01-01
Wageningen UR Livestock Research testte vier strooiselmaterialen voor vleeskuikens. Hoeveelheid en soort hadden geen effect op de resultaten. Snijmaissilage vroeg meer energie, maar de ammoniakemissie was lager
Samuel, Putra A.; Widyaningsih, Yekti; Lestari, Dian
2016-02-01
The objective of this study is modeling the Unemployment Rate (UR) in West Java, Central Java, and East Java, with rate of disease, infant mortality rate, educational level, population size, proportion of married people, and GDRP as the explanatory variables. Spatial factors are also considered in the modeling since the closer the distance, the higher the correlation. This study uses the secondary data from BPS (Badan Pusat Statistik). The data will be analyzed using Moran I test, to obtain the information about spatial dependence, and using Spatial Autoregressive modeling to obtain the information, which variables are significant affecting UR and how great the influence of the spatial factors. The result is, variables proportion of married people, rate of disease, and population size are related significantly to UR. In all three regions, the Hotspot of unemployed will also be detected districts/cities using Spatial Scan Statistics Method. The results are 22 districts/cities as a regional group with the highest unemployed (Most likely cluster) in the study area; 2 districts/cities as a regional group with the highest unemployed in West Java; 1 district/city as a regional groups with the highest unemployed in Central Java; 15 districts/cities as a regional group with the highest unemployed in East Java.
Water Ingress Testing of the Turbula Jar and U-233 Lead Pig Containers
Energy Technology Data Exchange (ETDEWEB)
Reeves, Kirk Patrick [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Karns, Tristan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Smith, Paul Herrick [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-11-02
Understanding the water ingress behavior of containers used at the TA-55 Plutonium Facility has significant implications for criticality safety. The purpose of this report is to document the water ingress behavior of the Turbula Jar with Bakelite lid and Viton gaskets (Turbula Jar) used in oxide blending operations and the U-233 lead pig container used to store and transport U-233 material. The technical basis for water resistant containers at TA-55 is described in LA-UR-15-22781, “Water Resistant Container Technical Basis Document for the TA-55 Criticality Safety Program.” Testing of the water ingress behavior of various containers is described in LA-CP-13-00695, “Water Penetration Tests on the Filters of Hagan and SAVY Containers,” LA-UR-15-23121, “Water Ingress into Crimped Convenience Containers under Flooding Conditions,” and in LA-UR- 16-2411, “Water Ingress Testing for TA-55 Containers.” Water ingress criteria are defined in TA55-AP-522 “TA-55 Criticality Safety Program”, and in PA-RD-01009 “TA55 Criticality Safety Requirements.” The water ingress criteria for submersion is no more than 50 ml of water ingress at a 6” water column height for a period of 2 hours.
Pacifici, Lara Brongo; Thomson, Norman
2011-01-01
Most students participating in science undergraduate research (UR) plan to attend either medical school or graduate school. This study examines possible differences between premed and non–premed students in their influences to do research and expectations of research. Questionnaire responses from 55 premed students and 80 non–premed students were analyzed. No differences existed in the expectations of research between the two groups, but attitudes toward science and intrinsic motivation to learn more about science were significantly higher for non–premed students. Follow-up interviews with 11 of the students, including a case study with one premed student, provided explanation for the observed differences. Premed students, while not motivated to learn more about science, were motivated to help people, which is why most of them are pursuing medicine. They viewed research as a way to help them become doctors and to rule out the possibility of research as a career. Non–premed students participated in research to learn more about a specific science topic and gain experience that may be helpful in graduate school research. The difference in the reasons students want to do UR may be used to tailor UR experiences for students planning to go to graduate school or medical school. PMID:21633068
Pacifici, Lara Brongo; Thomson, Norman
2011-01-01
Most students participating in science undergraduate research (UR) plan to attend either medical school or graduate school. This study examines possible differences between premed and non-premed students in their influences to do research and expectations of research. Questionnaire responses from 55 premed students and 80 non-premed students were analyzed. No differences existed in the expectations of research between the two groups, but attitudes toward science and intrinsic motivation to learn more about science were significantly higher for non-premed students. Follow-up interviews with 11 of the students, including a case study with one premed student, provided explanation for the observed differences. Premed students, while not motivated to learn more about science, were motivated to help people, which is why most of them are pursuing medicine. They viewed research as a way to help them become doctors and to rule out the possibility of research as a career. Non-premed students participated in research to learn more about a specific science topic and gain experience that may be helpful in graduate school research. The difference in the reasons students want to do UR may be used to tailor UR experiences for students planning to go to graduate school or medical school.
Öğreden, Ercan; Oğuz, Ural; Demirelli, Erhan; Benli, Erdal; Sancak, Eyüp Burak; Gülpinar, Murat Tolga; Akbaş, Alpaslan; Reşorlu, Berkan; Ayyildiz, Ali; Yalçin, Orhan
2016-04-19
The purpose of the present study was to review the complications of ureteroscopy (URS) by using the modified Clavien classification system (MCCS) and to investigate the factors associated with complications. Data regarding 811 patients who underwent URS for ureteral calculus were analyzed. Peroperative and postoperative complications were recorded. The patients were divided into seven groups depending on the severity of the complications. The association of sex, stone size, number, and localization with each MCCS grade was also evaluated. The average age was 45 years. The success of the procedure after one session was 93.5%. Complications were recorded in 57.9% of the patients. According to the MCCS, grade I, II, IIIa, IIIb, IVa, IVb, and V complications were documented in 29.8%, 7.1%, 8.6%, 11%, 0%, 1.2%, and 0% of the patients, respectively. The factors associated with the complications graded by MCCS were sex, stone size, number of stones, and localization. In addition, in multivariate analysis, history of previous surgeries for urolithiasis, orifice dilatation, and instrument size were associated with complications. According to MCCS, sex, history of previous surgeries for urolithiasis, orifice dilatation, size of the instrument, stone size, number of stones, and localization are associated with different grades of complications in URS.
