WorldWideScience

Sample records for university laboratories uspas

  1. Education in a rapidly advancing technology: Accelerators and beams

    International Nuclear Information System (INIS)

    Month, Mel

    2000-01-01

    The field of accelerators and beams (A and B) is one of today's fast changing technologies. Because university faculties have not been able to keep pace with the associated advancing knowledge, universities have not been able to play their traditional role of educating the scientists and engineers needed to sustain this technology for use in science, industry, commerce, and defense. This problem for A and B is described and addressed. The solution proposed, a type of ''distance'' education, is the U.S. Particle Accelerator School (USPAS) created in the early 1980s. USPAS provides the universities with a means of serving the education needs of the institutions using A and B, primarily but not exclusively the national laboratories. The field of A and B is briefly summarized. The need for education outside the university framework, the raison d'etre for USPAS, the USPAS method, program structure, and curriculum, and particular USPAS-university connections are explained. The management of USPAS is analyzed, including its unique administrative structure, its institutional ties, and its operations, finance, marketing, and governmental relations. USPAS performance over the years is documented and a business assessment is made. Finally, there is a brief discussion of the future potential for this type of educational program, including possible extrapolation to new areas and/or different environments, in particular, its extra-government potential and its international possibilities. (c) 2000 American Association of Physics Teachers

  2. US PARTICLE ACCELERATOR SCHOOL: Summer schools

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1989-11-15

    Continuing it's educational efforts, the US Particle Accelerator School (USPAS) held two summer schools this year. The USPAS has two basic purposes — education in accelerator physics and technology, in particular to train apprentices and update experts; and to encourage US universities and Laboratories to offer programmes in accelerator physics by developing textbooks, training faculty, and organizing schools.

  3. US PARTICLE ACCELERATOR SCHOOL: Summer schools

    International Nuclear Information System (INIS)

    Anon.

    1989-01-01

    Continuing it's educational efforts, the US Particle Accelerator School (USPAS) held two summer schools this year. The USPAS has two basic purposes — education in accelerator physics and technology, in particular to train apprentices and update experts; and to encourage US universities and Laboratories to offer programmes in accelerator physics by developing textbooks, training faculty, and organizing schools

  4. Acinetobacter baumannii universal stress protein A plays a pivotal role in stress response and is essential for pneumonia and sepsis pathogenesis.

    Science.gov (United States)

    Elhosseiny, Noha M; Amin, Magdy A; Yassin, Aymen S; Attia, Ahmed S

    2015-01-01

    Acinetobacter baumannii is one of the most significant threats to global public health. This threat is compounded by the fact that A. baumannii is rapidly becoming resistant to all relevant antimicrobials. Identifying key microbial factors through which A. baumannii resists hostile host environment is paramount to the development of novel antimicrobials targeting infections caused by this emerging pathogen. An attractive target could be a molecule that plays a role in the pathogenesis and stress response of A. baumannii. Accordingly, the universal stress protein A (UspA) was chosen to be fully investigated in this study. A platform of A. baumannii constructs, expressing various levels of the uspA gene ranging from zero to thirteen folds of wild-type level, and a recombinant E. coli strain, were employed to investigate the role of UspA in vitro stress and in vivo pathogenesis. The UspA protein plays a significant role in protecting A. baumannii from H(2)O(2), low pH, and the respiratory toxin 2,4-DNP. A. baumannii UspA protein plays an essential role in two of the deadliest types of infection caused by A. baumannii; pneumonia and sepsis. This distinguishes A. baumannii UspA from its closely related homolog, the Staphylococcus aureus Usp2, as well as from the less similar Burkholderia glumae Usps. Heterologous and overexpression experiments suggest that UspA mediates its role via an indirect mechanism. Our study highlights the role of UspA as an important contributor to the A. baumannii stress and virulence machineries, and polishes it as a plausible target for new therapeutics. Copyright © 2014 Elsevier GmbH. All rights reserved.

  5. The United States Particle Accelerator School: Educating the Next Generation of Accelerator Scientists and Engineers

    International Nuclear Information System (INIS)

    Barletta, William A.

    2009-01-01

    Only a handful of universities in the US offer any formal training in accelerator science. The United States Particle Accelerator School (USPAS) is National Graduate Educational Program that has developed a highly successful educational paradigm that, over the past twenty-years, has granted more university credit in accelerator/beam science and technology than any university in the world. Sessions are held twice annually, hosted by major US research universities that approve course credit, certify the USPAS faculty, and grant course credit. The USPAS paradigm is readily extensible to other rapidly developing, cross-disciplinary research areas such as high energy density physics.

  6. The United States Particle Accelerator School: Educating the next generation of accelerator scientists and engineers

    International Nuclear Information System (INIS)

    Barletta, William A.

    2008-01-01

    Only a handful of universities in the US offer any formal training in accelerator science. The United States Particle Accelerator School (USPAS) is National Graduate Educational Program that has developed a highly successful educational paradigm that, over the past twenty-years, has granted more university credit in accelerator / beam science and technology than any university in the world. Sessions are held twice annually, hosted by major US research universities that approve course credit, certify the USPAS faculty, and grant course credit. The USPAS paradigm is readily extensible to other rapidly developing, crossdisciplinary research areas such as high energy density physics

  7. [Future roles of clinical laboratories and clinical laboratory technologists in university hospitals].

    Science.gov (United States)

    Yokota, Hiromitsu; Yatomi, Yutaka

    2013-08-01

    Clinical laboratories in university hospitals should be operated with a good balance of medical practice, education, research, and management. The role of a clinical laboratory is to promptly provide highly reliable laboratory data to satisfy the needs of clinicians involved in medical practice and health maintenance of patients. Improvement and maintenance of the quality of the laboratory staff and environment are essential to achieve this goal. In order to implement these requirements efficiently, an appropriate quality management system should be introduced and established, and evaluated objectively by a third party (e.g. by obtaining ISO 15189 certification). ISO 15189 is an international standard regarding the quality and competence of clinical laboratories, and specifies a review of the efficient operational system and technical requirements such as competence in implementing practical tests and calibration. This means the results of laboratory tests reported by accredited laboratories withstand any international evaluation, which is very important to assure the future importance of the existence and management of clinical laboratories as well as internationalization of medical practice. "Education" and "research" have important implications in addition to "medical practice" and "management", as the roles that clinical laboratories should play in university hospitals. University hospital laboratories should be operated by keeping these four factors in good balance. Why are "education" and "research" required in addition to "medical practice" services? If individual clinical laboratory technologists can provide an appropriate response to this question, the importance of the existence of clinical laboratories would be reinforced, without being compromised.

  8. Universal stress proteins are important for oxidative and acid stress resistance and growth of Listeria monocytogenes EGD-e in vitro and in vivo.

    Directory of Open Access Journals (Sweden)

    Christa Seifart Gomes

    Full Text Available BACKGROUND: Pathogenic bacteria maintain a multifaceted apparatus to resist damage caused by external stimuli. As part of this, the universal stress protein A (UspA and its homologues, initially discovered in Escherichia coli K-12 were shown to possess an important role in stress resistance and growth in several bacterial species. METHODS AND FINDINGS: We conducted a study to assess the role of three homologous proteins containing the UspA domain in the facultative intracellular human pathogen Listeria monocytogenes under different stress conditions. The growth properties of three UspA deletion mutants (Δlmo0515, Δlmo1580 and Δlmo2673 were examined either following challenge with a sublethal concentration of hydrogen peroxide or under acidic conditions. We also examined their ability for intracellular survival within murine macrophages. Virulence and growth of usp mutants were further characterized in invertebrate and vertebrate infection models. Tolerance to acidic stress was clearly reduced in Δlmo1580 and Δlmo0515, while oxidative stress dramatically diminished growth in all mutants. Survival within macrophages was significantly decreased in Δlmo1580 and Δlmo2673 as compared to the wild-type strain. Viability of infected Galleria mellonella larvae was markedly higher when injected with Δlmo1580 or Δlmo2673 as compared to wild-type strain inoculation, indicating impaired virulence of bacteria lacking these usp genes. Finally, we observed severely restricted growth of all chromosomal deletion mutants in mice livers and spleens as compared to the load of wild-type bacteria following infection. CONCLUSION: This work provides distinct evidence that universal stress proteins are strongly involved in listerial stress response and survival under both in vitro and in vivo growth conditions.

  9. Radiation monitoring programme in a university hot laboratory

    International Nuclear Information System (INIS)

    Tillander, M.; Heinonen, O.J.

    1979-01-01

    The Department of Radiochemistry in the University of Helsinki is the only institute teaching radiochemistry at the university level in Finland. The research programme of the Deparment must therefore include the uses of radiation and radionuclides in many branches of science. The students must receive adequate instruction in radiation protection for safe work in laboratories. This also has the educational benefit that the radiochemists will subsequently be able to observe the necessary safety precautions when employing ionizing radiation professionally. The Department of Radiochemistry consists of the following laboratories: a radiotracer laboratory, a neutron/electron and a gamma irradiation laboratory, an environmental low activity level laboratory, a whole-body counting laboratory, a reactor chemistry laboratory and a waste-treatment facility. The radiation protection organization of the Department is presented. Various methods of monitoring, including advantages and disadvantages are discussed. Emphasis is placed on the reactor chemistry laboratory where transuranic elements are utilized. These elements are highly radiotoxic and their monitoring in most cases requires destructive analysis. Different methods of determining external and internal doses are evaluated with regard to sensitivity and accuracy. Detection limits for radionuclides utilized in the laboratory are presented for different measurement systems, including non-destructive monitoring, spectrometry after chemical analysis, liquid scintillation counting and low-energy gamma spectrometry using a CsI-NaI scintillation detector. The guidelines laid down in the IAEA Safety Series Manuals are discussed in the light of practical experience. (author)

  10. Universities and national laboratory roles in nuclear engineering

    International Nuclear Information System (INIS)

    Sackett, J.I.

    1991-01-01

    Nuclear Engineering Education is being significantly challenged in the United States. The decline in enrollment generally and the reduction of the number of nuclear engineering departments has been well documented. These declines parallel a lack of new construction for nuclear power plants and a decline in research and development to support new plant design. Precisely at a time when innovation is is needed to deal with many issues facing nuclear power, the number of qualified people to do so is being reduced. It is important that the University and National Laboratory Communities cooperate to address these issues. The Universities must increasingly identify challenges facing nuclear power that demand innovative solutions and pursue them. To be drawn into the technology the best students must see a future, a need and identify challenges that they can meet. The University community can provide that vision with help from the National Laboratories. It has been a major goal within the reactor development program at Argonne National Laboratory to establish the kind of program that can help accomplish this

  11. Annual Report 2002 of Warsaw University, Heavy Ion Laboratory

    International Nuclear Information System (INIS)

    2003-01-01

    The Annual Report of Warsaw University Heavy Ion Laboratory is the overview of the Laboratory and assembly of scientific activities of the team especially in the range of instrumental development, experiments and experimental set-ups and experiments using outside facilities of Warsaw Cyclotron

  12. A university hot laboratory for teaching and research

    International Nuclear Information System (INIS)

    Heinonen, O.; Miettinen, J.K.

    1976-01-01

    In small countries which have limited material and capital resources there is more need for studying and teaching reactor chemistry in universities than there is in countries with special nuclear research and training centres. A new 150-m 2 laboratory of reactor chemistry was added to the premises of the Department of Radiochemistry, University of Helsinki, in October 1975. It contains a hot area with low-pressure air-conditioning, a sanitary room, a low-activity area, and an office area. The main instrument is a mass-spectrometer MI-1309 equipped with an ion counter which is particularly useful for plutonium analysis. The laboratory can handle samples up-to 10Ci gamma-acitivity - which equals one pellet of a fuel rod - in a sealed lead cell which has an interchangeable box for alpha-active work. Pretreated samples are submitted to chemical separations in glove-boxes. Samples for alpha and mass spectroscopy are also prepared in glove-boxes. Also the laboratory is provided with fume hoods suitable for building lead shields. Radiation protection and special features typical to the university environment are discussed. Methods for verfication of contamination and protection against internal and external contamination are applied. These include air monitoring, analysis of excreta, and whole-body counting. (author)

  13. A new nuclear materials laboratory at Queen's University

    International Nuclear Information System (INIS)

    Holt, R.A.; Daymond, M.R.

    2015-01-01

    The Reactor Materials Testing Laboratory (RMTL) at Queen's University and the results of commissioning tests are described. RMTL uses energetic protons (up to 8MeV) to simulate fast neutron damage in materials for reactor components. The laboratory is also capable of He implantation (up to 12 MeV) to simulate the effects of transmutation He in reactor components. The $17.5M laboratory comprises a new building, a 4MV tandem accelerator, two electron microscopes, mechanical testing and specimen preparation equipment, and a radiation detection laboratory. RMTL focusses on studying dynamic effects of irradiation (irradiation creep, irradiation growth, irradiation induced swelling, fatigue under irradiation) in-situ. (author)

  14. Relationship of HS CRP and Sacroiliac Joint Inflammation in Undifferentiated Spondyloarthritis.

    Science.gov (United States)

    Liu, Te-Jung; Chang, Cheng-Chiang; Chen, Liang-Cheng; Chu, Heng-Yi; Hsu, Chun-Sheng; Chang, Shin-Tsu

    2018-01-01

    Elevation of serum high sensitivity C-reactive protein (hs-CRP) level has been demonstrated as a risk factor for varying diseases, as well as a biomarker for predicting recovery after operation of lumber disc herniation. Our objective was to investigate the relationship between serum hs-CRP and sacroiliac (SI) joint inflammation in patients with undifferentiated spondyloarthritis (uSpA). In this retrospective study, we enrolled patients with uSpA who underwent hs-CRP testing between January 2007 and September 2013. Serum hs-CRP was analyzed at our central laboratory. All enrolled patients underwent skeletal scintigraphic scan with quantitative sacroiliac measurement. A total of 29 patients were enrolled with mean age 32.27 years and female:male ratio of 6:23. Pearson's correlation coefficient showed a significant difference between hs-CRP in serum and SI/S ratio in uSpA, particularly the middle part of the sacroiliac joint, either right side or left side. The significantly high concentration of serum hs-CRP might indicate a systemic inflammatory response to flare-up of the SI joint and might be an indicator of SI inflammation in uSpA.

  15. Relationship of HS CRP and Sacroiliac Joint Inflammation in Undifferentiated Spondyloarthritis

    Science.gov (United States)

    Liu, Te-Jung; Chang, Cheng-Chiang; Chen, Liang-Cheng; Chu, Heng-Yi; Hsu, Chun-Sheng; Chang, Shin-Tsu

    2018-01-01

    Abstract Objective Elevation of serum high sensitivity C-reactive protein (hs-CRP) level has been demonstrated as a risk factor for varying diseases, as well as a biomarker for predicting recovery after operation of lumber disc herniation. Our objective was to investigate the relationship between serum hs-CRP and sacroiliac (SI) joint inflammation in patients with undifferentiated spondyloarthritis (uSpA). Methods In this retrospective study, we enrolled patients with uSpA who underwent hs-CRP testing between January 2007 and September 2013. Serum hs-CRP was analyzed at our central laboratory. All enrolled patients underwent skeletal scintigraphic scan with quantitative sacroiliac measurement. Results A total of 29 patients were enrolled with mean age 32.27 years and female:male ratio of 6:23. Pearson’s correlation coefficient showed a significant difference between hs-CRP in serum and SI/S ratio in uSpA, particularly the middle part of the sacroiliac joint, either right side or left side. The significantly high concentration of serum hs-CRP might indicate a systemic inflammatory response to flare-up of the SI joint and might be an indicator of SI inflammation in uSpA. PMID:29785410

  16. The University of New Mexico/Sandia National Laboratories small-angle scattering laboratory

    International Nuclear Information System (INIS)

    Rieker, T.P.; Hubbard, P.F.

    1998-01-01

    The University of New Mexico/Sandia National Laboratories small-angle scattering laboratory provides a wide q-range, 3x10 -4 Angstrom -1 -1 , for the structural analysis of materials on length scales from a few angstrom to ∼0.1 μm. The wide q-range is accomplished by combining data from a Bonse-Hart spectrometer (3x10 -4 Angstrom -1 -2 Angstrom -1 ) and a 5 m pinhole (3x10 -3 Angstrom -1 -1 ) instrument. Automation of the data acquisition systems along with a variety of sample environments and sample changers yields flexible, high throughput instruments. copyright 1998 American Institute of Physics

  17. Research Collaborations Between Universities and Department of Defense Laboratories

    Science.gov (United States)

    2014-07-31

    Council – Resident Research Associateship (USAF/NRC-RRA) Program,” last accessed March 10, 2013, http://www.wpafb.af.mil/ library /factsheets...as CRAs and CTAs, could enable collaboration through university consortia designed to support DOD laboratory research. Such alliances would have the...university consortia , may be able to leverage partnerships that meet their collaborative research needs. 5. Increased Patent Filing Fees when Partnering

  18. Heavy Ion Laboratory - Warsaw University - Annual Report 2003

    International Nuclear Information System (INIS)

    Pienkowski, L.; Zielinska, M.

    2004-01-01

    In the presented report the research activities of Heavy Ion Laboratory (HIL) of the Warsaw University in year of 2003 are described. The report is divided into four parts: Laboratory Overview, Experiments and Experimental Set-ups, Experiments using outside facilities and General information on HIL activities which contain the lists of personnel, seminars held at the HIL as well as external ones, the list of published papers and conference contributions. A summary of the (HIL) activities is briefly presented in ''Introduction'' written by HIL director prof. J. Jastrzebski

  19. Accelerator facility in a small laboratory of a private university

    International Nuclear Information System (INIS)

    Washio, Masakazu

    2005-01-01

    Washio laboratory in Waseda University started the project team in 1999 and finished tests of all machines in 2000. High brilliant soft X-ray generation by inverse Compton scattering and the pico-second pulse radiolysis system were developed. The time profile of creation of hydrated electron was obtained by the system in 2003. Determination of accelerator spec and cooperation of University, and set up of accelerator, preparation of research group, cooperation with KEK, student training, beam experiments, experiments and future is stated. This system was constructed and operated by many students in his laboratory, and supported by many members of KEK-ATF, Waseda University, Sumitomo Heavy Industries, Ltd., High Technology Research Center Project of Ministry of Education, Culture, Sports, Science and Technology, and Grant-in-Aid for Scientific Research of Japan Society for the Promotion Science. (S.Y.)

  20. Government-industry-uUniversity and rResearch lLaboratories cCoordination for new product development: Session 2. Government research laboratory perspective

    International Nuclear Information System (INIS)

    Kuzay, T.M.

    1997-01-01

    This talk is the second in an expanded series of presentations on the Government-Industry-University and Research Laboratories Coordination for new product development, which is a timely and important public policy issue. Such interactions have become particularly timely in light of the present decline in funding for research and development (R ampersand D) in the nation''s budget and in the private sector. These interactions, at least in principle, provide a means to maximize benefits for the greater good of the nation by pooling the diminishing resources. National laboratories, which traditionally interacted closely with the universities in educational training, now are able to also participate closely with industry in joint R ampersand D thanks to a number of public laws legislated since the early 80s. A review of the experiences with such interactions at Argonne National Laboratory, which exemplifies the national laboratories, shows that, despite differences in their traditions and the missions, the national laboratory-industry-university triangle can work together

  1. Effects of Students' Pre- and Post-Laboratory Concept Maps on Students' Attitudes toward Chemistry Laboratory in University General Chemistry

    Science.gov (United States)

    Kilic, Ziya; Kaya, Osman Nafiz; Dogan, Alev

    2004-01-01

    The purpose of this study was to investigate the effects of scientific discussions based on student-constructed pre- and post-laboratory concept maps on students' attitudes toward chemistry laboratory in the university general chemistry. As part of instruction, during the first four laboratory sessions, students were taught how to construct and…

  2. Google+ as a Tool for Use in Cooperative Laboratory Activities between Universities

    Science.gov (United States)

    Puig-Ortiz, Joan; Pàmies-Vilà, Rosa; Martinez Miralles, Jordi Ramon

    2015-01-01

    The following is a proposal for collaboration between universities with the aim to improve curricula that require laboratory activities. A methodology is suggested to implement an innovative educational project involving the exchange of laboratory activities. The exchange of laboratory activities can be carried out on different levels of…

  3. Building a Laboratory: the Work of Global University Rankers

    DEFF Research Database (Denmark)

    Lim, Miguel Antonio

    2015-01-01

    ’, and more relevant products. The metaphor allows us to understand the changeability of rankings and highlights that the process of making rankings can be influenced by the different audiences they are aimed at. University leaders are not passive players in the recognition of expertise in higher education...... evaluation. I present some of the ways in which these leaders are part of the process from the lesser known point-of-view of the ranking organisations. I propose three questions: 1) Can the university ranker be thought of as a ‘laboratory’? 2) How does the university ranking laboratory produce its ‘science...

  4. Annual report of Nuclear Engineering Research Laboratory, University of Tokyo in fiscal 1989

    International Nuclear Information System (INIS)

    1990-01-01

    This report summerizes the research and educational activities at the Nuclear Engineering Research Laboratory, Faculty of Engineering, University of Tokyo. The Laboratory holds four main facilities, which are Yayoi reactor, an electron accelerator, fusion blanket research facility, and heavy ion irradiation research facility. And they are open to the researchers both inside and outside the University. The application of the facilities are described. The activities and achievements of the Laboratory staffs, and theses for graduate, master, and doctor degrees are also summerized. (J.P.N.)

  5. A new nuclear materials laboratory at Queen's University

    Energy Technology Data Exchange (ETDEWEB)

    Holt, R.A.; Daymond, M.R., E-mail: holt@queensu.ca, E-mail: daymond@queensu.ca [Queen' s University, Department of Mechanical and Materials Engineering, Kingston, ON (Canada)

    2015-07-01

    The Reactor Materials Testing Laboratory (RMTL) at Queen's University and the results of commissioning tests are described. RMTL uses energetic protons (up to 8MeV) to simulate fast neutron damage in materials for reactor components. The laboratory is also capable of He implantation (up to 12 MeV) to simulate the effects of transmutation He in reactor components. The $17.5M laboratory comprises a new building, a 4MV tandem accelerator, two electron microscopes, mechanical testing and specimen preparation equipment, and a radiation detection laboratory. RMTL focusses on studying dynamic effects of irradiation (irradiation creep, irradiation growth, irradiation induced swelling, fatigue under irradiation) in-situ. (author)

  6. Broad scope educational role of a midsize university reactor NAA laboratory

    International Nuclear Information System (INIS)

    Vernetson, W.G.

    2000-01-01

    Broad scope educational activities at the Neutron Activation Analysis Laboratory (NAAL) associated with the 100 kW University of Florida Training Reactor (UFTR) have been implemented to serve a deserve and multidisciplinary academic clientele to meet a wide spectrum of educational needs for students at all academic levels. Educational usage of the complementary laboratory facilities is described and the importance of such academic experimental experience is emphasized for developing and maintaining a cadre of professionals in the analytical applications of nuclear energy. The synergistic operation of the NAAL and the reactor at the University of Florida to serve as a model worthy of emulation for other similar facilities is emphasized. (author)

  7. The Relationships between University Students' Chemistry Laboratory Anxiety, Attitudes, and Self-Efficacy Beliefs

    Science.gov (United States)

    Kurbanoglu, N. Izzet; Akin, Ahmet

    2010-01-01

    The aim of this study is to examine the relationships between chemistry laboratory anxiety, chemistry attitudes, and self-efficacy. Participants were 395 university students. Participants completed the Chemistry Laboratory Anxiety Scale, the Chemistry Attitudes Scale, and the Self-efficacy Scale. Results showed that chemistry laboratory anxiety…

  8. The proposed Diagnostic Instrumentation and Analysis Laboratory, Mississippi State University

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-11-01

    The Department of Energy (DOE) proposes to authorize Mississippi State University (MSU) to proceed with the detailed design, construction and equipping of the proposed Diagnostic Instrumentation and Analysis Laboratory (DIAL). DOE grant funds are available to the University for the limited purpose of performing preliminary studies, including analysis necessary to conduct this environmental assessment. The proposed facility would be located in the Mississippi Research and Technology Park, adjacent to the Mississippi Agriculture and Forestry Experiment Station campus in Starkville, Mississippi. Total project cost is estimated at $7,953,600. This proposed laboratory would be designed to conduct research into combustion devices related to waste management and environmental restoration that is of importance to industry and government. The proposed facility`s role would be to develop diagnostic instrumentation capabilities in the area of combustion and related processes.

  9. Using Cluster Analysis to Characterize Meaningful Learning in a First-Year University Chemistry Laboratory Course

    Science.gov (United States)

    Galloway, Kelli R.; Bretz, Stacey Lowery

    2015-01-01

    The Meaningful Learning in the Laboratory Instrument (MLLI) was designed to measure students' cognitive and affective learning in the university chemistry laboratory. The MLLI was administered at the beginning and the end of the first semester to first-year university chemistry students to measure their expectations and experiences for learning in…

  10. Reactor laboratory course for students majoring in nuclear engineering with the Kyoto University Critical Assembly (KUCA)

    International Nuclear Information System (INIS)

    Nishihara, H.; Shiroya, S.; Kanda, K.

    1996-01-01

    With the use of the Kyoto University Critical Assembly (KUCA), a joint reactor laboratory course of graduate level is offered every summer since 1975 by nine associated Japanese universities (Hokkaido University, Tohoku University, Tokyo Institute of Technology, Musashi Institute of Technology, Tokai University, Nagoya University, Osaka University, Kobe University of Mercantile Marine and Kyushu University) in addition to a reactor laboratory course of undergraduate level for Kyoto University. These courses are opened for three weeks (two weeks for the joint course and one week for the undergraduate course) to students majoring in nuclear engineering and a total of 1,360 students have taken the course in the last 21 years. The joint course has been institutionalized with the background that it is extremely difficult for a single university in Japan to have her own research or training reactor. By their effort, the united faculty team of the joint course have succeeded in giving an effective, unique one-week course, taking advantage of their collaboration. Last year, an enquete (questionnaire survey) was conducted to survey the needs for the educational experiments of graduate level and precious data have been obtained for promoting reactor laboratory courses. (author)

  11. Evaluating laboratory key performance using quality indicators in Alexandria University Hospital Clinical Chemistry Laboratories.

    Science.gov (United States)

    Rizk, Mostafa M; Zaki, Adel; Hossam, Nermine; Aboul-Ela, Yasmin

    2014-12-01

    The performance of clinical laboratories plays a fundamental role in the quality and effectiveness of healthcare. To evaluate the laboratory performance in Alexandria University Hospital Clinical Laboratories using key quality indicators and to compare the performance before and after an improvement plan based on ISO 15189 standards. The study was carried out on inpatient samples for a period of 7 months that was divided into three phases: phase I included data collection for evaluation of the existing process before improvement (March-May 2012); an intermediate phase, which included corrective, preventive action, quality initiative and steps for improvement (June 2012); and phase II, which included data collection for evaluation of the process after improvement (July 2012-September 2012). In terms of the preanalytical indicators, incomplete request forms in phase I showed that the total number of received requests were 31 944, with a percentage of defected request of 33.66%; whereas in phase II, there was a significant reduction in all defected request items (Plaboratories.

  12. The Los Alamos universe: Using multimedia to promote laboratory capabilities

    Energy Technology Data Exchange (ETDEWEB)

    Kindel, J.

    2000-03-01

    This project consists of a multimedia presentation that explains the technological capabilities of Los Alamos National Laboratory. It takes the form of a human-computer interface built around the metaphor of the universe. The project is intended promote Laboratory capabilities to a wide audience. Multimedia is simply a means of communicating information through a diverse set of tools--be they text, sound, animation, video, etc. Likewise, Los Alamos National Laboratory is a collection of diverse technologies, projects, and people. Given the ample material available at the Laboratory, there are tangible benefits to be gained by communicating across media. This paper consists of three parts. The first section provides some basic information about the Laboratory, its mission, and its needs. The second section introduces this multimedia presentation and the metaphor it is based on along with some basic concepts of color and user interaction used in the building of this project. The final section covers construction of the project, pitfalls, and future improvements.

  13. Preliminary study: Formaldehyde exposure in laboratories of Sharjah university in UAE

    OpenAIRE

    Ahmed, Hafiz Omer

    2011-01-01

    Objectives : Laboratory technicians, students, and instructors are at high risk, because they deal with chemicals including formaldehyde. Thus, this preliminary study was conducted to measure the concentration of formaldehyde in the laboratories of the University of Sharjah in UAE. Materials and Methods: Thirty-two air samples were collected and analyzed for formaldehyde using National Institute for Occupational Safety and Health (NIOSH) method 3500. In this method, formaldehyde reacts with c...

  14. Undergraduate Skills Laboratories at Sonoma State University

    Science.gov (United States)

    Gill, Amandeep; Zack, K.; Mills, H.; Cunningham, B.; Jackowski, S.

    2014-01-01

    Due to the current economic climate, funding sources for many laboratory courses have been cut from university budgets. However, it is still necessary for undergraduates to master laboratory skills to be prepared and competitive applicants when entering the professional world and/or graduate school. In this context, student-led programs may be able to compensate for this lack of formal instruction and reinforce concepts from lecture by applying research techniques to develop hands-on comprehension. The Sonoma State University Chapter of Society of Physics Students has established a peer-led skills lab to teach research techniques in the fields of astronomy and physics. The goal is to alleviate the pressures of both independently learning and efficiently applying techniques to junior and senior-level research projects. These skill labs are especially valuable for nontraditional students who, due to work or family duties, may not get a chance to fully commit to research projects. For example, a topic such as Arduino programming has a multitude of applications in both astronomy and physics, but is not taught in traditional university courses. Although some programming and electronics skills are taught in (separate) classes, they are usually not applied to actual research projects, which combined expertise is needed. For example, in astronomy, there are many situations involving programming telescopes and taking data with electronic cameras. Often students will carry out research using these tools but when something goes wrong, the students will not have the skills to trouble shoot and fix the system. Another astronomical topic to be taught in the skills labs is the analysis of astronomical data, including running remote telescopes, analyzing photometric variability, and understanding the concepts of star magnitudes, flat fields, and biases. These workshops provide a setting in which the student teacher may strengthen his or her understanding of the topic by presenting

  15. Establishment of a Laboratory for Biofuels Research at the University of Kentucky

    Energy Technology Data Exchange (ETDEWEB)

    Crocker, Mark [Univ. of Kentucky, Lexington, KY (United States). Center for Applied Energy Research; Crofcheck, Czarena [Univ. of Kentucky, Lexington, KY (United States). Center for Applied Energy Research; Andrews, Rodney [Univ. of Kentucky, Lexington, KY (United States). Center for Applied Energy Research

    2013-03-29

    This project was aimed at the development of the biofuels industry in Kentucky by establishing a laboratory to develop improved processes for biomass utilization. The facility is based at the University of Kentucky Center for Applied Energy Research and the Department of Biosystems and Agricultural Engineering, and constitutes an “open” laboratory, i.e., its equipment is available to other Kentucky researchers working in the area. The development of this biofuels facility represents a significant expansion of research infrastructure, and will provide a lasting resource for biobased research endeavors at the University of Kentucky. In order to enhance the laboratory's capabilities and contribute to on-going biofuels research at the University of Kentucky, initial research at the laboratory has focused on the following technical areas: (i) the identification of algae strains suitable for oil production, utilizing flue gas from coal-fired power plants as a source of CO2; (ii) the conversion of algae to biofuels; and (iii) the development of methods for the analysis of lignin and its deconstruction products. Highlights from these activities include the development of catalysts for the upgrading of lipids to hydrocarbons by means of decarboxylation/decarbonylation (deCOx), a study of bio-oil production from the fast pyrolysis of algae (Scenedesmus), and the application of pyrolytic gas chromatography coupled with mass spectrometry (Py-GC-MS) to the characterization of high lignin biomass feedstocks.

  16. Polarized targets at triangle universities nuclear laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Seely, M.L. [North Carolina State Univ., Raleigh, NC (United States); Gould, C.R. [North Carolina State Univ., Raleigh, NC (United States); Haase, D.G. [North Carolina State Univ., Raleigh, NC (United States); Huffman, P.R. [Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Keith, C.D. [North Carolina State Univ., Raleigh, NC (United States); Roberson, N.R. [Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Tornow, W. [Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Wilburn, W.S. [Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States)

    1995-03-01

    A summary of the polarized and aligned nuclear targets which have been constructed and used at the Triangle Universities Nuclear Laboratory is given. Statically polarized targets, typically operating at a temperature of 12 mK and a magnetic field of 7 T, have provided significant nuclear polarization in {sup 1}H, {sup 3}He, {sup 27}Al, {sup 93}Nb and {sup 165}Ho. A rotating, aligned {sup 165}Ho target is also in use. A {sup 3}He melting curve thermometer has been developed for use in statically polarized targets. A dynamically polarized proton target is under construction. ((orig.))

  17. Safety leadership in the teaching laboratories of electrical and electronic engineering departments at Taiwanese Universities.

    Science.gov (United States)

    Wu, Tsung-Chih

    2008-01-01

    Safety has always been one of the principal goals in teaching laboratories. Laboratories cannot serve their educational purpose when accidents occur. The leadership of department heads has a major impact on laboratory safety, so this study discusses the factors affecting safety leadership in teaching laboratories. This study uses a mail survey to explore the perceived safety leadership in electrical and electronic engineering departments at Taiwanese universities. An exploratory factor analysis shows that there are three main components of safety leadership, as measured on a safety leadership scale: safety controlling, safety coaching, and safety caring. The descriptive statistics also reveals that among faculty, the perception of department heads' safety leadership is in general positive. A two-way MANOVA shows that there are interaction effects on safety leadership between university size and instructor age; there are also interaction effects between presence of a safety committee and faculty gender and faculty age. It is therefore necessary to assess organizational factors when determining whether individual factors are the cause of differing perceptions among faculty members. The author also presents advice on improving safety leadership for department heads at small universities and at universities without safety committees.

  18. Universal immunogenicity validation and assessment during early biotherapeutic development to support a green laboratory.

    Science.gov (United States)

    Bautista, Ami C; Zhou, Lei; Jawa, Vibha

    2013-10-01

    Immunogenicity support during nonclinical biotherapeutic development can be resource intensive if supported by conventional methodologies. A universal indirect species-specific immunoassay can eliminate the need for biotherapeutic-specific anti-drug antibody immunoassays without compromising quality. By implementing the R's of sustainability (reduce, reuse, rethink), conservation of resources and greener laboratory practices were achieved in this study. Statistical analysis across four biotherapeutics supported identification of consistent product performance standards (cut points, sensitivity and reference limits) and a streamlined universal anti-drug antibody immunoassay method implementation strategy. We propose an efficient, fit-for-purpose, scientifically and statistically supported nonclinical immunogenicity assessment strategy. Utilization of a universal method and streamlined validation, while retaining comparability to conventional immunoassays and meeting the industry recommended standards, provides environmental credits in the scientific laboratory. Collectively, individual reductions in critical material consumption, energy usage, waste and non-environment friendly consumables, such as plastic and paper, support a greener laboratory environment.

  19. University of Washington, Nuclear Physics Laboratory annual report, 1995

    International Nuclear Information System (INIS)

    1995-04-01

    The Nuclear Physics Laboratory of the University of Washington supports a broad program of experimental physics research. The current program includes in-house research using the local tandem Van de Graff and superconducting linac accelerators and non-accelerator research in double beta decay and gravitation as well as user-mode research at large accelerator and reactor facilities around the world. This book is divided into the following areas: nuclear astrophysics; neutrino physics; nucleus-nucleus reactions; fundamental symmetries and weak interactions; accelerator mass spectrometry; atomic and molecular clusters; ultra-relativistic heavy ion collisions; external users; electronics, computing, and detector infrastructure; Van de Graff, superconducting booster and ion sources; nuclear physics laboratory personnel; degrees granted for 1994--1995; and list of publications from 1994--1995

  20. Risk assessment and quality improvement of liquid waste management in Taiwan University chemical laboratories.

    Science.gov (United States)

    Ho, Chao-Chung; Chen, Ming-Shu

    2018-01-01

    The policy of establishing new universities across Taiwan has led to an increase in the number of universities, and many schools have constructed new laboratories to meet students' academic needs. In recent years, there has been an increase in the number of laboratory accidents from the liquid waste in universities. Therefore, how to build a safety system for laboratory liquid waste disposal has become an important issue in the environmental protection, safety, and hygiene of all universities. This study identifies the risk factors of liquid waste disposal and presents an agenda for practices to laboratory managers. An expert questionnaire is adopted to probe into the risk priority procedures of liquid waste disposal; then, the fuzzy theory-based FMEA method and the traditional FMEA method are employed to analyze and improve the procedures for liquid waste disposal. According to the research results, the fuzzy FMEA method is the most effective, and the top 10 potential disabling factors are prioritized for improvement according to the risk priority number (RNP), including "Unclear classification", "Gathering liquid waste without a funnel or a drain pan", "Lack of a clearance and transport contract", "Liquid waste spill during delivery", "Spill over", "Decentralized storage", "Calculating weight in the wrong way", "Compatibility between the container material and the liquid waste", "Lack of dumping and disposal tools", and "Lack of a clear labels for liquid waste containers". After tracking improvements, the overall improvement rate rose to 60.2%. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Experience with an accrediated INAA service laboratory at a University - will research be next?

    International Nuclear Information System (INIS)

    Bode, P.

    1993-01-01

    Quality assurance, total quality management, and accreditation are the recognizable attributes of an attitude and consideration of a work process that is being introduced to industry, utilities, and (industrial) laboratories. International reference documents-the International Standard Organization (ISO)- IEC guides - have been developed to harmonize the ways of implementing and evaluating QA practices in connection with accreditation. The life-styles of working under quality practices and working at a university demonstrate a large contrast. Many of the basic principles of quality practices, such as full documentation, written procedures and instructions, and careful consideration of the conditions under which work will be performed, are characteristically absent at universities. Universities nowadays also have a mission to teach quality practices to the present and future generations of scientists. Within a few years, society may call for academics who are not only knowledgeable on the principles of quality practices but who also have been educated, trained, and practiced in such an environment. Conflicts will be avoided when such academics occupy leading positions in organizations that already use quality practices or when they become responsible for the introduction of quality practices. The neutron activation analysis (NAA) laboratory and associated analysis systems at the Interfaculty Reactor Institute (IRI) of the Delft University of Technology has been reorganized and brought into accord with the requirements of EN45001 and ISO guide 25. After an audit by the official accreditation body in the Netherlands, STERLAB, the laboratory received its accreditation in early 1993, making it the first accredited laboratory of both kinds (university and instrumental (INAA)) in the Netherlands and possibly in the world

  2. 3-Dimensional and Interactive Istanbul University Virtual Laboratory Based on Active Learning Methods

    Science.gov (United States)

    Ince, Elif; Kirbaslar, Fatma Gulay; Yolcu, Ergun; Aslan, Ayse Esra; Kayacan, Zeynep Cigdem; Alkan Olsson, Johanna; Akbasli, Ayse Ceylan; Aytekin, Mesut; Bauer, Thomas; Charalambis, Dimitris; Gunes, Zeliha Ozsoy; Kandemir, Ceyhan; Sari, Umit; Turkoglu, Suleyman; Yaman, Yavuz; Yolcu, Ozgu

    2014-01-01

    The purpose of this study is to develop a 3-dimensional interactive multi-user and multi-admin IUVIRLAB featuring active learning methods and techniques for university students and to introduce the Virtual Laboratory of Istanbul University and to show effects of IUVIRLAB on students' attitudes on communication skills and IUVIRLAB. Although there…

  3. Associated Western Universities summer participant program at the Lawrence Livermore National Laboratory, Summer 1997

    Energy Technology Data Exchange (ETDEWEB)

    Williams, B.

    1997-08-01

    The Associated Western Universities, Inc. (AWU) supports a student summer program at Lawrence Livermore National Laboratory (LLNL). This program is structured so that honors undergraduate students may participate in the Laboratory`s research program under direct supervision of senior Laboratory scientists. Included in this report is a list of the AWU participants for the summer of 1997. All students are required to submit original reports of their summer activities in a format of their own choosing. These unaltered student reports constitute the major portion of this report.

  4. Dose measurements in laboratory of Physics department, University of Khartoum

    International Nuclear Information System (INIS)

    Hamid, Maria Mohammed

    1999-05-01

    Personal monitoring in University of Khartoum is being conducted using thermoluminescent dosimetry. The purpose of the study is to measure the dose of radiation in laboratory of Physics in physics department. TL phosphors LiF: Mg, Ti (card) and LiF Mg, Cu, P (GR-200) and mini-rad dosimeter are used to measure the dose in laboratory. The total dose for students form the laboratory bu using card, GR-200 and mini-rad dosimeter was found to be 2.2μ sv/year. 2.5 μ sv/year and 2.6 μ sv respectively, and for the teacher about 4.0 μ sv/year, 5.8 μ sv/year and 13.6 μ sv/year respectively, and for the dose near junk room about 3.9 μ sv/year, 2.9 μ sv/year and 2.8 μ sv/year by using card, GR-200 and mini-rad dosimeter respectively. There is just a background radiation in the main library and the applied nuclear.(Author)

  5. Knowledge, attitude and practice of aspects of laboratory safety in Pathology Laboratories at the University of Port Harcourt Teaching Hospital, Nigeria.

    Science.gov (United States)

    Ejilemele, A A; Ojule, A C

    2005-12-01

    To assess current knowledge, attitudes and practice of aspects of laboratory safety in pathology laboratories at the University of Port Harcourt Teaching Hospital in view of perceived inadequacies in safety practices in clinical laboratories in developing countries. Sixty (60) self- administered questionnaires were distributed to all cadres of staff in four (4) different laboratories (Chemical Pathology, Haematology, Blood bank and Medical Microbiology) at the Hospital. Gross deficiencies were found in the knowledge, attitudes and practice of laboratory safety by laboratory staff in areas of use of personal protective equipment, specimen collection and processing, centrifuge--related hazards, infective hazards waste disposal and provision and use of First Aid Kits. Issues pertaining to laboratory safety are not yet given adequate attention by both employers and employees in developing countries in this ear of resurgence of diseases such as HIV/AIDS and Hepatitis Band C, is emphasized.

  6. Kyushu University Tandem Accelerator Laboratory report, 1988-1990

    International Nuclear Information System (INIS)

    Sagara, Kenshi; Morinobu, Shunpei

    1991-03-01

    Ten years have elapsed since the first beam was obtained from the Kyushu University tandem accelerator. Although the laboratory has achieved successful scientific results, the performance of the accelerator has been on a decline mainly due to the aging. In the last two and a half years, the tandem accelerator has suffered from the fall of terminal voltage to around 8 MV. However, the experimental studies in the laboratory have been active. The utilization of the polarized beams of protons and deuterons to study the scattering of the p+d system, the use of heavy ion beam for the systematic search for the molecular resonance in relatively heavy systems and for the study on reaction mechanism, the use of both light and heavy ion beams for the studies on nuclear engineering, material science and geological science and so on were carried out. The gamma ray spectroscopic study on the state near yrast line was largely hampered by the accelerator troubles, instead, the collaboration with the Niels Bohr Institute provided a wonderful research ground for the studies. (K.I.)

  7. Education and research at the Ohio State University nuclear reactor laboratory

    International Nuclear Information System (INIS)

    Miller, D.W.; Myser, R.D.; Talnagi, J.W.

    1989-01-01

    The educational and research activities at the Ohio State University Nuclear Reactor Laboratory (OSUNRL) are discussed in this paper. A brief description of an OSUNRL facility improvement program and its expected impact on research is presented. The overall long-term goal of the OSUNRL is to support the comprehensive education, research, and service mission of OSU

  8. A Place for Materials Science: Laboratory Buildings and Interdisciplinary Research at the University of Pennsylvania

    Science.gov (United States)

    Choi, Hyungsub; Shields, Brit

    2015-01-01

    The Laboratory for Research on the Structure of Matter (LRSM), University of Pennsylvania, was built in 1965 as part of the Advanced Research Projects Agency's (ARPA) Interdisciplinary Laboratories (IDL) program intended to foster interdisciplinary research and training in materials science. The process that led to the construction of the…

  9. University Physics Students' Ideas of Thermal Radiation Expressed in Open Laboratory Activities Using Infrared Cameras

    Science.gov (United States)

    Haglund, Jesper; Melander, Emil; Weiszflog, Matthias; Andersson, Staffan

    2017-01-01

    Background: University physics students were engaged in open-ended thermodynamics laboratory activities with a focus on understanding a chosen phenomenon or the principle of laboratory apparatus, such as thermal radiation and a heat pump. Students had access to handheld infrared (IR) cameras for their investigations. Purpose: The purpose of the…

  10. A Radiation Laboratory Curriculum Development at Western Kentucky University

    International Nuclear Information System (INIS)

    Barzilov, Alexander P.; Novikov, Ivan S.; Womble, Phil C.

    2009-01-01

    We present the latest developments for the radiation laboratory curriculum at the Department of Physics and Astronomy of Western Kentucky University. During the last decade, the Applied Physics Institute (API) at WKU accumulated various equipment for radiation experimentation. This includes various neutron sources (computer controlled d-t and d-d neutron generators, and isotopic 252 Cf and PuBe sources), the set of gamma sources with various intensities, gamma detectors with various energy resolutions (NaI, BGO, GSO, LaBr and HPGe) and the 2.5-MeV Van de Graaff particle accelerator. XRF and XRD apparatuses are also available for students and members at the API. This equipment is currently used in numerous scientific and teaching activities. Members of the API also developed a set of laboratory activities for undergraduate students taking classes from the physics curriculum (Nuclear Physics, Atomic Physics, and Radiation Biophysics). Our goal is to develop a set of radiation laboratories, which will strengthen the curriculum of physics, chemistry, geology, biology, and environmental science at WKU. The teaching and research activities are integrated into real-world projects and hands-on activities to engage students. The proposed experiments and their relevance to the modern status of physical science are discussed.

  11. Nuclear Physics Laboratory, University of Washington annual report

    International Nuclear Information System (INIS)

    1998-04-01

    The Nuclear Physics Laboratory at the University of Washington in Seattle pursues a broad program of nuclear physics. These activities are conducted locally and at remote sites. The current programs include in-house research using the local tandem Van de Graaff and superconducting linac accelerators and non-accelerator research in solar neutrino physics at the Sudbury Neutrino Observatory in Canada and at SAGE in Russia, and gravitation as well as user-mode research at large accelerators and reactor facilities around the world. Summaries of the individual research projects are included. Areas of research covered are: fundamental symmetries, weak interactions and nuclear astrophysics; neutrino physics; nucleus-nucleus reactions; ultra-relativistic heavy ions; and atomic and molecular clusters

  12. Association Euratom - Risø National Laboratory, Technical University of Denmark - Annual Progress Report 2007

    DEFF Research Database (Denmark)

    Michelsen, Poul; Korsholm, Søren Bang; Juul Rasmussen, Jens

    The programme of the Research Unit of the Fusion Association Euratom - Risø National Laboratory, Technical University of Denmark, covers work in fusion plasma physics and in fusion technology. The fusion plasma physics research focuses on turbulence and transport, and its interaction with the pla......The programme of the Research Unit of the Fusion Association Euratom - Risø National Laboratory, Technical University of Denmark, covers work in fusion plasma physics and in fusion technology. The fusion plasma physics research focuses on turbulence and transport, and its interaction...... phased out during 2007. Minor activities are system analysis, initiative to involve Danish industry in ITER contracts and public information. A summary is presented of the results obtained in the Research Unit during 2007....