Energy Technology Data Exchange (ETDEWEB)
Jörundsdóttir, Hrönn Ólína, E-mail: hronn.o.jorundsdottir@matis.is [Matis Ltd., Icelandic Food and Biotech R and D, Vinlandsleid 12, 113 Reykjavik (Iceland); Jensen, Sophie [Matis Ltd., Icelandic Food and Biotech R and D, Vinlandsleid 12, 113 Reykjavik (Iceland); Hylland, Ketil; Holth, Tor Fredrik [Department of Biosciences, University of Oslo, P.O. Box 1066 Blindern, N-0316 Oslo (Norway); Gunnlaugsdóttir, Helga [Matis Ltd., Icelandic Food and Biotech R and D, Vinlandsleid 12, 113 Reykjavik (Iceland); Svavarsson, Jörundur [University of Iceland, Department of Life and Environmental Sciences, Askja - Natural Science Building, Sturlugata 7, 101 Reykjavík (Iceland); Ólafsdóttir, Ásdís [The University of Iceland´s Research Centre in Sudurnes, Gardvegi 1, 245 Sandgerdi (Iceland); El-Taliawy, Haitham [Matis Ltd., Icelandic Food and Biotech R and D, Vinlandsleid 12, 113 Reykjavik (Iceland); Rigét, Frank; Strand, Jakob [Department of Bioscience, Arctic Research Centre, Aarhus University, Frederiksborgvej 399, PO Box 358, DK-4000 Roskilde (Denmark); Nyberg, Elisabeth; Bignert, Anders [Swedish Museum of Natural History, P.O. Box 50007, 104 05 Stockholm (Sweden); Hoydal, Katrin S. [The Faroese Environment Agency, Traðagøta 38, P.O. Box 2048, FO-165 Argir, the Faroe Islands (Faroe Islands); Halldórsson, Halldór Pálmar [The University of Iceland´s Research Centre in Sudurnes, Gardvegi 1, 245 Sandgerdi (Iceland)
2014-09-15
As the ice cap of the Arctic diminishes due to global warming, the polar sailing route will be open larger parts of the year. These changes are likely to increase the pollution load on the pristine Arctic due to large vessel traffic from specific contaminant groups, such as polycyclic aromatic hydrocarbons (PAHs). A well-documented baseline for PAH concentrations in the biota in the remote regions of the Nordic Seas and the sub-Arctic is currently limited, but will be vital in order to assess future changes in PAH contamination in the region. Blue mussels (Mytilus edulis) were collected from remote sites in Greenland, Iceland, the Faroe Islands, Norway and Sweden as well as from urban sites in the same countries for comparison. Cod (Gadus morhua) was caught north of Iceland and along the Norwegian coast. Sixteen priority PAH congeners and the inorganic trace elements arsenic, cadmium, mercury and lead were analysed in the blue mussel samples as well as PAH metabolites in cod bile. Σ{sub 16}PAHs ranged from 28 ng/g dry weight (d.w.) (Álftafjörður, NW Iceland) to 480 ng/g d.w. (Ísafjörður, NW Iceland). Mussel samples from Mjóifjörður, East Iceland and Maarmorilik, West Greenland, contained elevated levels of Σ{sub 16}PAHs, 370 and 280 ng/g d.w., respectively. Levels of inorganic trace elements varied with highest levels of arsenic in mussels from Ísafjörður, Iceland (79 ng/g d.w.), cadmium in mussels from Mjóifjörður, Iceland (4.3 ng/g d.w.), mercury in mussels from Sørenfjorden, Norway (0.23 ng/g d.w.) and lead in mussels from Maarmorilik, Greenland (21 ng/g d.w.). 1-OH-pyrene was only found above limits of quantification (0.5 ng/mL) in samples from the Norwegian coast, ranging between 44 and 140 ng/ml bile. Generally, PAH levels were low in mussels from the remote sites investigated in the study, which indicates limited current effect on the environment. - Highlights: • Low levels of PAHs in blue mussels from remote areas of the Arctic. • Low
Directory of Open Access Journals (Sweden)
Pereira Elzânia Sales
2001-01-01
Full Text Available O objetivo do presente estudo foi avaliar os efeitos das fontes nitrogenadas e o uso de Sacharomyces cerevisiae em dietas à base de cana-de-açúcar sobre os consumos e as digestibilidades aparentes totais e parciais de matéria seca (MS, matéria orgânica (MO, proteína bruta (PB, extrato etéreo (EE, carboidratos totais (CHO, fibra em detergente neutro (FDN e carboidratos não-estruturais (CNE, o balanço nitrogenado e os parâmetros ruminais. Foram utilizados quatro novilhos Holandês-Zebu, fistulados no rúmen e abomaso, alimentados com quatro rações à base de cana-de-açúcar, constituídas de duas fontes nitrogenadas (uréia ou cama de frango combinadas com dois níveis de Sacharomyces cerevisiae (0 e 10 g/dia. Utilizou-se delineamento em quadrado latino 4 x 4. A fibra em detergente neutro indigestível (FDNi foi utilizada como indicador, para determinar as digestibilidades aparentes totais e parciais. Os consumos de MS, MO, EE, CT e CNE não foram influenciados pelas fontes nitrogenadas e pela utilização de Sacharomyces cerevisiae. Os consumos de PB e FDN foram maiores para as dietas suplementadas com cama de frango. Os coeficientes de digestibilidades totais de PB e EE foram maiores para as dietas constituídas de uréia. As digestibilidades aparentes totais de MS, MO, CT e FDN não foram influenciadas pelas fontes nitrogenadas e pela utilização de Sacharomyces cerevisiae. O pH do líquido ruminal decresceu linearmente para as dietas suplementadas com uréia e apresentou comportamento quadrático, quando estas dietas foram combinadas com Sacharomyces cerevisiae. As concentrações de amônia no líquido ruminal apresentaram comportamento quadrático, estimando-se valores máximos de 16,90; 26,12; 18,48; e 14,40 mg/100 mL para os tratamentos constituídos de cana-de-açúcar e uréia; cana-de-açúcar, uréia e Sacharomyces cerevisiae; cana-de-açúcar e cama de frango; e cana-de-açúcar, cama de frango e Sacharomyces cerevisiae
Salje, Henrik; Andrews, Jason R.; Deo, Sarang; Satyanarayana, Srinath; Sun, Amanda Y.; Pai, Madhukar; Dowdy, David W.
2014-01-01
Background India has announced a goal of universal access to quality tuberculosis (TB) diagnosis and treatment. A number of novel diagnostics could help meet this important goal. The rollout of one such diagnostic, Xpert MTB/RIF (Xpert) is being considered, but if Xpert is used mainly for people with HIV or high risk of multidrug-resistant TB (MDR-TB) in the public sector, population-level impact may be limited. Methods and Findings We developed a model of TB transmission, care-seeking behavior, and diagnostic/treatment practices in India and explored the impact of six different rollout strategies. Providing Xpert to 40% of public-sector patients with HIV or prior TB treatment (similar to current national strategy) reduced TB incidence by 0.2% (95% uncertainty range [UR]: −1.4%, 1.7%) and MDR-TB incidence by 2.4% (95% UR: −5.2%, 9.1%) relative to existing practice but required 2,500 additional MDR-TB treatments and 60 four-module GeneXpert systems at maximum capacity. Further including 20% of unselected symptomatic individuals in the public sector required 700 systems and reduced incidence by 2.1% (95% UR: 0.5%, 3.9%); a similar approach involving qualified private providers (providers who have received at least some training in allopathic or non-allopathic medicine) reduced incidence by 6.0% (95% UR: 3.9%, 7.9%) with similar resource outlay, but only if high treatment success was assured. Engaging 20% of all private-sector providers (qualified and informal [providers with no formal medical training]) had the greatest impact (14.1% reduction, 95% UR: 10.6%, 16.9%), but required >2,200 systems and reliable treatment referral. Improving referrals from informal providers for smear-based diagnosis in the public sector (without Xpert rollout) had substantially greater impact (6.3% reduction) than Xpert scale-up within the public sector. These findings are subject to substantial uncertainty regarding private-sector treatment patterns, patient care-seeking behavior
Directory of Open Access Journals (Sweden)
Ricardo Andrade Reis
2001-06-01
Full Text Available Avaliaram-se as alterações da fração fibrosa e as características químicas dos fenos de braquiária decumbens (Brachiaria decumbnes Stapf e jaraguá (Hyparrhenia rufa Ness Stapf não-tratados, tratados com uréia (U-5,4% da MS, uréia (UL-5,4% da MS mais labe-labe (Lablab purpureus L. Sweet, cv. Highworth-3,0% da MS ou amônia anidra (NH3 -3,0% da MS. O tratamento químico com uréia ou NH3 aumentou o pH e a digestibilidade in vitro verdadeira dos fenos. A amonização não alterou os teores de fibra em detergente ácido e celulose, mas diminuiu os de fibra em detergente neutro, hemicelulose e lignina. O uso do labe-labe como fonte adicional de urease não aumentou a eficiência da uréia no tratamento dos volumosos. As avaliações do conteúdo de umidade, do poder tampão e da atividade ureática são técnicas que podem auxiliar na previsão das respostas dos volumosos à amonização com o uso de uréia.The experiment was conducted to evaluate the changes on the chemical composition and the in vitro dry matter digestibility (IVDMD of the Brachiaria decumbens Stapf, jaraguá (Hyparrhenia rufa Ness Stapf hays, untreated, treated with urea (5.4% DM, urea (UL-5.4% DM and lab lab (Lablab purpureus L. Sweet, cv. Highworth-3.0% DM; and anhydrous ammonia (NH3 3.0% DM. The chemical treatment increased the pH and the in vitro digestibility of the hays Ammoniation did not affect ADF and cellulose contents. The NDF, hemicellulose and lignin contents decreased due to ammoniation with NH3. The urea utilization had the same efficiency that anhydrous ammonia on the hemicellulose content of the hays. The use of an external source of urease did not affect the urea treatment efficiency. The evaluation of the chemical characteristics of the forages, as the dry matter content, buffering capacity, and urease activity can be helpful on the prediction of their responses to the ammoniation.
Water Content of Lunar Alkali Fedlspar
Mills, R. D.; Simon, J. I.; Wang, J.; Alexander, C. M. O'D.; Hauri, E. H.