  13. Annual Report FY2011: Establishment of a Laboratory for Biofuels Research at the University of Kentucky

    Energy Technology Data Exchange (ETDEWEB)

    Crocker, Mark [Univ. of Kentucky, Lexington, KY (United States). Center for Applied Energy Research; Crofcheck, Czarena [Univ. of Kentucky, Lexington, KY (United States). Center for Applied Energy Research; Andrews, Rodney [Univ. of Kentucky, Lexington, KY (United States). Center for Applied Energy Research

    2011-12-21

    This project is aimed at the development of the biofuels industry in Kentucky by establishing a laboratory to develop improved processes for biomass utilization. The facility is based at the University of Kentucky Center for Applied Energy Research and the Department of Biosystems and Agricultural Engineering, and constitutes an open laboratory, i.e., its equipment is available to other Kentucky researchers working in the area. The development of this biofuels facility represents a significant expansion of research infrastructure, and will provide a lasting resource for biobased research endeavors at the University of Kentucky. In order to enhance the laboratory's capabilities and contribute to on-going biofuels research at the University of Kentucky, initial research at the laboratory has focused on the following technical areas: (i) the identification of algae strains suitable for oil production, utilizing flue gas from coal-fired power plants as a source of CO2; (ii) the conversion of algae to biofuels; and (iii) thermochemical methods for the deconstruction of lignin. Highlights from these activities include a detailed study of bio-oil production from the fast pyrolysis of microalgae (Scenedesmus sp.) and the application of pyrolytic gas chromatography coupled with mass spectrometry (Py-GC-MS) to the characterization of high lignin biomass feedstocks.

  14. University of Illinois at Urbana-Champaign, Materials Research Laboratory progress report for FY 1991

    Energy Technology Data Exchange (ETDEWEB)

    1991-10-01

    The Materials Research Laboratory at the University of Illinois is an interdisciplinary laboratory operated in the College of Engineering. Its focus is the science of materials and it supports research in the areas of condensed matter physics, solid state chemistry, and materials science. This report addresses topics such as: an MRL overview; budget; general programmatic and institutional issues; new programs; research summaries for metallurgy, ceramics, solid state physics, and materials chemistry.

  15. University of Illinois at Urbana-Champaign, Materials Research Laboratory progress report for FY 1991

    International Nuclear Information System (INIS)

    1991-10-01

    The Materials Research Laboratory at the University of Illinois is an interdisciplinary laboratory operated in the College of Engineering. Its focus is the science of materials and it supports research in the areas of condensed matter physics, solid state chemistry, and materials science. This report addresses topics such as: an MRL overview; budget; general programmatic and institutional issues; new programs; research summaries for metallurgy, ceramics, solid state physics, and materials chemistry

  16. BUSEFL: The Boston University Space Environment Forecast Laboratory

    International Nuclear Information System (INIS)

    Contos, A.R.; Sanchez, L.A.; Jorgensen, A.M.

    1996-01-01

    BUSEFL (Boston University Space Environment Forecast Laboratory) is a comprehensive, integrated project to address the issues and implications of space weather forecasting. An important goal of the BUSEFL mission is to serve as a testing ground for space weather algorithms and operational procedures. One such algorithm is the Magnetospheric Specification and Forecast Model (MSFM), which may be implemented in possible future space weather prediction centers. Boston University Student-satellite for Applications and Training (BUSAT), the satellite component of BUSEFL, will incorporate four experiments designed to measure (1) the earth close-quote s magnetic field, (2) distribution of energetic electrons trapped in the earth close-quote s radiation belts, (3) the mass and charge composition of the ion fluxes along the magnetic field lines and (4) the auroral forms at the foot of the field line in the auroral zones. Data from these experiments will be integrated into a ground system to evaluate space weather prediction codes. Data from the BUSEFL mission will be available to the scientific community and the public through media such as the World Wide Web (WWW). copyright 1996 American Institute of Physics

  17. Improving Pre-Service Elementary Teachers' Education via a Laboratory Course on Air Pollution: One University's Experience

    Science.gov (United States)

    Mandrikas, Achilleas; Parkosidis, Ioannis; Psomiadis, Ploutarchos; Stoumpa, Artemisia; Chalkidis, Anthimos; Mavrikaki, Evangelia; Skordoulis, Constantine

    2013-01-01

    This paper describes the structure of the "Air Pollution Course", an environmental science laboratory course developed at the Science Education Laboratory of the Faculty of Primary Education, University of Athens, as well as the findings resulting from its implementation by pre-service elementary teachers. The course proposed in this…

  18. Studies of nuclear processes at the Triangle Universities Nuclear Laboratory. Progress report, 1 September 1994--31 August 1995

    International Nuclear Information System (INIS)

    Ludwig, E.J.

    1995-01-01

    The Triangle Universities Nuclear Laboratory (TUNL)--a collaboration of Duke University, North Carolina State University, and the University of North Carolina at Chapel Hill--has had a very productive year. This report covers the second year of a three-year grant between the US Department of Energy and the three collaborating universities. The TUNL research program focuses on the following areas of nuclear physics: parity violation in neutron and charged-particle resonances--the mass and energy dependence of the weak interaction spreading width; chaotic behavior in 30 P from studies of eigenvalue fluctuations in nuclear level schemes; studies of few-body systems; nuclear astrophysics; nuclear data evaluation for A = 3--20, for which TUNL is now the international center; high-spin spectroscopy and superdeformation in nuclei, involving collaborations at Argonne National Laboratory. Developments in technology and instrumentation have been vital to the research and training program. In this progress report the author describes: a proposed polarized γ-beam facility at the Duke Free Electron Laser Laboratory; cryogenic systems and microcalorimeter development; continuing development of the Low Energy Beam Facility. The research summaries presented in this progress report are preliminary

  19. Studies of nuclear processes at the Triangle Universities Nuclear Laboratory. Progress report, 1 September 1994--31 August 1995

    Energy Technology Data Exchange (ETDEWEB)

    Ludwig, E.J.

    1995-09-01

    The Triangle Universities Nuclear Laboratory (TUNL)--a collaboration of Duke University, North Carolina State University, and the University of North Carolina at Chapel Hill--has had a very productive year. This report covers the second year of a three-year grant between the US Department of Energy and the three collaborating universities. The TUNL research program focuses on the following areas of nuclear physics: parity violation in neutron and charged-particle resonances--the mass and energy dependence of the weak interaction spreading width; chaotic behavior in {sup 30}P from studies of eigenvalue fluctuations in nuclear level schemes; studies of few-body systems; nuclear astrophysics; nuclear data evaluation for A = 3--20, for which TUNL is now the international center; high-spin spectroscopy and superdeformation in nuclei, involving collaborations at Argonne National Laboratory. Developments in technology and instrumentation have been vital to the research and training program. In this progress report the author describes: a proposed polarized {gamma}-beam facility at the Duke Free Electron Laser Laboratory; cryogenic systems and microcalorimeter development; continuing development of the Low Energy Beam Facility. The research summaries presented in this progress report are preliminary.

  20. Comparison of structured and unstructured physical activity training on predicted VO2max and heart rate variability in adolescents - a randomized control trial.

    Science.gov (United States)

    Sharma, Vivek Kumar; Subramanian, Senthil Kumar; Radhakrishnan, Krishnakumar; Rajendran, Rajathi; Ravindran, Balasubramanian Sulur; Arunachalam, Vinayathan

    2017-05-01

    Physical inactivity contributes to many health issues. The WHO-recommended physical activity for adolescents encompasses aerobic, resistance, and bone strengthening exercises aimed at achieving health-related physical fitness. Heart rate variability (HRV) and maximal aerobic capacity (VO2max) are considered as noninvasive measures of cardiovascular health. The objective of this study is to compare the effect of structured and unstructured physical training on maximal aerobic capacity and HRV among adolescents. We designed a single blinded, parallel, randomized active-controlled trial (Registration No. CTRI/2013/08/003897) to compare the physiological effects of 6 months of globally recommended structured physical activity (SPA), with that of unstructured physical activity (USPA) in healthy school-going adolescents. We recruited 439 healthy student volunteers (boys: 250, girls: 189) in the age group of 12-17 years. Randomization across the groups was done using age and gender stratified randomization method, and the participants were divided into two groups: SPA (n=219, boys: 117, girls: 102) and USPA (n=220, boys: 119, girls: 101). Depending on their training status and gender the participants in both SPA and USPA groups were further subdivided into the following four sub-groups: SPA athlete boys (n=22) and girls (n=17), SPA nonathlete boys (n=95) and girls (n=85), USPA athlete boys (n=23) and girls (n=17), and USPA nonathlete boys (n=96) and girls (n=84). We recorded HRV, body fat%, and VO2 max using Rockport Walk Fitness test before and after the intervention. Maximum aerobic capacity and heart rate variability increased significantly while heart rate, systolic blood pressure, diastolic blood pressure, and body fat percentage decreased significantly after both SPA and USPA intervention. However, the improvement was more in SPA as compared to USPA. SPA is more beneficial for improving cardiorespiratory fitness, HRV, and reducing body fat percentage in terms of

  1. Recent developments at the high-field laboratory of Tohoku University

    International Nuclear Information System (INIS)

    Motokawa, M.; Watanabe, K.; Miura, S.; Awaji, S.; Nojiri, H.; Mogi, I.; Mitsudo, S.; Sakon, T.

    1998-01-01

    Recent developments and experiments performed at the high-field laboratory of Tohoku University are described. We have (1) hybrid magnets which produce high fields up to 31.1 T, (2) liquid-helium-free superconducting magnets up to 11 T which are available continuously for more than a year, (3) a 20 T superconducting magnet, (4) pulsed field magnets up to 40 T by a 100 kJ bank and (5) repeating pulsed field systems up to 25 T, synchronized with a pulsed neutron source

  2. Spondyloarthropaty characterization and factors determination of bad prognostic in a Colombian patients population

    International Nuclear Information System (INIS)

    Londono P, John Dario; Gonzalez, Luis Alonso; Ramirez, Luis Alberto; Santos, Pedro; Avila, Mabel; Santos, Ana Maria; Romero, Consuelo; Valle, Rafael Raul

    2005-01-01

    Purpose: to characterized a group of Colombian patients with diagnosis of Spondiloarthropaty (SpA) and establish the factors related with progression to Ankylosing Spondylitis (AS) in patients with recent diagnosis. Methods: a total of 139 consecutive (January 2000 to September 2004) patients with diagnosis of SpA (ESSG): 55 AS, 49 with undifferentiated SpA (u-Spa), 22 with Reactive Arthritis (ReA) and 13 with Psoriatic arthritis (PsA), were evaluated following the ASAS recommendations. The mean duration of disease was 8,5 +/- 9, 2 years. A familial history of SpA was registered in 18%: 25% AS, 11.5 u-SpA, 10% ReA, 25% PsA. Uveitis was noticed in 7.2%: 14.5% in AS and 4.2% in u-SpA. Clinical characteristics at onset were different among SpA subgroups. The Age of onset of disease (years) was 26.8 +/- 10 for all group and 22.4 +/- 7.2: AS, 27.8 +/- 8 u-SpA, 27.1 +/- 7.1 Are, 41.1:t 15.7 APs. Duration of arthritis at first episode o disease was 3.3 +/- 3.8 for all group and 4.2:t 5.2 for AS, 2.9 +/- 2.7 for u-SpA, 2.5 +/- 2.1 for Are and 3.4+/- 3.4 for APs. The Spinal Pain Duration at the first episode of disease was 5.8 +/- 6.3 for all group, 8.1 +/- 7.9q * for AS, 4.9+/-5 for u-SpA, 3.4+/- 2.6 for Are, 3.2+/- 2.3 for APs (q ANOVA P < 0.05* AS vs u-SpA, p < 0.025; :j: AS vs u-SpA p < 0.000; AS vs. total group p = 0.05). A total of 51 (29 u-SpA and 22 Are) patients began the illness after 2000 and they were followed by regular schedule: 11 patients progress to AS (5 u-SpA and 6 Are) in a period of 3.53+/-0.9 year. 10, 10 (77%) were HLA-B27 positive, the age of onset of the disease was 19.7+/-3.5 years, the duration of the first arthritis episode was 3,2+/-1,4 months, spinal pain 8,7+/-2.8 months, entesopathy 51+/-2.3 months. Our results indicate that demographic and clinical characteristic at onset (age, sex, duration of symptoms) may determine evolution over the time (prognosis) in patients with SpA

  3. QA experience at the University of Wisconsin accredited dosimetry calibration laboratory

    Energy Technology Data Exchange (ETDEWEB)

    DeWard, L.A.; Micka, J.A. [Univ. of Wisconsin, Madison, WI (United States)

    1993-12-31

    The University of Wisconsin Accredited Dosimetry Calibration Laboratory (UW ADCL) employs procedure manuals as part of its Quality Assurance (QA) program. One of these manuals covers the QA procedures and results for all of the UW ADCL measurement equipment. The QA procedures are divided into two main areas: QA for laboratory equipment and QA for external chambers sent for calibration. All internal laboratory equipment is checked and recalibrated on an annual basis, after establishing its consistency on a 6-month basis. QA for external instruments involves checking past calibration history as well as comparing to a range of calibration values for specific instrument models. Generally, the authors find that a chamber will have a variation of less than 0.5 % from previous Co-60 calibration factors, and falls within two standard deviations of previous calibrations. If x-ray calibrations are also performed, the energy response of the chamber is plotted and compared to previous instruments of the same model. These procedures give the authors confidence in the transfer of calibration values from National Institute of Standards and Technology (NIST).

  4. QA experience at the University of Wisconsin accredited dosimetry calibration laboratory

    International Nuclear Information System (INIS)

    DeWard, L.A.; Micka, J.A.

    1993-01-01

    The University of Wisconsin Accredited Dosimetry Calibration Laboratory (UW ADCL) employs procedure manuals as part of its Quality Assurance (QA) program. One of these manuals covers the QA procedures and results for all of the UW ADCL measurement equipment. The QA procedures are divided into two main areas: QA for laboratory equipment and QA for external chambers sent for calibration. All internal laboratory equipment is checked and recalibrated on an annual basis, after establishing its consistency on a 6-month basis. QA for external instruments involves checking past calibration history as well as comparing to a range of calibration values for specific instrument models. Generally, the authors find that a chamber will have a variation of less than 0.5 % from previous Co-60 calibration factors, and falls within two standard deviations of previous calibrations. If x-ray calibrations are also performed, the energy response of the chamber is plotted and compared to previous instruments of the same model. These procedures give the authors confidence in the transfer of calibration values from National Institute of Standards and Technology (NIST)

  5. Neutron radiography at the University of Michigan's Phoenix Memorial Laboratory

    International Nuclear Information System (INIS)

    Lindsay, J.T.; Elam, S.; Koblish, T.; Lee, P.; McAuliffe, D.

    1990-01-01

    Real-time neutron radiography (RTNR) is rapidly becoming a valuable tool for nondestructive testing and basic research with a wide variety of applications. The Phoenix Memorial Laboratory (PML) at the University of Michigan has developed an RTNR facility and has been using this facility to study several phenomena of interest to researchers in many areas. These phenomena include imaging of the internal fluid flow in gas turbine engine nozzles and coking and debris deposition in several gas turbine nozzles. This paper presents a summary of the technique and facilities involved in these applications

  6. Safety in Academic Chemistry Laboratories: Volume 1. Accident Prevention for College and University Students, 7th Edition.

    Science.gov (United States)

    American Chemical Society, Washington, DC.

    This book contains volume 1 of 2 and describes safety guidelines for academic chemistry laboratories to prevent accidents for college and university students. Contents include: (1) "Your Responsibility for Accident Prevention"; (2) "Guide to Chemical Hazards"; (3) "Recommended Laboratory Techniques"; and (4) "Safety Equipment and Emergency…

  7. Annual report of Radiation Laboratory Department of Nuclear Engineering Kyoto University for fiscal 1993

    International Nuclear Information System (INIS)

    1994-07-01

    This publication is the collection of the papers presented research activities of Radiation Laboratory, Department of Nuclear Engineering, Kyoto University during the 1993 academic/fiscal year (April, 1993 - March, 1994). The 47 of the presented papers are indexed individually. (J.P.N.)

  8. Annual report of Radiation Laboratory Department of Nuclear Engineering Faculty of Engineering, Kyoto University

    International Nuclear Information System (INIS)

    1993-07-01

    This publication is the collection of the papers presented research activities of Radiation laboratory, Department of Nuclear Engineering, Kyoto University during the 1992 academic/fiscal year (April, 1992 - March, 1993). The 48 of the presented papers are indexed individually. (J.P.N.)

  9. Research reactor usage at the Idaho National Engineering Laboratory in support of university research and education

    International Nuclear Information System (INIS)

    Woodall, D.M.; Dolan, T.J.; Stephens, A.G.

    1990-01-01

    The Idaho National Engineering Laboratory is a US Department of Energy laboratory which has a substantial history of research and development in nuclear reactor technologies. There are a number of available nuclear reactor facilities which have been incorporated into the research and training needs of university nuclear engineering programs. This paper addresses the utilization of the Advanced Reactivity Measurement Facility (ARMF) and the Coupled Fast Reactivity Measurement Facility (CFRMF) for thesis and dissertation research in the PhD program in Nuclear Science and Engineering by the University of Idaho and Idaho State University. Other reactors at the INEL are also being used by various members of the academic community for thesis and dissertation research, as well as for research to advance the state of knowledge in innovative nuclear technologies, with the EBR-II facility playing an essential role in liquid metal breeder reactor research. 3 refs

  10. Promoting ergonomics in Algeria: activities of "the research and training laboratory" in the University of Oran.

    Science.gov (United States)

    Mebarki, Bouhafs; El-Bachir, Tebboune Cheikh

    2012-01-01

    The growing need in Algeria to develop ergonomics knowledge and practice in industry was behind the initiative to develop a training and research project within the ergonomics laboratory at Oran University. Since 2005 the laboratory team is running an academic option master in work design and ergonomics. The evaluation of the academic master in 2010 revealed the acute need of the local industry for professional competences in ergonomic and work psychology. A professional training master program in "ergonomics & work psychology" was then developed in partnership with local industry, five European Universities and six Universities from three Maghreb countries. Research projects were initiated around the two training programs, in conjunction with a number of ergonomics dissemination and promotion activities. Preliminary results of the project are presented and discussed in relation to the local context, and in the light of similar cases in Industrially Developing Countries.

  11. The Importance of a Laboratory Section on Student Learning Outcomes in a University Introductory Earth Science Course

    Science.gov (United States)

    Forcino, Frank L.

    2013-01-01

    Laboratory sections of university Earth science courses provide hands-on, inquiry-based activities for students in support of lecture and discussion. Here, I compare student conceptual knowledge outcomes of laboratory sections by administering an independent concept inventory at the beginning and end of two courses: one that had a lecture and a…

  12. Annual report of Nuclear Engineering Research Laboratory, University of Tokyo in fiscal 1992

    International Nuclear Information System (INIS)

    1993-07-01

    In this annual report, the activities of education and research, the state of operation of research facilities and others in Nuclear Engineering Research Laboratory, University of Tokyo in fiscal year 1992 are summarized. In this Laboratory, there are four large research facilities, that are, the fast neutron source reactor 'Yayoi', the electron beam linac, the nuclear fusion reactor blanket experiment facility and the heavy irradiation research facility. Those are used for carrying out education and research in the wide fields of nuclear engineering, and are offered also for joint utilization. The results of research by using respective research facilities have been summarized in separate reports. The course of the management and operation of each research facility is described, and the research activities, the theses for doctorate and graduation these of teachers, personnel and graduate students in the Laboratory are summarized. (J.P.N.)

  13. A new IBA-AMS laboratory at the Comenius University in Bratislava (Slovakia)

    Science.gov (United States)

    Povinec, Pavel P.; Masarik, Jozef; Kúš, Peter; Holý, Karol; Ješkovský, Miroslav; Breier, Robert; Staníček, Jaroslav; Šivo, Alexander; Richtáriková, Marta; Kováčik, Andrej; Szarka, Ján; Steier, Peter; Priller, Alfred

    2015-01-01

    A Centre for Nuclear and Accelerator Technologies (CENTA) has been established at the Comenius University in Bratislava comprising of a tandem laboratory designed for Ion Beam Analysis (IBA), Ion Beam Modification (IBM) of materials and Accelerator Mass Spectrometry (AMS). The main equipment of the laboratory, i.e. Alphatross and MC-SNICS ion sources, 3 MV Pelletron tandem accelerator, and analyzers of accelerated ions are described. Optimization of ion beam characteristics for different ion sources with gas and solid targets, for transmission of accelerated ions with different energy and charge state, for different parameters of the high-energy ion analyzers, as well as first AMS results are presented. The scientific program of the CENTA will be devoted mainly to nuclear, environmental, life and material sciences.

  14. [Laboratory medicine in the obligatory postgraduate clinical training system--common clinical training program in the department of laboratory medicine in our prefectural medical university hospital].

    Science.gov (United States)

    Okamoto, Yasuyuki

    2003-04-01

    I propose a postgraduate common clinical training program to be provided by the department of laboratory medicine in our prefectural medical university hospital. The program has three purposes: first, mastering basic laboratory tests; second, developing the skills necessary to accurately interpret laboratory data; third, learning specific techniques in the field of laboratory medicine. For the first purpose, it is important that medical trainees perform testing of their own patients at bedside or in the central clinical laboratory. When testing at the central clinical laboratory, instruction by expert laboratory technicians is helpful. The teaching doctors in the department of laboratory medicine are asked to advise the trainees on the interpretation of data. Consultation will be received via interview or e-mail. In addition, the trainees can participate in various conferences, seminars, and meetings held at the central clinical laboratory. Finally, in order to learn specific techniques in the field of laboratory medicine, several special courses lasting a few months will be prepared. I think this program should be closely linked to the training program in internal medicine.

  15. Annual report of Laboratory of Nuclear Studies, Osaka University, 1980

    International Nuclear Information System (INIS)

    1981-01-01

    This is the progress report of the research activities in the Laboratory of Nuclear Studies during the period from April, 1980, to March, 1981. The activities were carried out by the OULNS staffs and also by outsiders at the OULNS. In this period, the X-ray astrophysics group, the radiation physics group and the high energy physics group joined the OULNS. The main accelerators in the OULNS are a 110 cm variable energy cyclotron and a 4.7 MeV Van de Graaff machine. The detailed experimental studies on inbeam e-gamma spectroscopy and beta-decay were carried out at two accelerator laboratories. The radiochemistry facility and a mass spectrometer were fully used. The research activities extended to high energy physics by utilizing national facilities, such as a 230 cm cyclotron in the Research Center for Nuclear Physics and a proton synchrotron in the National Laboratory for High Energy Physics. The theoretical studies on elementary particles and nuclear physics were carried out also. It is important that the facilities in the OULNS were used by the outsiders in Osaka University, such as solid state physics group and particle-induced X-ray group. The activities of the divisions of cyclotron, Van de Graaff, high energy physics, accelerator development and nuclear instrumentation, mass spectroscopy, radioisotope, solid state and theoretical physics are reported. (Kako, I.)

  16. Making Stuff Outreach at the Ames Laboratory and Iowa State University

    Energy Technology Data Exchange (ETDEWEB)

    Ament, Katherine; Karsjen, Steven; Leshem-Ackerman, Adah; King, Alexander

    2011-04-01

    The U. S. Department of Energy's Ames Laboratory in Ames, Iowa was a coalition partner for outreach activities connected with NOVA's Making Stuff television series on PBS. Volunteers affiliated with the Ames Laboratory and Iowa State University, with backgrounds in materials science, took part in activities including a science-themed Family Night at a local mall, Science Cafes at the Science Center of Iowa, teacher workshops, demonstrations at science nights in elementary and middle schools, and various other events. We describe a selection of the activities and present a summary of their outcomes and extent of their impact on Ames, Des Moines and the surrounding communities in Iowa. In Part 2, results of a volunteer attitude survey are presented, which shed some light on the volunteer experience and show how the volunteers participation in outreach activities has affected their views of materials education.

  17. Science and production laboratories: integration between the industry and universities

    International Nuclear Information System (INIS)

    Anokhin, A.N.; Sivokon', V.P.; Rakitin, I.D.

    2010-01-01

    Industry laboratories provide students with an opportunity to resolve real serious tasks and be exposed to a wide range of professional activities. Staffing in the Russian nuclear industry is a serious concern. There is a shortage of experienced specialists, and it is impossible to train a replacement for them quickly. Creation of a true professional is a long and thorough process, whereby the amount of knowledge and experience very slowly transforms into quality of performance. The authors underline that the teacher of a modern technical university should not and must not act as a middle man between the textbook and the students. The teacher must instead become a holder of the latest technological knowledge, which he will pass to students during lessons. The authors report on the ERGOLAB, a problematic science and research laboratory for ergonomic research and development in the nuclear field. Ergonomic support is one of the more important factors in the prevention of human errors, maintenance of professional health and improvement of performance efficiency [ru

  18. The CT Scanner Facility at Stellenbosch University: An open access X-ray computed tomography laboratory

    Science.gov (United States)

    du Plessis, Anton; le Roux, Stephan Gerhard; Guelpa, Anina

    2016-10-01

    The Stellenbosch University CT Scanner Facility is an open access laboratory providing non-destructive X-ray computed tomography (CT) and a high performance image analysis services as part of the Central Analytical Facilities (CAF) of the university. Based in Stellenbosch, South Africa, this facility offers open access to the general user community, including local researchers, companies and also remote users (both local and international, via sample shipment and data transfer). The laboratory hosts two CT instruments, i.e. a micro-CT system, as well as a nano-CT system. A workstation-based Image Analysis Centre is equipped with numerous computers with data analysis software packages, which are to the disposal of the facility users, along with expert supervision, if required. All research disciplines are accommodated at the X-ray CT laboratory, provided that non-destructive analysis will be beneficial. During its first four years, the facility has accommodated more than 400 unique users (33 in 2012; 86 in 2013; 154 in 2014; 140 in 2015; 75 in first half of 2016), with diverse industrial and research applications using X-ray CT as means. This paper summarises the existence of the laboratory's first four years by way of selected examples, both from published and unpublished projects. In the process a detailed description of the capabilities and facilities available to users is presented.

  19. Establishing Good Laboratory Practice at Small Colleges and Universities

    Directory of Open Access Journals (Sweden)

    Susan Meryl Bornstein-Forst

    2017-05-01

    Full Text Available Good Laboratory Practice (GLP and Standard Operating Procedures (SOPs provide guidelines for proper operation of equipment, maintenance and sanitation, reporting structures, and related activities. These practices are routinely employed at large academic and research-based institutions. However, they are often overlooked or omitted at smaller colleges and universities where staff and resources are limited. Incorrect assumptions and presumed responsibilities can lead to safety hazards, damage to equipment, loss of infrastructure, and confusion regarding operations and oversight. This report addresses the development of the “who, what, when, how, and where” policies and SOPs that constitute GLP. Once established and utilized by all departmental members, these structures ensure that academic and research-related activities are conducted safely and efficiently.

  20. Radiation Physics for Personnel and Environmental Protection

    International Nuclear Information System (INIS)

    Cossairt, J.D.

    1999-01-01

    The Fermi National Accelerator Laboratory FERMILAB- TM- 1834 Fermi National Accelerator Laboratory This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of their employees, makes any warranty, expressed or implied, or assumes any legal liability or responsibility for the accuracy, completeness, or usefulness of any information, apparatus, product, or process disclosed, or represents that its use would not infringe privately owned rights. Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the United States Government or any agency thereof. The views and opinions of authors expressed herein do not necessarily state or reflect those of the United States Government or any agency thereof. This manuscript has been authored by Universities Research Association, Inc. under con- tract No. DE- ACO% 76CH03000 with the U. S. Department of Energy. The United States Government and the publisher, by accepting the article for publication, acknowledges that the United States Government retains a nonexclusive, paid- up, irrevocable, worldwide license to publish or reproduce the published form of this manuscript, or allow others to do so, for This text is dedicated to my wife Claudia, and our children, Joe and Sally, who provided me with love, cheerfulness, and their support during the long hours spent in the preparation of various versions of this text. I acknowledge the opportunity provided by the Fermilab Director, John Peoples, Jr., to be a part of the U. S. Particle Accelerator School. Also, the encouragement of Mel Month and A. Lincoln Read to teach in the USPAS has been sincerely appreciated. Several members of the Fermilab Environment, Safety and Health Section have greatly assisted me during the

  1. A DOE University-national laboratory waste-management education and research consortium (WERC)

    International Nuclear Information System (INIS)

    Bhada, R.K.; Morgan, J.D.; Townsend, J.S.

    1991-01-01

    This paper presents the results and current status of a consortium of three universities and two national laboratories working closely with industry for an Education and Research program on waste-management and environmental restoration. The program sponsored by the US Department of Energy has been in effect for 18 months and has achieved significant progress towards establishing: undergraduate, graduate and associate degree programs involving environmental management, interactive TV courses from the consortium members transmitted throughout the United States, Mexico ampersand Canada, a satellite TV network, a professional development teleconference series, research programs at the leading edge of technology training multi-disciplinary students, research laboratories for analyses, testing, and student training, technology transfer programs, including a TV series on research applications, outreach programs, including pre-college and minority education, community monitoring

  2. Annual report of Nuclear Engineering Research Laboratory, Faculty of Engineering, University of Tokyo, fiscal year 1994

    International Nuclear Information System (INIS)

    1995-08-01

    This annual report is the summary of the research and education activities, the state of operating research facilities and others in fiscal year 1994 in this Research Laboratory. In this Research Laboratory, there are four main installations, namely the fast neutron source reactor 'Yayoi', the electron linear accelerator, the basic experiment facility for the design of nuclear fusion reactor blanket and the heavy irradiation research facility. The former two are put to the joint utilization by all Japanese universities, the blanket is to that within Faculty of Engineering, and the HIT is to that within this university. The fast neutron science research facility, the installation of which was approved in 1993 as the ancillary equipment of the Yayoi, has been put to the joint utilization for all Japan, and achieved good results. In this report, the management and operation of these main installations, research activities, the publication of research papers,graduation and degree theses, the publication of research papers, graduation and degree theses, the events in the Laboratory for one year, the list of the visitors to the Laboratory, the list of the records of official trips to foreign countries and others, and the list of UTNL reports are described. (K.I.)

  3. Asking the next generation: the implementation of pre-university students’ ideas about physics laboratory preparation exercises

    Science.gov (United States)

    Dunnett, K.; Bartlett, P. A.

    2018-01-01

    It was planned to introduce online pre-laboratory session activities to a first-year undergraduate physics laboratory course to encourage a minimum level of student preparation for experiments outside the laboratory environment. A group of 16 and 17 year old laboratory work-experience students were tasked to define and design a pre-laboratory activity based on experiments that they had been undertaking. This informed the structure, content and aims of the activities introduced to a first year physics undergraduate laboratory course, with the particular focus on practising the data handling. An implementation study showed how students could try to optimise high grades, rather than gain efficiency-enhancing experience if careful controls were not put in place by assessors. However, the work demonstrated that pre-university and first-year physics students can take an active role in developing scaffolding activities that can help to improve the performance of those that follow their footsteps.

  4. Formerly utilized MED/AEC sites Remedial Action Program. Report of the decontamination of Jones Chemical Laboratory, Ryerson Physical Laboratory, and Eckhart Hall, the University of Chicago, Chicago, Illinois

    Energy Technology Data Exchange (ETDEWEB)

    Wynuveen, R.A.; Smith, W.H.; Sholeen, C.M.; Flynn, K.F.

    1984-08-01

    The US Department of Energy (DOE) has implemented a program to decontaminate radioactively contaminated sites that were formerly utilized by the Manhattan Engineer District (MED) and/or the Atomic Energy Commission (AEC) for activities that included handling of radioactive material. This program is referred to as the ''Formerly Utilized Sites Remedial Action Program'' (FUSRAP). Among these sites are Jones Chemical Laboratory, Ryerson Physical Laboratory, Kent Chemical Laboratory, and Eckhart Hall of The University of Chicago, Chicago, Illinois. Since 1977, the University of Chicago decontaminated Kent Chemical Laboratory as part of a facilities renovation program. All areas of Eckhart Hall, Ryerson Physical Laboratory, and Jones Chemical Laboratory that had been identified as contaminated in excess of current guidelines in the 1976-1977 surveys were decontaminated to levels where no contamination could be detected relative to natural backgrounds. All areas that required defacing to achieve this goal were restored to their original condition. The radiological evaluation of the sewer system, based primarily on the radiochemical analyses of sludge and water samples, indicated that the entire sewer system is potentially contaminated. While this evaluation was defined as part of this project, the decontamination of the sewer system was not included in the purview of this effort. The documentation included in this report substantiates the judgment that all contaminated areas identified in the earlier reports in the three structures included in the decontamination effort (Eckhart Hall, Ryerson Physical Laboratory, and Jones Chemical Laboratory) were cleaned to levels commensurate with release for unrestricted use.

  5. Formerly utilized MED/AEC sites Remedial Action Program. Report of the decontamination of Jones Chemical Laboratory, Ryerson Physical Laboratory, and Eckhart Hall, the University of Chicago, Chicago, Illinois

    International Nuclear Information System (INIS)

    Wynuveen, R.A.; Smith, W.H.; Sholeen, C.M.; Flynn, K.F.

    1984-08-01

    The US Department of Energy (DOE) has implemented a program to decontaminate radioactively contaminated sites that were formerly utilized by the Manhattan Engineer District (MED) and/or the Atomic Energy Commission (AEC) for activities that included handling of radioactive material. This program is referred to as the ''Formerly Utilized Sites Remedial Action Program'' (FUSRAP). Among these sites are Jones Chemical Laboratory, Ryerson Physical Laboratory, Kent Chemical Laboratory, and Eckhart Hall of The University of Chicago, Chicago, Illinois. Since 1977, the University of Chicago decontaminated Kent Chemical Laboratory as part of a facilities renovation program. All areas of Eckhart Hall, Ryerson Physical Laboratory, and Jones Chemical Laboratory that had been identified as contaminated in excess of current guidelines in the 1976-1977 surveys were decontaminated to levels where no contamination could be detected relative to natural backgrounds. All areas that required defacing to achieve this goal were restored to their original condition. The radiological evaluation of the sewer system, based primarily on the radiochemical analyses of sludge and water samples, indicated that the entire sewer system is potentially contaminated. While this evaluation was defined as part of this project, the decontamination of the sewer system was not included in the purview of this effort. The documentation included in this report substantiates the judgment that all contaminated areas identified in the earlier reports in the three structures included in the decontamination effort (Eckhart Hall, Ryerson Physical Laboratory, and Jones Chemical Laboratory) were cleaned to levels commensurate with release for unrestricted use

  6. Annual report of Nuclear Engineering Research Laboratory, Faculty of Engineering, University of Tokyo, fiscal year 1995

    International Nuclear Information System (INIS)

    1996-08-01

    This is an annual report prepared on research education action, operation state of research instruments and others in FY 1995 at Nuclear Engineering Research Laboratory, Faculty of Engineering, University of Tokyo. The laboratory has four large instruments such as high speed neutron source reactor, 'Yayoi', electron linac, fundamentally experimental equipment for blanket design of nuclear fusion reactor, and heavy radiation research equipment (HIT), of which former two are used for cooperative research with universities in Japan, and the next blanket and the last HIT are also presented for cooperative researches in Faculty of Engineering and in University of Tokyo, respectively. FY 1995 was the beginning year of earnest discussion on future planning of this facility with concentrated effort. These four large research instruments are all in their active use. And, their further improvement is under preparation. In this report, the progress in FY 1995 on operation and management of the four large instruments are described at first, and on next, research actions, contents of theses for degree and graduation of students as well as research results of laboratory stuffs are summarized. These researches are constituted mainly using these large instruments in the facility, aiming at development of advanced and new field of atomic energy engineering and relates to nuclear reactor first wall engineering, nuclear reactor fuel cycle engineering, electromagnetic structure engineering, thermal-liquid engineering, mathematical information engineering, quantum beam engineering, new type reactor design and so on. (G.K.)

  7. Annual report of Nuclear Engineering Research Laboratory, Faculty of Engineering, University of Tokyo, fiscal year 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-08-01

    This is an annual report prepared on research education action, operation state of research instruments and others in FY 1995 at Nuclear Engineering Research Laboratory, Faculty of Engineering, University of Tokyo. The laboratory has four large instruments such as high speed neutron source reactor, `Yayoi`, electron linac, fundamentally experimental equipment for blanket design of nuclear fusion reactor, and heavy radiation research equipment (HIT), of which former two are used for cooperative research with universities in Japan, and the next blanket and the last HIT are also presented for cooperative researches in Faculty of Engineering and in University of Tokyo, respectively. FY 1995 was the beginning year of earnest discussion on future planning of this facility with concentrated effort. These four large research instruments are all in their active use. And, their further improvement is under preparation. In this report, the progress in FY 1995 on operation and management of the four large instruments are described at first, and on next, research actions, contents of theses for degree and graduation of students as well as research results of laboratory stuffs are summarized. These researches are constituted mainly using these large instruments in the facility, aiming at development of advanced and new field of atomic energy engineering and relates to nuclear reactor first wall engineering, nuclear reactor fuel cycle engineering, electromagnetic structure engineering, thermal-liquid engineering, mathematical information engineering, quantum beam engineering, new type reactor design and so on. (G.K.)

  8. QCD phase transition in the laboratory and in the early universe

    International Nuclear Information System (INIS)

    Sinha, Bikash

    1998-01-01

    It is expected that two nuclei colliding at ultra-relativistic energies (∼ 200 GeV/nucleon or more) may lead to hadronic matter go through a phase transition to its fundamental constituents, quarks and gluons, usually referred to as quark gluon plasma (QGP). Somewhat analogously, the universe, as per conventional wisdom should have consisted of quarks, gluons, leptons and photons, a microsecond after the Big Bang. The experience and wisdom, expected from nucleus-nucleus collisions in the laboratory and anticipated to facilitate our understanding of the quark-hadron phase transition. Indeed what possible footprints of that primordial epoch can be traced in today's cosmos is one of the interesting and intriguing questions. In this paper, the following areas will be focused: the issue of successive thermal and chemical equilibrium scenarios; a detailed study of hot hadronic matter and its implication on the thermal model; and finally, the surviving quark nuggets beyond a critical baryon content, and, nuggets being possible candidates for baryonic dark matter in the universe, a much more straightforward candidate than illusive actions or SUSY particles. It is our considered view that quark hadron phase transition in the microsecond universe is a thriving area of research and lot more can be understood and known from this primordial event. (author)

  9. Safety climate in university and college laboratories: impact of organizational and individual factors.

    Science.gov (United States)

    Wu, Tsung-Chih; Liu, Chi-Wei; Lu, Mu-Chen

    2007-01-01

    Universities and colleges serve to be institutions of education excellence; however, problems in the areas of occupational safety may undermine such goals. Occupational safety must be the concern of every employee in the organization, regardless of job position. Safety climate surveys have been suggested as important tools for measuring the effectiveness and improvement direction of safety programs. Thus, this study aims to investigate the influence of organizational and individual factors on safety climate in university and college laboratories. Employees at 100 universities and colleges in Taiwan were mailed a self-administered questionnaire survey; the response rate was 78%. Multivariate analysis of variance revealed that organizational category of ownership, the presence of a safety manager and safety committee, gender, age, title, accident experience, and safety training significantly affected the climate. Among them, accident experience and safety training affected the climate with practical significance. The authors recommend that managers should address important factors affecting safety issues and then create a positive climate by enforcing continuous improvements.

  10. Flexible System Integration and Advanced Hierarchical Control Architectures in the Microgrid Research Laboratory of Aalborg University

    DEFF Research Database (Denmark)

    Meng, Lexuan; Hernández, Adriana Carolina Luna; Diaz, Enrique Rodriguez

    2016-01-01

    This paper presents the system integration and hierarchical control implementation in an inverter-based microgrid research laboratory (MGRL) in Aalborg University, Denmark. MGRL aims to provide a flexible experimental platform for comprehensive studies of microgrids. The structure of the laborato...

  11. From customer satisfaction survey to corrective actions in laboratory services in a university hospital.

    Science.gov (United States)

    Oja, Paula I; Kouri, Timo T; Pakarinen, Arto J

    2006-12-01

    To find out the satisfaction of clinical units with laboratory services in a university hospital, to point out the most important problems and defects in services, to carry out corrective actions, and thereafter to identify the possible changes in satisfaction. and Senior physicians and nurses-in-charge of the clinical units at Oulu University Hospital, Finland. Customer satisfaction survey using a questionnaire was carried out in 2001, indicating the essential aspects of laboratory services. Customer-specific problems were clarified, corrective actions were performed, and the survey was repeated in 2004. In 2001, the highest dissatisfaction rates were recorded for computerized test requesting and reporting, turnaround times of tests, and the schedule of phlebotomy rounds. The old laboratory information system was not amenable to major improvements, and it was renewed in 2004-05. Several clinical units perceived turnaround times to be long, because the tests were ordered as routine despite emergency needs. Instructions about stat requesting were given to these units. However, no changes were evident in the satisfaction level in the 2004 survey. Following negotiations with the clinics, phlebotomy rounds were re-scheduled. This resulted in a distinct increase in satisfaction in 2004. Satisfaction survey is a screening tool that identifies topics of dissatisfaction. Without further clarifications, it is not possible to find out the specific problems of customers and to undertake targeted corrective actions. Customer-specific corrections are rarely seen as improvements in overall satisfaction rates.

  12. Aerosol in selected laboratories at Faculty of Mechanical Engineering, Opole University of Technology

    Science.gov (United States)

    Olszowski, Tomasz

    2017-10-01

    The paper contains the results of a study into mass concentration of the dispersed aerosol fraction with the aerodynamic diameter of up to 2.5 and 10 micrometers. The study was conducted during classes with students participating in them in two laboratories located at Faculty of Mechanical Engineering, Opole University of Technology as well as outdoor outside the building. It was demonstrated that the values of the mass concentration of PM2.5 and PM10 measured in the laboratories differ considerably from the levels measured in the ambient air in the outdoor areas surrounding the faculty building. It was concluded that the diversity of PM2.5/PM10 ratio was greater in the laboratories. Direct correlation was not established between the concentrations of the particular PM fractions in the two investigated environments. It was demonstrated that there is a statistically significant relation between the concentration of PM2.5 and PM10 and the number of people present in the laboratory. The conducted cluster analysis led to the detection of the existence of dominant structures determining air quality parameters. For the analyzed case, endogenic factors are responsible for the aerosanitary condition. The study demonstrated that the evaluation of air quality needs to be performed individually for the specific rooms.

  13. Annual report of Nuclear Engineering Research Laboratory, University of Tokyo in fiscal 1991

    International Nuclear Information System (INIS)

    1992-07-01

    In this annual report, the activities of education and research, the state of operation of research facilities and others in Nuclear Engineering Research Laboratory, University of Tokyo in fiscal year 1991 are summarized. In this Laboratory, there are four large research facilities, that is, the fast neutron source reactor 'Yayoi', the electron beam linac, the nuclear fusion reactor blanket experiment facility and the heavy irradiation research facility. Those are used for carrying out education and research in the wide fields of nuclear engineering, and are offered also for joint utilization. The results of the research by using respective research facilities were summarized in separate reports. In this annual report, the course of the management and operation of respective research facilities is described, and the research activities, the theses for doctorate and graduation theses of the teachers, personnel and graduate students in the Laboratory are summarized. In the research, those on first wall engineering for fusion reactors, fuel cycle engineering, electromagnetic structure engineering, AI and robotics, quantum beam engineering, new type reactor design and so on are included. (K.I.)

  14. Astronomy Laboratory Exercise on Olbers’ Paradox and the Age of the Universe

    Science.gov (United States)

    Glazer, Kelsey Samantha; Edwards, Charlotte; Overduin, James; Storrs, Alex

    2018-01-01

    We describe the development of a new laboratory exercise for undergraduate introductory astronomy courses. Students begin by estimating the intensity of the extragalactic background light using a simple Newtonian cosmological model that agrees with recent measurements to within a factor of two. They then use the 0.5m Towson University telescope to image a dark patch of sky such as the Hubble Deep Field near or during new Moon, and compare the intensity actually observed with that predicted. This comparison leads to a new appreciation of foreground contributions such as light pollution, airglow, zodiacal light, starlight and others. Students pick up important skills in uncertainty analysis and astronomical unit conversion. But the most valuable aspect of the exercise in our view is that it enables students to draw a direct connection between the evidence of their own eyes and the age of the Universe.

  15. The CT Scanner Facility at Stellenbosch University: An open access X-ray computed tomography laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Plessis, Anton du, E-mail: anton2@sun.ac.za [CT Scanner Facility, Central Analytical Facilities, Stellenbosch University, Stellenbosch (South Africa); Physics Department, Stellenbosch University, Stellenbosch (South Africa); Roux, Stephan Gerhard le, E-mail: lerouxsg@sun.ac.za [CT Scanner Facility, Central Analytical Facilities, Stellenbosch University, Stellenbosch (South Africa); Guelpa, Anina, E-mail: aninag@sun.ac.za [CT Scanner Facility, Central Analytical Facilities, Stellenbosch University, Stellenbosch (South Africa)

    2016-10-01

    The Stellenbosch University CT Scanner Facility is an open access laboratory providing non-destructive X-ray computed tomography (CT) and a high performance image analysis services as part of the Central Analytical Facilities (CAF) of the university. Based in Stellenbosch, South Africa, this facility offers open access to the general user community, including local researchers, companies and also remote users (both local and international, via sample shipment and data transfer). The laboratory hosts two CT instruments, i.e. a micro-CT system, as well as a nano-CT system. A workstation-based Image Analysis Centre is equipped with numerous computers with data analysis software packages, which are to the disposal of the facility users, along with expert supervision, if required. All research disciplines are accommodated at the X-ray CT laboratory, provided that non-destructive analysis will be beneficial. During its first four years, the facility has accommodated more than 400 unique users (33 in 2012; 86 in 2013; 154 in 2014; 140 in 2015; 75 in first half of 2016), with diverse industrial and research applications using X-ray CT as means. This paper summarises the existence of the laboratory’s first four years by way of selected examples, both from published and unpublished projects. In the process a detailed description of the capabilities and facilities available to users is presented.

  16. The molecular universe: from astronomy to laboratory astrophysics and back

    Science.gov (United States)

    van Dishoeck, Ewine

    2015-08-01

    Molecules are found in a wide range of astronomical environments, fromour Solar System to distant starburst galaxies at the highest redshifts. Thanks to the opening up of the infrared and (sub)millimeter wavelength regime, culminating with Herschel and ALMA, more than 180 different species have now been found throughout the various stages of stellar birth and death: diffuse and dense interstellar clouds, protostars and disks, the envelopes of evolved stars and planetary nebulae, and exo-planetary atmospheres. Molecules and solid-state features are now also routinely detected in the interstellar medium of external galaxies, near and far.There are many motivations for studying this molecular universe. From the chemical perspective, interstellar space provides a unique laboratory to study basic molecular processes under very different conditions from those normally found in a laboratory on Earth. For astronomers, molecules are unique probes of the many environments where they are found, providing information on density, temperature, dynamics, ionization fractions and magnetic fields. Molecules also play an important role in the cooling of clouds allowing them to collapse, including the formation of the very first stars and galaxies. Finally, the molecular composition is sensitive to the history of the material, and ultimately provides critical information on our origins.This talk will summarize a number of recent observational highlights and provide examples of cases where the availability of new laboratory data proved crucial in the analysis. This includes basic data such as spectroscopy and collisional rate coefficients, but also an improved understanding of photoprocesses in the gaseous and solid state. Much of the chemistry in star- and planet-forming regions is now thought to be driven by gas-grain chemistry rather than pure gas-phase chemistry, and a few examples of the close link between models and laboratory experiments will be given. In spite of lingering

  17. A universal open-source Electronic Laboratory Notebook.

    Science.gov (United States)

    Voegele, Catherine; Bouchereau, Baptiste; Robinot, Nivonirina; McKay, James; Damiecki, Philippe; Alteyrac, Lucile

    2013-07-01

    Laboratory notebooks remain crucial to the activities of research communities. With the increase in generation of electronic data within both wet and dry analytical laboratories and new technologies providing more efficient means of communication, Electronic Laboratory Notebooks (ELN) offer equivalent record keeping to paper-based laboratory notebooks (PLN). They additionally allow more efficient mechanisms for data sharing and retrieval, which explains the growing number of commercial ELNs available varying in size and scope but all are increasingly accepted and used by the scientific community. The International Agency for Research on Cancer (IARC) having already an LIMS and a Biobank Management System for respectively laboratory workflows and sample management, we have developed a free multidisciplinary ELN specifically dedicated to work notes that will be flexible enough to accommodate different types of data. Information for installation of our freeware ELN with source codes customizations are detailed in supplementary data. Supplementary data are available at Bioinformatics online.