2016-01-01
Detection of indigenous hydrogen in a diversity of lunar materials, including volcanic glass, melt inclusions, apatite, and plagioclase suggests water may have played a role in the chemical differentiation of the Moon. Spectroscopic data from the Moon indicate a positive correlation between water and Th. Modeling of lunar magma ocean crystallization predicts a similar chemical differentiation with the highest levels of water in the K- and Th-rich melt residuum of the magma ocean (i.e. urKREEP). Until now, the only sample-based estimates of water content of KREEP-rich magmas come from measurements of OH, F, and Cl in lunar apatites, which suggest a water concentration of alkali feldspar, a common mineral in K-enriched rocks, can have approx. 20 ppm of water, which implies magmatic water contents of approx. 1 wt % in the high-silica magmas. This estimate is 2 to 3 orders of magnitude higher than that estimated from apatite in similar rocks. However, the Cl and F contents of apatite in chemically similar rocks suggest that these melts also had high Cl/F ratios, which leads to spuriously low water estimates from the apatite. We can only estimate the minimum water content of urKREEP (+ bulk Moon) from our alkali feldspar data because of the unknown amount of degassing that led to the formation of the granites. Assuming a reasonable 10 to 100 times enrichment of water from urKREEP into the granites produces an estimate of 100-1000 ppm of water for the urKREEP reservoir. Using the modeling of and the 100-1000 ppm of water in urKREEP suggests a minimum bulk silicate Moon water content between 2 and 20 ppm. However, hydrogen loss was likely very significant in the evolution of the lunar mantle. Conclusions: Lunar granites crystallized between 4.3-3.8 Ga from relatively wet melts that degassed upon crystallization. The formation of these granites likely removed significant amounts of water from some mantle source regions, e.g. later mare basalts predicting derivation from a
Tien procent minder emissies (interview met Chris Karman)
Wolkers, H.; Karman, C.C.
2012-01-01
De nieuwe havensleepboot E3-Tug bespaart brandstof en vermindert emissies. IMARES Wageningen UR ontwikkelde de software die een optimale combinatie berekent van de elektrische en de dieselvoortstuwing.
Gclust Server: 106419 [Gclust Server
Lifescience Database Archive (English)
Full Text Available rly meiotic genes, binds URS1 upstream regulatory sequence, couples metabolic responses to nutritional cues ...ouples metabolic responses to nutritional cues with initiation and progression of
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ur ... transferase [Photobacterium profundum] ... Length = 121 ... Query: 20 ... AQATTISFNDLLVKPTSDI...QIIDCRSSNHYNGWAEDGATQGGHIPGAINIDANWINDLSP 79 ... AQATTISFNDLLVKPTSDIQIIDCR...SSNHYNGWAEDGATQGGHIPGAINIDANWINDLSP Sbjct: 1 ... AQATTISFNDLLVKPTSDIQIIDCRSSNHYNGWAEDGATQGGHIPGAINIDANWINDLSP 60 ... Query: 140 K 140 ... K Sbjct: 121 K 121
42 CFR 456.231 - Continued stay review required.
2010-10-01
... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Mental Hospitals Ur Plan... a review of each recipient's continued stay in the mental hospital to decide whether it is needed...
QUEL CHE RESTA DELLA PSICANALISI. UNA LETTURA MERLEAU‐PONTIANA DI FREUD
Directory of Open Access Journals (Sweden)
Scotti, Alessandra
2015-12-01
Full Text Available This paper investigates Maurice Merleau‐Ponty’s interest about Freud’s philosophical works. It invokes the Freud’s recognition as “Master of the School of suspicion”, a famous definition made by Paul Ricœur. According to Ricœur, Freud’s theories take place within the philosophical stream that looks at “constituted cogito” with deep mistrust. Through the analysis of “Phenomenology of Perception” we can observe the accusation of “pansexuality” moved by Merleau‐Ponty. However, as Merleau‐ Ponty’s philosophy develops and his view changes from “existential” to “ontological”, the relation between Freud and Merleau‐Ponty changes accordingly, until the acknowledgment of the unconscious as a prediction of the “chair”.
International Nuclear Information System (INIS)
Tang, M H; Wang, Z P; Zeng, Z Q; Xu, X L; Wang, G Y; Zhang, L B; Xiao, Y G; Yang, S B; Jiang, B; Li, J C; He, J
2011-01-01
The SrTiO 3 (STO) thin films on a Pt/Ti/SiO 2 /Si substrate were synthesized using a sol–gel method to form a metal–insulator–metal structure. This device shows the bipolar resistance switching (BRS) behavior for a compliance current I cc of less than 0.1 mA but exhibits soft breakdown at a higher level of compliance current. A transition from the BRS behavior to the stable unipolar resistive switching behavior (URS) was also observed. We found that the BRS behavior may be controlled by the structure interface while the URS behavior is likely bulk controlled. Our study indicates that the external compliance current is a key factor in resistance switching phenomenon of STO thin films
Fabrication procedures for manufacturing high uranium concentration dispersion fuel elements
SOUZA, JOSE A.B. de
2014-01-01
O IPEN-CNEN/SP desenvolveu e disponibilizou para produção rotineira a tecnologia de fabricação de elementos combustíveis tipo dispersão, para uso em reatores nucleares de pesquisas. O combustível fabricado no IPEN-CNEN/SP está limitado à concentração de urânio de 3,0gU/cm3, para dispersões a base de U3Si2-Al, e de 2,3gU/cm3, para dispersões a base de U3O8-Al. O aumento da concentração de urânio nas placas combustíveis possibilita aumentar a reatividade do núcleo do reator e a vida útil do com...
Directory of Open Access Journals (Sweden)
Thalita Lázaro Leal
2007-08-01
Full Text Available Objetivou-se estimar as variações nas excreções diárias de creatinina, uréia e derivados de purinas (DP na urina utilizando coletas durante seis dias consecutivos e avaliar as concentrações de nitrogênio uréico no plasma (NUP em novilhos. Utilizaram-se quatro animais, machos castrados, de grau de sangue predominantemente Holandês, peso médio de 445 kg, distribuídos em quadrado latino 4 x 4, com os tratamentos definidos em esquema fatorial 2 x 2 (dois níveis de uréia em substituição ao farelo de soja: 0 e 100%; e dois níveis de oferta de concentrado: 0,75 e 1,25% do PV e a comparação entre dias de avaliação, em esquema de parcelas subdivididas. O volumoso, constituído de silagem de capim-elefante (80% e silagem de sorgo (20%, foi fornecido à vontade. A síntese de compostos nitrogenados microbianos, estimada a partir da excreção de DP, foi maior quando houve maior oferta de concentrado e menor quando a proteína do farelo de soja foi substituída pela uréia. Não houve efeito da interação níveis de concentrado ´ níveis de uréia nem efeito de níveis de uréia sobre a concentração de NUP e a excreção de N-uréico na urina. As excreções urinárias de uréia, alantoína, ácido úrico e a quantidade estimada de proteína microbiana não foram afetadas pelos dias de coleta de urina. Não houve diferença na excreção de creatinina entre os dias de coleta, sendo obtido valor médio de 25,47 mg/kgPV, 117,92 mg/kg0,75 ou 1,04 mmol/kg0,75. A ausência de efeito de número de dias sobre a excreção de creatinina tem grande aplicação prática. Na estimativa da excreção de creatinina e de derivados de purinas, recomendam-se coletas de urina com duração de 24 horas.The objective of this trial was to investigate the daily variation in the urinary excretions of creatinine, urea and purine derivatives (PD as well as the plasma concentration of urea-N (PUN in steers. Four castrated Holstein steers averaging 445 kg
Bloedzuigers in pluimveestallen
Mul, M.F.; Mullens, B.A.; Koenraadt, C.J.M.
2009-01-01
Wageningen UR en Universiteit Amsterdam werken aan mogelijke maatregelen tegen de vogelmijt, Dermanyssus gallinae, in Nederlandse legpluimveestallen. Ook is uitbreiding van een ander vogelmijt-type gesignaleerd: de noordelijke vogelmijt, of Ornithonyssus sylviarum
Janmaat, L.
2008-01-01
Informatiepagina van Wageningen UR en het Louis Bolk Instituut. over het onderzoek aan een biologisch bedrijfssysteem met bloembollen, vaste planten, zomerbloemen en sierheesters in de Bollenstreek, met extra aandacht voor de bodemkwaliteit
QUALIDADE DO MAMÃO 'FORMOSA' SUBMETIDO A DIFERENTES TEMPERATURAS DE REFRIGERAÇÃO
Directory of Open Access Journals (Sweden)
Railene Hérica Carlos Rocha
2007-01-01
Full Text Available The objective of this work was evaluating the principal alterations of the chemical properties of quality of the papaya 'Formosa' under refrigerated storage. The harvest of fruits was accomplished in a commercial planting located in the municipal district of Baraúna-RN. The storage happened in cameras under controlled conditions of temperatures (8, 10 and 12 ºC ± 1 ºC and relative humidity of the air (90 ±5% during periods of 7, 14, 21 and 28 days. After each period, the papayas were transferred to environmental conditions (20 ± 1oC 60 ± 5% UR where a period of shelf life of seven days was simulated. Then, the papayas were analyzed regarding the titratable acidity (ATT, C vitamin, total soluble solids (SS, starch, reducing and non-reducing sugars. A completely randomized experimental design was used, in a factorial 3 x 4 outline (temperatures x time of storage, with five replications and two fruits per plot. The best extension for the post harvest useful life of papaya 'Formosa' was esteemed for the fruits submitted to 10 °C and 90 ± 5% UR up to 20 days, with soluble solids above 12% and C vitamin around 40 mg×100 g-1. The fruits submitted to 8 °C, 90 ± 5% UR had the worst estimates, presenting the smallest contents of SS.
International Nuclear Information System (INIS)
Mozaffari, Sayed Ahmad; Rahmanian, Reza; Abedi, Mohammad; Amoli, Hossein Salar
2014-01-01
Graphical abstract: - Highlights: • Application and optimization of reactive RF magnetron sputtering for homogeneous nanoporous ZnO thin film formation. • Exploiting nanoporous ZnO thin film as a good porous framework with large surface area/volume for having stable immobilized enzyme with minimum loss of activity. • Application of impedimetric assessment for urea biosensing due to its rapidity, sensitivity, and repeatability. - Abstract: Uniform sputtered nanoporous zinc oxide (Nano-ZnO) thin film on the conductive fluorinated-tin oxide (FTO) layer was applied to immobilize urease enzyme (Urs) for urea detection. Highly uniform nanoporous ZnO thin film were obtained by reactive radio frequency (RF) magnetron sputtering system at the optimized instrumental deposition conditions. Characterization of the surface morphology and roughness of ZnO thin film by field emission-scanning electron microscopy (FE-SEM) exhibits cavities of nanoporous film as an effective biosensing area for enzyme immobilization. Step by step monitoring of FTO/Nano-ZnO/Urs biosensor fabrication were performed using electrochemical methods such as cyclic voltammetry (CV) and electrochemical impedance spectroscopy (EIS) techniques. Fabricated FTO/Nano-ZnO/Urs biosensor was used for urea determination using EIS experiments. The impedimetric results show high sensitivity for urea detection within 0.83–23.24 mM and limit of detection as 0.40 mM
International Nuclear Information System (INIS)
Miller, David W.