  18. Universities and National Laboratories

    Indian Academy of Sciences (India)

    knowledge, etc. in the curriculum of the Institute of Technology at Kharagpur. The. University of ... Nothing can be farther from reality. If the powers that can ... have moved and mixed and have had my being in the student community. I claim that.

  19. Annual report of Laboratory of Nuclear Studies, Osaka University, for fiscal 1995

    International Nuclear Information System (INIS)

    1996-01-01

    This publication is the progress report of the research activities carried out by the members of the Osaka University Laboratory of Nuclear Studies (OULNS) in fiscal year 1995. Some groups carried out their experimental researches using the major research facilities at the OULNS, that include 4.75 MV Van de Graaff, a mass spectrograph, and an M360 Computer. Other groups intensively carried out all or part of their researches outside Osaka University including the facilities in foreign countries. In short the reader will enjoy a whole spectrum of research fields studied by nuclear and particle techniques. To expand and enrich the studies in the interdisciplinary region between nuclear physics and solid state physics investigated by use of nuclear technologies, especially by use of unstable nuclear beams, OULNS is now planning a small Radioactive-Nuclear-Beam Facility which consists of an AVF cyclotron of K = 30 with high intensity beams of light ions and a post accelerator, a radio-frequency-quadrupole accelerator (RFQ). (J.P.N.)

  20. A Cryogenic Detector Characterization Facility in the Shallow Underground Laboratory at the Technical University of Munich

    Science.gov (United States)

    Langenkämper, A.; Defay, X.; Ferreiro Iachellini, N.; Kinast, A.; Lanfranchi, J.-C.; Lindner, E.; Mancuso, M.; Mondragón, E.; Münster, A.; Ortmann, T.; Potzel, W.; Schönert, S.; Strauss, R.; Ulrich, A.; Wawoczny, S.; Willers, M.

    2018-04-01

    The Physics Department of the Technical University of Munich operates a shallow underground detector laboratory in Garching, Germany. It provides ˜ 160 {m^2} of laboratory space which is shielded from cosmic radiation by ˜ 6 m of gravel and soil, corresponding to a shielding of ˜ 15 {m.w.e.} . The laboratory also houses a cleanroom equipped with work- and wetbenches, a chemical fumehood as well as a spin-coater and a mask-aligner for photolithographic processing of semiconductor detectors. Furthermore, the shallow underground laboratory runs two high-purity germanium detector screening stations, a liquid argon cryostat and a ^3 He-^4 He dilution refrigerator with a base temperature of ≤ 12-14 mK . The infrastructure provided by the shallow laboratory is particularly relevant for the characterization of CaWO_4 target crystals for the CRESST-III experiment, detector fabrication and assembly for rare event searches. Future applications of the laboratory include detector development in the framework of coherent neutrino nucleus scattering experiments (ν -cleus) and studying its potential as a site to search for MeV-scale dark matter with gram-scale cryogenic detectors.

  1. Annual report of Nuclear Engineering Research Laboratory, University of Tokyo in fiscal 1990

    International Nuclear Information System (INIS)

    1991-01-01

    In this annual report, the activities of research and education and the state of operation of the research facilities in this Laboratory in fiscal year 1990 are summarized. There are four large research facilities in this Laboratory, that is, the fast neutron source reactor 'Yayoi', the electron beam linear accelerator, the nuclear fusion reactor blanket experiment device and the heavy ion irradiation research facility. Those are used to execute research and education in the wide fields of atomic energy engineering, and put to the common utilization by universities in whole Japan. The results of the research with these facilities have been reported in the separate reports. The research aims at developing the most advanced and new fields in nuclear reactor engineering, and includes the engineering of the first wall and the fuel cycle for nuclear fusion reactors, electromagnetic structure engineering, AI and robotics, quantum beam engineering, the design of new type reactors, the basic process of radiochemistry and so on. The report on the course of the large scale facilities, research activities, the publication of research, education and the events in the Laboratory in the year are described. (K.I.)

  2. Growing a garden without water: Graduate teaching assistants in introductory science laboratories at a doctoral/research university

    Science.gov (United States)

    Luft, Julie A.; Kurdziel, Josepha P.; Roehrig, Gillian H.; Turner, Jessica

    2004-03-01

    Graduate teaching assistants (GTAs) in the sciences are a common feature of U.S. universities that have a prominent mission of research. During the past 2 decades, increased attention has been paid to the professional development of GTAs as instructors. As a result, universities have created training programs to assist GTAs in selecting instructional methods, curricular formats, and assessments when they serve as laboratory, lecture, or discussion group instructors. Unfortunately, few studies explore the educational and instructional environment of GTAs in these reformed settings. This study was conducted to address this specific need. As a constructivist inquiry, qualitative methods were used to collect and analyze the data to elucidate the educational and instructional environment of science GTAs at a doctoral/research university in which various training programs existed. We found that GTAs worked autonomously, that traditional practices and curricula existed in laboratories, and that instructors frequently held limited views of undergraduates' abilities and motivation. Findings in this initial study about GTAs suggest that developers of GTA training programs draw on the literature regarding science teacher education, and that reward systems be instituted that recognize faculty and staff for their participation in GTA training programs.

  3. Portuguese Universities Sharing Remote Laboratories

    Directory of Open Access Journals (Sweden)

    Maria Teresa Restivo

    2009-11-01

    Full Text Available This paper describes a pedagogical assignment based on a cooperative work involving teachers/students from two Portuguese universities. As it happens one is the oldest in the country – University of Coimbra (UC - and the other the largest - University of Porto (UP, about 120 km apart. The authors, believing in the relevance of Information and Communication Technologies (ITs in teaching/learning methodologies and in cooperative teaching methods worked together to plan this pedagogical experience and to run it in a one semester course. Students from UC have been introduced to the remote lab at UP and got the first contact with the remote experiments using easily available sound and image resources based on Skype and an IP camera for better image quality. This first contact has been conducted by the first author at UP with support of the second author at UC. The work will describe briefly the remote experiments used, their inclusion in the course at UC, the associated assessment criteria and, finally, student comments.

  4. Physics laboratory 2

    International Nuclear Information System (INIS)

    1980-01-01

    The report covers the research activities of the Physics laboratory of H.C. Oersted Institute, University of Copenhagen in the period January 1, 1976 - January 1, 1979. It gives also an idea about the teaching carried out by yhe laboratory. The research - broadly speaking - deals mainly with the interaction of particles (ions, electrons and neutrons) and electromagnetic radiation (X-rays) with matter. Use is made in studies of: atomic physics, radiation effects, surface physics, the electronic and crystallographic structure of matter and some biological problems. The research is carried out partly in the laboratory itself and partly at and in collaboration with other institutes in this country (H.C. Oersted Institute, Chemical Laboratories, Denmark's Technical University, Aarhus University, Institute of Physics and Risoe National Laboratory) and abroad (Federal Republic of Germany, France, India, Sweden, U.K., U.S.A. and U.S.S.R.). All these institutes are listed in the abstract titles. Bibliography comprehends 94 publications. A substantial part of the research is supported by the Danish Natural Sciences Research Council. (author)

  5. Kansas State University accelerator laboratory upgrade

    International Nuclear Information System (INIS)

    Richard, P.

    1989-01-01

    The J.R. Macdonald Laboratory is undergoing a major upgrade of its facilities and capabilities. The laboratory is dedicated to the study of ion-atom collisions using highly charged ions from accelerators and/or ion sources. The mainstay of the laboratory over the last two decades has been a 6 MV tandem accelerator. It has been used to produce one- to a few-MeV/u highly charged ions for studying high energy atomic collisions, and to produce recoil ions from ocllisions with projectile ions for studying low energy atomic collisions. In order to enhance the capabilities of studying atomic collisions in these two energy regimes, we are constructing a superconducting LINAC booster to the tandem, and a stand-alone CRYEBIS source. The project, which is funded by the US Department of Energy, began in May 1985 with a May 1989 completion schedule. The upgrade includes a building addition, funded by the State of Kansas, to house the new facilities. The LINAC consists of a time-superbunching module, followed by three large cryostat modules each containing four superconducting resonators, and followed by an energy-rebunching module. The resonators are the split-ring superconducting Nb type designed and constructed at Argonne National Laboratory, and are presently being tested at KSU. The CRYEBIS source, which consists of a 1 m long 5 T superconducting solenoid with a high degree of straightness, is in the final stages of assembly. We have in operation a new computer network for data acquisition and analysis. A progress report on the status of the upgrade is presented. (orig.)

  6. The University as an Open Laboratory

    Science.gov (United States)

    Birx, Donald L.; Ford, Ralph M.; Payne, Carrie A.

    2013-01-01

    Colleges and universities are two of the most formidable resources a country has to reinvent and grow its economy. This is the second of two papers that outlines a process of building and strengthening research universities that enhances regional technology development and facilitates flexible networks of collaboration and resource sharing. In the…

  7. First signs and symptoms of spondyloarthritis—data from an inception cohort with a disease course of two years or less (REGISPONSER-Early)

    Science.gov (United States)

    Rojas-Vargas, Marena; Muñoz-Gomariz, Elisa; Escudero, Alejandro; Font, Pilar; Zarco, Pedro; Almodovar, Raquel; Gratacós, Jordi; Mulero, Juan; Juanola, Xavier; Montilla, Carlos; Moreno, Estefanía

    2009-01-01

    Objective. To determine the first signs and symptoms, and the clinical, biological and radiological characteristics of patients with early SpA. Methods. A total of 150 SpA patients were selected from 2367 listed in REGISPONSER (Registro Español de Espondiloartritis de la Sociedad Española de Reumatología). The inclusion criterion was a disease course of ⩽2 yrs from the onset of symptoms or the appearance of the first sign of disease. Results. Forty-six patients had AS, 51 psoriatic SpA (Ps-SpA), 43 uSpA, 5 ReA, 4 IBD arthropathy and 1 JCA. The mean age at onset of symptoms and at diagnosis was higher in Ps-SpA group (48.1 ± 13.6 and 48.5 ± 13.6 yrs) than in AS group (38.1 ± 12.8 and 38.9 ± 12.7 yrs) and uSpA group (36.3 ± 11.5 and 36.9 ± 11.4 yrs). The most frequent signs or symptoms were back pain: 72% AS group and 56% uSpA group. Lower limb arthritis was the first symptom in 57% Ps-SpA patients, 35% uSpA patients and 20% AS patients; upper limb arthritis was the first symptom in 53% Ps-SpA group and <16% of the remainder. Compared with longer duration disease, at onset, AS patients report upper limb arthritis more frequently and uSpA patients report more of enthesitis. Early radiological sacroiliitis was observed in all AS patients, of whom 54% had Grade II, 39% had Grade III and 7% had Grade IV. Conclusions. In our population, the first manifestations of SpA were low back pain and SI syndrome in AS and uSpA patients and peripheral arthritis in the Ps-SpA group. We can find early SI joint affectation in AS patients. PMID:19208685

  8. Leveraging Existing Laboratory Capacity towards Universal Health ...

    African Journals Online (AJOL)

    Adequately equipped clinical laboratories should provide early warning signals of health risks. The Assessment categorized the laboratories at three levels relating to the type of facility, these being hospital, health center and health post. This study used results from the SARA to determine the ability to make timely diagnosis ...

  9. Advanced Manufacturing Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Manufacturing Laboratory at the University of Maryland provides the state of the art facilities for realizing next generation products and educating the...

  10. Does the Beach-Spawning Grunion Eat Its Own Eggs? Eighth Graders Use Inquiry-Based Investigation to Collect Real Data in a University Laboratory

    Science.gov (United States)

    Cavanagh, J. William; Martinez, Kimberly M.; Higgins, Benjamin A.; Horn, Michael H.

    2014-01-01

    A collaborative effort between a junior high school and a nearby university allowed 40 eighth-grade honors students to engage in a scientific investigation within a university laboratory. These students, with their science teachers and university researchers, gathered data on egg cannibalism in a beach-spawning fish and thereby contributed to an…

  11. Multicenter validation of the value of BASFI and BASDAI in Chinese ankylosing spondylitis and undifferentiated spondyloarthropathy patients

    OpenAIRE

    Lin, Zhiming; Gu, Jieruo; He, Peigen; Gao, Jiesheng; Zuo, Xiaoxia; Ye, Zhizhong; Shao, Fengmin; Zhan, Feng; Lin, Jinying; Li, Li; Wei, Yanlin; Xu, Manlong; Liao, Zetao; Lin, Qu

    2009-01-01

    The objectives of this study were to evaluate the reliability of Bath ankylosing spondylitis functional index (BASFI) and Bath ankylosing spondylitis disease activity index (BASDAI) in Chinese ankylosing spondylitis (AS) and undifferentiated spondyloarthropathy (USpA) patients. 664 AS patients by the revised New York criteria for AS and 252 USpA patients by the European Spondyloarthropathy Study Group criteria were enrolled. BASDAI and BASFI questionnaires were translated into Chinese. Partic...

  12. [How do hospital clinical laboratories and laboratory testing companies cooperate and build reciprocal relations?].

    Science.gov (United States)

    Kawano, Seiji

    2014-12-01

    As the 2nd Joint Symposium of the Japanese Society of Laboratory Medicine and the Japanese Association of Laboratory Pathologists, the symposium on clinical test out-sourcing and branch laboratories was held at the 60th General Meeting of the Japanese Society of Laboratory Medicine on November 2nd, 2013 in Kobe. For the symposium, we conducted a questionnaire survey on the usage of clinical test out-sourcing and the introduction of branch laboratories to clinical laboratories of Japanese university hospitals, both private and public, between July 25th and August 20th, 2013. Seventy-two hospitals responded to the questionnaire survey, consisting of 41 public medical school hospitals and 31 private ones. According to the survey, the selection of each clinical test for out-sourcing was mainly determined by the capacities of hospital clinical laboratories and their equipment, as well as the profitability of each test. The main concerns of clinical laboratory members of university hospitals involved the continuity of measurement principles, traceability, and standardization of reference values for each test. They strongly requested the interchangeability and computerization of test data between laboratory testing companies. A branch laboratory was introduced to six hospitals, all of which were private medical college hospitals, out of 72 university hospitals, and eight of the other hospitals were open to its introduction. The merits and demerits of introducing a branch laboratory were also discussed. (Review).

  13. In vivo ultrasound and photoacoustic monitoring of mesenchymal stem cells labeled with gold nanotracers.

    Directory of Open Access Journals (Sweden)

    Seung Yun Nam

    Full Text Available Longitudinal monitoring of cells is required in order to understand the role of delivered stem cells in therapeutic neovascularization. However, there is not an imaging technique that is capable of quantitative, longitudinal assessment of stem cell behaviors with high spatial resolution and sufficient penetration depth. In this study, in vivo and in vitro experiments were performed to demonstrate the efficacy of ultrasound-guided photoacoustic (US/PA imaging to monitor mesenchymal stem cells (MSCs labeled with gold nanotracers (Au NTs. The Au NT labeled MSCs, injected intramuscularly in the lower limb of the Lewis rat, were detected and spatially resolved. Furthermore, our quantitative in vitro cell studies indicate that US/PA imaging is capable of high detection sensitivity (1×10⁴ cells/mL of the Au NT labeled MSCs. Finally, Au NT labeled MSCs captured in the PEGylated fibrin gel system were imaged in vivo, as well as in vitro, over a one week time period, suggesting that longitudinal cell tracking using US/PA imaging is possible. Overall, Au NT labeling of MSCs and US/PA imaging can be an alternative approach in stem cell imaging capable of noninvasive, sensitive, quantitative, longitudinal assessment of stem cell behaviors with high spatial and temporal resolutions at sufficient depths.

  14. Economic impact of university veterinary diagnostic laboratories: A case study.

    Science.gov (United States)

    Schulz, Lee L; Hayes, Dermot J; Holtkamp, Derald J; Swenson, David A

    2018-03-01

    Veterinary diagnostic laboratories (VDLs) play a significant role in the prevention and mitigation of endemic animal diseases and serve an important role in surveillance of, and the response to, outbreaks of transboundary and emerging animal diseases. They also allow for business continuity in livestock operations and help improve human health. Despite these critical societal roles, there is no academic literature on the economic impact of VDLs. We present a case study on the economic impact of the Iowa State University Veterinary Diagnostic Laboratory (ISUVDL). We use economic contribution analysis coupled with a stakeholder survey to estimate the impact. Results suggest that the ISUVDL is responsible for $2,162.46 million in direct output, $2,832.45 million in total output, $1,158.19 million in total value added, and $31.79 million in state taxes in normal years. In an animal health emergency this increases to $8,446.21 million in direct output, $11,063.06 million in total output, $4,523.70 million in total value added, and $124.15 million in state taxes. The ISUVDL receives $4 million annually as a direct state government appropriation for operating purposes. The $31.79 million in state taxes in normal years and the $124.15 million in state taxes in an animal health emergency equates to a 795% and 3104% return on investment, respectively. Estimates of the economic impact of the ISUVDL provide information to scientists, administrators, and policymakers regarding the efficacy and return on investment of VDLs. Copyright © 2018 Elsevier B.V. All rights reserved.

  15. Carbon Stock in Integrated Field Laboratory Faculty of Agriculture University of Lampung

    Directory of Open Access Journals (Sweden)

    Irwan Sukri Banuwa

    2016-05-01

    Full Text Available This study aimed to determine the amount of carbon stock and CO2 plant uptake in the Integrated Field Laboratory (IFL Faculty of Agriculture University of Lampung. The research was conducted from April to November 2015. The study was arranged in a completely randomized block design (CRBD, consisting of five land units as treatment with four replications for each treatment. Biomass of woody plants was estimated using allometric equation, biomass of understorey plants was estimated using plant dry weight equation, and organic C content in plants and soils were analyzed using a Walkey and Black method. The results showed that land unit consisting of densely woody plants significantly affects total biomass of woody plants, organic C content in woody plants and total carbon content (above and below ground. The highest amount of woody plant biomass was observed in land unit 5, i.e. 1,196.88 Mg ha-1, and above ground total carbon was 437.19 Mg ha-1. IFL Faculty of Agriculture University of Lampung has a total carbon stock of 2,051.90 Mg and capacity to take up total CO2 of 6,656.88 Mg.

  16. Reactor laboratory course for Korean under-graduate students in Kyoto University Critical Assembly (KUGSiKUCA)

    International Nuclear Information System (INIS)

    Pyeon, Cheol Ho; Misawa, Tsuyoshi; Unesaki, Hironobu; Ichihara, Chihiro; Shiroya, Seiji; Whang, Joo Ho; Kim, Myung Hyun

    2005-01-01

    The Reactor Laboratory Course for Korean Under-Graduate Students has been carried out at Kyoto University Critical Assembly of Japan. This course has been launched from fiscal year 2003 and has been founded by Ministry of Science and Technology of Korean Government. Since then, the total number of 43 Korean under-graduate students, who have majored in nuclear engineering of 6 universities in all over the Korea, has been taken part in this course. The reactor physics experiments have been performed in this course, such as Approach to criticality, Control rod calibration, Measurement of neutron flux and power calibration, and Educational reactor operation. As technical tour of Japan, nuclear site tour has been taken during their stay in Japan, such as PWR, FBR, nuclear fuel company and some institutes

  17. Embry-Riddle Aeronautical University multispectral sensor and data fusion laboratory: a model for distributed research and education

    Science.gov (United States)

    McMullen, Sonya A. H.; Henderson, Troy; Ison, David

    2017-05-01

    The miniaturization of unmanned systems and spacecraft, as well as computing and sensor technologies, has opened new opportunities in the areas of remote sensing and multi-sensor data fusion for a variety of applications. Remote sensing and data fusion historically have been the purview of large government organizations, such as the Department of Defense (DoD), National Aeronautics and Space Administration (NASA), and National Geospatial-Intelligence Agency (NGA) due to the high cost and complexity of developing, fielding, and operating such systems. However, miniaturized computers with high capacity processing capabilities, small and affordable sensors, and emerging, commercially available platforms such as UAS and CubeSats to carry such sensors, have allowed for a vast range of novel applications. In order to leverage these developments, Embry-Riddle Aeronautical University (ERAU) has developed an advanced sensor and data fusion laboratory to research component capabilities and their employment on a wide-range of autonomous, robotic, and transportation systems. This lab is unique in several ways, for example, it provides a traditional campus laboratory for students and faculty to model and test sensors in a range of scenarios, process multi-sensor data sets (both simulated and experimental), and analyze results. Moreover, such allows for "virtual" modeling, testing, and teaching capability reaching beyond the physical confines of the facility for use among ERAU Worldwide students and faculty located around the globe. Although other institutions such as Georgia Institute of Technology, Lockheed Martin, University of Dayton, and University of Central Florida have optical sensor laboratories, the ERAU virtual concept is the first such lab to expand to multispectral sensors and data fusion, while focusing on the data collection and data products and not on the manufacturing aspect. Further, the initiative is a unique effort among Embry-Riddle faculty to develop multi

  18. Formerly Utilized MED/AEC Sites Remedial Action Program. Project management plan for the decontamination of Jones Laboratory, Ryerson Physical Laboratory, and Eckhart Hall, the University of Chicago, Chicago, Illinois

    International Nuclear Information System (INIS)

    Flynn, K.F.; Smith, W.H.; Wynveen, R.A.

    1984-01-01

    The Department of Energy (DOE) has in place a plan for the decontamination and decommissioning of contaminated sites that had been formerly utilized by the Manhattan Engineering District (MED) and/or the Atomic Energy Commission. This plan is referred to as the Formerly Utilized Sites Remedial Action Program (FUSRAP). Among these sites are Jones Laboratory, Ryerson Physical Laboratory and Eckhart Hall of The University of Chicago at Chicago, Illinois. This document represents the Project Management Plan for the decontamination of these facilities. 13 references, 3 figures, 1 table

  19. Formerly Utilized MED/AEC Sites Remedial Action Program. Project management plan for the decontamination of Jones Laboratory, Ryerson Physical Laboratory, and Eckhart Hall, the University of Chicago, Chicago, Illinois

    Energy Technology Data Exchange (ETDEWEB)

    Flynn, K.F.; Smith, W.H.; Wynveen, R.A.

    1984-01-01

    The Department of Energy (DOE) has in place a plan for the decontamination and decommissioning of contaminated sites that had been formerly utilized by the Manhattan Engineering District (MED) and/or the Atomic Energy Commission. This plan is referred to as the Formerly Utilized Sites Remedial Action Program (FUSRAP). Among these sites are Jones Laboratory, Ryerson Physical Laboratory and Eckhart Hall of The University of Chicago at Chicago, Illinois. This document represents the Project Management Plan for the decontamination of these facilities. 13 references, 3 figures, 1 table.

  20. Profile of central research and application laboratory of Aǧrı İbrahim Çeçen University

    Science.gov (United States)

    Türkoǧlu, Emir Alper; Kurt, Murat; Tabay, Dilruba

    2016-04-01

    Aǧrı İbrahim Çeçen University built a central research and application laboratory (CRAL) in the east of Turkey. The CRAL possesses 7 research and analysis laboratories, 12 experts and researchers, 8 standard rooms for guest researchers, a restaurant, a conference hall, a meeting room, a prey room and a computer laboratory. The CRAL aims certain collaborations between researchers, experts, clinicians and educators in the areas of biotechnology, bioimagining, food safety & quality, omic sciences such as genomics, proteomics and metallomics. It also intends to develop sustainable solutions in agriculture and animal husbandry, promote public health quality, collect scientific knowledge and keep it for future generations, contribute scientific awareness of all stratums of society, provide consulting for small initiatives and industries. It has been collaborated several scientific foundations since 2011.

  1. Profile of central research and application laboratory of Ağrı İbrahim Çeçen University

    International Nuclear Information System (INIS)

    Türkoğlu, Emir Alper; Kurt, Murat; Tabay, Dilruba

    2016-01-01

    Ağrı İbrahim Çeçen University built a central research and application laboratory (CRAL) in the east of Turkey. The CRAL possesses 7 research and analysis laboratories, 12 experts and researchers, 8 standard rooms for guest researchers, a restaurant, a conference hall, a meeting room, a prey room and a computer laboratory. The CRAL aims certain collaborations between researchers, experts, clinicians and educators in the areas of biotechnology, bioimagining, food safety & quality, omic sciences such as genomics, proteomics and metallomics. It also intends to develop sustainable solutions in agriculture and animal husbandry, promote public health quality, collect scientific knowledge and keep it for future generations, contribute scientific awareness of all stratums of society, provide consulting for small initiatives and industries. It has been collaborated several scientific foundations since 2011.

  2. Profile of central research and application laboratory of Ağrı İbrahim Çeçen University

    Energy Technology Data Exchange (ETDEWEB)

    Türkoğlu, Emir Alper, E-mail: eaturkoglu@yandex.com [Ağrı İbrahim Çeçen University, Faculty of Pharmacy, Department of Pharmaceutical Technology, Ağrı (Turkey); Ağrı İbrahim Çeçen University, Central Research and Application Laboratory, Ağrı (Turkey); Kurt, Murat, E-mail: muratkurt60@hotmail.com; Tabay, Dilruba, E-mail: dtabay@agri.edu.tr [Ağrı İbrahim Çeçen University, Central Research and Application Laboratory, Ağrı (Turkey)

    2016-04-18

    Ağrı İbrahim Çeçen University built a central research and application laboratory (CRAL) in the east of Turkey. The CRAL possesses 7 research and analysis laboratories, 12 experts and researchers, 8 standard rooms for guest researchers, a restaurant, a conference hall, a meeting room, a prey room and a computer laboratory. The CRAL aims certain collaborations between researchers, experts, clinicians and educators in the areas of biotechnology, bioimagining, food safety & quality, omic sciences such as genomics, proteomics and metallomics. It also intends to develop sustainable solutions in agriculture and animal husbandry, promote public health quality, collect scientific knowledge and keep it for future generations, contribute scientific awareness of all stratums of society, provide consulting for small initiatives and industries. It has been collaborated several scientific foundations since 2011.

  3. Safety in the Chemical Laboratory: Safety in the Chemistry Laboratories: A Specific Program.

    Science.gov (United States)

    Corkern, Walter H.; Munchausen, Linda L.

    1983-01-01

    Describes a safety program adopted by Southeastern Louisiana University. Students are given detailed instructions on laboratory safety during the first laboratory period and a test which must be completely correct before they are allowed to return to the laboratory. Test questions, list of safety rules, and a laboratory accident report form are…

  4. The communication of laboratory investigations by university entrants

    Science.gov (United States)

    Campbell, Bob; Kaunda, Loveness; Allie, Saalih; Buffler, Andy; Lubben, Fred

    2000-10-01

    The purpose of the study reported here was to analyse the ways in which unversity entrant science students carry out and communicate experimental activities and to identify a model to explain characteristic communication practices. The study was prompted by a need to inform the development of an introductory laboratory course. The students studied shared an educational background characterised by a lack of experience with laboratory work and scientific writing. Seven groups of three students were studied. The investigative strategies of these groups were observed. Laboratory reports were used to identify the ways in which students communicated these strategies. Data are presented that show a discrepancy between the strategies used and those reported. The results suggest that: (i) students' perceptions of the purpose of a laboratory task influence their decisions on what to report; (ii) understandings of laboratory procedures greatly influence their decision on what to report and on how much detail to include in a report and; (iii) knowledge of discourse rules contributes to effective reporting. It is concluded that students' communication of an investigation results from the differential operation of various perceptual filters that determine both the procedural and discourse elements of their reports. It is recommended that the communication of science should be taught explicitly and alongside the procedures and concepts of science.

  5. The Australian Institute of Nuclear Science and Engineering - a model for university-national laboratory collaboration

    International Nuclear Information System (INIS)

    Gammon, R.B.

    1994-01-01

    This paper describes the aims and activities of the Australian Institute of Nuclear Science and Engineering (AINSE), from its foundation in 1958 through to 1993. The philosophy, structure and funding of the Institute are briefly reviewed, followed by an account of the development of national research facilities at the Lucas Heights Research Laboratories, with particular emphasis on nuclear techniques of analyses using neutron scattering instruments and particle accelerators. AINSE's program of Grants, fellowships and studentships are explained with many examples given of projects having significance in the context of Australia's national goals. Conference and training programs are also included. The achievements during these years demonstrate that AINSE has been an efficient and cost-effective model for collaboration between universities and a major national laboratory. In recent years, industry, government organisations and the tertiary education system have undergone major re-structuring and rationalization. A new operational structure for AINSE has evolved in response to these changes and is described

  6. Annual report of Nuclear Engineering Research Laboratory, Faculty of Engineering, University of Tokyo, fiscal year 1996

    International Nuclear Information System (INIS)

    1997-08-01

    This report summarizes research and educational activities, operation status of the research facilities of the Nuclear Engineering Research Laboratory, Faculty of Engineering, University of Tokyo on fiscal year 1996. This facility has four major research facilities such as fast neutron source reactor 'Yayoi', electron Linac, fundamental experiment facility for nuclear fusion reactor blanket design and high fluence irradiation facility(HIT). Education and research activities are conducted in a wide fields of nuclear engineering using these facilities. The former two facilities are available for various studies by universities all over Japan, facility for nuclear fusion reactor blanket design is utilized for research within the Faculty of Engineering and HIT is used for the research within the University of Tokyo. The facility established a plan to reorganized into a nation wide research collaboration center in fiscal year 1995 and after further discussion of a future program it is decided to hold 'Nuclear energy symposium' periodically after fiscal year 1997 as a part of the activity for appealing the research results to the public. (G.K.)

  7. A new ion-beam laboratory for materials research at the Slovak University of Technology

    Science.gov (United States)

    Noga, Pavol; Dobrovodský, Jozef; Vaňa, Dušan; Beňo, Matúš; Závacká, Anna; Muška, Martin; Halgaš, Radoslav; Minárik, Stanislav; Riedlmajer, Róbert

    2017-10-01

    An ion beam laboratory (IBL) for materials research has been commissioned recently at the Slovak University of Technology within the University Science Park CAMBO located in Trnava. The facility will support research in the field of materials science, physical engineering and nanotechnology. Ion-beam materials modification (IBMM) as well as ion-beam analysis (IBA) are covered and deliverable ion energies are in the range from tens of keV up to tens of MeV. Two systems have been put into operation. First, a high current version of the HVEE 6 MV Tandetron electrostatic tandem accelerator with duoplasmatron and cesium sputtering ion sources, equipped with two end-stations: a high-energy ion implantation and IBA end-station which includes RBS, PIXE and ERDA analytical systems. Second, a 500 kV implanter equipped with a Bernas type ion source and two experimental wafer processing end-stations. The facility itself, operational experience and first IBMM and IBA experiments are presented together with near-future plans and ongoing development of the IBL.

  8. Antimatter in the universe and laboratory

    OpenAIRE

    Dolgov, A. D.

    2014-01-01

    Possible signatures which may indicate an existence of antimatter in the Galaxy and in the early universe are reviewed. A model which could give rise to abundant antimatter in the Galaxy is considered.

  9. Association Euratom - Risø National Laboratory for Sustainable Energy, Technical University of Denmark - Annual Progress Report 2009

    DEFF Research Database (Denmark)

    Korsholm, Søren Bang; Michelsen, Poul; Juul Rasmussen, Jens

    The programme of the Research Unit of the Fusion Association Euratom - Risø National Laboratory for Sustainable Energy, Technical University of Denmark, covers work in fusion plasma physics and in fusion technology. The fusion plasma physics research focuses on turbulence and transport, and its...... superconductors. Minor activities are system analysis, initiative to involve Danish industry in ITER contracts and public information. A summary is presented of the results obtained in the Research Unit during 2009....

  10. AMTEX: A university, government, industry, partnership

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, L.J. [Auburn Univ., AL (United States); Cheatham, R.L. [Pacific Northwest Lab., Richland, WA (United States); Peskin, A.M. [Brookhaven National Lab., Upton, NY (United States)

    1993-12-01

    The AMTEX Partnership is a research and development collaboration between the US Department of Energy (DOE), the DOE`s multiprogram laboratories, universities, and the integrated textile industry. The integrated industry includes fibers, textiles, apparel, and other fabricated products. The goal of AMTEX is to strengthen the competitiveness of this vital industry and thereby preserve and create new jobs. AMTEX is a role model for government, industry and universities working together to achieve a specified goal. Under the oversight of the Laboratory Technology Transfer Program in DOE`s Office of Energy Research, the multiprogram laboratories, universities and industry are pursuing a broad, industry-driven research agenda. It combines the research and development capabilities of industry and universities with the unique expertise and facilities of the DOE laboratory system.

  11. Antimatter in the universe and laboratory

    Directory of Open Access Journals (Sweden)

    Dolgov A.D.

    2015-01-01

    Full Text Available Possible signatures which may indicate an existence of antimatter in the Galaxy and in the early universe are reviewed. A model which could give rise to abundant antimatter in the Galaxy is considered.

  12. The Virtual Robotics Laboratory

    International Nuclear Information System (INIS)

    Kress, R.L.; Love, L.J.

    1997-01-01

    The growth of the Internet has provided a unique opportunity to expand research collaborations between industry, universities, and the national laboratories. The Virtual Robotics Laboratory (VRL) is an innovative program at Oak Ridge National Laboratory (ORNL) that is focusing on the issues related to collaborative research through controlled access of laboratory equipment using the World Wide Web. The VRL will provide different levels of access to selected ORNL laboratory equipment to outside universities, industrial researchers, and elementary and secondary education programs. In the past, the ORNL Robotics and Process Systems Division (RPSD) has developed state-of-the-art robotic systems for the Army, NASA, Department of Energy, Department of Defense, as well as many other clients. After proof of concept, many of these systems sit dormant in the laboratories. This is not out of completion of all possible research topics, but from completion of contracts and generation of new programs. In the past, a number of visiting professors have used this equipment for their own research. However, this requires that the professor, and possibly his students, spend extended periods at the laboratory facility. In addition, only a very exclusive group of faculty can gain access to the laboratory and hardware. The VRL is a tool that enables extended collaborative efforts without regard to geographic limitations

  13. Contribution of trimeric autotransporter C-terminal domains of oligomeric coiled-coil adhesin (Oca) family members YadA, UspA1, EibA, and Hia to translocation of the YadA passenger domain and virulence of Yersinia enterocolitica.

    Science.gov (United States)

    Ackermann, Nikolaus; Tiller, Maximilian; Anding, Gisela; Roggenkamp, Andreas; Heesemann, Jürgen

    2008-07-01

    The Oca family is a novel class of autotransporter-adhesins with highest structural similarity in their C-terminal transmembrane region, which supposedly builds a beta-barrel pore in the outer membrane (OM). The prototype of the Oca family is YadA, an adhesin of Yersinia enterocolitica and Yersinia pseudotuberculosis. YadA forms a homotrimeric lollipop-like structure on the bacterial surface. The C-terminal regions of three YadA monomers form a barrel in the OM and translocate the trimeric N-terminal passenger domain, consisting of stalk, neck, and head region to the exterior. To elucidate the structural and functional role of the C-terminal translocator domain (TLD) and to assess its promiscuous capability with respect to transport of related passenger domains, we constructed chimeric YadA proteins, which consist of the N-terminal YadA passenger domain and C-terminal TLDs of Oca family members UspA1 (Moraxella catarrhalis), EibA (Escherichia coli), and Hia (Haemophilus influenzae). These constructs were expressed in Y. enterocolitica and compared for OM localization, surface exposure, oligomerization, adhesion properties, serum resistance, and mouse virulence. We demonstrate that all chimeric YadA proteins translocated the YadA passenger domain across the OM. Y. enterocolitica strains producing YadA chimeras or wild-type YadA showed comparable binding to collagen and epithelial cells. However, strains producing YadA chimeras were attenuated in serum resistance and mouse virulence. These results demonstrate for the first time that TLDs of Oca proteins of different origin are efficient translocators of the YadA passenger domain and that the cognate TLD of YadA is essential for bacterial survival in human serum and mouse virulence.

  14. Leveraging Existing Laboratory Capacity towards Universal Health ...

    African Journals Online (AJOL)

    Background: The provision of quality health care is influenced by ... Laboratory support is urgently needed to enhance service delivery in the ... Information generated through ... professionals using simple rapid technology have been adopted.

  15. Visual interaction: models, systems, prototypes. The Pictorial Computing Laboratory at the University of Rome La Sapienza.

    Science.gov (United States)

    Bottoni, Paolo; Cinque, Luigi; De Marsico, Maria; Levialdi, Stefano; Panizzi, Emanuele

    2006-06-01

    This paper reports on the research activities performed by the Pictorial Computing Laboratory at the University of Rome, La Sapienza, during the last 5 years. Such work, essentially is based on the study of humancomputer interaction, spans from metamodels of interaction down to prototypes of interactive systems for both synchronous multimedia communication and groupwork, annotation systems for web pages, also encompassing theoretical and practical issues of visual languages and environments also including pattern recognition algorithms. Some applications are also considered like e-learning and collaborative work.

  16. Association Euratom - Risø National Laboratory for Sustainable Energy, Technical University of Denmark - Annual Progress Report 2008

    DEFF Research Database (Denmark)

    Korsholm, Søren Bang; Michelsen, Poul; Juul Rasmussen, Jens

    The programme of the Research Unit of the Fusion Association Euratom - Risø National Laboratory for Sustainable Energy, Technical University of Denmark, covers work in fusion plasma physics and in fusion technology. The fusion plasma physics research focuses on turbulence and transport, and its...... been initiated in 2008. Minor activities are system analysis, initiative to involve Danish industry in ITER contracts and public information. A summary is presented of the results obtained in the Research Unit during 2008....

  17. University of Colorado at Boulder Nuclear Physics Laboratory technical progress report

    International Nuclear Information System (INIS)

    Peterson, R.J.

    1991-01-01

    This report summarizes experimental work carried out between October 1, 1990, the closing of our Progress Report, and August 14, 1991 at the Nuclear Physics Laboratory of the University of Colorado, Boulder, under contract DE-FG02-ER40269 with the United States Department of Energy. This contract supports broadly based experimental work in intermediate energy nuclear physics. The program includes pion-nucleon studies at TRIUMF and LAMPF, inelastic pion scattering and charge exchange reactions at LAMPF, and nucleon charge exchange at LAMPF/NTOF. The first results of spin-transfer observables in the isovector (rvec p,rvec n) reaction are included in this report. Our data confirm the tentative result from (rvec p,rvec p') reactions that the nuclear isovector spin response shows neither longitudinal enhancement nor transverse queching. Our program in quasifree scattering of high energy pions shows solid evidence of isoscalar enhancement of the nuclear nonspin response. We include several comparisons of the quasifree scattering of different probes. Results from our efforts in the design of accelerator RF cavities are also included in this report

  18. The Dewey School as Triumph, Tragedy, and Misunderstood: Exploring the Myths and Historiography of the University of Chicago Laboratory School

    Science.gov (United States)

    Fallace, Thomas; Fantozzi, Victoria

    2017-01-01

    Background/Context: Over the last century, perhaps no school in American history has been studied more than John Dewey's Laboratory School at the University of Chicago (1896-1904). Scholars have published dozens of articles, books, essays, and assessments of a school that existed for only seven and a half years. Purpose/Objective/Research…

  19. Report on application results of the nuclear reactor in Atomic Energy Research Laboratory, Rikkyo University. April 1994 - March 1995

    International Nuclear Information System (INIS)

    1995-01-01

    This report is on researching action state, application state, management state, and others of 1994 fiscal year at the Atomic Energy Research Laboratory, Rikkyo University. The experimental reactor has been used for the studies such as application of neutron radioactivity analysis to multi fields, application of fission and alpha track method to age determination and metallurgy, hot atom chemistry, neutron radiation effect on semiconductors and others, nuclear data measurement, organism, materials and products using neutron radiography, and development and application to inspection of radiation detectors such as neutron detector. This report was a report shown as a shape of research results of actions of the researchers. And, another report of colaborate research results using the Rikkyo University reactor was also published from the Atomic Energy Center, the University of Tokyo begun since April, 1974. (G.K.)

  20. Archive of Geosample Data and Information from the University of Rhode Island (URI) Graduate School of Oceanography (GSO), Marine Geological Samples Laboratory (MGSL)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Marine Geological Samples Laboratory (MGSL) of the Graduate School of Oceanography (GSO), University of Rhode Island is a partner in the Index to Marine and...

  1. Characterizing Instructional Practices in the Laboratory: The Laboratory Observation Protocol for Undergraduate STEM

    Science.gov (United States)

    Velasco, Jonathan B.; Knedeisen, Adam; Xue, Dihua; Vickrey, Trisha L.; Abebe, Marytza; Stains, Marilyne

    2016-01-01

    Chemistry laboratories play an essential role in the education of undergraduate Science, Technology, Engineering, and Mathematics (STEM) and non-STEM students. The extent of student learning in any educational environment depends largely on the effectiveness of the instructors. In chemistry laboratories at large universities, the instructors of…

  2. Fifty-five years (1955-2010) of the Coagulation Section at Laboratory of Hematology, Sestre milosrdnice University Hospital, and its founder, hematologist Ljubomir Popović.

    Science.gov (United States)

    Stancić, Vladimir; Stancić, Nevenka; Vucelić, Vesna; Lang, Nada; Grbac, Ljiljana

    2011-09-01

    The Coagulation Section at Laboratory of Hematology, Sestre milosrdnice University Hospital, Zagreb, was founded in 1955 by Ljubomir Popović, hematologist and assistant at School of Medicine, University of Zagreb, in cooperation with hard-working laboratory technicians. Apart from papers on hematologic neoplasms, plasmacytoma and lymphoma, Ljubomir Popović published a number of papers in the field of anticoagulant therapy with heparin and oral anticoagulants, some of which are also in use today. After Ljubomir Popović left the Hospital in 1964, the Laboratory was run by Professor Nedjeljko Milić, head of the newly founded Division of Hematology. In 1968, the management of the Laboratory of Hematology was taken over by Biserka Raić, MS, medical biochemist, until her retirement in 2007. Great development in morphological and cytometric studies of blood and blood cells has been paralleled by continuous progress and almost dominating activities in the diagnosis of hemostasis disorders. In the 1970s, Marko Koprcina, hematologist, and Biserka Raić introduced the then latest tests in practice at all Hospital departments. In that golden age of the Coagulation Section, M. Koprcina, B. Raić and their associates transferred their knowledge to all colleagues in the Hospital. Through that collaboration, high standards in the diagnosis of hemostasis disorders were achieved, from which the currently high level of clinical knowledge about coagulation disorders and their treatment has derived, making Sestre milosrdnice University Hospital one of the leading hospitals in this field in the country. By describing development of the Coagulation Section and the life of its founder Ljubomir Popović, the authors tried to provide an answer to the following question: can today's clinicians still have a deciding role in laboratory development, considering that assessments of different phenomena are always initiated by an interested clinician who is trying to interpret and understand

  3. Publications and geothermal sample library facilities of the Earth Science Laboratory, University of Utah Research Institute

    Energy Technology Data Exchange (ETDEWEB)

    Wright, Phillip M.; Ruth, Kathryn A.; Langton, David R.; Bullett, Michael J.

    1990-03-30

    The Earth Science Laboratory of the University of Utah Research Institute has been involved in research in geothermal exploration and development for the past eleven years. Our work has resulted in the publication of nearly 500 reports, which are listed in this document. Over the years, we have collected drill chip and core samples from more than 180 drill holes in geothermal areas, and most of these samples are available to others for research, exploration and similar purposes. We hope that scientists and engineers involved in industrial geothermal development will find our technology transfer and service efforts helpful.

  4. Annual report 1991 of Munich University and Technical University Accelerator Laboratory

    International Nuclear Information System (INIS)

    1992-01-01

    The experimental work in the Accelerator Laboratory contains investigations of nuclear reactions and nuclear structure, studies of atom physics and the application of nuclear physics methods in physics and in interdisciplinary research. These applications are acceleration mass spectrometry to detect traces of radio-isotopes and material analysis with particle beams. The development of apparatus in the fields of accelereator construction, ion sources and targets are at the heart of the laboratory and help to establish its reputation. They are of the greatest importance for the education of students. The development stage for the superconducting post-accelerator TRITRON is complete and prototypes of the magnets and resonators were successfully tested and operated. The mass-production of all the components is under way or already finished. The standard injector for the tandem axxelerator and an injector for accelerator mass spectroscopy with stable isotopes are being newly designed. The experimental work is supplemented by the calculations of our theoretical collagues of core reaction mechanisms, core de-excitation and the Cerenkov radiation of core structures and transition strengths, by relativistic Hartree-Fock calculations and by star model calculations. (orig.) [de

  5. QA Programme of the TLD laboratory of the University of Costa Rica: IEC 61066 testing

    International Nuclear Information System (INIS)

    Mora, Patricia; Porras Chaverria, Mariela

    2008-01-01

    The Thermoluminescence Personal Dosimetry Laboratory of the University of Costa Rica provides dose measurements for around 90% of occupational radiation workers in the country. The assessment of doses to workers routinely exposed to external sources of radiation constitutes an integral part of any radiation protection programme and helps national authorities to ensure acceptably safe and satisfactory radiological conditions in workplaces. Harshaw Readers Model 4000 and 4500, dosimeter holders Type 8814 with TLD-100 in 0110 cards and loose TLD-100 chips are used to monitor personal dose equivalent, Hp(10) and Hp(0.07). In order to provide a reliable measurement of the operational quantities, a study was undertaken to verify the fulfillment of international requirements in our system (Model 4500 with cards) against the Thermoluminescence dosimetry systems for personal and environmental monitoring CEI IEC 61066 (1991 -2012). The type tests performed were nine in total: batch homogeneity, reproducibility, linearity, detection threshold, effect of climate conditions on reader, effect of light exposure on dosimeters, isotropy, transient voltage and dropping on dosimeters. A Cesium-137 source was used to irradiate the dosimeters and all procedures follow the indications given on the standard. Results showed that all IEC criteria were met by our Laboratory. Acceptable uncertainties were also studied under the ICRP recommendations; the analysis of the Trumpet Curve was done with satisfactory results (for doses above 0.5 mSv; quotient of measure to real dose less than 3%). For purposes of accreditation (ISO/IEC 17025:2005) and performance testing this work is very relevant since the University of Costa Rica wants to establish a solid individual monitoring programme for external radiation exposure that will provide users, registrants, licensees and regulatory bodies with information that can be used for the optimization of protection and dose limitation of Costa Rican workers

  6. Characterization of the Shielded Neutron Source at Triangle Universities Nuclear Laboratory

    Science.gov (United States)

    Hobson, Chad; Finch, Sean; Howell, Calvin; Malone, Ron; Tornow, Wernew

    2016-09-01

    In 2015, Triangle Universities Nuclear Laboratory rebuilt its shielded neutron source (SNS) with the goal of improving neutron beam collimation and reducing neutron and gamma-ray backgrounds. Neutrons are produced via the 2H(d,n)3He reaction and then collimated by heavy shielding to form a beam. The SNS has the ability to produce both a rectangular and circular neutron beam through use of two collimators with different beam apertures. Our work characterized both the neutron beam profiles as well as the neutron and gamma-ray backgrounds at various locations around the SNS. This characterization was performed to provide researchers who use the SNS with beam parameters necessary to plan and conduct an experiment. Vertical and horizontal beam profiles were measured at two different distances from the neutron production cell by scanning a small plastic scintillator across the face of the beam at various energies for each collimator. Background neutron and gamma-ray intensities were measured using time-of-flight techniques at 10 MeV and 16 MeV with the rectangular collimator. We present results on the position and size of neutron beam as well as on the structure and magnitude of the backgrounds.