2014-01-01
Japan's Fukushima Daiichi severe nuclear accident in March 2011 has resulted in a reassessment of nuclear emergency response and preparedness in Canada. On May 26, 27 and 28, 2014 Ontario Power Generation (OPG) conducted the first North American full scale nuclear emergency response exercise designed to include regional, provincial and federal bodies as well as the utility. This paper describes the radiological aspects of the OPG Exercise Unified Response (ExUR) with emphasis on deployment of new Fukushima equipment on the Darlington site, management of emergency workers deplored in the vicinity of Darlington to collect environmental samples and radiation measurements, performance of dose calculations, communication of dose projections and protective actions to local, provincial and federal agencies and conduct of vehicle, truck and personnel monitoring and decontamination facilities. The ExUR involved more than 1000 personnel from local, provincial and federal bodies. Also, 200 OPG employees participated in the off-site emergency response duties. The objective of the ExUR was to test and enhance the preparedness of the utility (OPG), government and non-government agencies and communities to respond to a nuclear emergency. The types of radiological instrumentation and mobile facilities employed are highlighted in the presentation. The establishment of temporary emergency rooms with 8 beds and treatment facilities to manage potentially contaminated injuries from the nuclear emergency is also described. (author)
Directory of Open Access Journals (Sweden)
Fernanda L. Ferreira
Full Text Available ABSTRACT The phytochemical study of the extract leaves from Maytenus distichophylla Mart. and Salacia crassifolia (Mart. ex Schult. G. Don, Celastraceae, resulted in the isolation of 3-oxofriedelane, 3β-hydroxyfriedelane, 3β,24-dihydroxyfriedelane, 3-oxo-28,29-dihydroxyfriedelane, two mixtures of pentacyclic triterpenes (α-amyrin with β-amyrin and 3β-stearyloxy-urs-12-ene with 3β-stearyloxy-olean-12-ene, 3β-palmityloxy-urs-12-ene, the steroid β-sitosterol and its glycosylated derivative β-glucosyl-β-sitosterol, tritriacontanoic acid and the natural polymer gutta percha. The chemical structures of these constituents were established by IR, 1H and 13C NMR spectral data. Crude extracts, the mixtures of triterpenes and the isolated constituents were subjected to in vitro acetylcholinesterase inhibitory evaluation. Acetylcholinesterase inhibitory effect was observed for crude chloroform extract leaves from M. distichophylla (100% and S. crassifolia (97.93 ± 5.63% and for the triterpenes 3β,24-dihydroxyfriedelane (99.05 ± 1.12%, 3-oxo-28,29-dihydroxyfriedelane (90.59 ± 3.76% and 3β-palmityloxy-urs-12-ene (97.93 ± 1.47%. The percent inhibitions induced by these natural products were very similar to those produced by physostigmine (93.94 ± 2.10% a standard acetylcholinesterase inhibitor. Therefore, these results open perspectives for the use of these species as source of compounds with similar physostigmine pharmacological effect.
Effects of road type during transport on lamb welfare and meat quality in dry hot climates.
Miranda-de la Lama, Genaro C; Monge, Paula; Villarroel, Morris; Olleta, Jose Luis; García-Belenguer, Sylvia; María, Gustavo A
2011-06-01
This study determined whether transporting lambs on paved (PR) or unpaved roads (UR) for 3 h had an effect on plasma stress indicators (cortisol, lactate, glucose, creatine kinase [CK], red blood cells, white blood cells, hematocrit, and neutrophil/lymphocyte [N/L] ratio) and instrumental meat quality (pH24, bruising score, water holding capacity [WHC], color, and texture). A total of 48 Rasa Aragonesa male lambs were used that were approximately 100 days old (12.5 kg ± 1.64, carcass weight). The results suggest that transport on unpaved roads had a significant influence on physiological and hematological stress parameters. Road type had a significant effect on all variables, except for white and red blood cells, and hematocrit levels. The UR lambs had significantly higher (at least p ≤ 0.01) cortisol, lactate, glucose, and CK levels and a higher N/L ratio than PR lambs. Meat from UR lambs had some dark-cutting characteristics, with a darker color, higher ultimate pH, and higher tenderness values than PR. In conclusion, lambs transported on unpaved roads had a more intense stress response and poorer meat quality than lambs transported on paved roads. An effort to improve the logistics associated with route planning is necessary to prevent welfare problems during transport to slaughter.
Directory of Open Access Journals (Sweden)
Þorvarður Atli Þórsson
2008-06-01
Full Text Available Í þessari grein er sett fram sú kenning að áhrif hryðjuverkanna 11. september á afstöðu íslenskra stjórnvalda gagnvart hryðjuverkum hafi verið umtalsverð og haft áhrif hvernig við nálguðumst hryðjuverk og þá sem þau fremja. Til að skoða þessi áhrif voru skoðaðar þær ræður utanríkisráðherra og dómsmálaráðherra sem settar hafa verið á heimasíður viðkomandi ráðuneyta, en bæði ráðuneyti telja hryðjuverk vera á dagskrá þeirra. Voru allar ræður og greinar utanríkisráðherra sem birtar voru á tímabilinu 1995-2008 og dómsmálaráðherra sem birtar voru á tímabilinu 1999-2008 skoðaðar, 495 samtals, og athugað var hvort hryðjuverk voru sett í samhengi við alþjóðlega glæpastarfsemi eða alþjóðlega ógn og þjóðaröryggi.
SPECT quantification of 123I - and - CIT in Parkinsonism
International Nuclear Information System (INIS)
Larcos, G.; Shaffi, M.; Hutton, B.F.; Hatton, R.; Kyme, A.; Fung, V.S.C.; Morris, J.G.L.