  7. The University of Kansas High-Throughput Screening Laboratory. Part II: enabling collaborative drug-discovery partnerships through cutting-edge screening technology.

    Science.gov (United States)

    McDonald, Peter R; Roy, Anuradha; Chaguturu, Rathnam

    2011-07-01

    The University of Kansas High-Throughput Screening (KU HTS) core is a state-of-the-art drug-discovery facility with an entrepreneurial open-service policy, which provides centralized resources supporting public- and private-sector research initiatives. The KU HTS core was established in 2002 at the University of Kansas with support from an NIH grant and the state of Kansas. It collaborates with investigators from national and international academic, nonprofit and pharmaceutical organizations in executing HTS-ready assay development and screening of chemical libraries for target validation, probe selection, hit identification and lead optimization. This is part two of a contribution from the KU HTS laboratory.

  8. The effect of comedication with conventional synthetic disease modifying antirheumatic drugs on TNF inhibitor drug survival in patients with ankylosing spondylitis and undifferentiated spondyloarthritis

    DEFF Research Database (Denmark)

    Lie, Elisabeth; Kristensen, Lars Erik; Forsblad-d'Elia, Helena

    2015-01-01

    on patients with a clinical diagnosis of AS or uSpA starting treatment with adalimumab, etanercept or infliximab as their first TNFi during 2003-2010 were retrieved from the Swedish national biologics register and linked to national population based registers. Five-year drug survival was analysed by Cox......, and the associations were retained when adjusting for erythrocyte sedimentation rate, C-reactive protein, patient global, swollen joints, uveitis, psoriasis and inflammatory bowel disease. CONCLUSIONS: In this large register study of patients with AS and uSpA, use of csDMARD comedication was associated with better 5...

  9. MEMS Sensors and Actuators Laboratory (MSAL)

    Data.gov (United States)

    Federal Laboratory Consortium — The MEMS Sensors and Actuators Laboratory (MSAL) in the A.J. Clark School of Engineering at the University of Maryland (UMD) was established in January 2000. Our lab...

  10. Remote Laboratories: Bridging University to Secondary Schools

    Directory of Open Access Journals (Sweden)

    Horácio Fernandes

    2012-01-01

    Full Text Available e-lab is a remote laboratory infrastructure powered by a software framework that allows the operation and data retrieve from a remote apparatus. In this demonstration we will present the e-lab interface properties and its modus operandi, giving as well some topics of complimentary software use for data interpretation and analysis.

  11. Pilot Project on Women and Science. A report on women scientists at the University of New Mexico and Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Salvaggio, R. [New Mexico Univ., Albuquerque, NM (United States)

    1993-08-01

    In the fall of 1991, through the coordinating efforts of the University of New Mexico and Los Alamos National Laboratory, the Pilot Project on Women and Science was initiated as a year-long study of women scientists at both the university and the laboratory. Its purpose was to gather information directly from women scientists in an attempt to analyze and make recommendations concerning the professional and cultural environment for women in the sciences. This report is an initial attempt to understand the ways in which women scientists view themselves, their profession, and the scientific culture they inhabit. By recording what these women say about their backgrounds and educational experiences, their current positions, the difficult negotiations many have made between their personal and professional lives, and their relative positions inside and outside the scientific community, the report calls attention both to the individual perspectives offered by these women and to the common concerns they share.

  12. Independent Confirmatory Survey Report for the University of Arizona Nuclear Reactor Laboratory, Tucson, Arizona DCN:2051-SR-01-0

    International Nuclear Information System (INIS)

    Altic, Nick A.

    2011-01-01

    The University of Arizona (University) research reactor is a TRIGA swimming pool type reactor designed by General Atomics and constructed at the University in 1958. The reactor first went into operation in December of 1958 under U.S. Nuclear Regulatory Commission (NRC) license R-52 until final shut down on May 18, 2010. Initial site characterization activities were conducted in February 2009 during ongoing reactor operations to assess the radiological status of the Nuclear Reactor Laboratory (NRL) excluding the reactor tank, associated components, and operating systems. Additional post-shutdown characterization activities were performed to complete characterization activities as well as verify assumptions made in the Decommissioning Plan (DP) that were based on a separate activation analysis (ESI 2009 and WMG 2009). Final status survey (FSS) activities began shortly after the issuance of the FSS plan in May 2011. The contractor completed measurement and sampling activities during the week of August 29, 2011.

  13. Cost of presumptive source term Remedial Actions Laboratory for energy-related health research, University of California, Davis

    International Nuclear Information System (INIS)

    Last, G.V.; Bagaasen, L.M.; Josephson, G.B.; Lanigan, D.C.; Liikala, T.L.; Newcomer, D.R.; Pearson, A.W.; Teel, S.S.

    1995-12-01

    A Remedial Investigation/Feasibility Study (RI/FS) is in progress at the Laboratory for Energy Related Health Research (LEHR) at the University of California, Davis. The purpose of the RI/FS is to gather sufficient information to support an informed risk management decision regarding the most appropriate remedial actions for impacted areas of the facility. In an effort to expedite remediation of the LEHR facility, the remedial project managers requested a more detailed evaluation of a selected set of remedial actions. In particular, they requested information on both characterization and remedial action costs. The US Department of Energy -- Oakland Office requested the assistance of the Pacific Northwest National Laboratory to prepare order-of-magnitude cost estimates for presumptive remedial actions being considered for the five source term operable units. The cost estimates presented in this report include characterization costs, capital costs, and annual operation and maintenance (O ampersand M) costs. These cost estimates are intended to aid planning and direction of future environmental remediation efforts

  14. Fritz Engineering Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — Features 800,000 lb and 5,000,000 lb universal testing machines, and a dynamic test bed with broad fatigue-testing capabilities, and a wide range of instrumentation....

  15. Argonne National Laboratory 1983-1984

    International Nuclear Information System (INIS)

    1984-01-01

    This publication presents significant developments at Argonne National Laboratory during 1983-84. Argonne is a multidisciplinary research center with primary focus on nuclear energy, basic research, biomedical-environmental studies and alternate energy research. The laboratory is operated by the University of Chicago for the Department of Energy

  16. Studies of nuclear processes at the Triangle Universities Nuclear Laboratory. Progress report, 1 September 1995--31 August 1996

    International Nuclear Information System (INIS)

    Ludwig, E.J.

    1996-01-01

    The Triangle Universities Nuclear Laboratory (TUNL)--a collaboration of Duke University, North Carolina State University, and the University of North Carolina at Chapel Hill--has had a very productive year. This report covers parts of the second and third year of a three-year grant between the US Department of Energy and the three collaborating universities. The TUNL research program focuses on the following areas: precision test of parity-invariance violation in resonance neutron scattering at LANSCE/LANL; parity violation measurements using charged-particle resonances in A = 20--40 targets and the A = 4 system at TUNL; chaotic behavior in the nuclei 30 P and 34 Cl from studies of eigenvalue fluctuations in nuclear level schemes; search for anomalies in the level density (pairing phase transition) in 1f-2p shell nuclei using GEANIE at LANSCE/LANL; parity-conserving time-reversal noninvariance tests using 166 Ho resonances at Geel, ORELA, or LANSCE/LANL; nuclear astrophysics; few-body nuclear systems; Nuclear Data evaluation for A = 3--20 for which TUNL is now the international center. Developments in technology and instrumentation are vital to the research and training program. Innovative work was continued in: polarized beam development; polarized target development; designing new cryogenic systems; designing new detectors; improving high-resolution beams for the KN and FN accelerators; development of an unpolarized Low-Energy Beam Facility for radiative capture studies of astrophysical interest. Preliminary research summaries are presented

  17. Studies of nuclear processes at the Triangle Universities Nuclear Laboratory. Progress report, 1 September 1995--31 August 1996

    Energy Technology Data Exchange (ETDEWEB)

    Ludwig, E.J.

    1996-09-01

    The Triangle Universities Nuclear Laboratory (TUNL)--a collaboration of Duke University, North Carolina State University, and the University of North Carolina at Chapel Hill--has had a very productive year. This report covers parts of the second and third year of a three-year grant between the US Department of Energy and the three collaborating universities. The TUNL research program focuses on the following areas: precision test of parity-invariance violation in resonance neutron scattering at LANSCE/LANL; parity violation measurements using charged-particle resonances in A = 20--40 targets and the A = 4 system at TUNL; chaotic behavior in the nuclei {sup 30}P and {sup 34}Cl from studies of eigenvalue fluctuations in nuclear level schemes; search for anomalies in the level density (pairing phase transition) in 1f-2p shell nuclei using GEANIE at LANSCE/LANL; parity-conserving time-reversal noninvariance tests using {sup 166}Ho resonances at Geel, ORELA, or LANSCE/LANL; nuclear astrophysics; few-body nuclear systems; Nuclear Data evaluation for A = 3--20 for which TUNL is now the international center. Developments in technology and instrumentation are vital to the research and training program. Innovative work was continued in: polarized beam development; polarized target development; designing new cryogenic systems; designing new detectors; improving high-resolution beams for the KN and FN accelerators; development of an unpolarized Low-Energy Beam Facility for radiative capture studies of astrophysical interest. Preliminary research summaries are presented.

  18. Beams at U.S. high energy physics laboratories

    International Nuclear Information System (INIS)

    1976-06-01

    Tables are given of beam characteristics for particle accelerators at Argonne National Laboratory, Brookhaven National Laboratory, Cornell University, Fermi National Accelerator Laboratory, and the Stanford Linear Accelerator Center. Characteristics given include energy, momentum, and flux

  19. Satellite Control Laboratory

    DEFF Research Database (Denmark)

    Wisniewski, Rafal; Bak, Thomas

    2001-01-01

    The Satellite Laboratory at the Department of Control Engineering of Aalborg University (SatLab) is a dynamic motion facility designed for analysis and test of micro spacecraft. A unique feature of the laboratory is that it provides a completely gravity-free environment. A test spacecraft...... of the laboratory is to conduct dynamic tests of the control and attitude determination algorithms during nominal operation and in abnormal conditions. Further it is intended to use SatLab for validation of various algorithms for fault detection, accommodation and supervisory control. Different mission objectives...... can be implemented in the laboratory, e.g. three-axis attitude control, slew manoeuvres, spins stabilization using magnetic actuation and/or reaction wheels. The spacecraft attitude can be determined applying magnetometer measurements...

  20. Rotavirus Infection in the Auckland Region After the Implementation of Universal Infant Rotavirus Vaccination: Impact on Hospitalizations and Laboratory Implications.

    Science.gov (United States)

    McAuliffe, Gary N; Taylor, Susan L; Drinković, Dragana; Roberts, Sally A; Wilson, Elizabeth M; Best, Emma J

    2018-01-01

    In July 2014, New Zealand introduced universal infant vaccination with RotaTeq (Merk & Co.) administered as 3 doses at 6 weeks, 3 and 5 months of age. We sought to assess the impact of rotavirus vaccination on gastroenteritis (GE) hospitalizations in the greater Auckland region and analyze changes in rotavirus testing in the period around vaccine introduction. Hospitalizations, laboratory testing rates and methods were compared between the pre-vaccine period (2009-2013), post-vaccine period (January 2015 to December 2015) and year of vaccine introduction (2014). There was a 68% decline in rotavirus hospitalizations of children Auckland region. However, continued rotavirus testing at pre-vaccine rates risks generating false positive results. Laboratories and clinicians should consider reviewing their testing algorithms before vaccine introduction.

  1. Medical laboratory science and nursing students' perception of academic learning environment in a Philippine university using Dundee Ready Educational Environment Measure (DREEM).

    Science.gov (United States)

    Barcelo, Jonathan M

    2016-01-01

    This study aimed to compare the perception of the academic learning environment between medical laboratory science students and nursing students at Saint Louis University, Baguio City, Philippines. A cross-sectional survey research design was used to measure the perceptions of the participants. A total of 341 students from the Department of Medical Laboratory Science, School of Natural Sciences, and the School of Nursing answered the Dundee Ready Education Environment Measure (DREEM) instrument from April to May 2016. Responses were compared according to course of study, gender, and year level. The total mean DREEM scores of the medical laboratory science students and nursing students did not differ significantly when grouped according to course of study, gender, or year level. Medical laboratory science students had significantly lower mean scores in the sub-domains 'perception of learning' and 'perception of teaching.' Male medical laboratory science students had significantly lower mean scores in the sub-domain 'perception of learning' among second year students. Medical laboratory science students had significantly lower mean scores in the sub-domain 'perception of learning.' Nursing students identified 7 problem areas, most of which were related to their instructors. Medical laboratory science and nursing students viewed their academic learning environment as 'more positive than negative.' However, the relationship of the nursing instructors to their students needs improvement.

  2. Implementation of a rapid HIT immunoassay at a university hospital - Retrospective analysis of HIT laboratory orders in patients with thrombocytopenia.

    Science.gov (United States)

    Black, Anne; Heimerl, Susanne; Oertli, Linnéa; Wilczek, Wolf; Greinacher, Andreas; Spannagl, Michael; Herr, Wolfgang; Hart, Christina

    2017-10-01

    Heparin-induced thrombocytopenia (HIT) is a rare cause of thrombocytopenia and a potentially life-threatening adverse drug reaction. Clinical overdiagnosis of HIT results in costly laboratory tests and anticoagulation. Criteria and algorithms for diagnosis are established, but their translation into clinical practice is still challenging. In a retrospective approach we studied all HIT related laboratory test requests within four years and evaluated data before (1st period, 24month) and after (2nd period, 24month) replacing particle gel immunoassay (PaGIA) and enzyme-linked immunosorbent assay (ELISA) by a chemiluminescent immunoassay (CLIA). HIT was confirmed by heparin-induced platelet activation (HIPA) test. Clinical pretest probability for HIT using an implemented simplified 4Ts score and platelet count were evaluated. Costs for laboratory tests and alternative anticoagulation were calculated. In 1850 patients with suspected HIT, 2327 laboratory orders were performed. In 87.2% of these orders an intermediate/high simplified 4Ts score was found. Thrombocytopenia was present in 87.1%. After replacing PaGIA and ELISA by CLIA the number of immunological and functional laboratory tests was reduced by 38.2%. The number of positive HIT immunoassays declined from 22.6% to 6.0%, while the number of positive HIPA tests among positive immunological tests increased by 19%. Altogether, acute HIT was confirmed in 59 patients. A decline in the use of alternative anticoagulants was observed in the 2nd period. Our study shows that in a university hospital setting HIT is well-known, but diagnosis requires a precise laboratory confirmation. Replacing PaGIA and ELISA by CLIA did not influence laboratory order behavior but results in reduced overall costs for laboratory diagnostics and alternative anticoagulation. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Health centres' view of the services provided by a university hospital laboratory: Use of satisfaction surveys

    Science.gov (United States)

    Oja, Paula; Kouri, Timo; Pakarinen, Arto

    2010-01-01

    Customer orientation has gained increasing attention in healthcare. A customer satisfaction survey is one way to raise areas and topics for quality improvement. However, it seems that customer satisfaction surveys have not resulted in quality improvement in healthcare. This article reports how the authors' university hospital laboratory has used customer satisfaction surveys targeted at the health centres in their hospital district. Closed-ended statements of the questionnaire were planned to cover the essential aspects of laboratory services. In addition, an open-ended question asked what was considered to be the most important problem in services. The questionnaires were sent to the medical directors of the health centres. The open-ended question proved to be very useful because the responses specified the main problems in service. Based on the responses, selected dissatisfied customers were contacted to specify their responses and possible corrective actions were taken. It is concluded that a satisfaction survey can be used as a screening tool to identify topics of dissatisfaction. In addition, further clarifications with selected customers are needed to specify the causes for their dissatisfaction and to undertake proper corrective actions. PMID:20205616

  4. Formerly utilized MED/AEC sites remedial action program post-remedial-action radiological survey of Kent Chemical Laboratory, the University of Chicago, Chicago, IL

    International Nuclear Information System (INIS)

    Wynveen, R.A.; Smith, W.H.; Sholeen, C.M.; Justus, A.L.; Flynn, K.F.

    1983-05-01

    A comprehensive radiological assessment of Kent Laboratory was conducted during September 1977, by the ANL Radiological Survey Group to determine if any radioactive contamination remained. The results of the assessment indicated the need for remedial action. Since 1977, the University has decontaminated this laboratory building, and in May 1983, the Department of Energy requested the ANL Radiological Survey Group to conduct a post-remedial-action survey. All the contaminated areas identified during the 1977 assessment were rechecked. Contamination remained in six of the rooms. Further decontamination of these areas was conducted by university personnel, and as a result, these areas are now free of contamination. However, a contaminated clay pipe in the attic remained. The clay pipe has since been removed and disposed of as solid radioactive waste. During the post-remedial-action survey, six soil samples were collected from excavation trenches dug in Rooms 1 and 2 as part of the University's remedial action efforts. Also, four sludge samples were taken from below the manhole covers in the basement of Kent Chemical Laboratory to assess the radiological condition of the sewer system. A radiological assessment of the sewer system had not been accomplished during the 1977 survey as per program direction. Radiochemical (fluorometric) and gamma-spectral analyses indicated that eight out of ten soil and sludge samples contained levels of radioactivity above expected background concentrations. The soil has since been further excavated. The building is now free of radioactive contamination in excess of background levels; however, the sewers do contain radioactive materials above background levels since contamination was found at appropriate access points. 6 references, 16 figures, 7 tables

  5. Association Euratom - Risoe National Laboratory for Sustainable Energy, Technical University of Denmark. Annual progress report 2008

    Energy Technology Data Exchange (ETDEWEB)

    Korsholm, S.B.; Michelsen, P.K.; Rasmussen, J.J.; Westergaard, C.M. (eds.)

    2009-04-15

    The programme of the Research Unit of the Fusion Association Euratom - Risoe National Laboratory for Sustainable Energy, Technical University of Denmark, covers work in fusion plasma physics and in fusion technology. The fusion plasma physics research focuses on turbulence and transport, and its interaction with the plasma equilibrium and particles. The effort includes both first principles based modelling, and experimental observations of turbulence and of fast ion dynamics by collective Thomson scattering. New activities in technology related to development of high temperature superconductors have been initiated in 2008. Minor activities are system analysis, initiative to involve Danish industry in ITER contracts and public information. A summary is presented of the results obtained in the Research Unit during 2008. (Author)

  6. Association Euratom - Risoe National Laboratory for Sustainable Energy, Technical University of Denmark. Annual progress report 2010

    Energy Technology Data Exchange (ETDEWEB)

    Korsholm, S.B.; Michelsen, P.K.; Rasmussen, J.J.; Westergaard, C.M. (eds.)

    2011-04-15

    The programme of the Research Unit of the Fusion Association Euratom - Risoe National Laboratory for Sustainable Energy, Technical University of Denmark, covers work in fusion plasma physics and in fusion technology. The fusion plasma physics research focuses on turbulence and transport, and its interaction with the plasma equilibrium and particles. The effort includes both first principles based modelling, and experimental observations of turbulence and of fast ion dynamics by collective Thomson scattering. Within fusion technology there are activities related to development of high temperature superconductors. Other activities are system analysis, initiative to involve Danish industry in ITER contracts and public information. A summary is presented of the results obtained in the Research Unit during 2010. (Author)

  7. Association Euratom - Risoe National Laboratory for Sustainable Energy, Technical University of Denmark. Annual progress report 2008

    International Nuclear Information System (INIS)

    Korsholm, S.B.; Michelsen, P.K.; Rasmussen, J.J.; Westergaard, C.M.

    2009-04-01

    The programme of the Research Unit of the Fusion Association Euratom - Risoe National Laboratory for Sustainable Energy, Technical University of Denmark, covers work in fusion plasma physics and in fusion technology. The fusion plasma physics research focuses on turbulence and transport, and its interaction with the plasma equilibrium and particles. The effort includes both first principles based modelling, and experimental observations of turbulence and of fast ion dynamics by collective Thomson scattering. New activities in technology related to development of high temperature superconductors have been initiated in 2008. Minor activities are system analysis, initiative to involve Danish industry in ITER contracts and public information. A summary is presented of the results obtained in the Research Unit during 2008. (Author)

  8. Association Euratom - Risoe National Laboratory for Sustainable Energy, Technical University of Denmark. Annual progress report 2009

    International Nuclear Information System (INIS)

    Korsholm, S.B.; Michelsen, P.K.; Rasmussen, J.J.; Westergaard, C.M.

    2010-04-01

    The programme of the Research Unit of the Fusion Association Euratom - Risoe National Laboratory for Sustainable Energy, Technical University of Denmark, covers work in fusion plasma physics and in fusion technology. The fusion plasma physics research focuses on turbulence and transport, and its interaction with the plasma equilibrium and particles. The effort includes both first principles based modelling, and experimental observations of turbulence and of fast ion dynamics by collective Thomson scattering. Within fusion technology there are activities related to development of high temperature superconductors. Minor activities are system analysis, initiative to involve Danish industry in ITER contracts and public information. A summary is presented of the results obtained in the Research Unit during 2009. (Author)

  9. Association Euratom - Risoe National Laboratory for Sustainable Energy, Technical University of Denmark. Annual progress report 2009

    Energy Technology Data Exchange (ETDEWEB)

    Korsholm, S B; Michelsen, P K; Rasmussen, J J; Westergaard, C M [eds.

    2010-04-15

    The programme of the Research Unit of the Fusion Association Euratom - Risoe National Laboratory for Sustainable Energy, Technical University of Denmark, covers work in fusion plasma physics and in fusion technology. The fusion plasma physics research focuses on turbulence and transport, and its interaction with the plasma equilibrium and particles. The effort includes both first principles based modelling, and experimental observations of turbulence and of fast ion dynamics by collective Thomson scattering. Within fusion technology there are activities related to development of high temperature superconductors. Minor activities are system analysis, initiative to involve Danish industry in ITER contracts and public information. A summary is presented of the results obtained in the Research Unit during 2009. (Author)

  10. Association Euratom - Risoe National Laboratory for Sustainable Energy, Technical University of Denmark. Annual progress report 2010

    International Nuclear Information System (INIS)

    Korsholm, S.B.; Michelsen, P.K.; Rasmussen, J.J.; Westergaard, C.M.

    2011-04-01

    The programme of the Research Unit of the Fusion Association Euratom - Risoe National Laboratory for Sustainable Energy, Technical University of Denmark, covers work in fusion plasma physics and in fusion technology. The fusion plasma physics research focuses on turbulence and transport, and its interaction with the plasma equilibrium and particles. The effort includes both first principles based modelling, and experimental observations of turbulence and of fast ion dynamics by collective Thomson scattering. Within fusion technology there are activities related to development of high temperature superconductors. Other activities are system analysis, initiative to involve Danish industry in ITER contracts and public information. A summary is presented of the results obtained in the Research Unit during 2010. (Author)

  11. Computerized Laboratories in an Undergraduate Psychology Department.

    Science.gov (United States)

    Brazier, Mary M.

    A computer project sponsored by a National Science Foundation grant was completed in the psychology department at Loyola University. The purpose of the project was to upgrade existing laboratory equipment in both the operant learning and sensation/perception laboratories, to provide equipment for a cognition laboratory, and to allow increased and…

  12. chemical safety in laboratories of african universities

    African Journals Online (AJOL)

    unesco

    Universities in Africa are in need of chemical safety and security facilities, ... In March 2009, fifty one 4th year undergraduate students (graduating class) of .... manufacturing industries, and many of them are concerned primarily ... advancement of chemistry world wide to do their best both to push the African chemistry.

  13. Laboratory-Directed Research and Development 2016 Summary Annual Report

    International Nuclear Information System (INIS)

    Pillai, Rekha Sukamar; Jacobson, Julie Ann

    2017-01-01

    The Laboratory-Directed Research and Development (LDRD) Program at Idaho National Laboratory (INL) reports its status to the U.S. Department of Energy (DOE) by March of each year. The program operates under the authority of DOE Order 413.2C, 'Laboratory Directed Research and Development' (April 19, 2006), which establishes DOE's requirements for the program while providing the laboratory director broad flexibility for program implementation. LDRD funds are obtained through a charge to all INL programs. This report includes summaries of all INL LDRD research activities supported during Fiscal Year (FY) 2016. INL is the lead laboratory for the DOE Office of Nuclear Energy (DOE-NE). The INL mission is to discover, demonstrate, and secure innovative nuclear energy solutions, other clean energy options, and critical infrastructure with a vision to change the world's energy future and secure our critical infrastructure. Operating since 1949, INL is the nation's leading research, development, and demonstration center for nuclear energy, including nuclear nonproliferation and physical and cyber-based protection of energy systems and critical infrastructure, as well as integrated energy systems research, development, demonstration, and deployment. INL has been managed and operated by Battelle Energy Alliance, LLC (a wholly owned company of Battelle) for DOE since 2005. Battelle Energy Alliance, LLC, is a partnership between Battelle, BWX Technologies, Inc., AECOM, the Electric Power Research Institute, the National University Consortium (Massachusetts Institute of Technology, Ohio State University, North Carolina State University, University of New Mexico, and Oregon State University), and the Idaho university collaborators (i.e., University of Idaho, Idaho State University, and Boise State University). Since its creation, INL's research and development (R&D) portfolio has broadened with targeted programs supporting national missions to advance nuclear energy, enable clean

  14. A Laboratory Safety Program at Delaware.

    Science.gov (United States)

    Whitmyre, George; Sandler, Stanley I.

    1986-01-01

    Describes a laboratory safety program at the University of Delaware. Includes a history of the program's development, along with standard safety training and inspections now being implemented. Outlines a two-day laboratory safety course given to all graduate students and staff in chemical engineering. (TW)

  15. High Temperature Materials Laboratory third annual report

    Energy Technology Data Exchange (ETDEWEB)

    Tennery, V.J.; Foust, F.M.

    1990-12-01

    The High Temperature Materials Laboratory has completed its third year of operation as a designated DOE User Facility at the Oak Ridge National Laboratory. Growth of the user program is evidenced by the number of outside institutions who have executed user agreements since the facility began operation in 1987. A total of 88 nonproprietary agreements (40 university and 48 industry) and 20 proprietary agreements (1 university, 19 industry) are now in effect. Sixty-eight nonproprietary research proposals (39 from university, 28 from industry, and 1 other government facility) and 8 proprietary proposals were considered during this reporting period. Research projects active in FY 1990 are summarized.

  16. Implementation of a Project-Based Molecular Biology Laboratory Emphasizing Protein Structure-Function Relationships in a Large Introductory Biology Laboratory Course

    Science.gov (United States)

    Treacy, Daniel J.; Sankaran, Saumya M.; Gordon-Messer, Susannah; Saly, Danielle; Miller, Rebecca; Isaac, R. Stefan; Kosinski-Collins, Melissa S.

    2011-01-01

    In introductory laboratory courses, many universities are turning from traditional laboratories with predictable outcomes to inquiry-inspired, project-based laboratory curricula. In these labs, students are allowed to design at least some portion of their own experiment and interpret new, undiscovered data. We have redesigned the introductory…

  17. University of Maryland MRSEC - Facilities: Keck Laboratory

    Science.gov (United States)

    operation. This site remains as a history of the center, but will not be actively maintained. University of . Crystals are made up of layers, or "planes" of atoms, perfectly stacked in an ordered pattern . Because this surface has been cut at a slight angle to the crystal planes, it appears "stepped"

  18. Daytime Utilization of a University Observatory for Laboratory Instruction

    Science.gov (United States)

    Mattox, J. R.

    2006-08-01

    Scheduling convenience provides a strong incentive to fully explore effective utilization of educational observatories during daylight hours. I present two compelling daytime student activities that I developed at the Observatory at Fayetteville State University. My Introductory Astronomy Laboratory classes pursue these as separate investigations. My Physical Science classes complete both in a single lab period of 110 minutes duration. Both of these activities are also appropriate for High School student investigators, and could be used as demonstrations for younger students. Daylight Observation of Venus. With a clear sky, and when its elongation exceeds ~20˚, Venus is readily apparent in the daytime sky once a telescope is pointed at it. This is accomplished either with a digital pointing system, or with setting circles on a polar-aligned mount using the Sun to initialize the RA circle. Using the telescope pointing as a reference, it is also possible under optimal circumstances for students to see Venus in the daytime sky with naked eyes. Students are asked to write about the circumstances that made it possible to see Venus. Educational utilization of daytime observations of the Moon, Jupiter, Saturn, and the brightest stars are also discussed. Using a CCD Camera to Determine the Temperature of a Sunspot. After my students view the Sun with Eclipse Glasses and in projection using a 3-inch refractor, they analyze a CCD image of a sunspot (which they obtain if possible) to determine the ratio of its surface intensity relative to the normal solar surface. They then use the Stefan-Boltzmann law (usually with some coaching) to determine the sunspot temperature given the nominal surface temperature of the Sun. Appropriate safety precautions are presented given the hazards of magnified sunlight. Mitigation of dome seeing during daylight hours is discussed.

  19. A study of the National Physical Laboratory microdosimetry research programme in collaboration with the University of Leeds

    International Nuclear Information System (INIS)

    Menzel, H.G.

    1987-11-01

    A study of the present programme of work carried out by the National Physical Laboratory and the University of Leeds, has been carried out. The study is based on the use of the tissue-equivalent proportional counter in microdosimetic techniques in radiation protection for monoenergetic neutrons or reference radionuclide neutron sources. This report comments on the programme as a whole and provides recommendations for future research work, taking into account the research programmes carried out at other institutions. It also attempts to summarise the present state of knowledge and experience associated with the application of this technique to radiation fields met in routine radiation protection. (author)

  20. Report of the research results with University of Tokyo, Nuclear Engineering Research laboratory's Facilities in fiscal 1992

    International Nuclear Information System (INIS)

    1993-01-01

    This publication summarizes the results of the joint utilization of the research 'Yayoi' and the electron beam accelerator in the Nuclear Engineering Research Laboratory, University of Tokyo, in the fiscal year 1992. The Yayoi was operated smoothly through the year, and the number of research themes, for which the reactor Yayoi was jointly utilized and the related themes reached 23 cases. The research themes of the linac count up to 17, after its reconstruction to be twin-linac. In this publication, in addition to the utilization reports, also the 16 reports of Yayoi Study Meetings held in fiscal year 1992 are collected. (J.P.N.)

  1. A Laboratory Course in Technological Chemistry.

    Science.gov (United States)

    Wiseman, P.

    1986-01-01

    Describes a laboratory course taught at the University of Manchester Institute of Science and Technology (United Kingdom) which focuses on the preparation, properties, and applications of end-use products of the chemical industry. Outlines laboratory experiments on dyes, fibers, herbicides, performance testing, antioxidants, and surface active…

  2. Reliability of agriculture universal joint shafts based on temperature measuring in universal joint bearing assemblies

    Directory of Open Access Journals (Sweden)

    Аleksandar Asonja

    2015-03-01

    Full Text Available This paper presents a research into reliability calculations of agriculture double universal joint shafts based on temperature measuring in cardan-type universal joint bearing assemblies. Special laboratory equipment was developed for this research which is presented in the paper. The objective of this research was to test the real life span of universal joint shafts in the laboratory and in field, to obtain the results which can be used to improve the reliability of universal joint shafts. If the presented research were used along with maintenance measures recommended in the paper and with proper use, the level of reliability of the shafts would be 2.1 times higher. The presented results of the research showed that needle bearings, i.e. bearing assemblies of the joints, are the most critical elements on universal joint shafts and are possible causes of their lower reliability. The second universal joint is the part with the lowest reliability in the observed technical system.

  3. The laboratory in higher science education: Problems, premises and objectives

    NARCIS (Netherlands)

    Kirschner, P.A.; Meester, M.A.M.

    1988-01-01

    A university study in the natural sciences, devoid of a practical component such as laboratory work is virtually unthinkable. One could even go so far as saying that it is extremely rare for anyone to question the necessity of laboratory work in either high school or university science

  4. Proceedings of the symposium on technology in laboratories

    International Nuclear Information System (INIS)

    1988-10-01

    The Symposium on Technology in Laboratories was held on March 29 and 30, 1988 at Toyota Auditorium in Nagoya University. This symposium was hosted by Institute of Plasma Physics. Participants were about 210 and 54 papers were presented from many of Japanese universities and laboratories. Technical experience and new technics were reported and discussed divided into five sessions; technologies of manufacture, cryogenic, diagonostic and control system, computer and experimental apparatus. (author)

  5. Medical laboratory science and nursing students’ perception of academic learning environment in a Philippine university using Dundee Ready Educational Environment Measure (DREEM

    Directory of Open Access Journals (Sweden)

    Jonathan M. Barcelo

    2016-09-01

    Full Text Available Purpose This study aimed to compare the perception of the academic learning environment between medical laboratory science students and nursing students at Saint Louis University, Baguio City, Philippines. Methods A cross-sectional survey research design was used to measure the perceptions of the participants. A total of 341 students from the Department of Medical Laboratory Science, School of Natural Sciences, and the School of Nursing answered the Dundee Ready Education Environment Measure (DREEM instrument from April to May 2016. Responses were compared according to course of study, gender, and year level. Results The total mean DREEM scores of the medical laboratory science students and nursing students did not differ significantly when grouped according to course of study, gender, or year level. Medical laboratory science students had significantly lower mean scores in the sub-domains ‘perception of learning’ and ‘perception of teaching.’ Male medical laboratory science students had significantly lower mean scores in the sub-domain ‘perception of learning’ among second year students. Medical laboratory science students had significantly lower mean scores in the sub-domain ‘perception of learning.’ Nursing students identified 7 problem areas, most of which were related to their instructors. Conclusion Medical laboratory science and nursing students viewed their academic learning environment as ‘more positive than negative.’ However, the relationship of the nursing instructors to their students needs improvement.

  6. Intestinal and hepatic parasites determined in a university hospital parasitology laboratory

    Directory of Open Access Journals (Sweden)

    Zeynep Taş Cengiz

    2015-09-01

    Full Text Available Objective: The aim of this study is to present the prevalence of intestinal and hepatic parasites determined in Yüzüncü Yıl University Medical Faculty Parasitology Laboratory. Methods: The study was performed in 2008, and a total of 5985 stool samples were examined. Stool samples were examined with native-Lugol, sedimentation, flotation, trichrome staining and modified acid-fast staining methods. The stool samples of patient suspected to have Entamoeba histolytica/E.dispar infection were stained by trichrome staining method and evaluated by ELISA method for the antigen. ELISA method was used to confirm the results of Fasciola hepatica positive patients in stool examination. Results: In this study intestinal parasites were identified in 29.6% out of the 5985 people. In the study Giardia intestinalis (9.4%, plenty Blastocystis hominis (5.5%, Hymenolepis nana (1.7%, Ascaris lumbricoides (1.2%, Enterobius vermicularis (0.2%; in the stool examination, F.hepatica (0.1%, Cyclospora cayetanensis (0.1%, E.histolytica/E.dispar (0.06%, Taenia saginata (0.05%, Dicrocoelium dendriticum (0.05%, Trichuris trichiura (0.03% and Cryptosporidium spp. (0.02%, pathogenic parasites, were detected. Conclusion: In the study it is also understood that pathogenic intestinal parasites have still been reported at high rates and the problem of parasitosis continues in Van Province.

  7. Energy Programs at the Johns Hopkins University Applied Physics Laboratory, Quarterly Report, April-June 1980

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-06-01

    The Johns Hopkins University Applied Physics Laboratory, under contracts with several agencies of the federal government and an agency of the State of Maryland, is engaged in developing energy resources, utilization concepts, and monitoring and storage methods. This Quarterly Report summarizes the work on the various tasks as of 30 June 1980. The Energy Quarterly Report is divided into three sections. The first, Geothermal Energy Development Planning and Technical Assistance, supported by the Department of Energy/Division of Geothermal Energy (DOE/DGE), contains reports on the progress of geothermal-related tasks on which effort was concentrated during the quarter. The second section, Operational Research, Hydroelectric Power Development, supported by the Department of Energy/Resource Applications (DOE/RA), contains reports on small-scale hydroelectric investigations in the southeastern states. The third section, Energy Conversion and Storage Techniques, contains three articles. The first is on data analysis of OTEC core unit condenser tests, and is supported by the Department of Energy/Division of Central Solar Technology (DOE/CST). The second is on the current status of the Community Annual Storage Energy System at the U.S. Naval Air Station, Norfolk, Va., and is supported by the Department of Energy and the Department of Defense, Naval Facilities Engineering Command/Atlantic Division. The third is on utilization of landfill methane and is supported by Argonne National Laboratory.

  8. Multicenter validation of the value of BASFI and BASDAI in Chinese ankylosing spondylitis and undifferentiated spondyloarthropathy patients

    Science.gov (United States)

    Lin, Zhiming; He, Peigen; Gao, Jiesheng; Zuo, Xiaoxia; Ye, Zhizhong; Shao, Fengmin; Zhan, Feng; Lin, Jinying; Li, Li; Wei, Yanlin; Xu, Manlong; Liao, Zetao; Lin, Qu

    2009-01-01

    The objectives of this study were to evaluate the reliability of Bath ankylosing spondylitis functional index (BASFI) and Bath ankylosing spondylitis disease activity index (BASDAI) in Chinese ankylosing spondylitis (AS) and undifferentiated spondyloarthropathy (USpA) patients. 664 AS patients by the revised New York criteria for AS and 252 USpA patients by the European Spondyloarthropathy Study Group criteria were enrolled. BASDAI and BASFI questionnaires were translated into Chinese. Participants were required to fill in BASFI and BASDAI questionnaires again after 24 h. Moreover, BASDAI and BASFI were compared in AS patients receiving Enbrel or infliximab before and after treatment. For AS group, BASDAI ICC: 0.9502 (95% CI: 0.9330–0.9502, α = 0.9702), BASFI ICC: 0.9587 (95% CI: 0.9521–0.9645, α = 0.9789). For USpA group, BASDAI ICC: 0.9530 (95% CI: 0.9402–0.9632, α = 0.9760), BASFI ICC: 0.9900 (95% CI: 0.9871–0.9922, α = 0.9950). In the AS group, disease duration, occipital wall distance, modified Schober test, chest expansion, ESR, and CRP showed significant correlation with BASDAI and BASFI (all P < 0.01). In the USpA group, onset age, ESR, and CRP were significantly correlated with BASDAI (all P < 0.05), while modified Schober test, ESR, and CRP were significantly associated with BASFI (all P < 0.05). The change in BASDAI and BASFI via Enbrel or infliximab treatment showed a significant positive correlation (P < 0.01). The two instruments have good reliability and reference value regarding the evaluation of patient’s condition and anti-TNF-α treatment response. PMID:20012866

  9. Geochronology Intermediary Laboratory implantation at the Rio Grande do Norte Federal University: the dating of the Serrinha Granitoid (RN) and the correlate Brasiliana extensional deformation

    International Nuclear Information System (INIS)

    Macedo, Maria Helena F.; Sa, Emanuel F. Jardim de; Souza, Zorano S.; Mendes, Franklin S.; Ramalho, Karlos A.C.

    1997-01-01

    The article describes the activities developed by the Geochronology Intermediary Laboratory at the Federal University of the Rio Grande do Norte, a Brazilian university, where there were the preoccupation of establishing strategies for a geochronological development. It relates the Rubidium-Strontium (Rb/Sr) and Samarium-Neodymium (Sm/Nd) methods, describing the analysis realized in these methodologies. Afterward, it presents the geological and petrographic situation of the Granitoide de Serrinha, located at Rio Grande do Norte State, Brazil and its geochronological data

  10. Brookhaven National Laboratory site report for calendar year 1988

    Energy Technology Data Exchange (ETDEWEB)

    Miltenberger, R.P.; Royce, B.A.; Naidu, J.R.

    1989-06-01

    Brookhaven National Laboratory (BNL) is managed by Associated Universities Inc. (AUI). AUI was formed in 1946 by a group of nine universities whose purpose was to create and manage a laboratory in the Northeast in order to advance scientific research in areas of interest to universities, industry, and government. On January 31, 1947, the contract for BNL was approved by the Manhattan District of the Army Corps of Engineers and BNL was established on the former Camp Upton army camp. 54 refs., 21 figs., 78 tabs.

  11. Brookhaven National Laboratory site report for calendar year 1988

    International Nuclear Information System (INIS)

    Miltenberger, R.P.; Royce, B.A.; Naidu, J.R.

    1989-06-01

    Brookhaven National Laboratory (BNL) is managed by Associated Universities Inc. (AUI). AUI was formed in 1946 by a group of nine universities whose purpose was to create and manage a laboratory in the Northeast in order to advance scientific research in areas of interest to universities, industry, and government. On January 31, 1947, the contract for BNL was approved by the Manhattan District of the Army Corps of Engineers and BNL was established on the former Camp Upton army camp. 54 refs., 21 figs., 78 tabs

  12. How do laboratory technicians perceive their role in tuberculosis diagnostic process: a cross-sectional study among laboratory technicians in health centers of Central Java Province, Indonesia

    Directory of Open Access Journals (Sweden)

    Widjanarko B

    2016-09-01

    Full Text Available Bagoes Widjanarko,1 Dyah Anantalia Widyastari,2 Martini Martini,3 Praba Ginandjar3 1Department of Health Education and Behavior Sciences, Faculty of Public Health, Diponegoro University, Semarang, Indonesia; 2Institute for Population and Social Research, Mahidol University, Salaya, Thailand; 3Department of Epidemiology, Faculty of Public Health, Diponegoro University, Semarang, Indonesia Purpose: Detection of acid-fast bacilli in respiratory specimens serves as an initial pulmonary tuberculosis (TB diagnosis. Laboratories are the essential and fundamental part of all health systems. This study aimed to describe how laboratory technicians perceived their own self and work. This included perceived self-efficacy, perceived role, perceived equipment availability, perceived procedures, perceived reward and job, and perceived benefit of health education, as well as level of knowledge and attitudes related to work performance of laboratory technicians.Methods: This was a cross-sectional quantitative study involving 120 laboratory technicians conducted in Central Java. Interviews and observation were conducted to measure performance and work-related variables.Results: Among 120 laboratory technicians, 43.3% showed fairly good performance. They complied with 50%–75% of all procedures, including sputum collection, laboratory tools utilization, sputum smearing, staining, smear examination, grading of results, and universal precaution practice. Perceived role, perceived self-efficacy, and knowledge of laboratory procedures were significantly correlated to performance, besides education and years of working as a laboratory technician. Perceived equipment availability was also significantly correlated to performance after the education variable was controlled.Conclusion: Most of the laboratory technicians believed that they have an important role in TB patients’ treatment and should display proper self-efficacy in performing laboratory activities. The

  13. University of Washington

    Data.gov (United States)

    Federal Laboratory Consortium — The theme of the University of Washington based Center for Child Environmental Health Risks Research (CHC) is understanding the biochemical, molecular and exposure...

  14. Laboratory-Directed Research and Development 2016 Summary Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    Pillai, Rekha Sukamar [Idaho National Lab. (INL), Idaho Falls, ID (United States); Jacobson, Julie Ann [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2017-01-01

    The Laboratory-Directed Research and Development (LDRD) Program at Idaho National Laboratory (INL) reports its status to the U.S. Department of Energy (DOE) by March of each year. The program operates under the authority of DOE Order 413.2C, “Laboratory Directed Research and Development” (April 19, 2006), which establishes DOE’s requirements for the program while providing the laboratory director broad flexibility for program implementation. LDRD funds are obtained through a charge to all INL programs. This report includes summaries of all INL LDRD research activities supported during Fiscal Year (FY) 2016. INL is the lead laboratory for the DOE Office of Nuclear Energy (DOE-NE). The INL mission is to discover, demonstrate, and secure innovative nuclear energy solutions, other clean energy options, and critical infrastructure with a vision to change the world’s energy future and secure our critical infrastructure. Operating since 1949, INL is the nation’s leading research, development, and demonstration center for nuclear energy, including nuclear nonproliferation and physical and cyber-based protection of energy systems and critical infrastructure, as well as integrated energy systems research, development, demonstration, and deployment. INL has been managed and operated by Battelle Energy Alliance, LLC (a wholly owned company of Battelle) for DOE since 2005. Battelle Energy Alliance, LLC, is a partnership between Battelle, BWX Technologies, Inc., AECOM, the Electric Power Research Institute, the National University Consortium (Massachusetts Institute of Technology, Ohio State University, North Carolina State University, University of New Mexico, and Oregon State University), and the Idaho university collaborators (i.e., University of Idaho, Idaho State University, and Boise State University). Since its creation, INL’s research and development (R&D) portfolio has broadened with targeted programs supporting national missions to advance nuclear energy

  15. A professional development model for medical laboratory scientists working in the microbiology laboratory.

    Science.gov (United States)

    Amerson, Megan H; Pulido, Lila; Garza, Melinda N; Ali, Faheem A; Greenhill, Brandy; Einspahr, Christopher L; Yarsa, Joseph; Sood, Pramilla K; Hu, Peter C

    2012-01-01

    The University of Texas M.D. Anderson Cancer Center, Division of Pathology and Laboratory Medicine is committed to providing the best pathology and medicine through: state-of-the art techniques, progressive ground-breaking research, education and training for the clinical diagnosis and research of cancer and related diseases. After surveying the laboratory staff and other hospital professionals, the Department administrators and Human Resource generalists developed a professional development model for Microbiology to support laboratory skills, behavior, certification, and continual education within its staff. This model sets high standards for the laboratory professionals to allow the labs to work at their fullest potential; it provides organization to training technologists based on complete laboratory needs instead of training technologists in individual areas in which more training is required if the laboratory needs them to work in other areas. This model is a working example for all microbiology based laboratories who want to set high standards and want their staff to be acknowledged for demonstrated excellence and professional development in the laboratory. The PDM model is designed to focus on the needs of the laboratory as well as the laboratory professionals.

  16. Nuclear physics laboratory

    International Nuclear Information System (INIS)

    Deruytter, A.J.

    1978-01-01

    The report summarizes the main activities of the Linear Electron Accelerator Section of the Physics Laboratory of the State University of Ghent. The research fields are relative to: 1. Nuclear fission. 2. Photonuclear reactions. 3. Nuclear spectroscopy and positron annihilation. 4. Dosimetry. 5. Theoretical studies. (MDC)

  17. Nuclear physics laboratory

    International Nuclear Information System (INIS)

    Deruytter, A.J.

    1979-01-01

    The report summarizes the main activities of the Linear Electron Accelerator Section of the Physics Laboratory of the State University of Ghent. The research fields are relative to: 1. Nuclear fission. 2. Photonuclear reactions. 3. Nuclear spectroscopy and positron annihilation. 4. Dosimetry. 5. Theoretical studies. (MDC)

  18. Nuclear physics laboratory

    International Nuclear Information System (INIS)

    Deruytter, A.J.

    1980-01-01

    The report summarizes the main activities of the linear Electron Accelerator Section of the Physics Laboratory of the State University of Ghent. The research fields are relative to: 1. Nuclear fission 2. Photonuclear reactions 3. Nuclear spectroscopy and positron annihilation 4. Dosimetry 5. Theoretical studies. (MDC)

  19. General Motors and the University of Michigan smart materials and structures collaborative research laboratory

    Science.gov (United States)

    Brei, Diann; Luntz, Jonathan; Shaw, John; Johnson, Nancy L.; Browne, Alan L.; Alexander, Paul W.; Mankame, Nilesh D.

    2007-04-01

    The field of Smart Materials and Structures is evolving from high-end, one-of-a-kind products for medical, military and aerospace applications to the point of viability for mainstream affordable high volume products for automotive applications. For the automotive industry, there are significant potential benefits to be realized including reduction in vehicle mass, added functionality and design flexibility and decrease in component size and cost. To further accelerate the path from basic research and development to launched competitive products, General Motors (GM) has teamed with the College of Engineering at the University of Michigan (UM) to establish a $2.9 Million Collaborative Research Laboratory (CRL) in Smart Materials and Structures. Researchers at both GM and UM are working closely together to create leap-frog technologies which start at conceptualization and proceed all the way through demonstration and handoff to product teams, thereby bridging the traditional technology gap between industry and academia. In addition to Smart Device Technology Innovation, other thrust areas in the CRL include Smart Material Maturity with a basic research focus on overcoming material issues that form roadblocks to commercialism and Mechamatronic System Design Methodology with an applied focus on development tools (synthesis and analysis) to aid the engineer in application of smart materials to system engineering. This CRL is a global effort with partners across the nation and world from GM's Global Research Network such as HRL Laboratories in California and GM's India Science Lab in Bangalore, India. This paper provides an overview of this new CRL and gives examples of several of the projects underway.