2002-01-01
Full text: Evaluation of presynaptic dopaminergic function using 2B-carboxymethoxy-3B-(4-[ 123 I] iodophenyl) tropane ( 123 I-and-CIT) SPECT has employed subjective or semi-quantitative methods. Our hypothesis is that disease classification in Parkinsonism may be improved by partial volume correction and co-registration with MRI. We studied seven patients (pts) with IPD (four men, three women, mean age=54.5+/-10.9 yrs; Hoehn and Yahr stage range 1-3; Schwab and England scale range: 30-100 [mean=67.1+/-26.9]) and two controls with 123 I- - CIT using 110-150 MBq and a dual-head camera equipped with fan-beam collimation. SPECT was registered to MRI and then aligned to a reference template. Specific to non-specific dopaminergic binding (UR) was calculated for the putamen and caudate nucleus, as well as the fractional volume (FV; fraction of the Structure affected) and residual uptake ratio (RUR; count density in area/remnant apparently unaffected by disease). Parameters that were statistically significant were the putamen (p; but not caudate) UR, FV and RUR. We conclude that: (a) it is possible to distinguish dopaminergic activity within the putamen from caudate using MRI image co-registration and (b) parameters other than UR may discriminate IPD from normal subjects and other entities. Copyright (2002) The Australian and New Zealand Society of Nuclear Medicine Inc
Treatment of lower ureteric stones by ESWL and ICPL: a comparative study.
Islam, M S; Shameem, I A; Alam, A K M K; Kibria, S A M G
2005-12-01
This study was carried-out to find-out better and effective treatment option for Lower Ureteric Stones (LUS) by comparing Extracorporeal Shock Wave Lithotripsy (ESWL) with ureterorenoscopic (URS) Intracorporeal Pneumatic Lithotripsy (ICPL). A total of 60 patients attending the outpatient department of Bangabandhu Sheikh Mujib Medical University (BSMMU) with lower ureteric stones were divided into two groups, 30 in group-I (URS + ICPL) and the remaining 30 in group-II (ESWL). In group-I, 60% were male with mean age of 32.76 years and in group-II, 40% were male with mean age of 36.23 years. The ratio of involvement of right to left ureter was 1.7:1. The mean stone size was 10.7 + 2.69 mm (SD) in group-I and 9.9 + 1.97 mm (SD) in group-II. The differences in age, sex and side of involvement of ureter were not significant (p > 0.05) between the two groups. Among the groups 24 (80%) in group-I and 26 (86.61%) of patients in group-II were found stone free. The post procedure loin pain, fever and haematuria were more common in group-I than in group-II. The LUTS and loin pain were significantly more in group-I than in group-II (p ESWL was found effective method than URS + ICPL for the treatment of lower ureteric stones.
Yield and cost of individual common diagnostic tests in new primary care outpatients in Japan.
Takemura, Yuzuru; Ishida, Haku; Inoue, Yuji; Beck, J Robert
2002-01-01
Appropriate diagnostic testing involves considerations of cost-effectiveness. We examined the cost-effectiveness of individual tests in a panel of tests defined by the Japan Society of Clinical Pathology. We studied 540 new, symptomatic primary care outpatients with a set of 30 common diagnostic tests [the Essential Laboratory Tests (2); ELT(2) panel] for clinical evaluation and identification of occult disease. A useful result (UR) of testing was defined as a finding that contributed to a change in a physician's diagnosis or decision-making relating to a "tentative initial diagnosis" obtained from history and physical examination alone. The ELT(2) panel testing yielded 398 URs and uncovered 261 occult diseases among 540 patients. In total, 1592 tests contributed to either UR-generation or discovery of occult disease. The cost per effective test (cost required per test that contributed to either definition of effectiveness) ranged from 108 yen (approximately 0.92 US dollars) for total cholesterol to 6200 yen (approximately 52.50 dollars) for chest x-ray. Contribution rates and the cost per effective test varied among disease categories. We restructured panel components considering the effectiveness of each test. Subsets of the ELT(2) would have improved cost-effectiveness and achieved cost savings in five of eight disease categories. Assembly of tests based on cost-effectiveness can improve clinical efficiency and decrease total cost of panel testing for selected patient groups.
'Welzijnsvloer verdient zich op den duur terug'; van den Berg beproeft de groene vlag roostervloer
Anoniem,
2010-01-01
Het onderzoek van Wageningen UR naar de welzijnsvloeren is nog in volle gang. Maar vleeskalverhouder Wijnand van den Berg uit Kootwijkerbroek heeft op eigen initiatief al een welzijnsrooster in zijn stal op proef
Professor Atta invited to attend WSIS as `eminent scientist'
2003-01-01
Ministry of Science and Technology Prof. Atta-ur-Rahman has been nominated as an "eminent scientist" to attend the roundtables during "World Summit on the Information Society (WSIS)" on December 12 (1 paragraph).
Samen rekenen aan duurzaamheid
Boone, J.A.
2011-01-01
Internationale bedrijven, van Walmart en Ahold tot Unilever en McDonalds, gaan samen standaardmethoden vaststellen voor het meten van de duurzaamheid van hun producten. Wageningen UR wordt het Europese centrum van de samenwerking.
How to decide the optimal scheme and the optimal time for construction
International Nuclear Information System (INIS)
Gjermundsen, T.; Dalsnes, B.; Jensen, T.