  20. Environmental Waste Management in a School Hospital and in a Laboratory of Human Anatomy of a University

    Directory of Open Access Journals (Sweden)

    Kira Lusa Manfredini

    2013-12-01

    Full Text Available The scientific and professional activities developed in a Hospital School and a Laboratory of Human Anatomy of a university can generate parallel, chemical residues from various degrees of angerousness, which may require physical treatment and / or suitable chemical, before being sent to final destination. The General Hospital (GH generates monthly 10 L of xylenes and 50 L of glutaraldehyde to provide ass instance to their patients. Already the Laboratory of Human Anatomy of University de Caxias do Sul (AL-UCS uses more than 10,000 liters for preserving corpses in tanks. The present study aims to analyze the chemical waste management of the GH and the AL-UCS and propose techniques for recovery and reuse of chemicals formaldehyde, glutaraldehyde and xylenes, minimizing the impacts generated by the use, often indispensable and sometimes questionable, of such waste. So far two sets of samples were collected (in March and April 2013 of xylene, glutaraldehyde and formaldehyde in the GH and also at the AL-UCS and it is intended to repeat the collections with monthly periodicity, in the next two semesters. Partial results show that, comparing the relationship of area and the medium areas of the chromatographic (in µV.s of patterns with compounds of interest, an increase in the percentage of formaldehyde relative to the samples in standard formalin (121.84% may be due to contamination with organic compounds with a retention time close to the compound of interest, the xylene was little degradation in the samples, indicating that this compound can be reused in the common procedures of healthcare institutions, with respect to glutaraldehyde significant degradation was observed for the compound in samples represents only 61.88% of the chromatographic peak area of the standard, therefore the reuse of these compounds may require the use of purification methods such as simple distillation and fractional distillation

  1. Satellite Control Laboratory

    DEFF Research Database (Denmark)

    Wisniewski, Rafal; Bak, Thomas

    2001-01-01

    The Satellite Laboratory at the Department of Control Engineering of Aalborg University (SatLab) is a dynamic motion facility designed for analysis and test of micro spacecraft. A unique feature of the laboratory is that it provides a completely gravity-free environment. A test spacecraft......-axis magnetometer, three piezoelectric gyros, and four reaction wheels in a tetrahedron configuration. The operation of the spacecraft is fully autonomous. The data flow between the transducers and the onboard computer placed physically outside the satellite is provided by a radio link. The purpose...... can be implemented in the laboratory, e.g. three-axis attitude control, slew manoeuvres, spins stabilization using magnetic actuation and/or reaction wheels. The spacecraft attitude can be determined applying magnetometer measurements....

  2. Report of the research results with University of Tokyo, Nuclear Engineering Research Laboratory's Facilities in fiscal 1991

    International Nuclear Information System (INIS)

    1992-01-01

    This publication summarizes the results of the joint utilization of the nuclear reactor 'Yayoi' and the electron beam accelerator in the Nuclear Engineering Research Laboratory, University of Tokyo, in fiscal year 1991. The Yayoi was operated smoothly throughout the year, and the number of research themes, for which the reactor Yayoi was jointly utilized, and the related themes reached 21 cases. After the linear accelerator was reconstructed as the twin linac, the joint utilization was resumed in October, 1989, and the number of research themes, was 15 cases. In this publication, in addition to the utilization reports, also the reports of 15 cases of Yayoi Study Meetings held in fiscal year 1991 are collected. (K.I.)

  3. University of Rochester, Laboratory for Laser Energetics

    Science.gov (United States)

    1987-01-01

    In FY86 the Laboratory has produced a list of accomplishments in which it takes pride. LLE has met every laser-fusion program milestone to date in a program of research for direct-drive ultraviolet laser fusion originally formulated in 1981. LLE scientists authored or co-authored 135 scientific papers during 1985 to 1986. The collaborative experiments with NRL, LANL, and LLNL have led to a number of important ICF results. The cryogenic target system developed by KMS Fusion for LLE will be used in future high-density experiments on OMEGA to demonstrate the compression of thermonuclear fuel to 100 to 200 times that of solid (20 to 40 g/cm) in a test of the direct-drive concept, as noted in the National Academy of Sciences' report. The excellence of the advanced technology efforts at LLE is illustrated by the establishment of the Ultrafast Science Center by the Department of Defense through the Air Force Office of Scientific Research. Research in the Center will concentrate on bridging the gap between high-speed electronics and ultrafast optics by providing education, research, and development in areas critical to future communications and high-speed computer systems. The Laboratory for Laser Energetics continues its pioneering work on the interaction of intense radiation with matter. This includes inertial-fusion and advanced optical and optical electronics research; training people in the technology and applications of high-power, short-pulse lasers; and interacting with the scientific community, business, industry, and government to promote the growth of laser technology.

  4. Laboratory errors and patient safety.

    Science.gov (United States)

    Miligy, Dawlat A

    2015-01-01

    Laboratory data are extensively used in medical practice; consequently, laboratory errors have a tremendous impact on patient safety. Therefore, programs designed to identify and reduce laboratory errors, as well as, setting specific strategies are required to minimize these errors and improve patient safety. The purpose of this paper is to identify part of the commonly encountered laboratory errors throughout our practice in laboratory work, their hazards on patient health care and some measures and recommendations to minimize or to eliminate these errors. Recording the encountered laboratory errors during May 2008 and their statistical evaluation (using simple percent distribution) have been done in the department of laboratory of one of the private hospitals in Egypt. Errors have been classified according to the laboratory phases and according to their implication on patient health. Data obtained out of 1,600 testing procedure revealed that the total number of encountered errors is 14 tests (0.87 percent of total testing procedures). Most of the encountered errors lay in the pre- and post-analytic phases of testing cycle (representing 35.7 and 50 percent, respectively, of total errors). While the number of test errors encountered in the analytic phase represented only 14.3 percent of total errors. About 85.7 percent of total errors were of non-significant implication on patients health being detected before test reports have been submitted to the patients. On the other hand, the number of test errors that have been already submitted to patients and reach the physician represented 14.3 percent of total errors. Only 7.1 percent of the errors could have an impact on patient diagnosis. The findings of this study were concomitant with those published from the USA and other countries. This proves that laboratory problems are universal and need general standardization and bench marking measures. Original being the first data published from Arabic countries that

  5. An Investigation into Prospective Science Teachers' Attitudes towards Laboratory Course and Self-Efficacy Beliefs in Laboratory Use

    Science.gov (United States)

    Aka, Elvan Ince

    2016-01-01

    The aim of the current study is to identify the attitudes towards the laboratory course and self-efficacy beliefs in the laboratory use of prospective teachers who are attending Gazi University Gazi Education Faculty Primary Education Science Teaching program, and to investigate the relationship between the attitudes and self-efficacy beliefs.…

  6. Establishment of an Advanced Accelerator Applications University Participation Program at the University of Nevada, Las Vegas

    International Nuclear Information System (INIS)

    Hechanova, A.E.; Cerefice, G.S.

    2002-01-01

    The University of Nevada, Las Vegas (UNLV) established an Advanced Accelerator Applications (AAA) University Participation Program in March 2001 to develop a world-class research program for accelerator-driven transmutation technology while building core competencies and facilities to promote the University's strategic growth goals. The goal of this program is to involve UNLV students in research on the cutting edge of science and engineering as an integrated part of the national program to develop this emerging technology. This program augments UNLV's research capabilities and infrastructure, while establishing national and international research collaborations with national laboratories, industrial partners, and other universities, increasing the UNL V research community's presence in the global scientific community. The UNL V Program is closely integrated into the national project led by Los Alamos and Argonne National Laboratories. The primary mechanism to insure this degree of integration is the teaming of national laboratory scientists with UNL V faculty and students on student research proposals. The Program was implemented under an aggressive schedule with faculty response that surpassed expectations. A total of 12 multi-tasked projects that involve 21 graduate students and 13 faculty members began under first year funding. Other major accomplishments include establishment of an administrative structure implementing all the components of the Program and establishment of a communications network between national laboratory project leaders and UNL V faculty. (authors)

  7. Assessing the Use of Smartphone in the University General Physics Laboratory

    Science.gov (United States)

    Shi, Wei-Zhao; Sun, Jiajun; Xu, Chong; Huan, Weiliang

    2016-01-01

    In this study, smartphone was used to alter the traditional procedure by involving students in active learning experiences prior to the laboratory meeting. The researcher surveyed students' view on the effect of using smartphone to enhance learning in the general physics laboratory. The use of smartphone was evaluated by having 120 students who…

  8. Uncertainty Analysis of Resistance Tests in Ata Nutku Ship Model Testing Laboratory of Istanbul Technical University

    Directory of Open Access Journals (Sweden)

    Cihad DELEN

    2015-12-01

    Full Text Available In this study, some systematical resistance tests, where were performed in Ata Nutku Ship Model Testing Laboratory of Istanbul Technical University (ITU, have been included in order to determine the uncertainties. Experiments which are conducted in the framework of mathematical and physical rules for the solution of engineering problems, measurements, calculations include uncertainty. To question the reliability of the obtained values, the existing uncertainties should be expressed as quantities. The uncertainty of a measurement system is not known if the results do not carry a universal value. On the other hand, resistance is one of the most important parameters that should be considered in the process of ship design. Ship resistance during the design phase of a ship cannot be determined precisely and reliably due to the uncertainty resources in determining the resistance value that are taken into account. This case may cause negative effects to provide the required specifications in the latter design steps. The uncertainty arising from the resistance test has been estimated and compared for a displacement type ship and high speed marine vehicles according to ITTC 2002 and ITTC 2014 regulations which are related to the uncertainty analysis methods. Also, the advantages and disadvantages of both ITTC uncertainty analysis methods have been discussed.

  9. Wundt's laboratory at Leipzig in 1891.

    Science.gov (United States)

    Nicolas, S; Ferrand, L

    1999-08-01

    This article describes Wundt's laboratory at Leipzig in 1891 as viewed by a Belgian psychologist, J.J. Van Biervliet (1859-1945). Although few French-speaking psychologists worked in Wundt's laboratory, several of those who did reports wrote on how students were trained there. Van Biervliet decided to visit Wundt's laboratory at Leipzig in order to strengthen the foundation of his own laboratory at the University of Ghent and to become familiar with Wundt's experimental techniques. A translation of J.J. Van Biervliet's (1892) article "Experimental Psychology. Wundt's Institute at Leipzig" is presented here as one of the first and most complete articles in French describing the functioning of Wundt's laboratory.

  10. Direct-Drive Inertial Fusion Research at the University of Rochester's Laboratory for Laser Energetics: A Review

    International Nuclear Information System (INIS)

    McCrory, R.L.; Meyerhofer, D.D.; Loucks, S.J.; Skupsky, S.; Bahr, R.E.; Betti, R.; Boehly, T.R.; Craxton, R.S.; Collins, T.J.B.; Delettrez, J.A.; Donaldson, W.R.; Epstein, R.; Fletcher, K.A.; Freeman, C.; Frenje, J.A.; Glebov, V.Yu.; Goncharov, V.N.; Harding, D.R.; Jaanimagi, P.A.; Keck, R.L.; Kelly, J.H.; Kessler, T.J.; Kilkenny, J.D.; Knauer, J.P.; Li, C.K.; Lund, L.D.; Marozas, J.A.; McKenty, P.W.; Marshall, F.J.; Morse, S.F.B.; Padalino, S.; Petrasso, R.D.; Radha, P.B.; Regan, S.P.; Roberts, S.; Sangster, T.C.; Seguin, F.H.; Seka, W.; Smalyuk, V.A.; Soures, J.M.; Stoeckl, C.; Thorp, K.A.; Yaakobi, B.; Zuegel, J.D.

    2010-01-01

    This paper reviews the status of direct-drive inertial confinement fusion (ICF) research at the University of Rochester's Laboratory for Laser Energetics (LLE). LLE's goal is to demonstrate direct-drive ignition on the National Ignition Facility (NIF) by 2014. Baseline 'all-DT' NIF direct-drive ignition target designs have been developed that have a predicted gain of 45 (1-D) at a NIF drive energy of ∼1.6 MJ. Significantly higher gains are calculated for targets that include a DT-wicked foam ablator. This paper also reviews the results of both warm fuel and initial cryogenic-fuel spherical target implosion experiments carried out on the OMEGA UV laser. The results of these experiments and design calculations increase confidence that the NIF direct-drive ICF ignition goal will be achieved.

  11. Restructuring of University Laboratories within the Scope of Occupational Health and Safety

    OpenAIRE

    Ordu, Kamil Musa; Çivi Bilir, Gülçin

    2018-01-01

    Laboratory safety is major of importance tooccupational health and safety, which manages, and responds to all issues andconcerns surrounding physical, biological, ergonomic, electrical, chemical, andother standard operating procedures. In this work, laboratory design and equipment,which are arranged according to precautions that are taken against to allhazards regarding to work environment or personal expose at the workenvironments in laboratories that are already exist or will be established...

  12. Multidimensional Screening as a Pharmacology Laboratory Experience.

    Science.gov (United States)

    Malone, Marvin H.; And Others

    1979-01-01

    A multidimensional pharmacodynamic screening experiment that addresses drug interaction is included in the pharmacology-toxicology laboratory experience of pharmacy students at the University of the Pacific. The student handout with directions for the procedure is reproduced, drug compounds tested are listed, and laboratory evaluation results are…

  13. The Laboratory for School Science at the University of Oslo

    Science.gov (United States)

    Sjoberg, Svein

    1976-01-01

    Describes the purposes of the Center for Science Education at the University of Oslo as follows: to give help and advice to acting teachers; to make the staff at the university more aware of the needs and problems of the schools. Outlines the activities involved in fulfilling these purposes. (GS)

  14. Progress report from the Studsvik Neutron Research Laboratory 1990-91

    International Nuclear Information System (INIS)

    Dahlborg, U.; Ebbsjoe, I.; Holmqvist, B.

    1992-01-01

    The Studsvik Neutron Research Laboratory (NFL) is the base for the research activities at the Studsvik reactors. It is administrated by the University of Uppsala and is established to facilitate reactor based research. The laboratory is intended to, in co-operation with institutes and department at universities in Sweden, develop, construct and maintain experimental equipment for this kind of research and to make it available for scientists at Swedish universities and, if possible, also to scientists outside the universities. The research at the Studsvik facilities has during 1990 and 1991 been performed by groups form Uppsala University, Royal Institute of Technology, Stockholm, Chalmers Technical University, Gothenburg, and by scientists at NFL. The research programme of the groups is divided into three main areas, scattering of thermal neutrons, nuclear chemistry/nuclear physics, and neutron capture radiography

  15. Actions of the Academic Literacy Laboratory of the University of São Paulo: promoting academic writing in the undergraduate and graduate programs

    Directory of Open Access Journals (Sweden)

    Marília Mendes Ferreira

    2016-09-01

    Full Text Available The increasing internationalization of Brazilian universities requires its academic community not only to read, but also to communicate effectively in academic discourse in at least two languages - the mother tongue and a foreign language (mainly English. However, material conditions for meeting these demands are practically nonexistent in Brazilian higher education institutions (FERREIRA, 2015. The purpose of this article is to describe an action that aims to meet one of these demands imposed by internationalization – the socialization of academic production in English, French and Portuguese not only for reading purposes and assimilation of content, but above all for the publication in these languages. This action is undertaken by the Academic Literacy Laboratory at the University of São Paulo.

  16. Calgary Laboratory Services

    Directory of Open Access Journals (Sweden)

    James R. Wright MD, PhD

    2015-12-01

    Full Text Available Calgary Laboratory Services provides global hospital and community laboratory services for Calgary and surrounding areas (population 1.4 million and global academic support for the University of Calgary Cumming School of Medicine. It developed rapidly after the Alberta Provincial Government implemented an austerity program to address rising health care costs and to address Alberta’s debt and deficit in 1994. Over roughly the next year, all hospital and community laboratory test funding within the province was put into a single budget, fee codes for fee-for-service test billing were closed, roughly 40% of the provincial laboratory budget was cut, and roughly 40% of the pathologists left the province of Alberta. In Calgary, in the face of these abrupt changes in the laboratory environment, private laboratories, publicly funded hospital laboratories and the medical school department precipitously and reluctantly merged in 1996. The origin of Calgary Laboratory Services was likened to an “unhappy shotgun marriage” by all parties. Although such a structure could save money by eliminating duplicated services and excess capacity and could provide excellent city-wide clinical service by increasing standardization, it was less clear whether it could provide strong academic support for a medical school. Over the past decade, iterations of the Calgary Laboratory Services model have been implemented or are being considered in other Canadian jurisdictions. This case study analyzes the evolution of Calgary Laboratory Services, provides a metric-based review of academic performance over time, and demonstrates that this model, essentially arising as an unplanned experiment, has merit within a Canadian health care context.

  17. Research and Progress on Virtual Cloud Laboratory

    Directory of Open Access Journals (Sweden)

    Zhang Jian Wei

    2016-01-01

    Full Text Available In recent years, cloud computing technology has experienced continuous development and improvement, and has gradually expanded to the education sector. First, this paper will introduce the background knowledge of the current virtual cloud laboratory; by comparing the advantages and disadvantages between traditional laboratory and virtual cloud laboratory, and comparing the application, advantages and disadvantages, and development trend of OpenStack technology and VMWare technology in safety, performance, design, function, use case, and value of virtual cloud laboratory, this paper concludes that application based on OpenStack virtual cloud laboratory in universities and research institutes and other departments is essential.

  18. Electromedical devices test laboratories accreditation

    International Nuclear Information System (INIS)

    Murad, C; Rubio, D; Ponce, S; Alvarez Abri, A; Terron, A; Vicencio, D; Fascioli, E

    2007-01-01

    In the last years, the technology and equipment at hospitals have been increase in a great way as the risks of their implementation. Safety in medical equipment must be considered an important issue to protect patients and their users. For this reason, test and calibrations laboratories must verify the correct performance of this kind of devices under national and international standards. Is an essential mission for laboratories to develop their measurement activities taking into account a quality management system. In this article, we intend to transmit our experience working to achieve an accredited Test Laboratories for medical devices in National technological University

  19. Connecting QGP-Heavy Ion Physics to the Early Universe

    Energy Technology Data Exchange (ETDEWEB)

    Rafelski, Johann

    2013-10-15

    We discuss properties and evolution of quark-gluon plasma in the early Universe and compare to laboratory heavy ion experiments. We describe how matter and antimatter emerged from a primordial soup of quarks and gluons. We focus our discussion on similarities and differences between the early Universe and the laboratory experiments.

  20. Clasificación de reactivos químicos en los laboratorios de la Universidad Nacional Classification of chemical reagents in the laboratories of National University

    Directory of Open Access Journals (Sweden)

    José Carlos Mora Barrantes

    2012-11-01

    Full Text Available Durante el periodo 2008-2010 se realizaron inventarios de los reactivos químicos utilizados y almacenados en los laboratorios de los campus Omar Dengo y Benjamín Núñez de la Universidad Nacional. Se le solicitó a cada coordinador de laboratorio completar un formulario que incluía el nombre, la cantidad y el número CAS de los reactivos químicos almacenados y utilizados en cada laboratorio. Con estos datos, se clasificaron los reactivos de acuerdo con su categoría de peligro, utilizando el Código IMDG de la Organización de las Naciones Unidas (ONU. La clasificación de los reactivos químicos permitió el desarrollo de sus patrones de distribución en las diferentes unidades, institutos y centros de investigación de la Universidad Nacional. Además, se identificaron las clases de reactivos de mayor y menor uso en los laboratorios de la institución. El adecuado manejo de los reactivos químicos, con su correspondiente clasificación basada en la categoría de riesgo, es la base principal para la implementación de un ambiente seguro de trabajo en los laboratorios. La clasificación de los reactivos químicos permite minimizar los costos administrativos, económicos, legales, de seguridad y técnicos asociados con la atención de emergencias químicas; permitiendo además el desarrollo y aplicación de prácticas de trabajo preventivas por parte de funcionarios y estudiantes durante la manipulación de estas sustancias.During 2008-2010 inventories of chemical reagents used and stored in teaching and research laboratories of Omar Dengo and Benjamín Núñez campuses of National University were generated. E ach laboratory coordinator was asked to fill out a form that included name, quantity and CAS number of every chemical reagent stored and utilized in the laboratories. Chemical reagents were then classified according to the risk categories described by the United Nations IMDG Code. Such a classification process allowed the development

  1. [Trend survey of ocular infections with bacteria at Toyama University Hospital over the past six years--from the standpoint of laboratory examination].

    Science.gov (United States)

    Kubota, Tomomi; Hayashi, Shirou; Niimi, Hideki; Kitajima, Isao

    2012-07-01

    Specimens of bacterial ocular infections are frequently received in the clinical laboratory. However, a comprehensive trend survey of ocular infections with bacteria is very rare. Our objective is to understand the current tendency of ocular infections with bacteria in patients at Toyama University Hospital from the standpoint of laboratory examination. We studied 263 cases of ocular infection with bacteria diagnosed at Toyama University Hospital from January 2006 to December 2011. 123 were male and 140 were female, with a mean age of 61.2(0-98) years. Specimens were subjected to direct microscopy and culture. Cultures were positive in 174(66.2%) patients. The most common bacterial isolate was Staphylococcus (28.1%), followed by Corynebacterium (19.3%), Streptococcus (9.3%), and Propionibacterium (8.6%). MRSA accounted for 18.8% of all S. aureus isolates, and has increased in recent years. The number of bacteria detected was larger in March, June, July, August, and October. Age distribution indicated that around 70% of bacterial isolates were detected from patients over 60 years old. The most common specimen of ocular infections with bacteria was eye discharge (detection rate; 87.8%), followed by corneal scraping(41%), aqueous humor (19%), and vitreous body (27%). Nearly 80% of bacterial isolates were detected from patients with keratitis, endophthalmitis, dacryocystitis, and conjunctivitis. As for the disease specific detection rate, endophthalmitis was very low (38.3%). The detection rate by years indicated that the way doctors pick up the specimens greatly affects the detection rate. Based on this survey, we need close cooperation with medical doctors concerning laboratory examination in ocular infection with bacteria, and we must improve the detection sensitivity of specimens from patients with endophthalmitis.

  2. Phoenix's Wet Chemistry Laboratory Units

    Science.gov (United States)

    2008-01-01

    This image shows four Wet Chemistry Laboratory units, part of the Microscopy, Electrochemistry, and Conductivity Analyzer (MECA) instrument on board NASA's Phoenix Mars Lander. This image was taken before Phoenix's launch on August 4, 2007. The Phoenix Mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is by NASA's Jet Propulsion Laboratory, Pasadena, Calif. Spacecraft development is by Lockheed Martin Space Systems, Denver.

  3. Annual report of the Nuclear Physics Laboratory, University of Washington

    International Nuclear Information System (INIS)

    Snover, K.; Fulton, B.

    1996-04-01

    The Nuclear Physics Laboratory of the University of Washington has for over 40 years supported a broad program of experimental physics research. Some highlights of the research activities during the past year are given. Work continues at a rapid pace toward completion of the Sudbury Neutrino Observatory in January 1997. Following four years of planning and development, installation of the acrylic vessel began last July and is now 50% complete, with final completion scheduled for September. The Russian-American Gallium Experiment (SAGE) has completed a successful 51 Cr neutrino source experiment. The first data from 8 B decay have been taken in the Mass-8 CVC/Second Class Current study. The analysis of the measured barrier distributions for Ca-induced fission of prolate 192 Os and oblate 194 Pt has been completed. In a collaboration with a group from the Bhabha Atomic Research Centre they have shown that fission anisotropies at energies well above the barrier are not influenced by the mass asymmetry of the entrance channel relative to the Businaro-Gallone critical asymmetry. They also have preliminary evidence at higher bombarding energy that noncompound nucleus fission scales with the mean square angular momentum, in contrast to previous suggestions. The authors have measured proton and alpha particle emission spectra from the decay of A ∼ 200 compound nuclei at excitation energies of 50--100 MeV, and used these measurements to infer the nuclear temperature. The investigations of multiparticle Bose-Einstein interferometry have led to a new algorithm for putting Bose-Einstein and Coulomb correlations of up to 6th order into Monte Carlo simulations of ultra-relativistic collision events, and to a new fast algorithm for extracting event temperatures

  4. The Influence of Laboratory Safety on Capital Planning.

    Science.gov (United States)

    Francis, Robert A.

    1980-01-01

    Discusses state and federal legislation concerning the handling of dangerous materials and its impact on the design of college and university buildings. Lists federal legislation affecting laboratory safety, the objectives of each act, and the influence of each act on laboratory safety. (IRT)

  5. Upgrade of a radiation measurement laboratory course at the University of Florida

    International Nuclear Information System (INIS)

    Thomsen, L.M.; Bolch, W.E.; Wagner, T.H.

    1996-01-01

    The open-quotes Nuclear Radiation Detection and Instrumentation Laboratoryclose quotes course at the University of Florida provides health physics students with virtually their only hands-on exposure to the radiation measurement equipment used in professional practice. To better prepare students for employment, the course is currently under revision, with implementation of the revised course scheduled for fall semester 1996. The primary goal is to improve student understanding of the inherent strengths and limitations of various gas-filled, scintillation, and semiconductor detectors. A secondary goal is to improve student writing skills. To devise lab exercises that meet these goals, a six-step method for systematic laboratory course improvement was developed and used to guide the revision process. First, course objectives were delineated. Second, obstacles to achieving these course objectives were candidly assessed. Third, the course objectives were prioritized to ensure that the most important ones were met within the given time and equipment constraints. Fourth, performance-based learning objectives were written for each exercise. Fifth, exercises were developed that enable students to achieve the learning objectives specified. Sixth, when the revised course is implemented, its teaching effectiveness will be measured and steps will be taken to improve further. Course revision is nearly complete, and the new exercises promise to significantly improve both student technical knowledge and communication skill

  6. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

  7. Collaborative Learning in the Remote Laboratory NetLab

    Directory of Open Access Journals (Sweden)

    Jan Machotka

    2008-06-01

    Full Text Available At the University of South Australia (UniSA the practical component of engineering education is considered to be a vital factor in developing university graduate qualities [1]. Practical experiments performed in laboratory facilitate students' abilities to apply their knowledge, work collaboratively, control equipment and analyse the measured data. The remote laboratory NetLab has been developed within the School of Electrical and Information Engineering (EIE. A fully functional system has been used by up to 200 onshore and offshore students to conduct remote experiments every year since 2003. This paper describes the remote laboratory and discusses how collaborative team oriented tasks can be conducted in the online environment. The functionality of NetLab is demonstrated by an example of a remote experiment.

  8. Laboratory Performance of Universal Adhesive Systems for Luting CAD/CAM Restorative Materials.

    Science.gov (United States)

    Siqueira, Fabiana; Cardenas, Andres Millan; Gutierrez, Mario Felipe; Malaquias, Pâmela; Hass, Viviane; Reis, Alessandra; Loguercio, Alessandro D; Perdigão, Jorge

    To evaluate the microshear bond strength (μSBS) of several universal adhesive systems applied on five different indirect restorative materials. Five CAD/CAM materials were selected: 1) indirect resin composite (LAV); 2) feldspathic glass ceramic (VTR); 3) leucite-reinforced glass-ceramic (EMP); 4) lithium disilicate ceramic (EMX); 5) yttrium-stabilized zirconium dioxide (CZI). For each material, 15 blocks were cut into 4 rectangular sections (6 × 6 × 6 mm) (n = 60 per group), and processed as recommended by the respective manufacturer. For each indirect material, the following adhesive systems were applied according to the respective manufacturer's instructions: 1) AdheSE Universal [ADU]; 2) All-Bond Universal (ABU); 3) Ambar Universal (AMB); 4) Clearfil Universal (CFU); 5) Futurabond U (FBU); 6) One Coat 7 Universal (OCU); 7) Peak Universal Bond (PUB); 8) Prime&Bond Elect (PBE); 9) Scotchbond Universal Adhesive (SBU); 10) Xeno Select (XEN, negative control). After the application of the adhesive system, cylinder-shaped transparent matrices were filled with a dual-curing resin cement (NX3) and light cured. Specimens were stored in water (37°C for 24 h) and tested in shear mode at 1.0 mm/min (mSBS). The failure pattern and μSBS were statistically evaluated (a = 0.05). LAV, VTR, and EMP showed a greater number of cohesive fractures than EMX and CZI (p materials. There was a wide variability in mean μSBS when different universal adhesives were applied to the several CAD/CAM indirect materials. Most universal adhesives bonded well to air-abraded zirconia.

  9. The Virtual Robotics Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Kress, R.L.; Love, L.J.

    1999-09-01

    The growth of the Internet has provided a unique opportunity to expand research collaborations between industry, universities, and the national laboratories. The Virtual Robotics Laboratory (VRL) is an innovative program at Oak Ridge National Laboratory (ORNL) that is focusing on the issues related to collaborative research through controlled access of laboratory equipment using the World Wide Web. The VRL will provide different levels of access to selected ORNL laboratory secondary education programs. In the past, the ORNL Robotics and Process Systems Division has developed state-of-the-art robotic systems for the Army, NASA, Department of Energy, Department of Defense, as well as many other clients. After proof of concept, many of these systems sit dormant in the laboratories. This is not out of completion of all possible research topics. but from completion of contracts and generation of new programs. In the past, a number of visiting professors have used this equipment for their own research. However, this requires that the professor, and possibly his/her students, spend extended periods at the laboratory facility. In addition, only a very exclusive group of faculty can gain access to the laboratory and hardware. The VRL is a tool that enables extended collaborative efforts without regard to geographic limitations.

  10. Effect of manuka honey on the expression of universal stress protein A in meticillin-resistant Staphylococcus aureus.

    Science.gov (United States)

    Jenkins, Rowena; Burton, Neil; Cooper, Rose

    2011-04-01

    Staphylococcus aureus is an important pathogen that can cause many problems, from impetigo to endocarditis. With its continued resistance to multiple antibiotics, S. aureus remains a serious health threat. Honey has been used to eradicate meticillin-resistant S. aureus (MRSA) strains from wounds, but its mode of action is not yet understood. Proteomics provides a potent group of techniques that can be used to analyse differences in protein expression between untreated bacterial cells and those treated with inhibitory concentrations of manuka honey. In this study, two-dimensional (2D) electrophoresis was combined with matrix-assisted laser desorption/ionisation time-of-flight mass spectrometry (MALDI-TOF MS) to determine the identities of proteins whose levels of expression were changed at least two-fold following treatment with manuka honey. Protein extracts were obtained from cells grown in tryptone soy broth (with or without manuka honey) by mechanical disruption and were separated on 2D polyacrylamide gels. A protein was isolated in gels prepared from untreated cell extract that was absent from gels made using honey-treated cell extract. Using MALDI-TOF MS, the protein was identified as universal stress protein A (UspA). Downregulation of this protein was confirmed by real-time polymerase chain reaction (PCR), which showed a 16-fold downregulation in honey-treated cells compared with untreated samples. This protein is involved in the stress stamina response and its downregulation could help to explain the inhibition of MRSA by manuka honey. Copyright © 2011 Elsevier B.V. and the International Society of Chemotherapy. All rights reserved.

  11. Gallium Safety in the Laboratory

    International Nuclear Information System (INIS)

    Cadwallader, L.C.

    2003-01-01

    A university laboratory experiment for the US Department of Energy magnetic fusion research program required a simulant for liquid lithium. The simulant choices were narrowed to liquid gallium and galinstan (Ga-In-Sn) alloy. Safety information on liquid gallium and galinstan were compiled, and the choice was made to use galinstan. A laboratory safety walkthrough was performed in the fall of 2002 to support the galinstan experiment. The experiment has been operating successfully since early 2002

  12. University of Southern California

    Data.gov (United States)

    Federal Laboratory Consortium — The focus of the University of Southern California (USC) Children''s Environmental Health Center is to develop a better understanding of how host susceptibility and...

  13. Report of the research results with University of Tokyo, Nuclear Engineering Research Laboratory's facilities in fiscal 1993

    International Nuclear Information System (INIS)

    1994-01-01

    This publication summarizes the results of the joint utilization of the research 'Yayoi' and the electron beam accelerator in the Nuclear Engineering Research Laboratory, University of Tokyo, in the fiscal year 1993. In this report, the gists of 15 researches which were carried out on pile of the Yayoi, 9 researches off pile of the Yayoi and 14 researches by using the linear accelerator are collected. In addition, the 13 reports of Yayoi Study Meeting held in fiscal year 1993 are collected. Moreover, the list of the events carried out in the facility in fiscal year 1993, the registers of names of various committees, and the register of the names of persons who were in charge of joint utilization experiments in fiscal year 1993 are attached. (K.I.)

  14. In the physics class: university physics students' enactment of class and gender in the context of laboratory work

    Science.gov (United States)

    Danielsson, Anna T.

    2014-06-01

    This article explores how the doing of social class and gender can intersect with the learning of science, through case studies of two male, working-class university students' constitutions of identities as physics students. In doing so, I challenge the taken-for-granted notion that male physics students have an unproblematic relation to their chosen discipline, and nuance the picture of how working-class students relate to higher education by the explicit focus on one disciplinary culture. Working from the perspective of situated learning theory, the interviews with the two male students were analysed for how they negotiated the practice of the physics student laboratory and their own classed and gendered participation in this practice. By drawing on the heterogeneity of the practice of physics the two students were able to use the practical and technological aspects of physics as a gateway into the discipline. However, this is not to say that their participation in physics was completely frictionless. The students were both engaged in a continuous negotiation of how skills they had learned to value in the background may or may not be compatible with the ones they perceived to be valued in the university physicist community.

  15. Draft and final Supplemental Environmental Impact Report for the proposed renewal of the contract between the United States Department of Energy and the Regents of the University of California for operation and management of the Lawrence berkeley Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    1992-09-01

    This Supplemental Environmental Impact Report (SEIR) has been prepared in conformance with the California Environmental Quality Act (CEQA) and the University of California Procedures for the Implementation of CEQA (UC Procedures) to evaluate the potential environmental impacts associated with the University of California`s operation of the Lawrence Berkeley Laboratory (LBL) for the next five years. The specific project under consideration in this SEIR is the renewal of a five-year contract between the University and the United States Department of Energy (DOE) to manage and operate the Lawrence Berkeley Laboratory. As the California agency responsible for carrying out the proposed project, the University is the lead agency responsible for CEQA compliance. Environmental impacts, mitigation, and a site overview are presented.

  16. Draft and final Supplemental Environmental Impact Report for the proposed renewal of the contract between the United States Department of Energy and the Regents of the University of California for operation and management of the Lawrence berkeley Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    1992-09-01

    This Supplemental Environmental Impact Report (SEIR) has been prepared in conformance with the California Environmental Quality Act (CEQA) and the University of California Procedures for the Implementation of CEQA (UC Procedures) to evaluate the potential environmental impacts associated with the University of California's operation of the Lawrence Berkeley Laboratory (LBL) for the next five years. The specific project under consideration in this SEIR is the renewal of a five-year contract between the University and the United States Department of Energy (DOE) to manage and operate the Lawrence Berkeley Laboratory. As the California agency responsible for carrying out the proposed project, the University is the lead agency responsible for CEQA compliance. Environmental impacts, mitigation, and a site overview are presented.

  17. Laboratory Experiments and their Applicability

    OpenAIRE

    Steinhaus, Thomas; Jahn, Wolfram

    2007-01-01

    In conjunction with the Dalmarnock Fire Tests a series of laboratory tests have been conducted at the BRE Centre for Fire Safety Engineering at the University of Edinburgh (UoE) in support of the large scale tests. These were conducted prior to and post the tests in Dalmarnock. Before the tests, ignition experiments were carried out in the laboratory to ensure flame spread from the wastepaper basket to the sofa. The later series of lab tests comprised of small scale cone calori...

  18. Colorado State University (CSU) accelerator and FEL facility

    NARCIS (Netherlands)

    Milton, S.; Biedron, S.; Harris, J.; Martinez, J.; D'Audney, A.; Edelen, J.; Einstein, J.; Hall, C.; Horovitz, K.; Morin, A.; Sipahi, N.; Sipahi, T.; Williams, J.; Carrico, C.; Van Der Slot, P. J M

    2014-01-01

    The Colorado State University (CSU) Accelerator Facility will include a 6-MeV L-Band (1.3 GHz) electron linear accelerator (linac) with a free-electron laser (FEL) system capable of producing Terahertz (THz) radiation, a laser laboratory, a microwave test laboratory, and a magnetic test laboratory.

  19. Accelerator Laboratory of the University and the Technical University of Munich. Annual report 1992

    International Nuclear Information System (INIS)

    Korschinek, G.; Lutter, R.; Riess, F.

    1993-01-01

    This report contains extended abstracts about the work performed at the named laboratory together with a list of publications and reports. The abstracts concern experiments on nuclear reactions, nuclear spectroscopy, atomic physics, accelerator mass spectroscopy with heavy ions, and applications of nuclear techniques, theoretical work on nuclear reactions, nuclear structure, atomic physics, and astrophysics, developments of accelerators and radiation instrumentation, as well as data processing. (HSI)

  20. Nuclear Physics Laboratory annual report 1982

    International Nuclear Information System (INIS)

    1982-06-01

    This Annual Report describes the activities of the Nuclear Physics Laboratory of the University of Washington for the year ending approximately April 30, 1982. As in previous years we report here on a strong nuclear physics research program based upon use of the Laboratory's principal facility, an FN tandem and injector accelerator system. Other major elements of the Laboratory's current program include the hydrogen parity mixing experiment, intermediate-energy experiments conducted at Los Alamos and elsewhere, an accelerator mass spectrometry program emphasizing 10 Be and 14 C measurements on environmental materials, and a number of researches carried out by Laboratory members working collaboratively at other institutions both in this country and abroad

  1. SAFETY IN THE DESIGN OF SCIENCE LABORATORIES AND BUILDING CODES.

    Science.gov (United States)

    HOROWITZ, HAROLD

    THE DESIGN OF COLLEGE AND UNIVERSITY BUILDINGS USED FOR SCIENTIFIC RESEARCH AND EDUCATION IS DISCUSSED IN TERMS OF LABORATORY SAFETY AND BUILDING CODES AND REGULATIONS. MAJOR TOPIC AREAS ARE--(1) SAFETY RELATED DESIGN FEATURES OF SCIENCE LABORATORIES, (2) LABORATORY SAFETY AND BUILDING CODES, AND (3) EVIDENCE OF UNSAFE DESIGN. EXAMPLES EMPHASIZE…

  2. Willow Run Laboratories: Separating from the University of Michigan

    Science.gov (United States)

    Walsh, John

    1972-01-01

    Outlines the reasons for, and the problems involved in, separation of a research center from the University of Michigan in order to become an independent research organization contracting for private and military research. (AL)

  3. Modernisation of the intermediate physics laboratory

    Science.gov (United States)

    Kontro, Inkeri; Heino, Olga; Hendolin, Ilkka; Galambosi, Szabolcs

    2018-03-01

    The intermediate laboratory courses at the Department of Physics, University of Helsinki, were reformed using desired learning outcomes as the basis for design. The reformed laboratory courses consist of weekly workshops and small-group laboratory sessions. Many of the laboratory exercises are open-ended and have several possible ways of execution. They were designed around affordable devices, to allow for the purchase of multiple sets of laboratory equipment. This allowed students to work on the same problems simultaneously. Thus, it was possible to set learning goals which build on each other. Workshop sessions supported the course by letting the students solve problems related to conceptual and technical aspects of each laboratory exercise. The laboratory exercises progressed biweekly to allow for iterative problem solving. Students reached the learning goals well and the reform improved student experiences. Neither positive or negative changes in expert-like attitudes towards experimental physics (measured by E-CLASS questionnaire) were observed.

  4. Online general pre-laboratory training course for facilitating first year chemical laboratory use

    Directory of Open Access Journals (Sweden)

    Maria Limniou

    2010-03-01

    Full Text Available In Chemistry, practical work is a highly demanding process in which students should be well-prepared before and alert during,laboratory sessions. Various general difficulties such as the limited laboratory time and the lack of connections between theoryand practicals often do not allow students to actively participate in the learning process. The aim of this investigation is to studyhow an online general pre-laboratory training course inspired by cognitive load theory influenced the teaching of first yearchemistry students engaged in laboratory work. Two different groups of chemistry students (experimental group (EG andcontrol group (CG from the University of Manchester participated in this investigation. The EG group participated in the onlinepre-laboratory course before entering the laboratory, while the CG group performed the experiments following the traditionalteaching procedure. The comparison of students’ responses to the same assessments of fundamental chemical and basiclaboratory knowledge showed that overall the performance of the EG group of students was higher than that of the CGstudents. Overall, the EG students valued the opportunity to have an online training course. By creating a flexible learningenvironment which included animations, simulations and self-assessments, the general laboratory difficulties were overcome.These interactive learning features gave students the opportunity to engage in independent study, by which restrictions of timeand place were overcome.

  5. Changing scene highlights III. [Iowa State University

    Energy Technology Data Exchange (ETDEWEB)

    Fassel, V. A.; Harl, Neil E.; Legvold, Sam; Ruedenberg, Klaus; Swenson, Clayton A.; Burnet, George; Fisher, Ray W.; Gschneidner, Karl A.; Hansen, Robert S.; Kliewer, Kenneth L.; Wildman, Ruth

    1979-01-01

    The research programs in progress at Ames Laboratory, Iowa State University, are reviewed: hydrogen (storage), materials, catalysts, TRISTAN (their laboratory isotope separator), coal preparation, coal classification, land reclamation (after surface mining, nitinol, neutron radiography, grain dust explosions, biomass conversion, etc). (LTC)

  6. Actions of the Academic Literacy Laboratory of the University of São Paulo: promoting academic writing in the undergraduate and graduate programs

    Directory of Open Access Journals (Sweden)

    Marília Mendes Ferreira

    2016-09-01

    Full Text Available http://dx.doi.org/10.5007/2175-8026.2016v69n3p125 The increasing internationalization of Brazilian universities requires its academic community not only to read, but also to communicate effectively in academic discourse in at least two languages - the mother tongue and a foreign language (mainly English. However, material conditions for meeting these demands are practically nonexistent in Brazilian higher education institutions (FERREIRA, 2015. The purpose of this article is to describe an action that aims to meet one of these demands imposed by internationalization – the socialization of academic production in English, French and Portuguese not only for reading purposes and assimilation of content, but above all for the publication in these languages. This action is undertaken by the Academic Literacy Laboratory at the University of São Paulo.

  7. Sequence Classification: 398736 [

    Lifescience Database Archive (English)

    Full Text Available Non-TMB TMH Non-TMB TMB TMB Non-TMB >gi|15609453|ref|NP_216832.1| PROBABLE SUGAR-TRANSPORT... INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER USPA || http://www.ncbi.nlm.nih.gov/protein/15609453 ...

  8. University Research Consortium annual review meeting program

    International Nuclear Information System (INIS)

    1996-07-01

    This brochure presents the program for the first annual review meeting of the University Research Consortium (URC) of the Idaho National Engineering Laboratory (INEL). INEL is a multiprogram laboratory with a distinctive role in applied engineering. It also conducts basic science research and development, and complex facility operations. The URC program consists of a portfolio of research projects funded by INEL and conducted at universities in the United States. In this program, summaries and participant lists for each project are presented as received from the principal investigators

  9. University Research Consortium annual review meeting program

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-01

    This brochure presents the program for the first annual review meeting of the University Research Consortium (URC) of the Idaho National Engineering Laboratory (INEL). INEL is a multiprogram laboratory with a distinctive role in applied engineering. It also conducts basic science research and development, and complex facility operations. The URC program consists of a portfolio of research projects funded by INEL and conducted at universities in the United States. In this program, summaries and participant lists for each project are presented as received from the principal investigators.

  10. A Wet Chemistry Laboratory Cell

    Science.gov (United States)

    2008-01-01

    This picture of NASA's Phoenix Mars Lander's Wet Chemistry Laboratory (WCL) cell is labeled with components responsible for mixing Martian soil with water from Earth, adding chemicals and measuring the solution chemistry. WCL is part of the Microscopy, Electrochemistry, and Conductivity Analyzer (MECA) instrument suite on board the Phoenix lander. The Phoenix Mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is by NASA's Jet Propulsion Laboratory, Pasadena, Calif. Spacecraft development is by Lockheed Martin Space Systems, Denver.

  11. Laboratory Directed Research and Development FY 2000

    International Nuclear Information System (INIS)

    Hansen, Todd; Levy, Karin

    2001-01-01

    The Ernest Orlando Lawrence Berkeley National Laboratory (Berkeley Lab or LBNL) is a multi-program national research facility operated by the University of California for the Department of Energy (DOE). As an integral element of DOE's National Laboratory System, Berkeley Lab supports DOE's missions in fundamental science, energy resources, and environmental quality. Berkeley Lab programs advance four distinct goals for DOE and the nation: (1) To perform leading multidisciplinary research in the computing sciences, physical sciences, energy sciences, biosciences, and general sciences in a manner that ensures employee and public safety and protection of the environment. (2) To develop and operate unique national experimental facilities for qualified investigators. (3) To educate and train future generations of scientists and engineers to promote national science and education goals. (4) To transfer knowledge and technological innovations and to foster productive relationships among Berkeley Lab's research programs, universities, and industry in order to promote national economic competitiveness. Annual report on Laboratory Directed Research and Development for FY2000

  12. Incubation of Spirometra eggs at laboratory conditions by Modified ...

    African Journals Online (AJOL)

    Incubation of Spirometra eggs was conducted in the helminthology laboratory Faculty of Veterinary Medicine, Sokoine University of Agriculture during the period July to September, 2012. Spirometra eggs from faeces of naturally infected lions (Panthera leo) from Tarangire National Park, Tanzania were cultured at laboratory ...

  13. VIRTUAL LABORATORY IN DISTANCE LEARNING SYSTEM

    Directory of Open Access Journals (Sweden)

    Е. Kozlovsky

    2011-11-01

    Full Text Available Questions of designing and a choice of technologies of creation of virtual laboratory for the distance learning system are considered. Distance learning system «Kherson Virtual University» is used as illustration.

  14. Annual report of Laboratory of Nuclear Studies, Osaka University, for fiscal 1979

    International Nuclear Information System (INIS)

    1980-01-01

    This annual report presents the research activities carried out by the members of the Laboratory and the users of the facilities. The major facilities of the Laboratory are a 110 cm variable energy cyclotron and a 4.7 MeV Van de Graaff. The cyclotron division has made extensive studies on nuclear physics, such as the pre-equilibrium process of neutron emission, inelastic proton scattering, He-3 induced reactions, and polarization experiments. The Van de Graaff division reports about the works on hyperfine interaction, mirror beta-decay, heavy element ion source, and nuclear spin alignment. Model magnet study on the future project has also been developed at the Laboratory. Other divisions of the Laboratory are the mass spectroscopy division, the radioisotope division, and the theoretical physics division. The works of the mass spectroscopy division concern the on-line mass separation of radioisotopes, the field desorption of mass spectra, and instrumentation. The works of the radioisotope division spread widely on the field of nuclear chemistry. At the end of this report, various works, which have been made by the theoretical physics division, are introduced. (Kato, T.)

  15. Laboratory Astrophysics Prize: Laboratory Astrophysics with Nuclei

    Science.gov (United States)

    Wiescher, Michael

    2018-06-01

    Nuclear astrophysics is concerned with nuclear reaction and decay processes from the Big Bang to the present star generation controlling the chemical evolution of our universe. Such nuclear reactions maintain stellar life, determine stellar evolution, and finally drive stellar explosion in the circle of stellar life. Laboratory nuclear astrophysics seeks to simulate and understand the underlying processes using a broad portfolio of nuclear instrumentation, from reactor to accelerator from stable to radioactive beams to map the broad spectrum of nucleosynthesis processes. This talk focuses on only two aspects of the broad field, the need of deep underground accelerator facilities in cosmic ray free environments in order to understand the nucleosynthesis in stars, and the need for high intensity radioactive beam facilities to recreate the conditions found in stellar explosions. Both concepts represent the two main frontiers of the field, which are being pursued in the US with the CASPAR accelerator at the Sanford Underground Research Facility in South Dakota and the FRIB facility at Michigan State University.

  16. University of Colorado, Nuclear Physics Laboratory technical progress report, November 1, 1978-October 31, 1979. Report NPL-845

    International Nuclear Information System (INIS)

    1979-01-01

    This report summarizes work carried out at the Nuclear Physics Laboratory of the University of Colorado from November 1, 1978 to October 31, 1979, under contract EY-76-C-02-0535.A003 between the University of Colorado and the United States Department of Energy. Experimental studies of light ion-induced reactions were performed with the AVF cyclotron, which continues each year to produce beams of yet higher quality. Charged-particle studies continued to emphasize use of the high-resolution spectrometer system, but some return to broad-range spectroscopic studies using solid state detectors also occurred. Neutron time-of-flight experiments used 9-meter and 30-meter flight paths. Neutron-gamma ray coincidence studies developed into a new and promising field. The new PDP 11/34 data acquisition system was of great value in allowing such multiparameter experiments. Smaller programs in nuclear astrophysics, plasma diagnostic development, and medical physics were also undertaken. Research activities based at other accelerators grew. Studies of future directions for light-ion accelerators, including work on intense pulsed ion sources, orbit dynamics, and storage rings, were greatly enlarged. 19 of the articles in this report were abstracted and indexed individually. Lists of publications and personnel conclude this report

  17. The Virtual Robotics Laboratory; TOPICAL

    International Nuclear Information System (INIS)

    Kress, R.L.; Love, L.J.

    1999-01-01

    The growth of the Internet has provided a unique opportunity to expand research collaborations between industry, universities, and the national laboratories. The Virtual Robotics Laboratory (VRL) is an innovative program at Oak Ridge National Laboratory (ORNL) that is focusing on the issues related to collaborative research through controlled access of laboratory equipment using the World Wide Web. The VRL will provide different levels of access to selected ORNL laboratory secondary education programs. In the past, the ORNL Robotics and Process Systems Division has developed state-of-the-art robotic systems for the Army, NASA, Department of Energy, Department of Defense, as well as many other clients. After proof of concept, many of these systems sit dormant in the laboratories. This is not out of completion of all possible research topics. but from completion of contracts and generation of new programs. In the past, a number of visiting professors have used this equipment for their own research. However, this requires that the professor, and possibly his/her students, spend extended periods at the laboratory facility. In addition, only a very exclusive group of faculty can gain access to the laboratory and hardware. The VRL is a tool that enables extended collaborative efforts without regard to geographic limitations

  18. Comparison of semen quality between university-based and private assisted reproductive technology laboratories

    DEFF Research Database (Denmark)

    Jensen, Christian Fuglesang S; Khan, Omar; Sønksen, Jens

    2018-01-01

    laboratory, the first at each laboratory was selected for analysis. Comparison of major semen parameters was performed using descriptive statistics and Bland-Altman plots, with differences tested using Wilcoxon-signed rank test. RESULTS: Twenty-eight men aged 33 ± 5 (mean ± SD) years were included......OBJECTIVE: Obtaining a semen analysis (SA) is an essential step in evaluating infertile men. Despite using standardized procedures for analysis semen quality in the same individual often varies on repeated tests. The objective of this study was to investigate inter-laboratory variation in semen...

  19. Utilizing On-Campus Foodservice Facilities as a Laboratory

    Science.gov (United States)

    Dallmeyer, Martha A.

    2012-01-01

    In 2008, the Family and Consumer Sciences Department at Bradley University recognized the need to improve the quality of the laboratory experience in foodservice classes. A hands-on, real-world, learning experience was desired. Simultaneously, the university administration wanted to provide an on-campus foodservice for students from 8:00 p.m. to…

  20. Design of metrology laboratory and microfab center against vibration from shakers laboratory of the new Hong Kong University of Science and Technology

    Science.gov (United States)

    Hong, Westwood K. W.; Boulter, Nicholas

    1992-02-01

    The design of vibration-sensitive laboratories normally requires the protection of these areas from incoming vibration generated by plant, road traffic and footfall impacts. The compact nature of the new HKUST campus requires a more exact design than one would find for a spacious campus with laboratory buildings nicely separated. The HKUST user required a centralized laboratory service with easy access to the major testing facilities. This resulted in the location of vibration sensitive areas (micro-fabrication center and metrology laboratory) close to a Structural Laboratory housing large shakers. These were to be used for seismic and modal testing of structural elements and prototypes. The design of the support structure for the shakers, known as the reaction floor, was critical to the success of the building. Particular attention was paid to the design and construction of the foundations for the reaction floor. For controlling the vibration generated by 10-ton-force rated shakers, a massive structure with caisson supports was designed for the reaction floor and reaction wall. Finite element models were employed to calculate the response of the laboratory floors located above the reaction floor in other parts of the building. The metrology laboratory structure and the foundation design of the reaction floor and a wafer fab built in the U.K. will be presented.

  1. DOE University Reactor Sharing Program. Renewal for 1994--1995

    International Nuclear Information System (INIS)

    Chappas, W.J.; Adams, V.G.

    1994-01-01

    The Department of Energy University Reactor Sharing Program at University of Maryland, College Park (UMCP) has, once again, stimulated a broad use of the reactor facilities by undergraduate and graduate students, visitors, and professionals. Participants are exposed to topics such as nuclear engineering, radiation safety, and nuclear reactor operations. This information is presented through various means including tours, slide presentations, experiments, and discussions. Student research using the MUTR is also encouraged. In addition, the Reactor Sharing Program here at the University of Maryland does not limit itself to the confines of the TRIGA reactor facility. Incorporated in the program are the Maryland University Neutron Activation Analysis Laboratory, the Maryland University Radiation Effects Laboratory, and the UMCP 2x4 Thermal Hydraulic Loop. These facilities enhance and give an added dimension to the tours and experiments

  2. Chapter 2. The University as a Living Laboratory for Climate Solutions

    Directory of Open Access Journals (Sweden)

    Matthew St. Clair

    2016-12-01

    Full Text Available The story of the University of California’s institutional goal of de-carbonization by 2025, already years in the making, was a key feature of a systemwide Summit on carbon neutrality and climate mitigation in the Fall of 2015. This report, commissioned by the Summit, represents a unique multi-campus, interdisciplinary collaboration, an attempt by one university system to harness its diverse intellectual resources to address the crisis of global climate disruption. This chapter puts the Bending the Curve report into the context of the University of California’s (UC carbon neutrality and sustainability initiatives and offers one example of how a large organization can become a “living laboratory”— a research, teaching and learning, and innovation testbed—for climate solutions.

  3. Rutherford Appleton Laboratory

    International Nuclear Information System (INIS)

    1993-01-01

    Rutherford Appleton Laboratory (RAL), described in this document, supports a wide variety of projects. Each year more than 1000 scientists and engineers visit RAL to use its world-class laser and neutron-scattering facilities. RAL staff design and build instruments which circle the Earth in satellites, increasing our understanding of ozone depletion and global warming, of the life cycles of stars and galaxies and, indeed, of the origin of the Universe itself. They work with their academic colleagues at international laboratories such as European Organization for Nuclear Research (CERN), Geneva, where massive underground machines probe the microstructure of the atomic nucleus. Vastly complex calculations are carried out on the design of anti-cancer drugs, for example, using supercomputers at RAL. (author)

  4. Green Building Research Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Sailor, David Jean [Portland State Univ., Portland, OR (United States)

    2013-12-29

    This project provided support to the Green Building Research Laboratory at Portland State University (PSU) so it could work with researchers and industry to solve technical problems for the benefit of the green building industry. It also helped to facilitate the development of PSU’s undergraduate and graduate-level training in building science across the curriculum.

  5. Laboratory and space experiments as a key to the plasma universe

    International Nuclear Information System (INIS)

    Faelthammar, C.G.

    1993-08-01

    Almost all of the known matter in our universe is in the state of plasma. Because of the complexity of the plasma state, a reliable understanding has to be built on empirical knowledge, since theoretical models easily become misleading unless guided by experiment or observation. Cosmical plasmas cover a vast range of densities and temperatures, but in important respects they can be classified into three main categories: high, medium, and low density plasmas. The ability of a plasma to carry electric current is very different in different kinds of plasma, varying from high density plasmas, where the ordinary Ohms law applies to low density plasmas, where no local macroscopic relation needs to exist between electric field and current density. According to classical formulas, the electrical conductivity of many plasmas should be practically infinite. But on the basis of laboratory experiments and in situ measurements in space we now know that in important cases the plasmas ability to carry electric current can be reduced by many powers of ten, and even collisionless plasmas may support significant magnetic-field aligned electric fields. A small number of processes responsible for this have been identified. They include anomalous resistivity, magnetic mirror effect and electric double layers. One of the consequences is possible violation of the frozen field condition, which greatly simplifies the analysis but can be dangerously misleading. Another is the possibility of extremely efficient release of magnetically stored energy. Cosmical plasmas have a strong tendency to form filamentary and cellular structures, which complicates their theoretical description by making homogeneous models inappropriate. In situ observations in the Earths magnetosphere have revealed completely unexpected and still not fully understood chemical separation processes that are likely to be important also in astrophysical plasmas. 108 refs

  6. Radiological work in a university centre

    International Nuclear Information System (INIS)

    Westerman, B.

    1982-01-01

    In this paper the author outlines the problems of the industrial doctor's tasks in a university centre with physics laboratories and a hospital with medical laboratories. An inventory of problems is presented. The solutions are not easy because of the interdependence of medical, physical and technical inspectors. The health hazards appear to be low. (Auth.)

  7. Essay of accelerator R and D in a small laboratory of an university. Head ion IH linac for fusion material. 1983-1985

    International Nuclear Information System (INIS)

    Hattori, Toshiyuki

    2005-01-01

    The linear accelerator of Inter-Digital H type (IH linac) is known to have a high shunt impedance. Research Laboratory for Nuclear Reactors of Tokyo Institute of Technology introduced an IH linac for fusion materials irradiation test in 1983. The beam injector was a tandem electrostatic accelerator. The IH linac was designed and fabricated based on the developmental work at Institute for Nuclear Study of University of Tokyo. The processes of component alignment, cold test and start-up operation are described. Educational aspect of the project is also reviewed. (K.Y.)

  8. Adverse reproduction outcomes among employees working in biomedical research laboratories

    DEFF Research Database (Denmark)

    Wennborg, H.; Bonde, Jens Peter; Stenbeck, M.

    2002-01-01

    Objectives The aim of the study was to investigate reproductive outcomes such as birthweight, preterm births, and postterm births among women working in research laboratories while pregnant. Methods Female university personnel were identified from a source cohort of Swedish laboratory employees...

  9. Inadequate Information in Laboratory Test Requisition in a Tertiary ...

    African Journals Online (AJOL)

    Objectives: This study examined the pattern of deficiencies in the laboratory test requisition by doctors at the University of Benin Teaching Hospital, Benin City, Nigeria, with a view to suggesting strategies of reducing error rates in laboratory test requisition. Materials and Method: The study generated data through ...

  10. LABORATORY SCALE STEAM INJECTION TREATABILITY STUDIES

    Science.gov (United States)

    Laboratory scale steam injection treatability studies were first developed at The University of California-Berkeley. A comparable testing facility has been developed at USEPA's Robert S. Kerr Environmental Research Center. Experience has already shown that many volatile organic...

  11. Three-year customer satisfaction survey in laboratory medicine in a Chinese university hospital.

    Science.gov (United States)

    Guo, Siqi; Duan, Yifei; Liu, Xiaojuan; Jiang, Yongmei

    2018-04-25

    Customer satisfaction is a key quality indicator of laboratory service. Patients and physicians are the ultimate customers in medical laboratory, and their opinions are essential components in developing a customer-oriented laboratory. A longitudinal investigation of customer satisfaction was conducted through questionnaires. We designed two different questionnaires and selected 1200 customers (600 outpatients and 600 physicians) to assess customer satisfaction every other year from 2012 to 2016. Items with scores satisfaction in 2014 was better, which illustrated our strategy was effective. However, some items remained to be less than 4, so we repeated the survey after modifying questionnaires in 2016. However, the general satisfaction points of the physicians and patients reduced in 2016, which reminded us of some influential factors we had neglected. By using dynamic survey of satisfaction, we can continuously find deficiencies in our laboratory services and take suitable corrective actions, thereby improving our service quality.

  12. Detection of a Usp-like gene in Calotropis procera plant from the de novo assembled genome contigs of the high-throughput sequencing dataset

    KAUST Repository

    Shokry, Ahmed M.

    2014-02-01

    The wild plant species Calotropis procera (C. procera) has many potential applications and beneficial uses in medicine, industry and ornamental field. It also represents an excellent source of genes for drought and salt tolerance. Genes encoding proteins that contain the conserved universal stress protein (USP) domain are known to provide organisms like bacteria, archaea, fungi, protozoa and plants with the ability to respond to a plethora of environmental stresses. However, information on the possible occurrence of Usp in C. procera is not available. In this study, we uncovered and characterized a one-class A Usp-like (UspA-like, NCBI accession No. KC954274) gene in this medicinal plant from the de novo assembled genome contigs of the high-throughput sequencing dataset. A number of GenBank accessions for Usp sequences were blasted with the recovered de novo assembled contigs. Homology modelling of the deduced amino acids (NCBI accession No. AGT02387) was further carried out using Swiss-Model, accessible via the EXPASY. Superimposition of C. procera USPA-like full sequence model on Thermus thermophilus USP UniProt protein (PDB accession No. Q5SJV7) was constructed using RasMol and Deep-View programs. The functional domains of the novel USPA-like amino acids sequence were identified from the NCBI conserved domain database (CDD) that provide insights into sequence structure/function relationships, as well as domain models imported from a number of external source databases (Pfam, SMART, COG, PRK, TIGRFAM). © 2014 Académie des sciences.

  13. Progress report from the Studsvik Neutron Research Laboratory 1987-89

    International Nuclear Information System (INIS)

    Dahlborg, U.; Ebbsjoe, I.; Holmqvist, B.

    1993-01-01

    The present publication contains information from activities at the Studsvik Neutron Research Laboratory (NFL) and the Department of Neutron Research. NFL is the base for the research activities at the Studvik reactors. It is administrated by the University of Uppsala and is established to facilitate reactor based research. The laboratory is intended to, in co-operation with institutes and departments at universities in Sweden, develop, construct and maintain experimental equipment for this kind of research and to make it available for scientists at Swedish universitites and, if possible, also to scientists outside the universities. The research at the Studsvik facilities has during 1989 been performed by groups from Uppsala University, Royal Institute of Technology in Stockholm, Chalmers Technical University, Gothenburg, and by scientists at NFL. The research program of the groups is divided into three main areas, scattering of thermal neutrons, nuclear chemistry and nuclear physics, and neutron capture radiography. The program for subatomic physics, especially neutron physics, at the Department for Neutron Research, Uppsala University has also staff permanently placed at NFL but they are in their research using the facilities at the The Svedberg Laboratory, Uppsala. In addition to supporting research NFL has also put substantial efforts on creating facilities for training of undergraduate students. Thus a facility for practical exercises in neutron physics, activation analysis and radiography has recently been installed at the R2-0 reactor as a collaboration between NFL, Dept. of Neutron Research, Upppsala and Department for Reactor Physics, KTH

  14. 40 CFR 262.103 - What is the scope of the laboratory environmental management standard?

    Science.gov (United States)

    2010-07-01

    ... environmental management standard? 262.103 Section 262.103 Protection of Environment ENVIRONMENTAL PROTECTION... University Laboratories XL Project-Laboratory Environmental Management Standard § 262.103 What is the scope of the laboratory environmental management standard? The Laboratory Environmental Management Standard...

  15. The role of the Oregon State University Endophyte Service Laboratory in diagnosing clinical cases of endophyte toxicoses.

    Science.gov (United States)

    Craig, A Morrie; Blythe, Linda L; Duringer, Jennifer M

    2014-07-30

    The Oregon State University Colleges of Veterinary Medicine and Agricultural Sciences instituted the Endophyte Service Laboratory to aid in diagnosing toxicity problems associated with cool-season grasses in livestock. The endophyte (Neotyphodium coenophalum) present in tall fescue (Festuca arundinacea) produces ergopeptine alkaloids, of which ergovaline is the molecule used to determine exposure and toxicity thresholds for the vasoconstrictive conditions "fescue foot" and "summer slump". Another vasoconstrictive syndrome, "ergotism," is caused by a parasitic fungus, Claviceps purpurea, and its primary toxin, ergotamine. "Ryegrass staggers" is a neurological condition that affects livestock consuming endophyte (Neotyphodium lolii)-infected perennial ryegrass (Lolium perenne) with high levels of lolitrem B. HPLC-fluorescent analytical methods for these mycotoxins are described and were used to determine threshold levels of toxicity for ergovaline and lolitrem B in cattle, sheep, horses, and camels. In addition, six clinical cases in cattle are presented to illustrate diagnosis of these three diseases.

  16. Building leadership among laboratory-based and clinical and translational researchers: the University of California, San Francisco experience.

    Science.gov (United States)

    Wides, Cynthia; Mertz, Elizabeth; Lindstaedt, Bill; Brown, Jeanette

    2014-02-01

    In 2005 the University of California, San Francisco (UCSF) implemented the Scientific Leadership and Management (SLM) course, a 2-day leadership training program to assist laboratory-based postdoctoral scholars in their transition to independent researchers managing their own research programs. In 2011, the course was expanded to clinical and translational junior faculty and fellows. The course enrollment was increased from approximate 100 to 123 participants at the same time. Based on course evaluations, the number and percent of women participants appears to have increased over time from 40% (n = 33) in 2007 to 53% (n = 58) in 2011. Course evaluations also indicated that participants found the course to be relevant and valuable in their transition to academic leadership. This paper describes the background, structure, and content of the SLM and reports on participant evaluations of the course offerings from 2007 through 2011. © 2014 Wiley Periodicals, Inc.

  17. DebriSat Pre Preshot Laboratory Analyses

    Science.gov (United States)

    2015-03-27

    INTEGRATION DIVISION OFFICE OF EVP/SSG Shant Kenderian, DIRECTOR DEPT MATERIALS PROCESSING DEPT SPACE MATERIALS LABORATORY ENGINEERING & TECHNOLOGY ...UNCLASSIFIED Norman Fitz-Coy University of Florida nfc @ufl.edu Heather Cowardin NASA-JSC heather.cowardin@nasa.gov Brian Roebuck AEDC

  18. The plasma universe

    International Nuclear Information System (INIS)

    Faelthammar, C.G.

    1989-12-01

    The term 'Plasma Universe', coined by Hannes Alfven, emphasices the fact that plasma phenomena discovered in the laboratory and in accessible regions of space. must be important also in the rest of the universe, which consists almost entirely of matter in the plasma state. Relevant aspect of this concept will be discussed. They include the response of the plasma to electric currents, the support of magnetic-field aligned electric fields, violation of the frozen-field condition, rapid release of magnetically stored energy, acceleration of charged particles, chemical separation, and filamentary and cellular structures. (authors)

  19. Promoting Good Clinical Laboratory Practices and Laboratory Accreditation to Support Clinical Trials in Sub-Saharan Africa

    Science.gov (United States)

    Shott, Joseph P.; Saye, Renion; Diakité, Moussa L.; Sanogo, Sintry; Dembele, Moussa B.; Keita, Sekouba; Nagel, Mary C.; Ellis, Ruth D.; Aebig, Joan A.; Diallo, Dapa A.; Doumbo, Ogobara K.

    2012-01-01

    Laboratory capacity in the developing world frequently lacks quality management systems (QMS) such as good clinical laboratory practices, proper safety precautions, and adequate facilities; impacting the ability to conduct biomedical research where it is needed most. As the regulatory climate changes globally, higher quality laboratory support is needed to protect study volunteers and to accurately assess biological parameters. The University of Bamako and its partners have undertaken a comprehensive QMS plan to improve quality and productivity using the Clinical and Laboratory Standards Institute standards and guidelines. The clinical laboratory passed the College of American Pathologists inspection in April 2010, and received full accreditation in June 2010. Our efforts to implement high-quality standards have been valuable for evaluating safety and immunogenicity of malaria vaccine candidates in Mali. Other disease-specific research groups in resource-limited settings may benefit by incorporating similar training initiatives, QMS methods, and continual improvement practices to ensure best practices. PMID:22492138

  20. Rural neurosurgical and spinal laboratory setup.

    Science.gov (United States)

    Smith, Adam; Gagliardi, Filippo; Pelzer, Nicholas Robert; Hampton, Jacob; Chau, Anthony Minh Tien; Stewart, Fiona; Mortini, Pietro; Gragnaniello, Cristian

    2015-12-01

    Increasing focus has been placed on the use of simulation in neurosurgical and spinal surgical training worldwide, with the establishment of many surgical laboratories dedicated to such purpose. So far, the opportunities for hands-on cadaveric training in the areas of neurosurgery and spine surgery remain limited in Australia, owing to various factors, including the abolition of dissection in many medical schools, high maintenance requirements and widespread geographical distribution of surgical trainees. We established a cadaver-based neurosurgical laboratory based at the medical school of the University of New England in Armidale, Australia, which is used by the surgical dissection course for junior surgical trainees offered by the university. We reported our experiences in setting up a neurosurgical research laboratory, and explored the feasibility of establishing a cost-effective anatomical research facility in a rural setting in Australia. We found that Genelyn(TM)-fixed cadavers had limited movements of the head as required for adequate surgical positioning and exposure. Furthermore, we discovered that bodies embalmed via the femoral vein had poorly perfused heads after surgical exposure, and thus decapitation had to be performed unfortunately for our purpose. Cadaver samples and surgical equipment were sourced from various veterinary practices and commercial companies. Using human and animal cadavers, this laboratory provided trainees with hands-on opportunities to improve their surgical skills and neuroanatomical knowledge, as well as develop familiarity with highly specialized surgical equipment. We demonstrated the feasibility of establishing a cost-effective neurosurgical research laboratory in Australia and discussed various aspects of its maintenance.

  1. Triangle Universities Nuclear Laboratory. Annual report, 1 September 1981-1 October 1982

    International Nuclear Information System (INIS)

    Seagondollar, L.W.

    1982-01-01

    The varied research programs described reflect a decision by TUNL to devote its major resources to the study of the multiple facets of nuclear structure which can be probed through light ion induced nuclear reactions. Particular emphasis is placed on reactions induced by polarized protons, deuterons, and neutrons. We also continue a major commitment to the study of the statistical properties of nuclear structure revealed by elastic and inelastic scattering experiments using ultra high resolution beams. A third major laboratory commitment involves measurements of fast neutron cross sections required by the Department of Energy's program to produce controlled thermonuclear fusion. The major accelerator facilities of the laboratory include a model FN tandem Van de Graaff accelerator and a 15 MeV fixed energy negative ion cyclotron injector. The laboratory has two additional single ended Van de Graaff accelerators with terminal energies of 4 MV and 3 MV, respectively

  2. The stellar spectroscopy laboratory and curriculum counselling for secondary-school students

    International Nuclear Information System (INIS)

    Cenadelli, D.

    2011-01-01

    The stellar spectroscopy laboratory is the flagship of a wide-ranging work of curriculum counselling fostered by the Physics Department of the Milan University and the high school 'G. Parini' in Milan. In time, valuable results were gained in setting up a new way of collaboration between the high school and university worlds and in spurring secondary-school students to embark in a scientific, and more specifically physical, career. The present work briefly discusses the contents of the laboratory, its didactical value, its role of curriculum counselling and its effectiveness in directing students to take into consideration the physical sciences as a possible university choice.

  3. The Physics Multimedia Laboratory at Arkansas State University

    Science.gov (United States)

    Sustich, Andrew

    1997-11-01

    With the help of an NSF-ILI grant, we have revamped our introductory calculus-based sequence. The course now meets six hours per week entirely in the laboratory without traditional lectures. Multimedia computers together with MBL probes and software provide a hands-on interactive curriculum that actively engages students throughout the class period. An innovative web-based individualized homework service provides for a meaningful homework component to the course and gives students immediate feedback on their solutions. We discuss impementation of this new course and results from its first offering. We will also discuss some of the problems associated with faculty attitudes and plans for conversion of the algebra-based sequence to a similar format.

  4. Laboratory-based educational and outreach activities in the framework of a CAREER award at the University of Oregon

    Science.gov (United States)

    Bindeman, I. N.

    2011-12-01

    The Stable Isotope Laboratory at the University of Oregon has been used as a learning and outreach center in the framework of the 09 award entitled "Stable isotope insights into large-volume volcanic eruptions". The PI and other members of the group have actively recruitted undergraduate students, summer session and catalytic outreach undergraduates, and hosted international students, visitors, and collaborators from Russia, Iceland, France, the UK, Australia, and Switzerland. We also integrated closely with the Oregon-wide summer program that brings community college students to the University of Oregon for 2.5 months summer research residence (UCORE). In total we gave supervised five undergraduate students and three UCORE students. Additionally, we recruited undergraduates from U of Chicago, Colorado and Pomona Colleges to spend summers in the lab and in the field. In conjunction with the NSF funded PIRE program, two female graduate and one female undergraduate students participated in fieldwork in Kamchatka, and three Kamchatka undergraduates, and one Moscow graduate student visited the University Oregon. Students performed their own projects or Senior Theses and reported their results locally and at AGU conferences. We developed a management structure in which graduate students, a postdoc, and lab technician co-supervised students and visitors and this exposed them into the supervisory roles, contributed to the project progress, and liberated PI from micromanagement duties. The talk will present our experience with this management concept of a lab-based-learning initiative, which defines roles for each member of the lab. Our outreach activities included public lectures at community colleges by PI and a graduate student, and the topical Penrose conference co-organized by the PI, which attracted many students and visitors who collected their data in the lab. PI has introduced a voluntary fieldtrip as a part of his Volcanoes and Earthquake large enrollment class

  5. From Cookbook to Collaborative: Transforming a University Biology Laboratory Course

    Science.gov (United States)

    Herron, Sherry S.

    2009-01-01

    As described in "How People Learn," "Developing Biological Literacy," and by the Commission on Undergraduate Education in the Biological Sciences during the 1960s and early 1970s, laboratories should promote guided-inquiries or investigations, and not simply consist of cookbook or verification activities. However, the only word that could describe…

  6. The Role of Computer-Based Educational Laboratories in Nuclear Engineering University Programmes

    International Nuclear Information System (INIS)

    Korolev, S.A.; Kosilov, A.N.; Chernov, E.V.; Vygovskiy, S.B.

    2014-01-01

    The specialized Educational and research laboratory 'Reactor physics, control and safe operation of WWER type NPP’ is based on the computer simulator of WWER -1000 and offers the real-time monitoring of data available to the WWER -1000 NPP control room operators, and provides a possibility to investigate reactor behavior in normal and abnormal situations. The laboratory supports interactive technologies and team-based activities that enable students to build their knowledge through required gateway courses and explore problems relevant to real life situations

  7. Energy Programs at the Johns Hopkins University Applied Physics Laboratory, Quarterly Report, October-December 1980

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-12-01

    The Johns Hopkins University Applied Physics Laboratory is engaged in developing energy resources, utilization concepts, and monitoring and storage methods. This Quarterly Report summarizes the work on the various tasks as of 31 December 1980. The Energy Quarterly Report is divided into five sections. The first, Geothermal Energy Development Planning and Technical Assistance, supported by the Department of Energy/Division of Geothermal Energy (DOE/DGE), contains reports on the progress of geothermal-related tasks on which effort was concentrated during the quarter. The second section, Operational Research, Hydroelectric Power Development, supported by the Department of Energy/Resource Applications (DOE/RA), contains a report on institutional problems for small-scale hydroelectric power development in the southeastern states and a list of documents published by APL in the hydroelectric program and in the geothermal program, above. The third section, Seismotectonic Investigations, contains an article on work on the geologic structure of the Danbury Quadrangle that is supported by the Reactor Safety Research Division of the Nuclear Regulatory Commission (NRC) and an in-house supported study on a new method for assessing earthquakes in intraplate regions. The fourth section, Energy Conversion and Storage Techniques, contains four articles. The first is an evaluation of the Einstein refrigerator, supported by independent IR and D funds. The second concerns fly-wheel technology development at APL supported by the Department of Energy, Division of Energy Storage (DOE/STOR). The third is a report on APL energy conservation efforts at its own buildings, and the fourth is an article on liquefied natural gas (LNG) safety evaluation, supported by the National Academy of Sciences. The fifth section explores the value of establishing an Energy Research Institute at The Johns Hopkins University.

  8. Teaching and Research with Accelerators at Tarleton State University

    International Nuclear Information System (INIS)

    Marble, Daniel K.

    2009-01-01

    Tarleton State University students began performing both research and laboratory experiments using accelerators in 1998 through visitation programs at the University of North Texas, US Army Research Laboratory, and the Naval Surface Warfare Center at Carderock. In 2003, Tarleton outfitted its new science building with a 1 MV pelletron that was donated by the California Institution of Technology. The accelerator has been upgraded and supports a wide range of classes for both the Physics program and the ABET accredited Engineering Physics program as well as supplying undergraduate research opportunities on campus. A discussion of various laboratory activities and research projects performed by Tarleton students will be presented.

  9. TIT reactor laboratory course using JAERI and PNC large experimental facilities

    International Nuclear Information System (INIS)

    Sekimoto, Hiroshi; Obara, Toru; Ohtani, Nobuo.

    1995-01-01

    This report is presented on a reactor laboratory course for graduate students using large facilities in national laboratories in Japan. A reactor laboratory course is offered every summer since 1990 for all graduate students in the Nuclear Engineering Course in Tokyo Institute of Technology (TIT), where the students can choose one of the experiments prepared at Japan Atomic Energy Research Institute (JAERI), Power Reactor and Nuclear Fuel Development Corporation (PNC) and Research Reactor Institute, Kyoto University (KUR). Both JAERI and PNC belong to Science and Technology Agency (STA). This is the first university curriculum of nuclear engineering using the facilities owned by the STA laboratories. This type of collaboration is promoted in the new Long-Term Program for Research, Development and Utilization of Nuclear Energy adopted by Atomic Energy Commission. Most students taking this course reported that they could learn so much about reactor physics and engineering in this course and the experiment done in large laboratory was a very good experience for them. (author)

  10. Particle physics laboratory turns 50

    CERN Multimedia

    Berdik, Chris

    2004-01-01

    For a half-century, physicists from all over the world have sought out the most fundamental structures of the universe from deep beneath the mountains of Switzerland. On Saturday, the laboratory in which they did their work, CERN, capped off a year of celebrations for its 50th annviersary (½ page)

  11. A General Chemistry Laboratory Course Designed for Student Discussion

    Science.gov (United States)

    Obenland, Carrie A.; Kincaid, Kristi; Hutchinson, John S.

    2014-01-01

    We report a study of the general chemistry laboratory course at one university over four years. We found that when taught as a traditional laboratory course, lab experiences do not encourage students to deepen their understanding of chemical concepts. Although the lab instructor emphasized that the lab experiences were designed to enhance…

  12. Laboratory Directed Research and Development FY 2000

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, Todd; Levy, Karin

    2001-02-27

    The Ernest Orlando Lawrence Berkeley National Laboratory (Berkeley Lab or LBNL) is a multi-program national research facility operated by the University of California for the Department of Energy (DOE). As an integral element of DOE's National Laboratory System, Berkeley Lab supports DOE's missions in fundamental science, energy resources, and environmental quality. Berkeley Lab programs advance four distinct goals for DOE and the nation: (1) To perform leading multidisciplinary research in the computing sciences, physical sciences, energy sciences, biosciences, and general sciences in a manner that ensures employee and public safety and protection of the environment. (2) To develop and operate unique national experimental facilities for qualified investigators. (3) To educate and train future generations of scientists and engineers to promote national science and education goals. (4) To transfer knowledge and technological innovations and to foster productive relationships among Berkeley Lab's research programs, universities, and industry in order to promote national economic competitiveness. Annual report on Laboratory Directed Research and Development for FY2000.

  13. Let´s go the University Laboratory: a successful collaborative experience

    OpenAIRE

    Vázquez Ferri, Carmen; Pérez Rodríguez, Jorge; Espinosa Tomás, Julián; Hernández Poveda, Consuelo; Mas Candela, David; Miret Marí, Juan José

    2013-01-01

    In order to encourage high school students to be interested in Physics and Optics, the Technological and Educational Innovation group “Teaching in Optics and Vision Sciences” (DOCIVIS) has been working closely with numerous secondary schools within the territory covered by the University of Alicante (UA) for four years. The collaboration is framed within the UA’s Research Networks, that are directed to preparation sections to entrance University. The main objective is to promote the coordinat...

  14. Application of Lean-Six Sigma Approach in a Laboratory Experimental Case Study

    Directory of Open Access Journals (Sweden)

    Hashim Raza Rizvi

    2013-12-01

    Full Text Available Laboratory experiments are a conventional activity performed at academic institutions, government and private organizations. These experimental studies provide the basis for new inventions in the field of science and engineering. Laboratory experiments are conducted on the basis of provided guidelines, already established by different standard organizations like ASTM, AASHTO etc. This article is based on a case study in which the process of an experiment is examined on the basis of Value Stream Maps (VSM and potential improvement possibilities have been identified. After determining the potential waste, appropriate Lean tools are selected to implement and observe the improvements. The process is examined after application of the Lean tools and a comparison is performed. University laboratory environment can be improved considerably by applying Lean Tools. MUDA application reduced the total work time from 90.75 hours and 10-CD to 63.75 hours and 7-CD hence saving, 27 hours and 3-CD for one experiment. This is remarkable achievement of this application. Heijunka application provided the students equal workload and they performed explicitly better than they used to. 5-S tool provided the students the opportunity to manage the laboratory in an effective and clean way. Safety of the students is a very major concern at university laboratory environment. 5-S not only upgraded the laboratory overall performance, but it significantly raised the safety standards of the laboratory. More application of the Lean Tools should be exercised explored to have more effective and efficient university laboratory experimental environment.

  15. [The experimental surgery and your relation with the university: an experience report].

    Science.gov (United States)

    Yamaki, Vitor Nagai; Teixeira, Renan Kleber Costa; Feijo, Daniel Haber; Silva, José Antonio Cordero da; Botelho, Nara Macedo; Henriques, Marcus Vinicius

    2014-01-01

    The laboratory of experimental surgery represents one of the key points for the university, especially in the biomedical area. This focuses on the university's tripod of primary structure that are teaching, research and extension, which are essential for formation of humanistic and practice of a good doctor that is based, first of all, on scientific evidence and critical knowledge. The importance of a laboratory of experimental surgery centers for medical education was regulated from the new curriculum guidelines of the Ministério da Educação e Cultura, establishing a mandatory laboratory within college centers. Therefore, it is of great importance to the contribution of the laboratories of experimental surgery in the curriculum, both in the discipline of surgical technics and experimental surgery, and an incentive for basic research. Thus, the study presents the experience of 15 years of the Laboratory of Experimental Surgery from Universidade do Estado do Pará, with the goal show the importance of this to medical graduation and the university.

  16. Planning an Automatic Fire Detection, Alarm, and Extinguishing System for Research Laboratories

    Directory of Open Access Journals (Sweden)

    Rostam Golmohamadi

    2014-04-01

    Full Text Available Background & Objectives: Educational and research laboratories in universities have a high risk of fire, because they have a variety of materials and equipment. The aim of this study was to provide a technical plan for safety improvement in educational and research laboratories of a university based on the design of automatic detection, alarm, and extinguishing systems . Methods : In this study, fire risk assessment was performed based on the standard of Military Risk Assessment method (MIL-STD-882. For all laboratories, detection and fire alarm systems and optimal fixed fire extinguishing systems were designed. Results : Maximum and minimum risks of fire were in chemical water and wastewater (81.2% and physical agents (62.5% laboratories, respectively. For studied laboratories, we designed fire detection systems based on heat and smoke detectors. Also in these places, fire-extinguishing systems based on CO2 were designed . Conclusion : Due to high risk of fire in studied laboratories, the best control method for fire prevention and protection based on special features of these laboratories is using automatic detection, warning and fire extinguishing systems using CO2 .

  17. Sequence Classification: 288227 [

    Lifescience Database Archive (English)

    Full Text Available rone, transcription antiterminator, affects expression of rpoS and uspA || http://www.ncbi.nlm.nih.gov/protein/16128606 ... ...Non-TMB Non-TMH Non-TMB TMB Non-TMB Non-TMB >gi|16128606|ref|NP_415156.1| RNA chape

  18. [Standardization in laboratory hematology by participating in external quality assurance programs].

    Science.gov (United States)

    Nazor, Aida; Siftar, Zoran; Flegar-Mestrić, Zlata

    2011-09-01

    Since 1985, Department of Clinical Chemistry and Laboratory Medicine, Merkur University Hospital, Zagreb, has been participating in the International External Quality Assessment Scheme for Hematology (IEQAS-H) organized by the World Health Organization (WHO). Owing to very good results, in 1987 the Department received a certificate of participation in this control scheme. Department has been cooperating in the external quality assessment program in laboratory hematology which has been continuously performed in Croatia since 1986 by the Committee for External Quality Assessment Schemes under the auspices of the Croatian Society of Medical Biochemists and School of Pharmacy and Biochemistry, University of Zagreb. Nowadays, 186 medical biochemical laboratories are included in the National External Quality Assessment program, which is performed three times per year. Our Department has participated in the international projects of the European Committee for External Quality Assurance Programs in Laboratory Medicine (EQALM).

  19. Co-Laboratories: New Arenas for Scientific Work

    Directory of Open Access Journals (Sweden)

    Mauricio Arroyave Franco

    2011-09-01

    Full Text Available The laboratories like experimental sites are an important tool in education and research, since they allow understanding better the concepts, as well as construct new knowledge. However, there are disadvantages associated with laboratories: the cost of infrastructure, insufficient availability of equipment and the associate risk with the experimentation in harmful environments for human beings. It is considered that these disadvantages can be mitigated with the use of TICs. This paper presents the development of a web platform for remote access to laboratory resources, it is was developed in the Moodle system, and considers laboratories with diverse characteristics. Access to the devices of each laboratory was developed in different web technologies that were later integrated into the platform. The end result was a platform that meets the needs of access to laboratory facilities independent of web technology used and the own characteristics of each laboratory. The results of this study are expected to be are the basis for more flexible and extensive access to resources EAFIT University laboratory and in the future of Colombia.

  20. Challenges in small screening laboratories: implementing an on-demand laboratory information management system.

    Science.gov (United States)

    Lemmon, Vance P; Jia, Yuanyuan; Shi, Yan; Holbrook, S Douglas; Bixby, John L; Buchser, William

    2011-11-01

    The Miami Project to Cure Paralysis, part of the University of Miami Miller School of Medicine, includes a laboratory devoted to High Content Analysis (HCA) of neurons. The goal of the laboratory is to uncover signaling pathways, genes, compounds, or drugs that can be used to promote nerve growth. HCA permits the quantification of neuronal morphology, including the lengths and numbers of axons. HCA of various libraries on primary neurons requires a team-based approach, a variety of process steps and complex manipulations of cells and libraries to obtain meaningful results. HCA itself produces vast amounts of information including images, well-based data and cell-based phenotypic measures. Documenting and integrating the experimental workflows, library data and extensive experimental results is challenging. For academic laboratories generating large data sets from experiments involving thousands of perturbagens, a Laboratory Information Management System (LIMS) is the data tracking solution of choice. With both productivity and efficiency as driving rationales, the Miami Project has equipped its HCA laboratory with an On Demand or Software As A Service (SaaS) LIMS to ensure the quality of its experiments and workflows. The article discusses how the system was selected and integrated into the laboratory. The advantages of a SaaS based LIMS over a client-server based system are described. © 2011 Bentham Science Publishers

  1. HIV/AIDS Knowledge, Attitude and Practice among Dilla University ...

    African Journals Online (AJOL)

    USER

    Dilla University, Institute of Education and Behavioral Sciences, Department of Psychology P.O.BOX:419; Dilla. University ...... Journal of Laboratory Medicine and Research 2015;. 1(104):1-5. ... International Journal of Scientific Research and.

  2. Preservation of enucleated porcine eyes for use in a wet laboratory

    NARCIS (Netherlands)

    Nibourg, Lisanne M.; Koopmans, Steven A.

    PURPOSE: To design a method to preserve enucleated porcine eyes for use in a wet laboratory. SETTING: Laboratory of Experimental Ophthalmology, University Medical Center Groningen, the Netherlands. DESIGN: Experimental study. METHODS: Porcine eyes were preserved using 15 methods including salt

  3. High Temperature Materials Laboratory fourth annual report, October 1990--September 1991

    Energy Technology Data Exchange (ETDEWEB)

    Tennery, V.J.; Foust, F.M.

    1991-12-01

    The High Temperature Materials Laboratory has completed its fourth year of operation as a designated Department of Energy User Facility at the Oak Ridge National Laboratory. Growth of the user program is evidenced by the number of outside institutions who have executed user agreements since the facility began operation in 1987. A total of 118 nonproprietary agreements (62 university and 56 industry) and 28 proprietary agreements (2 university, 26 industry) are now in effect. Five other government facilities have also participated in the user program. Sixty-free nonproprietary research proposals (38 from university, 26 from industry, and 1 other government facility) and four proprietary proposals were considered during this reporting period. Research projects active in FY 1991 are summarized.

  4. The irradiation as alternative treatment for laboratory wastes

    International Nuclear Information System (INIS)

    Borrely, Sueli Ivone; Romanelli, Maria Fernanda; Silva, Giovana Pasqualini da; Castro, Daniela Marques

    2005-01-01

    The irradiation of effluents may be done by electron accelerator or gamma radiation source (cobalt-60). This technology has been developed as an alternative for several contaminants from different processes and sources. This paper shows the results of electron beam applied to liquid laboratories residues (effluents and standard solutions). Radiation doses were determined for the improvement of laboratories residues measured by detoxification of them. New technologies for residues treatment as well as decreasing contaminants generation is essential part of laboratories activities for environmental management for industry, universities and research institutions. (author)

  5. Cost-effective utilisation of basic biochemical laboratory ...

    African Journals Online (AJOL)

    ... of Chemical Pathology, University of KwaZulu-Natal/National Health Laboratory Service (NHLS) ... the basic principles that govern the selection ... issues of quality control and the audit trail of quality assurance in the maintenance of the.

  6. An Undergraduate Nanotechnology Engineering Laboratory Course on Atomic Force Microscopy

    Science.gov (United States)

    Russo, D.; Fagan, R. D.; Hesjedal, T.

    2011-01-01

    The University of Waterloo, Waterloo, ON, Canada, is home to North America's first undergraduate program in nanotechnology. As part of the Nanotechnology Engineering degree program, a scanning probe microscopy (SPM)-based laboratory has been developed for students in their fourth year. The one-term laboratory course "Nanoprobing and…

  7. Laboratory report on RF superconductivity at Peking University

    International Nuclear Information System (INIS)

    Kui, Zhao; Baocheng, Zhang; Lifang, Wang; Jin, Yu; Rongli, Geng; Genfa, Wu; Tong, Wang; Jinhu, Song; Chia-erh, Chen

    1996-01-01

    The activities on RF superconductivity at Peking University in the past two years are reported. Two 1.5 GHz Nb cavities were successfully fabricated using Chinese Nb sheets in 1994. One of the cavities has been measured, and the results are given. A laser driven DC electron gun has been designed and constructed which is the pre-testing device of photo-electron gun using superconducting cavity. A series of experiments on the cathode and cavity will be performed in the near future. Two superconducting accelerating devices are being considered for two projects in China. (R.P.)

  8. The Mars Simulation Laboratory, University of Aarhus

    Science.gov (United States)

    Merrison, J. P.; Field, D.; Finster, K.; Lomstein, B. Aa.; Nørnberg, P.; Ramsing, N. B.; Uggerhøj, E.

    2001-08-01

    Present day Mars presents an extremely hostile environment to organic material. The average temperature is low (-50C), the atmospheric pressure is also low (7mbar) and there is little water over most of the planet. Chemically the surface is extremely oxidising and no signs of organic material have been detected. There is also a strong component of ultra violet radiation in the Martian sun light, lethal to most organisms. At Aarhus University we have constructed a Mars simulation environment which reproduces the physical, chemical and mineralogical conditions on Mars. It is hoped to set limits on where organic matter (or even life) might exist on Mars, for example at some depth under the surface, beneath the polar ice or within rocks. It is also possible to adjust the conditions in the simulation to investigate the most extreme environments in which organisms can be preserved or still function.

  9. Radiation chemistry at the Metallurgical Laboratory, Manhattan Project, University of Chicago (1942-1947) and the Argonne National Laboratory, Argonne, IL (1947-1984)

    International Nuclear Information System (INIS)

    Gordon, S.

    1989-01-01

    The events in radiation chemistry which occurred in the Manhattan Project Laboratory and Argonne National Laboratory during World War II are reviewed. Research programmes from then until the present day are presented, with emphasis on pulse radiolysis studies. (UK)

  10. A University forum on low-level waste

    International Nuclear Information System (INIS)

    Ring, J.; Lorenzen, W.; Osborne, F.; Shapiro, J.

    1995-01-01

    This article describes the Biomedical Radioactive Waste Management Program at Harvard University. Included is an overview of the program and specific discussions of education of laboratory technicians; specific waste processing methods; laboratory decay-in-storage; packaging by researcher; processing in the local waste room; transfer from local disposal to on-site management facility; program results

  11. Validation of a laboratory and hospital information system in a medical laboratory accredited according to ISO 15189.

    Science.gov (United States)

    Biljak, Vanja Radisic; Ozvald, Ivan; Radeljak, Andrea; Majdenic, Kresimir; Lasic, Branka; Siftar, Zoran; Lovrencic, Marijana Vucic; Flegar-Mestric, Zlata

    2012-01-01

    The aim of the study was to present a protocol for laboratory information system (LIS) and hospital information system (HIS) validation at the Institute of Clinical Chemistry and Laboratory Medicine of the Merkur University Hospital, Zagreb, Croatia. Validity of data traceability was checked by entering all test requests for virtual patient into HIS/LIS and printing corresponding barcoded labels that provided laboratory analyzers with the information on requested tests. The original printouts of the test results from laboratory analyzer(s) were compared with the data obtained from LIS and entered into the provided template. Transfer of data from LIS to HIS was examined by requesting all tests in HIS and creating real data in a finding generated in LIS. Data obtained from LIS and HIS were entered into a corresponding template. The main outcome measure was the accuracy of transfer obtained from laboratory analyzers and results transferred from LIS and HIS expressed as percentage (%). The accuracy of data transfer from laboratory analyzers to LIS was 99.5% and of that from LIS to HIS 100%. We presented our established validation protocol for laboratory information system and demonstrated that a system meets its intended purpose.