1991-01-01
Since the development in Norway began some 105 years ago the mean annual generation has reached approximately 110 TWh. This means that there is a large potential for uprating and refurbishing (U/R). A project undertaken by the Norwegian Water Resources and Energy Administration (NVE) has identified energy resources by means of U/R to about 10 TWh annual generation. One problem in harnessing the potential owned by small and medium sized electricity boards is the lack of simple tools to help us carry out the right decisions. The paper describes a simple model to find the best solution of scheme and the optimal time to start. The principle of present value is used. The main input is: production, price, annual costs of maintenance, the remaining lifetime and the social rate of return. The model calculates the present value of U/R/N for different points of time to start U/R/N. In addition the present value of the existing plant is calculated. Several alternatives can be considered. The best one will be the one which gives the highest present value according to the value of the existing plant. The internal rate of return is also calculated. To be aware of the sensitivity a star diagram is shown. The model gives the opportunity to include environmental charges and the value of effect (peak power). (Author)
Directory of Open Access Journals (Sweden)
Cristiane Maria A Morgado
2008-06-01
Full Text Available Este trabalho teve como objetivo avaliar diferentes temperaturas e coberturas na conservação de frutos de pimentão 'Magali-R'. No primeiro experimento, avaliou-se o uso de filme de PVC ou cera, e os frutos foram armazenados a 20ºC e 66%UR, e no segundo experimento associou-se o filme de PVC e cera, com armazenamento a 22°C (67% UR; 12ºC (90% UR e 5ºC (87% UR. Acompanhou-se a evolução da qualidade dos frutos avaliando-se a massa fresca, a aparência, o aparecimento de podridões e os teores de sólidos solúveis, acidez titulável e ácido ascórbico. A proteção dos pimentões com cera ou filme de PVC foi favorável à manutenção da aparência e da massa fresca, e protegeu-os contra podridões, sem prejuízos aos teores de sólidos solúveis, acidez titulável e ácido ascórbico, com aumento significativo na vida útil para até 33 dias com o armazenamento a 5°C.Different temperatures and films were evaluated for the conservation of 'Magali-R' bell peppers. In the first experiment, fruits were covered with PVC film or wax, and stored under 20ºC and 66% RH. In the second, fruits covered with PVC film or wax, and stored under 22ºC (67% RH; 12ºC (90% RH; and 5ºC (87% RH. Fruits were evaluated for fresh mass, appearance, rot and soluble solids, titratable acidity and ascorbic acid content. The protection of bell peppers with wax or PVC film helped to maintain the appearance, the fresh mass and to protect against rotting, without damages to soluble solids, titratable acidity and ascorbic acid contents, with significant increase in shelf life up to 33 days with storage under 5°C.
Fluorescence tracers as a reference for pesticide transport in wetland systems
Lange, Jens; Passeport, Elodie; Tournebize, Julien
2010-05-01
Two different fluorescent tracers, Uranine (UR) and Sulforhodamine (SRB), were injected as a pulse into surface flow wetlands. Tracer breakthrough curves were used to document hydraulic efficiencies, peak attenuation and retention capacities of completely different wetland systems. The tracers were used as a reference to mimic photolytic decay (UR) and sorption (SRB) of contaminants, since a real herbicide (Isoproturon, IPU) was injected in parallel to UR and SRB. Analysis costs limited IPU sampling frequency and single samples deviated from the tracer breakthrough curves. Still, a parallel behavior of IPU and SRB could be observed in totally different wetland systems, including underground passage through drainage lines. Similar recovery rates for IPU and SRB confirmed this observation. Hence, SRB was found to be an appropriate reference tracer to mimic the behavior of mobile pesticides (low KOC, without degradation) in wetland systems and the obtained wetland characteristics for SRB may serve as an indication for contaminant retention. Owing to the properties of IPU, the obtained results should be treated as worst case scenarios for highly mobile pesticides. A comparison of six different wetland types suggested that non-steady wetland systems with large variation in water level may temporally store relatively large amounts of tracers (contaminants), partly in areas that are not continuously saturated. This may lead to an efficient attenuation of peak concentrations. However, when large parts of these systems are flushed by natural storm events, tracers (contaminants) may be re-mobilized. In steady systems vegetation density and water depth were found to be the most important factors for tracer/contaminant retention. Illustrated by SRB, sorption on sediments and vegetation was a quick, almost instantaneous process which lead to considerable tracer losses even at high flow velocities and short contact times. Shallow systems with dense vegetation appeared to be the
Dragos, Laurian B; Somani, Bhaskar K; Sener, Emre T; Buttice, Salvatore; Proietti, Silvia; Ploumidis, Achilles; Iacoboaie, Catalin T; Doizi, Steeve; Traxer, Olivier
2017-07-01
Modern flexible ureteroscopes (fURSs) have good deflection, but despite this, approaching an acute angled calix can still be difficult. The goals of our in vitro study were to assess the ability of the available modern fURSs to effectively access the sharp angled calices and to compare the end-tip deflection of the various fiber-optic and digital fURSs. Using a bench-training model for FURS (K-Box, Porgès-Coloplast), we tried to access an acute angled calix with nine different fURSs (BOA vision, COBRA vision, R.Wolf; FLEX X 2 , FLEX Xc, K.Storz; LithoVue, Boston Scientific; URF-P5, URF-P6, URF-V, URF-V2, Olympus). Passing the fURSs through a ureteral access sheath (ReTrace, Porgès-Coloplast), the maximum end-tip deflection for every fURS was measured with the tip extended out from the sheath at 1, 2, 3, and 4 cm. Two ranking methods were designed for scoring the fURSs, one based on total ranking points and the other on total degrees of deflection. While all fiber-optic fURSs (except URF-P6) were able to access the sharp angled calix, none of the digital fURSs (except FLEX Xc) reached the difficult angled calix. Similarly, all fiber-optic fURSs had better end-tip deflection compared with the digital fURSs, except FLEX Xc, which was as deflectable as the fiber-optic fURSs. The fURSs showed an end-tip deflection (median difference of almost 21°) in favor of fiber-optic fURSs. Based on the scoring, the highest ranked fURS (best deflection) was FLEX X2 and the lowest ranked fURS (worst deflection) was URF-V2. Digital fURSs were less effective in accessing the sharp angled calix and they had lesser end-tip deflection compared with the fiber-optic counterparts. When approaching a difficult lower pole calix, it might be better to use a fiber-optic fURS.