  12. Federal laboratories for the 21st century

    Energy Technology Data Exchange (ETDEWEB)

    Gover, J. [Sandia National Labs., Albuquerque, NM (United States); Huray, P.G. [Univ. of South Carolina, Columbia, SC (United States)

    1998-04-01

    Federal laboratories have successfully filled many roles for the public; however, as the 21st Century nears it is time to rethink and reevaluate how Federal laboratories can better support the public and identify new roles for this class of publicly-owned institutions. The productivity of the Federal laboratory system can be increased by making use of public outcome metrics, by benchmarking laboratories, by deploying innovative new governance models, by partnerships of Federal laboratories with universities and companies, and by accelerating the transition of federal laboratories and the agencies that own them into learning organizations. The authors must learn how government-owned laboratories in other countries serve their public. Taiwan`s government laboratory, Industrial Technology Research Institute, has been particularly successful in promoting economic growth. It is time to stop operating Federal laboratories as monopoly institutions; therefore, competition between Federal laboratories must be promoted. Additionally, Federal laboratories capable of addressing emerging 21st century public problems must be identified and given the challenge of serving the public in innovative new ways. Increased investment in case studies of particular programs at Federal laboratories and research on the public utility of a system of Federal laboratories could lead to increased productivity of laboratories. Elimination of risk-averse Federal laboratory and agency bureaucracies would also have dramatic impact on the productivity of the Federal laboratory system. Appropriately used, the US Federal laboratory system offers the US an innovative advantage over other nations.

  13. New Dimensions in Teaching Digital Electronics: A Multimode Laboratory Utilizing NI ELVIS IITM, LabVIEW and NI Multisim

    Directory of Open Access Journals (Sweden)

    Andrew Katumba

    2010-11-01

    Full Text Available Over the years, conventional Laboratories in African Universities have been hampered by inadequate resources in terms of the required hardware, space and skilled personnel to administer them. This paper describes a multi-dimensional approach to experimentation, developed by the Makerere University iLabs Project Team, hereafter referred to as iLABS@MAK. The two dimensional approach involves both Virtual Labs and Online Laboratories designed to address laboratory deficiencies in Digital Electronics, encompassing five courses in the curricula of the Bachelor of Science (B.Sc in Computer, Electrical and Telecommunication Engineering Programs. A digital Online Laboratory, the Makerere University Digital iLab (MDEi supporting experiments in the fields of combinational logic circuits and asynchronous sequential logic circuits has been developed. The laboratory utilizes the National Instruments Educational Laboratory Virtual Instrumentation Suite (NI ELVIS II™ platform, the Laboratory Virtual Instrument Engineering Workbench (LabVIEW graphical programming environment and NI Multisim. Typical experiment setups supported by the MDEi are presented

  14. Draft Strategic Laboratory Missions Plan. Volume II

    International Nuclear Information System (INIS)

    1996-03-01

    This volume described in detail the Department's research and technology development activities and their funding at the Department's laboratories. It includes 166 Mission Activity Profiles, organized by major mission area, with each representing a discrete budget function called a Budget and Reporting (B ampersand R) Code. The activities profiled here encompass the total research and technology development funding of the laboratories from the Department. Each profile includes a description of the activity and shows how the funding for that activity is distributed among the DOE laboratories as well as universities and industry. The profiles also indicate the principal laboratories for each activity, as well as which other laboratories are involved. The information in this volume is at the core of the Strategic Laboratory Mission Plan. It enables a reader to follow funds from the Department's appropriation to a specific activity description and to specific R ampersand D performing institutions. This information will enable the Department, along with the Laboratory Operations Board and Congress, to review the distribution of R ampersand D performers chosen to execute the Department's missions

  15. Draft Strategic Laboratory Missions Plan. Volume II

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-03-01

    This volume described in detail the Department`s research and technology development activities and their funding at the Department`s laboratories. It includes 166 Mission Activity Profiles, organized by major mission area, with each representing a discrete budget function called a Budget and Reporting (B & R) Code. The activities profiled here encompass the total research and technology development funding of the laboratories from the Department. Each profile includes a description of the activity and shows how the funding for that activity is distributed among the DOE laboratories as well as universities and industry. The profiles also indicate the principal laboratories for each activity, as well as which other laboratories are involved. The information in this volume is at the core of the Strategic Laboratory Mission Plan. It enables a reader to follow funds from the Department`s appropriation to a specific activity description and to specific R & D performing institutions. This information will enable the Department, along with the Laboratory Operations Board and Congress, to review the distribution of R & D performers chosen to execute the Department`s missions.

  16. Measuring meaningful learning in the undergraduate chemistry laboratory

    Science.gov (United States)

    Galloway, Kelli R.

    The undergraduate chemistry laboratory has been an essential component in chemistry education for over a century. The literature includes reports on investigations of singular aspects laboratory learning and attempts to measure the efficacy of reformed laboratory curriculum as well as faculty goals for laboratory learning which found common goals among instructors for students to learn laboratory skills, techniques, experimental design, and to develop critical thinking skills. These findings are important for improving teaching and learning in the undergraduate chemistry laboratory, but research is needed to connect the faculty goals to student perceptions. This study was designed to explore students' ideas about learning in the undergraduate chemistry laboratory. Novak's Theory of Meaningful Learning was used as a guide for the data collection and analysis choices for this research. Novak's theory states that in order for meaningful learning to occur the cognitive, affective, and psychomotor domains must be integrated. The psychomotor domain is inherent in the chemistry laboratory, but the extent to which the cognitive and affective domains are integrated is unknown. For meaningful learning to occur in the laboratory, students must actively integrate both the cognitive domain and the affective domains into the "doing" of their laboratory work. The Meaningful Learning in the Laboratory Instrument (MLLI) was designed to measure students' cognitive and affective expectations and experiences within the context of conducting experiments in the undergraduate chemistry laboratory. Evidence for the validity and reliability of the data generated by the MLLI were collected from multiple quantitative studies: a one semester study at one university, a one semester study at 15 colleges and universities across the United States, and a longitudinal study where the MLLI was administered 6 times during two years of general and organic chemistry laboratory courses. Results from

  17. Accelerator-based techniques for the support of senior-level undergraduate physics laboratories

    International Nuclear Information System (INIS)

    Williams, J.R.; Clark, J.C.; Isaacs-Smith, T.

    2001-01-01

    Approximately three years ago, Auburn University replaced its aging Dynamitron accelerator with a new 2MV tandem machine (Pelletron) manufactured by the National Electrostatics Corporation (NEC). This new machine is maintained and operated for the University by Physics Department personnel, and the accelerator supports a wide variety of materials modification/analysis studies. Computer software is available that allows the NEC Pelletron to be operated from a remote location, and an Internet link has been established between the Accelerator Laboratory and the Upper-Level Undergraduate Teaching Laboratory in the Physics Department. Additional software supplied by Canberra Industries has also been used to create a second Internet link that allows live-time data acquisition in the Teaching Laboratory. Our senior-level undergraduates and first-year graduate students perform a number of experiments related to radiation detection and measurement as well as several standard accelerator-based experiments that have been added recently. These laboratory exercises will be described, and the procedures used to establish the Internet links between our Teaching Laboratory and the Accelerator Laboratory will be discussed

  18. Knowledge, attitude, and practice (KAP) of 'teaching laboratory' technicians towards laboratory safety and waste management: a pilot interventional study.

    Science.gov (United States)

    El-Gilany, A-H; El-Shaer, S; Khashaba, E; El-Dakroory, S A; Omar, N

    2017-06-01

    A quasi-experimental study was performed on 20 technicians working in the Faculty of Medicine, Mansoura University, Egypt. The knowledge, attitude, and practice (KAP) of laboratory technicians was measured before and two months after enrolling them in an intervention programme about laboratory best practice procedures. The programme addressed laboratory safety and medical waste management. The assessment was performed using a validated Arabic self-administered questionnaire. Pre- and post-intervention scores were compared using non-parametric tests. There are significant increases in the scores of KAP after implementation of the training programme. Copyright © 2017 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.

  19. Multiple-use plasma laboratory for graduate fusion education

    International Nuclear Information System (INIS)

    Hankins, O.E.; Gilligan, J.G.; Wehring, B.W.; Bourham, M.; Auciello, O.H.

    1989-01-01

    In a climate of tight fusion research and teaching laboratory budgets, it has become necessary to utilize equipment obtained for research purposes in the teaching program. Likewise, it is desirable to use plasma research equipment from nonfusion projects to support basic understanding of general plasma concepts. Multiple experiments can also be done on a single device. The plasma laboratory that has been developed at North Carolina State University in the last 4 yr incorporates all of the aforementioned ideas to support a 3-credit-hour hands-on laboratory course for graduate students. Incorporating teaching and research into the fusion plasma laboratory maximizes the resources and gives students experience on actual research tools. 2 refs

  20. Assessing and Analyzing Behavior Strategies of Instructors in College Science Laboratories.

    Science.gov (United States)

    Kyle, William C., Jr.; And Others

    1980-01-01

    Analyzed are university instructor behaviors in introductory and advanced level laboratories of botany, chemistry, geology, physics and zoology. Science Laboratory Interaction Categories--Teacher (SLIC) was used to assess 15 individual categories of teacher behaviors in the areas of questioning, giving directions, transmitting information,…

  1. Oak Ridge National Laboratory Review: Volume 24, No. 2, 1991

    Energy Technology Data Exchange (ETDEWEB)

    Krause, C. (ed.)

    1991-01-01

    The Oak Ridge National Laboratory (ORNL) is a multiprogram, multipurpose laboratory that conducts research in the physical, chemical, and life sciences; in fusion, fission, and fossil energy; and in energy conservation and other energy-related technologies. This review outlines some current endeavors of the lab. A state of the laboratory presentation is given by director, Alvin Trivelpiece. Research of single crystals for welding is described. The Science Alliance, a partnership between ORNL and the University of Tennessee, is chronicled. And several incites into distinguished personnel at the laboratory are given. (GHH)

  2. Oak Ridge National Laboratory Review: Volume 24, No. 2, 1991

    Energy Technology Data Exchange (ETDEWEB)

    Krause, C. [ed.

    1991-12-31

    The Oak Ridge National Laboratory (ORNL) is a multiprogram, multipurpose laboratory that conducts research in the physical, chemical, and life sciences; in fusion, fission, and fossil energy; and in energy conservation and other energy-related technologies. This review outlines some current endeavors of the lab. A state of the laboratory presentation is given by director, Alvin Trivelpiece. Research of single crystals for welding is described. The Science Alliance, a partnership between ORNL and the University of Tennessee, is chronicled. And several incites into distinguished personnel at the laboratory are given. (GHH)

  3. Smart Grid Integration Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Troxell, Wade [Colorado State Univ., Fort Collins, CO (United States)

    2011-12-22

    The initial federal funding for the Colorado State University Smart Grid Integration Laboratory is through a Congressionally Directed Project (CDP), DE-OE0000070 Smart Grid Integration Laboratory. The original program requested in three one-year increments for staff acquisition, curriculum development, and instrumentation all which will benefit the Laboratory. This report focuses on the initial phase of staff acquisition which was directed and administered by DOE NETL/ West Virginia under Project Officer Tom George. Using this CDP funding, we have developed the leadership and intellectual capacity for the SGIC. This was accomplished by investing (hiring) a core team of Smart Grid Systems engineering faculty focused on education, research, and innovation of a secure and smart grid infrastructure. The Smart Grid Integration Laboratory will be housed with the separately funded Integrid Laboratory as part of CSU's overall Smart Grid Integration Center (SGIC). The period of performance of this grant was 10/1/2009 to 9/30/2011 which included one no cost extension due to time delays in faculty hiring. The Smart Grid Integration Laboratory's focus is to build foundations to help graduate and undergraduates acquire systems engineering knowledge; conduct innovative research; and team externally with grid smart organizations. Using the results of the separately funded Smart Grid Workforce Education Workshop (May 2009) sponsored by the City of Fort Collins, Northern Colorado Clean Energy Cluster, Colorado State University Continuing Education, Spirae, and Siemens has been used to guide the hiring of faculty, program curriculum and education plan. This project develops faculty leaders with the intellectual capacity to inspire its students to become leaders that substantially contribute to the development and maintenance of Smart Grid infrastructure through topics such as: (1) Distributed energy systems modeling and control; (2) Energy and power conversion; (3

  4. Multimodal imaging of lymph nodes and tumors using glycol-chitosan-coated gold nanoparticles (Conference Presentation)

    Science.gov (United States)

    Sun, In-Cheol; Dumani, Diego S.; Emelianov, Stanislav Y.

    2017-03-01

    A key step in staging cancer is the diagnosis of metastasis that spreads through lymphatic system. For this reason, researchers develop various methods of sentinel lymph node mapping that often use a radioactive tracer. This study introduces a safe, cost-effective, high-resolution, high-sensitivity, and real-time method of visualizing the sentinel lymph node: ultrasound-guided photoacoustic (US/PA) imaging augmented by a contrast agent. In this work, we use clearable gold nanoparticles covered by a biocompatible polymer (glycol chitosan) to enhance cellular uptake by macrophages abundant in lymph nodes. We incubate macrophages with glycol-chitosan-coated gold nanoparticles (0.05 mg Au/ml), and then fix them with paraformaldehyde solution for an analysis of in vitro dark-field microscopy and cell phantom. The analysis shows enhanced cellular uptake of nanoparticles by macrophages and strong photoacoustic signal from labeled cells in tissue-mimicking cell phantoms consisting gelatin solution (6 %) with silica gel (25 μm, 0.3%) and fixed macrophages. The in-vivo US/PA imaging of cervical lymph nodes in healthy mice (nu/nu, female, 5 weeks) indicates a strong photoacoustic signal from a lymph node 10 minutes post-injection (2.5 mg Au/ml, 80 μl). The signal intensity and the nanoparticle-labeled volume of tissue within the lymph node continues to increase until 4 h post-injection. Histological analysis further confirms the accumulation of gold nanoparticles within the lymph nodes. This work suggests the feasibility of molecular/cellular US/PA imaging with biocompatible gold nanoparticles as a photoacoustic contrast agent in the diagnosis of lymph-node-related diseases.

  5. High Temperature Materials Laboratory sixth annual report, October 1992--September 1993

    Energy Technology Data Exchange (ETDEWEB)

    Tennery, V.J.; Foust, F.M.

    1993-12-01

    The High Temperature Materials Laboratory has completed its sixth year of operation as a designated Department of Energy User Facility at the Oak Ridge National Laboratory. Growth of the User Program is evidenced by the number of outside institutions executing user agreements since the facility began operation in 1987. A total of 172 nonproprietary agreements (88 university and 84 industry) and 35 proprietary agreements, (2 university, 33 industry) are now in effect. Six other government facilities have also participated in the User Program. Thirty-eight states are represented by these interactions. Ninety-four nonproprietary research proposals (44 from universities, 47 from industry, and 3 from other government facilities) and three proprietary proposals were considered during this reporting period. Nonproprietary research projects active in FY 1993 are summarized.

  6. Summer school in nuclear and radiochemistry at Brookhaven National Laboratory

    International Nuclear Information System (INIS)

    Kolsky, K.L.

    2005-01-01

    The U.S. Department of Energy supports 24 fellowships for students to attend six-week programs at either San Jose State University in California, or Brookhaven National Laboratory (BNL) in New York. The American Chemical Society through the Division of Nuclear Science and Technology operates both schools. The twelve students at the BNL program are enrolled in the State University of New York at Stony Brook (SUNYSB) and receive 3 college credits for the lecture course (CHE-361) and 3 additional credits for the laboratory course (CHE-362). In addition to lectures and laboratories, students tour various nuclear facilities offsite, at BNL, and at SUNYSB. Opportunities are given the students to interact with faculty and scientists within the profession through the Guest Lecture Program. Further details are discussed along with results of student surveys for the years 1999 through 2002. (author)

  7. How to analyse a Big Bang of data: the mammoth project at the Cern physics laboratory in Geneva to recreate the conditions immediately after the universe began requires computing power on an unprecedented scale

    CERN Multimedia

    Thomas, Kim

    2005-01-01

    How to analyse a Big Bang of data: the mammoth project at the Cern physics laboratory in Geneva to recreate the conditions immediately after the universe began requires computing power on an unprecedented scale

  8. Plasma universe

    International Nuclear Information System (INIS)

    Alfven, H.

    1986-04-01

    Traditionally the views in our cosmic environment have been based on observations in the visual octave of the electromagnetic spectrum, during the last half-century supplemented by infrared and radio observations. Space research has opened the full spectrum. Of special importance are the X-ray-gamma-ray regions, in which a number of unexpected phenomena have been discovered. Radiations in these regions are likely to originate mainly from magnetised cosmic plasma. Such a medium may also emit synchrotron radiation which is observable in the radio region. If we try to base a model of the universe on the plasma phenomena mentioned we find that the plasma universe is drastically different from the traditional visual universe. Information about the plasma universe can also be obtained by extrapolation of laboratory experiments and magnetospheric in situ measurements of plasma. This approach is possible because it is likely that the basic properties of plasma are the same everywhere. In order to test the usefulness of the plasma universe model we apply it to cosmogony. Such an approach seems to be rather successful. For example, the complicated structure of the Saturnian C ring can be accounted for. It is possible to reconstruct certain phenomena 4-5 bilions years ago with an accuracy of better than 1 percent

  9. Semiconductor laser joint study program with Rome Laboratory

    Science.gov (United States)

    Schaff, William J.; Okeefe, Sean S.; Eastman, Lester F.

    1994-09-01

    A program to jointly study vertical-cavity surface emitting lasers (VCSEL) for high speed vertical optical interconnects (VOI) has been conducted under an ES&E between Rome Laboratory and Cornell University. Lasers were designed, grown, and fabricated at Cornell University. A VCSEL measurement laboratory has been designed, built, and utilized at Rome Laboratory. High quality VCSEL material was grown and characterized by fabricating conventional lateral cavity lasers that emitted at the design wavelength of 1.04 microns. The VCSEL's emit at 1.06 microns. Threshold currents of 16 mA at 4.8 volts were obtained for 30 microns diameter devices. Output powers of 5 mW were measured. This is 500 times higher power than from the light emitting diodes employed previously for vertical optical interconnects. A new form of compositional grading using a cosinusoidal function has been developed and is very successful for reducing diode series resistance for high speed interconnection applications. A flip-chip diamond package compatible with high speed operation of 16 VCSEL elements has been designed and characterized. A flip-chip device binding effort at Rome Laboratory was also designed and initiated. This report presents details of the one-year effort, including process recipes and results.

  10. Energy Programs at the Johns Hopkins University Applied Physics Laboratory, Quarterly Report, July-September 1980

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-09-01

    The Johns Hopkins University Applied Physics Laboratory, under contracts with several agencies of the federal government, is engaged in developing energy resources, utilization concepts, and monitoring and storage methods. This Quarterly Report summarizes the work on the various tasks as of 31 September 1980. The Energy Quarterly Report is divided into four sections. The first, Geothermal Energy Development Planning and Technical Assistance, supported by the Department of Energy/Division of Geothermal Energy (DOE/DGE), contains reports on the progress of geothermal-related tasks on which effort was concentrated during the quarter. The second section, Operational Research, Hydroelectric Power Development, supported by the Department of Energy/Resource Applications (DOE/RA), contains reports on small-scale hydroelectric investigations in the southeastern states. The third section, Seismotectonic Investigations, supported by the Reactor Safety Research Division of the Nuclear Regulatory Commission (NRC), reports on neotectonic investigations of the Manhattan Prong. The fourth section, Energy Conversion and Storage Techniques, contains three articles. The first is an evaluation of the Einstein refrigerator, supported by independent IR&D funds. The second concerns OTEC pilot plant performance calculations, supported by the Department of Energy/Division of Central Solar Technology (DOE/CST). The third, describing a study of landfill methane recovery, is supported by the National Park Service.

  11. Laboratory directed research and development program FY 1999

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, Todd; Levy, Karin

    2000-03-08

    The Ernest Orlando Lawrence Berkeley National Laboratory (Berkeley Lab or LBNL) is a multi-program national research facility operated by the University of California for the Department of Energy (DOE). As an integral element of DOE's National Laboratory System, Berkeley Lab supports DOE's missions in fundamental science, energy resources, and environmental quality. Berkeley Lab programs advance four distinct goals for DOE and the nation: (1) To perform leading multidisciplinary research in the computing sciences, physical sciences, energy sciences, biosciences, and general sciences in a manner that ensures employee and public safety and protection of the environment. (2) To develop and operate unique national experimental facilities for qualified investigators. (3) To educate and train future generations of scientists and engineers to promote national science and education goals. (4) To transfer knowledge and technological innovations and to foster productive relationships among Berkeley Lab's research programs, universities, and industry in order to promote national economic competitiveness. This is the annual report on Laboratory Directed Research and Development (LDRD) program for FY99.

  12. Laboratory Directed Research and Development Program FY 2001

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, Todd; Levy, Karin

    2002-03-15

    The Ernest Orlando Lawrence Berkeley National Laboratory (Berkeley Lab or LBNL) is a multi-program national research facility operated by the University of California for the Department of Energy (DOE). As an integral element of DOE's National Laboratory System, Berkeley Lab supports DOE's missions in fundamental science, energy resources, and environmental quality. Berkeley Lab programs advance four distinct goals for DOE and the nation: (1) To perform leading multidisciplinary research in the computing sciences, physical sciences, energy sciences, biosciences, and general sciences in a manner that ensures employee and public safety and protection of the environment. (2) To develop and operate unique national experimental facilities for qualified investigators. (3) To educate and train future generations of scientists and engineers to promote national science and education goals. (4) To transfer knowledge and technological innovations and to foster productive relationships among Berkeley Lab's research programs, universities, and industry in order to promote national economic competitiveness. This is the annual report on Laboratory Directed Research and Development (LDRD) program for FY01.

  13. Tiger Team assessment of the Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    1990-06-01

    This report documents the results of the Department of Energy's (DOE's) Tiger Team Assessment conducted at Brookhaven National Laboratory (BNL) in Upton, New York, between March 26 and April 27, 1990. The BNL is a multiprogram laboratory operated by the Associated Universities, Inc., (AUI) for DOE. The purpose of the assessment was to provide the status of environment, safety, and health (ES H) programs at the laboratory. The scope of the assessment included a review of management systems and operating procedures and records; observations of facility operations; and interviews at the facilities. Subteams in four areas performed the review: ES H, Occupational Safety and Health, and Management and Organization. The assessment was comprehensive, covering all areas of ES H activities and waste management operations. Compliance with applicable Federal, State, and local regulations; applicable DOE Orders; and internal BNL requirements was assessed. In addition, the assessment included an evaluation of the adequacy and effectiveness of the DOE and the site contractor, Associated Universities, Inc. (AUI), management, organization, and administration of the ES H programs at BNL. This volume contains appendices.

  14. Tiger Team assessment of the Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    1990-06-01

    This report documents the results of the Department of Energy's (DOE's) Tiger Team Assessment conducted at Brookhaven National Laboratory (BNL) in Upton, New York, between March 26 and April 27, 1990. The BNL is a multiprogram laboratory operated by the Associated Universities, Inc., (AUI) for DOE. The purpose of the assessment was to provide the status of environment, safety, and health (ES H) programs at the Laboratory. The scope of the assessment included a review of management systems and operating procedures and records; observations of facility operations; and interviews at the facilities. Subteams in four areas performed the review: ES H, Occupational Safety and Health, and Management and Organization. The assessment was comprehensive, covering all areas of ES H activities and waste management operations. Compliance with applicable Federal, State, and local regulations; applicable DOE Orders; and internal BNL requirements was assessed. In addition, the assessment included an evaluation of the adequacy and effectiveness of the DOE and the site contractor, Associated Universities, Inc. (AUI), management, organization, and administration of the ES H programs at BNL.

  15. Measuring Meaningful Learning in the Undergraduate Chemistry Laboratory: A National, Cross-Sectional Study

    Science.gov (United States)

    Galloway, Kelli R.; Bretz, Stacey Lowery

    2015-01-01

    Research on laboratory learning points to the need to better understand what and how students learn in the undergraduate chemistry laboratory. The Meaningful Learning in the Laboratory Instrument (MLLI) was administered to general and organic chemistry students from 15 colleges and universities across the United States in order to measure the…

  16. Essay of accelerator R and D in a small laboratory of a university. Prototype of IHQ linac 1985-1989

    International Nuclear Information System (INIS)

    Hattori, Toshiyuki

    2004-01-01

    This is a series of stories on developing particle accelerators employing new acceleration principles at a university laboratory. In this paper the design, the cold-model test, the fabrication and the acceleration test of a linear accelerator (linac) of 'IHQ' type are described. The word IHQ is coined by combining 'Inter-digital H' and 'Radio-Frequency Quadrupole', which are the words for types of linacs. The linac of IHQ type can accelerate particles with rather low injection energy and can perform a high acceleration efficiency. In the acceleration test, the proton beam from an RFQ linac with an energy of 0.8MeV was injected to the IHQ linac and accelerated up to 2 MeV as designed. The effective shunt impedance of the accelerator structure was measured to be as high as 132MΩ/m as expected. (K.Y.)

  17. Implementation of Scientific Community Laboratories and Their Effect on Student Conceptual Learning, Attitudes, and Understanding of Uncertainty

    Science.gov (United States)

    Lark, Adam

    Scientific Community Laboratories, developed by The University of Maryland, have shown initial promise as laboratories meant to emulate the practice of doing physics. These laboratories have been re-created by incorporating their design elements with the University of Toledo course structure and resources. The laboratories have been titled the Scientific Learning Community (SLC) Laboratories. A comparative study between these SLC laboratories and the University of Toledo physics department's traditional laboratories was executed during the fall 2012 semester on first semester calculus-based physics students. Three tests were executed as pre-test and post-tests to capture the change in students' concept knowledge, attitudes, and understanding of uncertainty. The Force Concept Inventory (FCI) was used to evaluate students' conceptual changes through the semester and average normalized gains were compared between both traditional and SLC laboratories. The Colorado Learning Attitudes about Science Survey for Experimental Physics (E-CLASS) was conducted to elucidate students' change in attitudes through the course of each laboratory. Finally, interviews regarding data analysis and uncertainty were transcribed and coded to track changes in the way students understand uncertainty and data analysis in experimental physics after their participation in both laboratory type. Students in the SLC laboratories showed a notable an increase conceptual knowledge and attitudes when compared to traditional laboratories. SLC students' understanding of uncertainty showed most improvement, diverging completely from students in the traditional laboratories, who declined throughout the semester.

  18. A review of international underground laboratory developments

    International Nuclear Information System (INIS)

    Cheng Jianping; Yue Qian; Wu Shiyong; Shen Manbin

    2011-01-01

    Underground laboratories are essential for various important physics areas such as the search for dark matter, double beta decay, neutrino oscillation, and proton decay. At the same time, they are also a very important location for studying rock mechanics, earth structure evolution,and ecology. It is essential for a nation's basic research capability to construct and develop underground laboratories. In the past, China had no high-quality underground laboratory,in particular no deep underground laboratory,so her scientists could not work independently in major fields such as the search for dark matter,but had to collaborate with foreign scientists and share the space of foreign underground laboratories. In 2009, Tsinghua university collaborated with the Ertan Hydropower Development Company to construct an extremely deep underground laboratory, the first in China and currently the deepest in the world, in the Jinping traffic tunnel which was built to develop hydropower from the Yalong River in Sichuan province. This laboratory is named the China Jinping Underground Laboratory (CJPL) and formally opened on December 12, 2010. It is now a major independent platform in China and can host various leading basic research projects. We present a brief review of the development of various international underground laboratories,and especially describe CJPL in detail. (authors)

  19. North Carolina State University Nuclear Structure Research at the Triangle Universities Nuclear Laboratory. Progress report

    International Nuclear Information System (INIS)

    Seagondollar, L.W.; Waltner, A.W.; Mitchell, G.E.; Tilley, D.R.; Gould, C.R.

    1975-01-01

    A summary is presented of nuclear structure research completed at the Triangle Universities Nuclear Lab for the period 9/1/74 to 8/31/75. Included are abstracts and titles for studies of electromagnetic transitions in low-medium mass nuclei, high resolution studies, accelerator induced x-ray investigations, and energy related neutron and charged particle cross section measurements. (U.S.)

  20. Powder X-ray diffraction laboratory, Reston, Virginia

    Science.gov (United States)

    Piatak, Nadine M.; Dulong, Frank T.; Jackson, John C.; Folger, Helen W.

    2014-01-01

    The powder x-ray diffraction (XRD) laboratory is managed jointly by the Eastern Mineral and Environmental Resources and Eastern Energy Resources Science Centers. Laboratory scientists collaborate on a wide variety of research problems involving other U.S. Geological Survey (USGS) science centers and government agencies, universities, and industry. Capabilities include identification and quantification of crystalline and amorphous phases, and crystallographic and atomic structure analysis for a wide variety of sample media. Customized laboratory procedures and analyses commonly are used to characterize non-routine samples including, but not limited to, organic and inorganic components in petroleum source rocks, ore and mine waste, clay minerals, and glassy phases. Procedures can be adapted to meet a variety of research objectives.

  1. Feasibility of Key Star Wars Technology at Center of Debate over Information a Cal. Laboratory Gave Government.

    Science.gov (United States)

    McDonald, Kim

    1988-01-01

    The question of whether a university is responsible for the technical accuracy of information released by senior administrators of a laboratory it is charged with overseeing is examined in the case involving a dispute at the Lawrence Livermore National Laboratory that is overseen by the University of California. (MLW)

  2. Laboratory design for high-performance electron microscopy

    Energy Technology Data Exchange (ETDEWEB)

    O' Keefe, Michael A.; Turner, John H.; Hetherington, Crispin J.D.; Cullis, A.G.; Carragher, Bridget; Jenkins, Ron; Milgrim, Julie; Milligan,Ronald A.; Potter, Clinton S.; Allard, Lawrence F.; Blom, Douglas A.; Degenhardt, Lynn; Sides, William H.

    2004-04-23

    Proliferation of electron microscopes with field emission guns, imaging filters and hardware spherical aberration correctors (giving higher spatial and energy resolution) has resulted in the need to construct special laboratories. As resolutions improve, transmission electron microscopes (TEMs) and scanning transmission electron microscopes (STEMs) become more sensitive to ambient conditions. State-of-the-art electron microscopes require state-of-the-art environments, and this means careful design and implementation of microscope sites, from the microscope room to the building that surrounds it. Laboratories have been constructed to house high-sensitive instruments with resolutions ranging down to sub-Angstrom levels; we present the various design philosophies used for some of these laboratories and our experiences with them. Four facilities are described: the National Center for Electron Microscopy OAM Laboratory at LBNL; the FEGTEM Facility at the University of Sheffield; the Center for Integrative Molecular Biosciences at TSRI; and the Advanced Microscopy Laboratory at ORNL.

  3. How compliant are technicians with universal safety measures in medical laboratories in Croatia?--A pilot study.

    Science.gov (United States)

    Dukic, Kristina; Zoric, Matea; Pozaic, Petra; Starcic, Jelena; Culjak, Marija; Saracevic, Andrea; Miler, Marijana

    2015-01-01

    This pilot study aimed to investigate the use of personal protective equipment (PPE) and compliance to the code of conduct (rules defined in institutional, governmental and professional guidelines) among laboratory technicians in Croatian medical laboratories. In addition, we explored the differences in compliance between participants of different age groups, laboratory ownership and accreditation status. An anonymous and voluntary survey with 15 questions was conducted among Croatian medical laboratory technicians (N=217). The questions were divided into two groups: demographic characteristics and the use of PPE. The questions of the second part were graded according to the Likert scale (1-4) and an overall score, shown as median and range (min-max), was calculated for each participant. Differences between the overall scores were tested for each group of participants. The majority of participants always wear protective clothes at work, 38.7% of them always wear gloves in daily routine, more than 30.0% consume food and almost half of them drink beverages at workplace. A significantly lower overall score was found for participants working in public compared to private laboratories (36 (16-40) vs. 40 (31-40), Plaboratory accreditation status (P=0.081). A considerable percentage of laboratory technicians in Croatian medical laboratories do not comply with safety measures. Lack of compliance is observed in all personnel regardless laboratory accreditation and participants' age. However, those working in private laboratories adhere more to the code of conduct.

  4. Origins of the Lunar and Planetary Laboratory, University of Arizona

    Science.gov (United States)

    Cruikshank, Dale P.; Hartmann, William K.

    2014-11-01

    The roots of the Lunar and Planetary Laboratory (LPL) extend deep into the rich fabric of G. P. Kuiper’s view of the Earth as a planet and planetary systems as expected companions to most stars, as well as the post-war emergent technology of infrared detectors suitable for astronomy. These concepts and events began with Kuiper’s theoretical work at Yerkes Observatory on the origin of the Solar System, his discovery of two planetary satellites and observational work with his near-infrared spectrometer on the then-new McDonald 82-inch telescope in the mid- to late-1940s. A grant for the production of a photographic atlas of the Moon in the mid-1950s enabled him to assemble the best existing images of the Moon and acquire new photographs. This brought E. A. Whitaker and D. W. G. Arthur to Yerkes. Others who joined in the lunar work were geologist Carl S. Huzzen and grad student E. P. Moore, as well as undergrad summer students A. B. Binder and D. P. Cruikshank (both in 1958). The Atlas was published in 1959, and work began on an orthographic lunar atlas. Kuiper’s view of planetary science as an interdisciplinary enterprise encompassing astronomy, geology, and atmospheric physics inspired his vision of a research institution and an academic curriculum tuned to the combination of all the scientific disciplines embraced in a comprehensive study of the planets. Arrangements were made with the University of Arizona (UA) to establish LPL in affiliation with the widely recognized Inst. of Atmospheric Physics. Kuiper moved to the UA in late 1960, taking the lunar experts, graduate student T. C. Owen (planetary atmospheres), and associate B. M. Middlehurst along. G. van Biesbroeck also joined the migration to Tucson; Binder and Cruikshank followed along as new grad students. Astronomy grad student W. K. Hartmann came into the academic program at UA and the research group at LPL in 1961. Senior faculty affiliating with LPL in the earliest years were T. Gehrels, A. B

  5. Oak Ridge National Laboratory Institutional Plan, FY 1991--FY 1996

    Energy Technology Data Exchange (ETDEWEB)

    1991-02-01

    The Oak Ridge National Laboratory -- one of DOE's major multiprogram laboratories -- focuses its resources on energy research and development (R D). To be able to meet these R D challenges, the Laboratory must achieve excellence in its operations relative to environmental, safety, and health (ES H) protection and to restore its aging facility infrastructure. ORNL's missions are carried out in compliance with all applicable ES H regulations. The Laboratory conducts applied R D in energy technologies -- in conservation; fission; magnetic fusion; health and environmental protection; waste management; renewable resources; and fossil energy. Experimental and theoretical research is undertaken to investigate fundamental problems in physical, chemical, materials, computational, biomedical, earth, and environmental sciences; to advance scientific knowledge; and to support energy technology R D. ORNL designs, builds, and operates unique research facilities for the benefit of university, industrial, and national laboratory researchers. The Laboratory serves as a catalyst in bringing national and international research elements together for important scientific and technical collaborations. ORNL helps to prepare the scientific and technical work force of the future by offering innovative and varied learning and R D experiences at the Laboratory for students and faculty from preschool level through postdoctoral candidates. The transfer of science and technology to US industries and universities is an integral component of ORNL's R D missions. ORNL also undertakes research and development for non-DOE sponsors when such work is synergistic with DOE mission. 66 figs., 55 tabs.

  6. Oak Ridge National Laboratory Institutional Plan, FY 1991--FY 1996

    International Nuclear Information System (INIS)

    1991-02-01

    The Oak Ridge National Laboratory -- one of DOE's major multiprogram laboratories -- focuses its resources on energy research and development (R ampersand D). To be able to meet these R ampersand D challenges, the Laboratory must achieve excellence in its operations relative to environmental, safety, and health (ES ampersand H) protection and to restore its aging facility infrastructure. ORNL's missions are carried out in compliance with all applicable ES ampersand H regulations. The Laboratory conducts applied R ampersand D in energy technologies -- in conservation; fission; magnetic fusion; health and environmental protection; waste management; renewable resources; and fossil energy. Experimental and theoretical research is undertaken to investigate fundamental problems in physical, chemical, materials, computational, biomedical, earth, and environmental sciences; to advance scientific knowledge; and to support energy technology R ampersand D. ORNL designs, builds, and operates unique research facilities for the benefit of university, industrial, and national laboratory researchers. The Laboratory serves as a catalyst in bringing national and international research elements together for important scientific and technical collaborations. ORNL helps to prepare the scientific and technical work force of the future by offering innovative and varied learning and R ampersand D experiences at the Laboratory for students and faculty from preschool level through postdoctoral candidates. The transfer of science and technology to US industries and universities is an integral component of ORNL's R ampersand D missions. ORNL also undertakes research and development for non-DOE sponsors when such work is synergistic with DOE mission. 66 figs., 55 tabs

  7. Report of the research results with University of Tokyo, Nuclear Engineering Research Laboratory's Facilities in fiscal 1983

    International Nuclear Information System (INIS)

    1984-01-01

    Much achievement was obtained also in fiscal 1983 by the common utilization of the nuclear reactor ''Yayoi'' and the linear accelerator in the Nuclear Engineering Research Laboratory, University of Tokyo. These results were summarized, and this report is published. In the utilization of the reactor ''Yayoi'', the period of operation and the maximum output were limited very much, because long cooling period is necessary to prepare for the repair of fuel cladding in the next year. Also foreign research students commonly utilized the reactor ''Yayoi''. The common utilization of the linear accelerator was begun six years ago, and now it is carried out widely and smoothly. The total number of those who commonly utilized the facilities reached 3,179. The summaries of the results of 5 on-pile researches, 17 off-pile researches, and 16 researches using the linear accelerator are collected. The committee meetings and study meetings held in fiscal 1983 are listed. The names of the members of various committees and the names of those in charge of various experiments are given. (Kako, I.)

  8. Report of the research results with University of Tokyo, Nuclear Engineering Research Laboratory's Facilities in fiscal 1986

    International Nuclear Information System (INIS)

    1987-01-01

    This book contains a large number of reports of studies made in 1986 through joint utilization of the nuclear reactor 'Yayoi' and electron beam type accelerator which are installed in the Nuclear engineering Research Laboratory, Faculty of Engineering, University of Tokyo. The reports presented deal with 'Behaviors of Neutrons in Fast Reactor Blanket Shield', 'Effect of Fast Neutron Radiation on Organic Materials', 'Production and Recovery of Tritium in Nuclear Fusion Reactor Blanket System', 'Bench Mark Experiment of Effect of Atmospheric Scattering of Neutron', 'Experimental Evaluation of Nuclear Heat Rate', 'Fast Neutron Shielding Experiment', 'Effect of Fast Neutron Radiation on Hot Water', 'Neutron Shielding Experiment', 'Biological and Medical Application of 'Yayoi' Neutron', 'Effect of Fission-Fusion Correlation Radiation on Semiconductors (Si, GaAs)', 'Application of Fast Neutron to Radiography Technology', 'Streaming in Offset Slit', 'Design and Evaluation of New Reactor', 'LET Effect on Organic Material', 'Handling, Separation and Recovery of Transuranium Elements', 'Reactor Operation Support System Using Knowledge Engineering Technique', 'Application of Shape Memory Alloys to Nuclear Reactor Devices', 'Numerical Simulation of Turbulent Hear Transfer', and many other studies. (Nogami, K.)

  9. Updating the immunology curriculum in clinical laboratory science.

    Science.gov (United States)

    Stevens, C D

    2000-01-01

    To determine essential content areas of immunology/serology courses at the clinical laboratory technician (CLT) and clinical laboratory scientist (CLS) levels. A questionnaire was designed which listed all major topics in immunology and serology. Participants were asked to place a check beside each topic covered. For an additional list of serological and immunological laboratory testing, participants were asked to indicate if each test was performed in either the didactic or clinical setting, or not performed at all. A national survey of 593 NAACLS approved CLT and CLS programs was conducted by mail under the auspices of ASCLS. Responses were obtained from 158 programs. Respondents from all across the United States included 60 CLT programs, 48 hospital-based CLS programs, 45 university-based CLS programs, and 5 university-based combined CLT and CLS programs. The survey was designed to enumerate major topics included in immunology and serology courses by a majority of participants at two distinct educational levels, CLT and CLS. Laboratory testing routinely performed in student laboratories as well as in the clinical setting was also determined for these two levels of practitioners. Certain key topics were common to most immunology and serology courses. There were some notable differences in the depth of courses at the CLT and CLS levels. Laboratory testing associated with these courses also differed at the two levels. Testing requiring more detailed interpretation, such as antinuclear antibody patterns (ANAs), was mainly performed by CLS students only. There are certain key topics as well as specific laboratory tests that should be included in immunology/serology courses at each of the two different educational levels to best prepare students for the workplace. Educators can use this information as a guide to plan a curriculum for such courses.

  10. [Evaluation of clinical laboratories--assurance of their quality and competence].

    Science.gov (United States)

    Kawai, Tadashi

    2007-01-01

    Since ISO 15189:2003 was published, the accreditation program of clinical laboratories based on ISO 15189 has been introduced in many countries, except for those in USA where all clinical laboratories must be required to follow the federal law, CLIA'88. It will certainly help the accredited clinical laboratories improve their quality and competence. In relation to the activity of JCTLM, reference measurement laboratories will be accredited, based on ISO 15195 which is now under its review and amendment by ISO/TC212/WG2. In Japan, JCCLS (Japanese Committee for Clinical Laboratory Standards) and JAB (Japan Accreditation Board for Conformity Assessment) cojointly started the accreditation program for clinical laboratories, based on ISO 15189:2003, and a total of 15 laboratories including university hospitals, community hospitals and independent clinical laboratories have been accredited up until the end of 2006.

  11. Prevalence of metabolic components in university students

    OpenAIRE

    Silva, Ana Roberta Vilarouca da; Sousa, Luana Savana Nascimento de; Rocha, Telma de Sousa; Cortez, Ramiro Marx Alves; Macêdo, Layla Gonçalves do Nascimento; Almeida, Paulo César de

    2014-01-01

    OBJECTIVE: to identify the frequency of components of Metabolic Syndrome (MetS) among university students.METHOD: descriptive study with 550 students, from various courses run by a public university. The socioeconomic data, lifestyle, and components of MetS were filled out using a questionnaire. Blood sample collection was undertaken in the university itself by a contracted clinical analysis laboratory.RESULTS: 66.2% were female, with a mean age of 22.6±4.41; 71.7% were sedentary; 1.8% stated...

  12. From ideas to construction innovations: firms and universities collaborating

    Directory of Open Access Journals (Sweden)

    Jan Bröchner

    2016-03-01

    Full Text Available The purpose here is to study patterns of project collaboration found in one government supported programme for construction innovation. Preferred types of interaction were identified using data from two questionnaire surveys, one with experienced construction sector respondents and one aimed at construction researchers. All sixteen development projects within the Swedish Bygginnovationen programme were investigated, relying on documents and a survey of project managers. Important types of interaction, according to construction respondents, are informal contacts, joint research projects and staff mobility. For university respondents, informal contacts is also seen as the most important type of interaction, followed by MSc thesis work in firms and industrial PhD candidates. Grant applicants from manufacturing depended more on university laboratories and were less sensitive to firm/university distance. Laboratory use was also more frequent for projects relying on the field of materials engineering. In conclusion, there is a consensus about which types of collaboration are valuable. The broadness of participation in the programme, ranging over many industries, both as to origin of ideas and ultimate applications, reaches beyond narrow interpretations of the construction industry. Policy makers should recognize the innovation importance of university laboratory facilities and field testing, rather than seeing researchers as sources of ideas.

  13. MUSICAL-COMPUTER TECHNOLOGY: THE LABORATORY

    Directory of Open Access Journals (Sweden)

    Gorbunova Irina B.

    2012-12-01

    Full Text Available The article deals with musically-computer technology in the educational system on example of the Educational and Methodical Laboratory Music & Computer Technologies at the Herzen State Pedagogical University of Russia, St. Petersburg. Interdisciplinary field of professional activities relates to the creation and application of specialized music software and hardware tools and the knowledges in music and informatics. A realization of the concept of musical-computer education in preparing music teachers is through basic educational programs of vocational training, supplementary education, professional development of teachers and methodical support via Internet. In addition, the laboratory Music & Computer Technologies engaged in scientific activity: it is, above all, specialized researches in the field of pedagogy and international conferences.

  14. CLINIC-LABORATORY DESIGN BASED ON FUNCTION AND PHILOSOPHY AT PURDUE UNIVERSITY.

    Science.gov (United States)

    HANLEY, T.D.; STEER, M.D.

    THIS REPORT DESCRIBES THE DESIGN OF A NEW CLINIC AND LABORATORY FOR SPEECH AND HEARING TO ACCOMMODATE THE THREE BASIC PROGRAMS OF--(1) CLINICAL TRAINING OF UNDERGRADUATE AND GRADUATE STUDENT MAJORS, (2) SERVICES MADE AVAILABLE TO THE SPEECH AND HEARING HANDICAPPED, AND (3) RESEARCH IN SPEECH PATHOLOGY, AUDIOLOGY, PSYCHO-ACOUSTICS, AND…

  15. Computer-based nuclear radiation detection and instrumentation teaching laboratory system

    International Nuclear Information System (INIS)

    Ellis, W.H.; He, Q.

    1993-01-01

    The integration of computers into the University of Florida's Nuclear Engineering Sciences teaching laboratories is based on the innovative use of MacIntosh 2 microcomputers, IEEE-488 (GPIB) communication and control bus system and protocol, compatible modular nuclear instrumentation (NIM) and test equipment, LabVIEW graphics and applications software, with locally prepared, interactive, menu-driven, HyperCard based multi-exercise laboratory instruction sets and procedures. Results thus far have been highly successful with the majority of the laboratory exercises having been implemented

  16. Proceedings of symposium on technology in laboratories

    International Nuclear Information System (INIS)

    2008-03-01

    The Symposium on Technology in Laboratories was held on both 10th and 11th March 2008 at Ceratopia Toki in Toki city, Gifu Prefecture, Japan, which hosted by the National Institute for Fusion Science (NIFS). 287 people participated and 97 papers were presented from many universities, national laboratories, technical colleges, and some industries in Japan. Technical experience and new techniques were reported and discussed in four fields: technology of fabrication and cryogenics', 'device technology', 'diagnostic and control system', and 'computer and processing'. The 37 of the presented papers are indexed individually. (J.P.N.)

  17. Building baby universes

    Science.gov (United States)

    Coles, Peter

    2017-08-01

    The thought of a scientist trying to design a laboratory experiment in which to create a whole new universe probably sounds like it belongs in the plot of a science-fiction B-movie. But as author Zeeya Merali explains in her new book A Big Bang in a Little Room, there are more than a few eminent physicists who think that this is theoretically possible.

  18. NASA's Propulsion Research Laboratory

    Science.gov (United States)

    2004-01-01

    The grand opening of NASA's new, world-class laboratory for research into future space transportation technologies located at the Marshall Space Flight Center (MSFC) in Huntsville, Alabama, took place in July 2004. The state-of-the-art Propulsion Research Laboratory (PRL) serves as a leading national resource for advanced space propulsion research. Its purpose is to conduct research that will lead to the creation and development of innovative propulsion technologies for space exploration. The facility is the epicenter of the effort to move the U.S. space program beyond the confines of conventional chemical propulsion into an era of greatly improved access to space and rapid transit throughout the solar system. The laboratory is designed to accommodate researchers from across the United States, including scientists and engineers from NASA, the Department of Defense, the Department of Energy, universities, and industry. The facility, with 66,000 square feet of useable laboratory space, features a high degree of experimental capability. Its flexibility allows it to address a broad range of propulsion technologies and concepts, such as plasma, electromagnetic, thermodynamic, and propellant propulsion. An important area of emphasis is the development and utilization of advanced energy sources, including highly energetic chemical reactions, solar energy, and processes based on fission, fusion, and antimatter. The Propulsion Research Laboratory is vital for developing the advanced propulsion technologies needed to open up the space frontier, and sets the stage of research that could revolutionize space transportation for a broad range of applications.

  19. University Reactor Sharing Program. Period covered: September 1, 1981-August 31, 1982

    International Nuclear Information System (INIS)

    Hajek, B.K.; Myser, R.D.; Miller, D.W.

    1982-12-01

    During the period from September 1, 1981 to August 31, 1982, the Ohio State University Nuclear Reactor Laboratory participated in the Reactor Sharing Program by providing services to eight colleges and universities. A laboratory on Neutron Activation Analysis was developed for students in the program. A summary of services provided and a copy of the laboratory procedure are attached. Services provided in the last funded period were in three major areas. These were neutron activation analysis, nuclear engineering labs, and introductions to nuclear research. One group also performed radiation surveys and produced isotopes for calibration of their own analytical equipment

  20. Universal Precautions: A Review

    African Journals Online (AJOL)

    DATONYE ALASIA

    and hazards could cause devastating effects on. 2 health and ... (splash of blood or other body fluids into the eyes, nose or ... nurses, laboratory staff and aides who work in .... electric hand dryers are available which is ideal. ... self, patient and co-workers from infection. All ... with universal precautions include the absence of ...

  1. Dosimetric studies in the Institute of Energetic Techniques from the Polytechnic University of Catalunna

    International Nuclear Information System (INIS)

    Ortega, X.; Ginjaume, M.

    1998-01-01

    The University Institute for Energetic Techniques from the Polytechnic University of Catalunya in Barcelona develops its activities in the field of dosimetry in two main facilities which are: a calibration laboratory and a thermoluminescent dosimetry laboratory. Activities can be divided into three areas of action based on radiation levels analyzed: environmental, operational and clinical dosimetry

  2. It guides for the storage of reagents and elimination of waste of the laboratories of the headquarters Rodrigo Facio of the Costa Rica University

    International Nuclear Information System (INIS)

    Mata Bonilla, E. R.

    1996-01-01

    The Project guides for the storage of chemical reagents and elimination of waste of the laboratories of the campus Rodrigo Facio of the Costa Rica University, the objective to settle down in written form a method of storage of chemical reagents, as well as the basic elements for the establishment of a system of handling of chemical residuals for the laboratories of the campus. The storage of reagents in a laboratory requires that the probability of an accident is minimized and it should include the following elements: a classification of reagents and their later segregation (in accordance with the reactivity of each group), ventilation, illumination, controls and alarms in the event of fires, control of spills and an uniform system for the identification of reagents and storage area. The elimination of residuals of chemical reagents requires a series of stages to carry out of this operation in sure form for people, the property and the environment. In the first place it is required of an outline of the whole process of elimination of the waste, later on a system of classification of the produced residuals should be included that it contemplates the final method of elimination of the residual. Other elements that should take into account are: reduction of the volume of the waste, gathering methods, labeled and transport. In this work intends the System of Classification of Substances of the United Nations as classification method, segregation, and storage of the reagents of the laboratories of the campus [es

  3. Effective Laboratory Work in Biochemistry Subject: Students' and Lecturers' Perspective in Indonesia

    Science.gov (United States)

    Anwar, Yunita Arian Sani; Senam; Laksono F. X., Endang Widjajanti

    2017-01-01

    Biochemistry subject had problem in learning and teaching, especially in laboratory work. We explored laboratory learning implementation in Biochemistry subject. Participants of this research were 195 students who took biochemistry subject and 4 lecturers of biochemistry in three universities in Indonesia. We obtained data using questionnaires and…

  4. Asking the Next Generation: The Implementation of Pre-University Students' Ideas about Physics Laboratory Preparation Exercises

    Science.gov (United States)

    Dunnett, K.; Bartlett, P. A.

    2018-01-01

    It was planned to introduce online pre-laboratory session activities to a first-year undergraduate physics laboratory course to encourage a minimum level of student preparation for experiments outside the laboratory environment. A group of 16 and 17 year old laboratory work-experience students were tasked to define and design a pre-laboratory…

  5. Tribal lands provide forest management laboratory for mainstream university students

    Science.gov (United States)

    Serra J. Hoagland; Ronald Miller; Kristen M. Waring; Orlando Carroll

    2017-01-01

    Northern Arizona University (NAU) faculty and Bureau of Indian Affairs (BIA) foresters initiated a partnership to expose NAU School of Forestry (SoF) graduate students to tribal forest management practices by incorporating field trips to the 1.68-million acre Fort Apache Indian Reservation as part of their silviculture curriculum. Tribal field trips were contrasted and...

  6. Accreditation of medical laboratories in Croatia--experiences of the Institute of Clinical Chemistry, University Hospital "Merkur", Zagreb.

    Science.gov (United States)

    Flegar-Mestrić, Zlata; Nazor, Aida; Perkov, Sonja; Surina, Branka; Kardum-Paro, Mirjana Mariana; Siftar, Zoran; Sikirica, Mirjana; Sokolić, Ivica; Ozvald, Ivan; Vidas, Zeljko

    2010-03-01

    Since 2003 when the international norm for implementation of quality management in medical laboratories (EN ISO 15189, Medical laboratories--Particular requirements for quality and competence) was established and accepted, accreditation has become practical, generally accepted method of quality management and confirmation of technical competence of medical laboratories in the whole world. This norm has been translated into Croatian and accepted by the Croatian Institute for Norms as Croatian norm. Accreditation is carried out on voluntary basis by the Croatian Accreditation Agency that has up to now accredited two clinical medical biochemical laboratories in the Republic of Croatia. Advantages of accredited laboratory lie in its documented management system, constant improvement and training, reliability of test results, establishing users' trust in laboratory services, test results comparability and interlaboratory (international) test results acceptance by adopting the concept of metrological traceability in laboratory medicine.

  7. Energy Programs at the Johns Hopkins University Applied Physics Laboratory, Quarterly Report, January-March 1980

    Energy Technology Data Exchange (ETDEWEB)

    Entingh, Daniel J.

    1980-03-01

    The Johns Hopkins University Applied Physics Laboratory, under contracts with several agencies of the federal government and an agency of the State of Maryland, is engaged in developing energy resources, utilization concepts, and monitoring and storage methods. This Quarterly Report summarizes the work on the various tasks as of 31 March 1980. The Energy Quarterly Report is divided into four sections. The first, Geothermal Energy Development Planning and Technical Assistance, supported by the Department of Energy/Division of Geothermal Energy (DOE/DGE), contains reports on the progress of geothermal-related tasks on which effort was concentrated during the quarter. The second section, Operational Research, Hydroelectric Power Development, supported by the Department of Energy/Resource Applications (DOE/DGE), contains reports on small-scale hydroelectric investigations in the southeastern states. The third section, Seismotectonic Investigation, supported by the Reactor Safety Research Division of the Nuclear Regulatory Commission, reports on a neotectonic investigation in Connecticut. The fourth section, Energy Conversion and Storage Techniques, contains two articles, the first on OTEC core unit testing supported by the Department of Energy/Division of Central Solar Technology (DOE/CST), and the second on an analysis of the Community Annual Storage Energy System at the U.S. Naval Air Station, Norfolk, Va. This work is supported by the Department of Energy and the Department of Defense, Naval Facilities Engineering Command/Atlantic Division.

  8. [Efforts to achieve and effects of acquiring ISO 15189 in Tokushima University Hospital].

    Science.gov (United States)

    Shono, Kazuko; Kishi, Misako; Satou, Mituyo; Nagamine, Yasunori; Doi, Tosio

    2009-12-01

    The medical laboratory of Tokushima University Hospital acquired ISO 15189, an international standard for medical laboratories, on July 6th, 2007, resulting in it achieving the 24th place in Japan and 5th place among national university hospitals. The first surveillance was just performed on October 6th, 2008. Tokushima University Hospital, in which our medical laboratory is included as one section, already succeeded in acquiring ISO 9001, PrivacyMark System, and Quality Health Care ver. 5 before accomplishing ISO 15189. To achieve ISO 15189, we prepared documents based on ISO 9001 without any consultation, resulting in a review of the difference between ISO 9001 and ISO 15189 after the preliminary survey. Although achieving ISO 15189 resulted in an improvement in the reliability of laboratory results and accuracy, leading to the development of our technical skills and awareness, and sharing of knowledge, we consider that the considerable investment of time to prepare the requirements remains to be overcome.

  9. Laboratory Experiments on Low-crested Breakwaters

    DEFF Research Database (Denmark)

    Kramer, Morten Mejlhede; Zanuttigh, B.; van der Meer, J. W.

    2004-01-01

    The ducument describe 3D tests at scale 1:20 performed in the Laboratory at Department of Civil Engineering, Aalborg University.The wave obliquity was one of the main parameters, which were studied in the wave basin experiments. The experiments provide unique information about the influences...... of this parameter where almost no research has been done before....

  10. Developments of Spent Nuclear Fuel Pyroprocessing Technology at Idaho National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Michael F. Simpson

    2012-03-01

    This paper summarizes research in used fuel pyroprocessing that has been published by Idaho National Laboratory over the last decade. It includes work done both on treatment of Experimental Breeder Reactor-II and development of advanced technology for potential scale-up and commercialization. Collaborations with universities and other laboratories is included in the cited work.

  11. Problems Related to the Siting of the Laboratory Building for Civil Engineering Department at the University of Warmia and Mazury in Olsztyn, Poland

    Science.gov (United States)

    Zagroba, Marek

    2016-10-01

    This paper deals with the conditions underlying and the problems arising from the siting of a building with specialist laboratories in a developed part of the university campus in Olsztyn, Poland. The topography of the terrain and the need to house civil engineering laboratories in the planned building had an immense impact on the shape of the building and consequently on its foundations, whose dimensions responded to the ground conditions and the specification of various loads they would have to support, including the equipment for the laboratories. The siting of a building as a step in the construction process entails several problems, which are first taken into consideration at the stage of making preliminary concept plans and are subsequently verified while working on the final construction plan. The required information included geotechnical documentation, survey of the ground conditions and the data regarding the predicted loads on the building, necessary to select the right type of foundations. All these problems grow in importance when dealing with such unique buildings like the discussed example of a laboratory building for the Civil Engineering Department, built on a site within a conservation zone on the campus of the University of Warmia and Mazury in Olsztyn, Poland. The specific character of the building and the specialist equipment with which it was to be furnished (a resistance testing machine, a 17-meter-long wave flume) necessitated a series of analyses prior to the siting of the building and selecting suitable foundations. In turn, the fact that the new building was to be erected in the conservation zone meant that collaboration with the Heritage Conservation Office had to be undertaken at the stage of making the plan and continued during the construction works. The Heritage Officer's recommendations concerning the building's shape, divisions, dimensions, materials used, etc., created a situation where the team of designers and architects had to

  12. Consolidated clinical microbiology laboratories.

    Science.gov (United States)

    Sautter, Robert L; Thomson, Richard B

    2015-05-01

    The manner in which medical care is reimbursed in the United States has resulted in significant consolidation in the U.S. health care system. One of the consequences of this has been the development of centralized clinical microbiology laboratories that provide services to patients receiving care in multiple off-site, often remote, locations. Microbiology specimens are unique among clinical specimens in that optimal analysis may require the maintenance of viable organisms. Centralized laboratories may be located hours from patient care settings, and transport conditions need to be such that organism viability can be maintained under a variety of transport conditions. Further, since the provision of rapid results has been shown to enhance patient care, effective and timely means for generating and then reporting the results of clinical microbiology analyses must be in place. In addition, today, increasing numbers of patients are found to have infection caused by pathogens that were either very uncommon in the past or even completely unrecognized. As a result, infectious disease specialists, in particular, are more dependent than ever on access to high-quality diagnostic information from clinical microbiology laboratories. In this point-counterpoint discussion, Robert Sautter, who directs a Charlotte, NC, clinical microbiology laboratory that provides services for a 40-hospital system spread over 3 states in the southeastern United States explains how an integrated clinical microbiology laboratory service has been established in a multihospital system. Richard (Tom) Thomson of the NorthShore University HealthSystem in Evanston, IL, discusses some of the problems and pitfalls associated with large-scale laboratory consolidation. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  13. Laboratory testing of the in-well vapor-stripping system

    International Nuclear Information System (INIS)

    Gilmore, T.J.; Francois, O.

    1996-03-01

    The Volatile organic Compounds-Arid Integrated Demonstration (VOC-Arid ID) was implemented by the US Department of Energy's (DOE's) Office of Technology Development to develop and test new technologies for the remediation of organic chemicals in the subsurface. One of the technologies being tested under the VOC-Arid ID is the in-well vapor-stripping system. The in-well vapor-stripping concept was initially proposed by researchers at Stanford University and is currently under development through a collaboration between workers at Stanford University and DOE's Pacific Northwest National Laboratory. The project to demonstrate the in-well vapor-stripping technology is divided into three phases: (1) conceptual model and computer simulation, (2) laboratory testing, and (3) field demonstration. This report provides the methods and results of the laboratory testing in which a full-scale replica was constructed and tested above ground in a test facility located at DOE's Hanford Site, Washington. The system is a remediation technology designed to preferentially extract volatile organic compounds (VOCs) from contaminated groundwater by converting them to a vapor phase

  14. Laboratory-confirmed Congenital Rubella Syndrome at the ...

    African Journals Online (AJOL)

    Esem

    ORIGINAL ARTICLE. Laboratory-confirmed Congenital Rubella Syndrome at the University Teaching Hospital in Lusaka,. Zambia-Case Reports. 1,2. 3. 3. 4 ... microcephaly. Rubella Immunoglobulin M (IgM) results were positive. The third case, a girl, was seen at twelve weeks and brought in for slow growth rate. On.

  15. Environmental education for hazardous waste management and risk reduction in laboratories

    Directory of Open Access Journals (Sweden)

    Tomas Rafael Pierre Martinez

    2013-10-01

    Full Text Available The University laboratories are places where teaching, extension and research activities are develop, which harmful substances are manipulated and hazardous waste are generated, the lack of information about this makes them an inadequate provision causing human health and environmental risks. This research proposes the implementation of environmental education as an alternative for waste management and safety in the University of Magdalena laboratories. Applying a series of polls showed the effectiveness with efficiency or assertively rises at 30% cognitive level during the process. It recommends to obtain better results is necessary evaluate the ethic component.  

  16. Building a Laboratory-Scale Biogas Plant and Verifying its Functionality

    Science.gov (United States)

    Boleman, Tomáš; Fiala, Jozef; Blinová, Lenka; Gerulová, Kristína

    2011-01-01

    The paper deals with the process of building a laboratory-scale biogas plant and verifying its functionality. The laboratory-scale prototype was constructed in the Department of Safety and Environmental Engineering at the Faculty of Materials Science and Technology in Trnava, of the Slovak University of Technology. The Department has already built a solar laboratory to promote and utilise solar energy, and designed SETUR hydro engine. The laboratory is the next step in the Department's activities in the field of renewable energy sources and biomass. The Department is also involved in the European Union project, where the goal is to upgrade all existed renewable energy sources used in the Department.

  17. Ultrasound-guided photoacoustic imaging of lymph nodes with biocompatible gold nanoparticles as a novel contrast agent (Conference Presentation)

    Science.gov (United States)

    Sun, In-Cheol; Dumani, Diego; Emelianov, Stanislav Y.

    2017-02-01

    A key step in staging cancer is the diagnosis of metastasis that spreads through lymphatic system. For this reason, researchers develop various methods of sentinel lymph node mapping that often use a radioactive tracer. This study introduces a safe, cost-effective, high-resolution, high-sensitivity, and real-time method of visualizing the sentinel lymph node: ultrasound-guided photoacoustic (US/PA) imaging augmented by a contrast agent. In this work, we use clearable gold nanoparticles covered by a biocompatible polymer (glycol chitosan) to enhance cellular uptake by macrophages abundant in lymph nodes. We incubate macrophages with glycol-chitosan-coated gold nanoparticles (0.05 mg Au/ml), and then fix them with paraformaldehyde solution for an analysis of in vitro dark-field microscopy and cell phantom. The analysis shows enhanced cellular uptake of nanoparticles by macrophages and strong photoacoustic signal from labeled cells in tissue-mimicking cell phantoms consisting gelatin solution (6 %) with silica gel (25 μm, 0.3%) and fixed macrophages (13 X 105 cells). The in-vivo US/PA imaging of cervical lymph nodes in healthy mice (nu/nu, female, 5 weeks) indicates a strong photoacoustic signal from a lymph node 10 minutes post-injection (2.5 mg Au/ml, 80 μl). The signal intensity and the nanoparticle-labeled volume of tissue within the lymph node continues to increase until 4 h post-injection. Histological analysis further confirms the accumulation of gold nanoparticles within the lymph nodes. This work suggests the feasibility of molecular/cellular US/PA imaging with biocompatible gold nanoparticles as a photoacoustic contrast agent in the diagnosis of lymph-node-related diseases.

  18. Prevalence and associated factors of job-related depression in laboratory technicians in Hospital Universiti Sains Malaysia (HUSM) and Ministry of Health Malaysia (MOH) Hospitals in Kelantan.

    Science.gov (United States)

    Aziah, B D; Rusli, B N; Winn, T; Naing, L; Tengku, M A

    2004-06-01

    Karasek's job strain model postulates that workers chronically exposed to adverse psychosocial work environment (high strain job)--high psychological job demands and low job control, including poor social support, increased physical demand and hazardous work condition--will eventually develop both physical illnesses such as cardiovascular diseases and psychological disorders such as depression. In order to determine the prevalence and associated factors of job-related depression, a cross-sectional study was conducted among laboratory technicians in Hospital Universiti Sains Malaysia (HUSM) and Kementerian Kesihatan Malaysia (KKM) Hospitals in Kelantan between September 2001 and February 2002. One hundred and two laboratory technicians in HUSM and 79 laboratory technicians in 7 KKM Hospitals were selected; 84/102 (82.4%) in HUSM and 71/79 (89.9%) in KKM Hospitals responded. Data was collected using self-administered questionnaires of the validated Malay version of the Job Content Questionnaire (JCQ) originally developed by Robert Karasek. Results indicated that the prevalence of high job strain in laboratory technicians in HUSM and KKM hospitals was 33.3% (28/84) and 26.8% (19/71), respectively (p>0.05). Significantly higher proportion (59.5%) (50/84) of laboratory technicians in HUSM compared to those in KKM Hospitals (39.4%) (28/71) (p = 0.016) experienced job-related depression. Significant associated factors of job-related depression were low social support (HUSM: adjusted OR 4.7, 95% CI 1.2-18.8; KKM: adjusted OR 14.8, 95%CI 2.4-89.3), high psychological demand (HUSM: adjusted OR 3.0, 95%CI 1.0-8.8), and low decision authority (KKM: adjusted OR 9.7, 95%CI 1.0-91.1). We conclude that strengthening the social support network (supervisors' and coworkers' support), reducing psychological job demand, and increasing decision-making authority of laboratory technicians may go a long way towards reducing job-related depression.

  19. Pelletron accelerator at Panjab University Chandigarh

    International Nuclear Information System (INIS)

    Singh, Nirmal; Mehta, Devinder

    2006-01-01

    The purpose of pelletron accelerator at Panjab University is to develop a low-energy accelerator laboratory within the university infrastructure. It will be housing a tandem electrostatic accelerator. The facility will bring together the available scientific expertise from a wide range of applications, viz. medical, biological and physical sciences and engineering that utilize accelerator-based technologies and techniques. It will play an important role in promoting integrated research and education across scientific disciplines available in the campus. (author)

  20. Integrating Interdisciplinary Research-Based Experiences in Biotechnology Laboratories

    Science.gov (United States)

    Iyer, Rupa S.; Wales, Melinda E.

    2012-01-01

    The increasingly interdisciplinary nature of today's scientific research is leading to the transformation of undergraduate education. In addressing these needs, the University of Houston's College of Technology has developed a new interdisciplinary research-based biotechnology laboratory curriculum. Using the pesticide degrading bacterium,…

  1. Rutherford Appleton Laboratory 1983

    Energy Technology Data Exchange (ETDEWEB)

    Elliott, R T; Wroath, P D [eds.

    1984-01-01

    Efforts are summarized in the areas of: cosmic research; solar and interplanetary research; space plasma science; atmospheric research; distributed computing systems; industrial robotics; software engineering; advanced computer networking (Project UNIVERSE); computing applications in engineering; pattern analysis; electron beam lithography; radio research; applied superconductivity; particle physics; neutron beam research; laser research; and computing facilities and operations. Laboratory resources are summarized, and publications and reports resulting from the work reported for the year are listed, as well as lectures and meetings. (LEW)

  2. Pulsed and monoenergetic beams for neutron cross-section measurements using activation and scattering techniques at Triangle Universities Nuclear Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Hutcheson, A. [Triangle Universities Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 (United States)]. E-mail: hutch@tunl.duke.edu; Angell, C.T. [Triangle Universities Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 (United States); Becker, J.A. [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, CA 94550 (United States); Boswell, M. [Triangle Universities Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 (United States); Crowell, A.S. [Triangle Universities Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 (United States); Dashdorj, D. [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, CA 94550 (United States); Fallin, B. [Triangle Universities Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 (United States); Fotiades, N. [Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, NM 87545 (United States); Howell, C.R.; Karwowski, H.J.; Kelley, J.H.; Kiser, M. [Triangle Universities Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 (United States); Macri, R.A. [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, CA 94550 (United States); Nelson, R.O. [Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, NM 87545 (United States); Pedroni, R.S. [NC A and T State University, 1601 East Market Street, Greensboro, NC 27411 (United States); Tonchev, A.P.; Tornow, W. [Triangle Universities Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 (United States); Vieira, D.J. [Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, NM 87545 (United States); Weisel, G.J. [Penn State Altoona, 3000 Ivyside Park, Altoona, PA 16601 (United States); Wilhelmy, J.B. [Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, NM 87545 (United States)

    2007-08-15

    In support of the Stewardship Science Academic Alliances initiative, an experimental program has been developed at Triangle Universities Nuclear Laboratory (TUNL) to measure (n,xn) cross-sections with both in-beam and activation techniques with the goal of improving the partial cross-section database for the NNSA Stockpile Stewardship Program. First experimental efforts include excitation function measurements on {sup 235,238}U and {sup 241}Am using pulsed and monoenergetic neutron beams with E {sub n} = 5-15 MeV. Neutron-induced partial cross-sections were measured by detecting prompt {gamma} rays from the residual nuclei using various combinations of clover and planar HPGe detectors in the TUNL shielded neutron source area. Complimentary activation measurements using DC neutron beams have also been performed in open geometry in our second target area. The neutron-induced activities were measured in the TUNL low-background counting area. In this presentation, we include detailed information about the irradiation procedures and facilities and preliminary data on first measurements using this capability.

  3. GaInSn usage in the research laboratory

    International Nuclear Information System (INIS)

    Morley, N. B.; Burris, J.; Cadwallader, L. C.; Nornberg, M. D.

    2008-01-01

    GaInSn, a eutectic alloy, has been successfully used in the Magneto-Thermofluid Research Laboratory at the University of California-Los Angeles and at the Princeton Plasma Physics Laboratory for the past six years. This paper describes the handling and safety of GaInSn based on the experience gained in these institutions, augmented by observations from other researchers in the liquid metal experimental community. GaInSn is an alloy with benign properties and shows considerable potential in liquid metal experimental research and cooling applications

  4. Assessment of leadership among clinical laboratories managers of teaching hospitals: Quantum leadership approach

    Directory of Open Access Journals (Sweden)

    H. Dargahi

    2017-10-01

    Full Text Available Background: Quantum leadership approach causes efficient and effective procedures among health care organizations, specially clinical laboratories. Objective: This research was aimed to determine the status of quantum leadership dimensions among all management levels of clinical laboratories of teaching hospitals of medical sciences universities in Tehran. Methods: This descriptive, analytical and cross-sectional study was induced among 180 managers of 35 clinical laboratories of Iran, Shahid Beheshti and Tehran Universities of Medical Sciences 2016. The research tool was researcher - constructed questionnaire of quantum skills, demographic details that its content and face validity and reliability were confirmed. For analysis of data, T-test and ANOVA techniques were used. Findings: Most of the studied clinical laboratories managers were male, married, with 15-20 years work experiences, 1-5 years managerial services, and minimally one training courses in clinical laboratory management. The managers had relatively desired and desired score of quantum skills and leadership respectively. Also, there was significant correlation between quantum leadership with age (P=0.01, and with management training courses (P=0.02. Conclusion: It is expected this paradigm may change the clinical laboratory management in the near future with regards to desirability of quantum leadership dimensions among clinical laboratories.

  5. Implementation of Good Clinical Laboratory Practice (GCLP) guidelines within the External Quality Assurance Program Oversight Laboratory (EQAPOL).

    Science.gov (United States)

    Todd, Christopher A; Sanchez, Ana M; Garcia, Ambrosia; Denny, Thomas N; Sarzotti-Kelsoe, Marcella

    2014-07-01

    The EQAPOL contract was awarded to Duke University to develop and manage global proficiency testing programs for flow cytometry-, ELISpot-, and Luminex bead-based assays (cytokine analytes), as well as create a genetically diverse panel of HIV-1 viral cultures to be made available to National Institutes of Health (NIH) researchers. As a part of this contract, EQAPOL was required to operate under Good Clinical Laboratory Practices (GCLP) that are traditionally used for laboratories conducting endpoint assays for human clinical trials. EQAPOL adapted these guidelines to the management of proficiency testing programs while simultaneously incorporating aspects of ISO/IEC 17043 which are specifically designed for external proficiency management. Over the first two years of the contract, the EQAPOL Oversight Laboratories received training, developed standard operating procedures and quality management practices, implemented strict quality control procedures for equipment, reagents, and documentation, and received audits from the EQAPOL Central Quality Assurance Unit. GCLP programs, such as EQAPOL, strengthen a laboratory's ability to perform critical assays and provide quality assessments of future potential vaccines. © 2013.

  6. The management of radioactive waste in laboratories

    International Nuclear Information System (INIS)

    McLintock, I.S.

    1996-01-01

    Many laboratories in universities, colleges, research institutions and hospitals produce radioactive wastes. The recently-coined term for them is small users of radioactive materials, to distinguish them from concerns such as the nuclear industry. Until recently the accepted official view was that small users had few problems in disposing of their radioactive wastes. This misconception was dispelled in 1991 by the 12th Annual Report of the Radioactive Waste Management Advisory Committee. This book includes a description of the principles of the management and disposal of radioactive wastes from these laboratories. Its main intention, however, is to provide practical information and data for laboratory workers as well as for those responsible for management and ultimate disposal of radioactive wastes. I hope that it succeeds in this intention. (UK)

  7. Chemical research at Argonne National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-04-01

    Argonne National Laboratory is a research and development laboratory located 25 miles southwest of Chicago, Illinois. It has more than 200 programs in basic and applied sciences and an Industrial Technology Development Center to help move its technologies to the industrial sector. At Argonne, basic energy research is supported by applied research in diverse areas such as biology and biomedicine, energy conservation, fossil and nuclear fuels, environmental science, and parallel computer architectures. These capabilities translate into technological expertise in energy production and use, advanced materials and manufacturing processes, and waste minimization and environmental remediation, which can be shared with the industrial sector. The Laboratory`s technologies can be applied to help companies design products, substitute materials, devise innovative industrial processes, develop advanced quality control systems and instrumentation, and address environmental concerns. The latest techniques and facilities, including those involving modeling, simulation, and high-performance computing, are available to industry and academia. At Argonne, there are opportunities for industry to carry out cooperative research, license inventions, exchange technical personnel, use unique research facilities, and attend conferences and workshops. Technology transfer is one of the Laboratory`s major missions. High priority is given to strengthening U.S. technological competitiveness through research and development partnerships with industry that capitalize on Argonne`s expertise and facilities. The Laboratory is one of three DOE superconductivity technology centers, focusing on manufacturing technology for high-temperature superconducting wires, motors, bearings, and connecting leads. Argonne National Laboratory is operated by the University of Chicago for the U.S. Department of Energy.

  8. Education in the nuclear sciences in Japanese universities

    International Nuclear Information System (INIS)

    Takashima, Y.

    1993-01-01

    Although there are 430 governmental and private universities in Japan, only a limited number of them have departments associated with nuclear science education. Moreover, mainly because of financial pressures, this association is often limited to government universities. Nuclear engineering departments are incorporated with only seven of larger universities, and there are three institutes with nuclear reactors. In these facilities, education in reactor physics, radiation measurements, electromagnetic and material sciences, are conducted. In terms of radiation safety and radiological health physics, ten radioisotope centers and seven radiochemistry laboratories in universities play an important role. (author) 8 figs.; 5 tabs

  9. Towards an evaluation framework for Laboratory Information Systems.

    Science.gov (United States)

    Yusof, Maryati M; Arifin, Azila

    Laboratory testing and reporting are error-prone and redundant due to repeated, unnecessary requests and delayed or missed reactions to laboratory reports. Occurring errors may negatively affect the patient treatment process and clinical decision making. Evaluation on laboratory testing and Laboratory Information System (LIS) may explain the root cause to improve the testing process and enhance LIS in supporting the process. This paper discusses a new evaluation framework for LIS that encompasses the laboratory testing cycle and the socio-technical part of LIS. Literature review on discourses, dimensions and evaluation methods of laboratory testing and LIS. A critical appraisal of the Total Testing Process (TTP) and the human, organization, technology-fit factors (HOT-fit) evaluation frameworks was undertaken in order to identify error incident, its contributing factors and preventive action pertinent to laboratory testing process and LIS. A new evaluation framework for LIS using a comprehensive and socio-technical approach is outlined. Positive relationship between laboratory and clinical staff resulted in a smooth laboratory testing process, reduced errors and increased process efficiency whilst effective use of LIS streamlined the testing processes. The TTP-LIS framework could serve as an assessment as well as a problem-solving tool for the laboratory testing process and system. Copyright © 2016 King Saud Bin Abdulaziz University for Health Sciences. Published by Elsevier Ltd. All rights reserved.

  10. Incorporating the International Polar Year Into Introductory Geology Laboratories at Ohio State University

    Science.gov (United States)

    Judge, S. A.; Wilson, T. J.

    2005-12-01

    The International Polar Year (IPY) provides an excellent opportunity for highlighting polar research in education. The ultimate goal of our outreach and education program is to develop a series of modules that are focused on societally-relevant topics being investigated in Antarctic earth science, while teaching basic geologic concepts that are standard elements of school curricula. For example, we envision a university-level, undergraduate, introductory earth science class with the entire semester/quarter laboratory program focused on polar earth science research during the period of the International Polar Year. To attain this goal, a series of modules will be developed, including inquiry-based exercises founded on imagery (video, digital photos, digital core scans), GIS data layers, maps, and data sets available from OSU research groups. Modules that highlight polar research are also suitable for the K-12 audience. Scaleable/grade appropriate modules that use some of the same data sets as the undergraduate modules can be outlined for elementary through high school earth science classes. An initial module is being developed that focuses on paleoclimate data. The module provides a hands-on investigation of the climate history archived in both ice cores and sedimentary rock cores in order to understand time scales, drivers, and processes of global climate change. The paleoclimate module also demonstrates the types of polar research that are ongoing at OSU, allowing students to observe what research the faculty are undertaking in their respective fields. This will link faculty research with student education in the classroom, enhancing learning outcomes. Finally, this module will provide a direct link to U.S. Antarctic Program research related to the International Polar Year, when new ice and sedimentary rock cores will be obtained and analyzed. As a result of this laboratory exercise, the students will be able to: (1) Define an ice core and a sedimentary rock core

  11. University of Wisconsin, Nuclear Reactor Laboratory. Annual report, 1985-1986

    International Nuclear Information System (INIS)

    Cashwell, R.J.

    1986-01-01

    Operational activities for the reactor are described concerning nuclear engineering classes from the University of Wisconsin; reactor sharing program; utility personnel training; sample irradiations and neutron activation analysis; and changes in personnel, facility, and procedures. Results of surveillance tests are presented for operating statistics and fuel exposure; emergency shutdowns and inadvertent scrams; maintenance; radioactive waste disposal; radiation exposures; environmental surveys; and publications and presentations on work based on reactor use

  12. Internet use pattern of Undergraduate students at the University of ...

    African Journals Online (AJOL)

    The study recommends the provision of faculty computer laboratories equipped with internet facilities, installation of solar electric power back-up system, and the integration of Internet and computer literacy into the compulsory general studies programme of the University. University of Dar es Salaam Library Journal Vol.

  13. Laboratory-based surveillance in the molecular era: the TYPENED model, a joint data-sharing platform for clinical and public health laboratories.

    Science.gov (United States)

    Niesters, H G; Rossen, J W; van der Avoort, H; Baas, D; Benschop, K; Claas, E C; Kroneman, A; van Maarseveen, N; Pas, S; van Pelt, W; Rahamat-Langendoen, J C; Schuurman, R; Vennema, H; Verhoef, L; Wolthers, K; Koopmans, M

    2013-01-24

    Laboratory-based surveillance, one of the pillars of monitoring infectious disease trends, relies on data produced in clinical and/or public health laboratories. Currently, diagnostic laboratories worldwide submit strains or samples to a relatively small number of reference laboratories for characterisation and typing. However, with the introduction of molecular diagnostic methods and sequencing in most of the larger diagnostic and university hospital centres in high-income countries, the distinction between diagnostic and reference/public health laboratory functions has become less clear-cut. Given these developments, new ways of networking and data sharing are needed. Assuming that clinical and public health laboratories may be able to use the same data for their own purposes when sequence-based testing and typing are used, we explored ways to develop a collaborative approach and a jointly owned database (TYPENED) in the Netherlands. The rationale was that sequence data - whether produced to support clinical care or for surveillance -can be aggregated to meet both needs. Here we describe the development of the TYPENED approach and supporting infrastructure, and the implementation of a pilot laboratory network sharing enterovirus sequences and metadata.

  14. Final report of the Multiprogram Laboratory Panel Energy Research Advisory Board. Volume II. Support studies

    International Nuclear Information System (INIS)

    Spiewak, I.; Guthrie, M.P.; Nichols, J.P.; Preston, E.L.; West, C.D.; Wilbanks, T.J.; Wilkes, B.Y.; Zerby, A.C.

    1982-09-01

    Volume II - support studies for nine national laboratories include: report of statistical data on the multiprogram laboratories; examples of national laboratory use in foreign countries; domestic models for national laboratory utilization; relationships of laboratories with industry and universities; uses of laboratories for training industrial R and D personnel; legal mandates and constraints on the national laboratories; with appendices on facts about Harwell, CEN-Saclay, TNO, Studsvik, and JAERI-Tokai; the Requirements Boards of the United Kingdom Department of Industry; impact of President's FY 1983 budget; and the PNL experiment

  15. Delivery to the Wet Chemistry Laboratory

    Science.gov (United States)

    2008-01-01

    This portion of a picture acquired by NASA's Phoenix Mars Lander's Robotic Arm Camera documents the delivery of soil to one of four Wet Chemistry Laboratory (WCL) cells on the 30th Martian day, or sol, of the mission. Approximately one cubic centimeter of this soil was then introduced into the cell and mixed with water for chemical analysis. WCL is part of the Microscopy, Electrochemistry, and Conductivity Analyzer (MECA) instrument suite on board the Phoenix lander. The Phoenix Mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is by NASA's Jet Propulsion Laboratory, Pasadena, Calif. Spacecraft development is by Lockheed Martin Space Systems, Denver.

  16. Argonne National Laboratory research offers clues to Alzheimer's plaques

    CERN Multimedia

    2003-01-01

    Researchers from Argonne National Laboratory and the University of Chicago have developed methods to directly observe the structure and growth of microscopic filaments that form the characteristic plaques found in the brains of those with Alzheimer's Disease (1 page).

  17. Clinical Laboratory Data Management: A Distributed Data Processing Solution

    OpenAIRE

    Levin, Martin; Morgner, Raymond; Packer, Bernice

    1980-01-01

    Two turn-key systems, one for patient registration and the other for the clinical laboratory have been installed and linked together at the Hospital of the University of Pennsylvania, forming the nucleus of an evolving distributed Hospital Information System.

  18. Communities of Opportunity: Smart Growth Strategies for Colleges and Universities

    Science.gov (United States)

    Dalbey, Matthew; Nelson, Kevin; Bagnoli, Peggy; Bagnoli, David; Droge, Martha; Cirino, Anna Marie

    2007-01-01

    Colleges and universities are growing, and they need new facilities to accommodate this growth. Whether it's space for new academic classrooms, laboratories, dormitories, research centers, business incubators, or space for retail and services necessary for a campus to thrive, college and university business officers are involved in decision-making…

  19. Laboratory Directed Research and Development Program FY 2006

    Energy Technology Data Exchange (ETDEWEB)

    Hansen (Ed.), Todd

    2007-03-08

    The Ernest Orlando Lawrence Berkeley National Laboratory (Berkeley Lab or LBNL) is a multi-program national research facility operated by the University of California for the Department of Energy (DOE). As an integral element of DOE's National Laboratory System, Berkeley Lab supports DOE's missions in fundamental science, energy resources, and environmental quality. Berkeley Lab programs advance four distinct goals for DOE and the nation: (1) To perform leading multidisciplinary research in the computing sciences, physical sciences, energy sciences, biosciences, and general sciences in a manner that ensures employee and public safety and protection of the environment. (2) To develop and operate unique national experimental facilities for qualified investigators. (3) To educate and train future generations of scientists and engineers to promote national science and education goals. (4) To transfer knowledge and technological innovations and to foster productive relationships among Berkeley Lab's research programs, universities, and industry in order to promote national economic competitiveness.

  20. EXPERIENCE OF THE ORGANIZATION OF VIRTUAL LABORATORIES ON THE BASIS OF TECHNOLOGIES OF CLOUD COMPUTING

    Directory of Open Access Journals (Sweden)

    V. Oleksyuk

    2014-06-01

    Full Text Available The article investigated the concept of «virtual laboratory». This paper describes models of deploying of cloud technologies in IT infrastructure. The hybrid model is most recent for higher educational institution. The author suggests private cloud platforms to deploying the virtual laboratory. This paper describes the experience of the deployment enterprise cloud in IT infrastructure of Department of Physics and Mathematics of Ternopil V. Hnatyuk National Pedagogical University. The object of the research are virtual laboratories as components of IT infrastructure of higher education. The subject of the research are clouds as base of deployment of the virtual laboratories. Conclusions. The use of cloud technologies in the development virtual laboratories of the is an actual and need of the development. The hybrid model is the most appropriate in the deployment of cloud infrastructure of higher educational institution. It is reasonable to use the private (Cloudstack, Eucalyptus, OpenStack cloud platform in the universities.

  1. Brookhaven National Laboratory Institutional Plan FY2001--FY2005

    Energy Technology Data Exchange (ETDEWEB)

    Davis, S.

    2000-10-01

    Brookhaven National Laboratory is a multidisciplinary laboratory in the Department of Energy National Laboratory system and plays a lead role in the DOE Science and Technology mission. The Laboratory also contributes to the DOE missions in Energy Resources, Environmental Quality, and National Security. Brookhaven strives for excellence in its science research and in facility operations and manages its activities with particular sensitivity to environmental and community issues. The Laboratory's programs are aligned continuously with the goals and objectives of the DOE through an Integrated Planning Process. This Institutional Plan summarizes the portfolio of research and capabilities that will assure success in the Laboratory's mission in the future. It also sets forth BNL strategies for our programs and for management of the Laboratory. The Department of Energy national laboratory system provides extensive capabilities in both world class research expertise and unique facilities that cannot exist without federal support. Through these national resources, which are available to researchers from industry, universities, other government agencies and other nations, the Department advances the energy, environmental, economic and national security well being of the US, provides for the international advancement of science, and educates future scientists and engineers.

  2. "Strong interaction" for particle physics laboratories

    CERN Multimedia

    2003-01-01

    A new Web site pooling the communications resources of particle physics centres all over the world has just been launched. The official launching of the new particle physics website Interactions.org during the Lepton-Proton 2003 Conference at the American laboratory Fermilab was accompanied by music and a flurry of balloons. On the initiative of Fermilab, the site was created by a collaboration of communication teams from over fifteen of the world's particle physics laboratories, including KEK, SLAC, INFN, JINR and, of course, CERN, who pooled their efforts to develop the new tool. The spectacular launching of the new particle physics website Interactions.org at Fermilab on 12 August 2003. A real gateway to particle physics, the site not only contains all the latest news from the laboratories but also offers images, graphics and a video/animation link. In addition, it provides information about scientific policies, links to the universities, a very useful detailed glossary of particle physics and astrophysic...

  3. Women's Experiences in the Engineering Laboratory in Japan

    Science.gov (United States)

    Hosaka, Masako

    2014-01-01

    This qualitative study aims to examine Japanese women undergraduate engineering students' experiences of interacting with departmental peers of the same year in the laboratory setting by using interview data of 32 final-year students at two modestly selective national universities in Japan. Expectation state theory that explains unequal…

  4. An innovative educational approach to professional development of medical laboratory scientists in Botswana

    Directory of Open Access Journals (Sweden)

    Magowe MK

    2014-04-01

    Full Text Available Mabel KM Magowe,1 Jenny H Ledikwe,2,3 Ishmael Kasvosve,1 Robert Martin,2 Kabo Thankane,3 Bazghina-werq Semo2,31Faculty of Health Sciences, University of Botswana, Gaborone, Botswana; 2Department of Global Health, University of Washington, Seattle, Washington, USA; 3Botswana International Training and Education Center for Health, Gaborone, BotswanaPurpose: To address the shortage of laboratory scientists in Botswana, an innovative, one-year academic bridging program was initiated at the University of Botswana, to advance diploma-holding laboratory technicians towards becoming laboratory scientists holding Bachelor’s degrees. An evaluation was conducted, which described the outcomes of the program and the lessons learned from this novel approach to meeting human resource needs.Methods: This was a cross-sectional, mixed-methods evaluation. Qualitative interviews were conducted with graduates of the Bachelor of Science (BSc Medical Laboratory Sciences (MLS bridging program, along with the graduates’ current supervisors, and key informants who were involved in program development or implementation. The quantitative data collected included a written questionnaire, completed by program graduates, with a retrospective pre-test/post-test survey of graduates’ confidence, in terms of key laboratory competencies.Results: The BSc MLS bridging program produced thirty-three laboratory scientists over 3 years. There was a significant increase in confidence among graduates, for specified competencies, after the program (P<0.05. Graduates reported acquiring new skills and, often, accepting new responsibilities at their former workplace, particularly in relationship to leadership and management. Five graduates enrolled in advanced degree programs. Most graduates assumed increased responsibility. However, only two graduates were promoted after completing the training program. The lessons learned include: the importance of stakeholder involvement, the need for

  5. Multi-University Southeast INIE Consortium

    International Nuclear Information System (INIS)

    Hawari, Ayman; Hertel, Nolan; Al-Sheikhly, Mohamed; Miller, Laurence; Bayoumi, Abdel-Moeze; Haghighat, Ali; Lewis, Kenneth

    2010-01-01

    The Multi-University Southeast INIE Consortium (MUSIC) was established in response to the US Department of Energy's (DOE) Innovations in Nuclear Infrastructure and Education (INIE) program. MUSIC was established as a consortium composed of academic members and national laboratory partners. The members of MUSIC are the nuclear engineering programs and research reactors of Georgia Institute of Technology (GIT), North Carolina State University (NCSU), University of Maryland (UMD), University of South Carolina (USC), and University of Tennessee (UTK). The University of Florida (UF), and South Carolina State University (SCSU) were added to the MUSIC membership in the second year. In addition, to ensure proper coordination between the academic community and the nation's premier research and development centers in the fields of nuclear science and engineering, MUSIC created strategic partnerships with Oak Ridge National Laboratory (ORNL) including the Spallation Neutron Source (SNS) project and the Joint Institute for Neutron Scattering (JINS), and the National Institute of Standards and Technology (NIST). A partnership was also created with the Armed Forces Radiobiology Research Institute (AFRRI) with the aim of utilizing their reactor in research if funding becomes available. Consequently, there are three university research reactors (URRs) within MUSIC, which are located at NCSU (1-MW PULSTAR), UMD (0.25-MW TRIGA) and UF (0.10-MW Argonaut), and the AFRRI reactor (1-MW TRIGA MARK F). The overall objectives of MUSIC are: (a) Demonstrate that University Research Reactors (URR) can be used as modern and innovative instruments of research in the basic and applied sciences, which include applications in fundamental physics, materials science and engineering, nondestructive examination, elemental analysis, and contributions to research in the health and medical sciences, (b) Establish a strong technical collaboration between the nuclear engineering faculty and the MUSIC URRs

  6. Fusion virtual laboratory: The experiments' collaboration platform in Japan

    Energy Technology Data Exchange (ETDEWEB)

    Nakanishi, H., E-mail: nakanisi@nifs.ac.jp [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Kojima, M.; Takahashi, C.; Ohsuna, M.; Imazu, S.; Nonomura, M. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Hasegawa, M. [RIAM, Kyushu University, Kasuga, Fukuoka 816-8560 (Japan); Yoshikawa, M. [PRC, University of Tsukuba, Tsukuba, Ibaraki 305-8577 (Japan); Nagayama, Y.; Kawahata, K. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan)

    2012-12-15

    'Fusion virtual laboratory (FVL)' is the experiments' collaboration platform covering multiple fusion projects in Japan. Major Japanese fusion laboratories and universities are mutually connected through the dedicated virtual private network, named SNET, on SINET4. It has 3 different categories; (i) LHD remote participation, (ii) bilateral experiments' collaboration, and (iii) remote use of supercomputer. By extending the LABCOM data system developed at LHD, FVL supports (i) and (ii) so that it can deal with not only LHD data but also the data of two remote experiments: QUEST at Kyushu University and GAMMA10 at University of Tsukuba. FVL has applied the latest 'cloud' technology for both data acquisition and storage architecture. It can provide us high availability and performance scalability of the whole system. With a well optimized TCP data transferring method, the unified data access platform for both experimental data and numerical computation results could become realistic on FVL. The FVL project will continue demonstrating the ITER-era international collaboration schemes and the necessary technology.

  7. Study of the comprehension of the scientific method by members of a university health research laboratory.

    Science.gov (United States)

    Burlamaque-Neto, A C; Santos, G R; Lisbôa, L M; Goldim, J R; Machado, C L B; Matte, U; Giugliani, R

    2012-02-01

    In Brazil, scientific research is carried out mainly at universities, where professors coordinate research projects with the active participation of undergraduate and graduate students. However, there is no formal program for the teaching/learning of the scientific method. The objective of the present study was to evaluate the comprehension of the scientific method by students of health sciences who participate in scientific projects in an academic research laboratory. An observational descriptive cross-sectional study was conducted using Edgar Morin complexity as theoretical reference. In a semi-structured interview, students were asked to solve an abstract logical puzzle - TanGram. The collected data were analyzed using the hermeneutic-dialectic analysis method proposed by Minayo and discussed in terms of the theoretical reference of complexity. The students' concept of the scientific method is limited to participation in projects, stressing the execution of practical procedures as opposed to scientific thinking. The solving of the TanGram puzzle revealed that the students had difficulties in understanding questions and activities focused on subjects and their processes. Objective answers, even when dealing with personal issues, were also reflected on the students' opinions about the characteristics of a successful researcher. Students' difficulties concerning these issues may affect their scientific performance and result in poorly designed experiments. This is a preliminary study that should be extended to other centers of scientific research.

  8. Chemical reageants management in laboratories of the Universidad Nacional

    Directory of Open Access Journals (Sweden)

    José Carlos Mora Barrantes

    2013-03-01

    Full Text Available During years 2008-2009, a diagnostic regarding chemical reagents management (aspects related with; regulations, safety procedures, handle and storage conditions, etc in teaching and research laboratories of the Universidad Nacional, was carried out. In order to collect such information different strategies/methodologies were used: 1 application of an interview and questionnaire to the laboratories’ personnel, 2an inspection of the laboratories, 3 generation of chemical reagents database 4 work sessions with university management authorities and 5 interview with chemical products management personnel of public and private institutions .This study allowed to identify the actual conditions for the chemical reagents management at Universidad Nacional, for example; the different procedures for the segregation, storage, labeling and use of the chemicals, as well as the aspects related with; chemical database generation, material and safety equipment control, use of safety procedures, etc. Also, the study allowed to evaluate the existing management procedures executed by university authorities for handling them appropriately. As a conclusion, in order to conduct an adequate chemical reagents management at Universidad Nacional it is necessary to formulate and implement regulation (institutional procedures, protocols, etc and the establishment of an university office in charge of all the chemical reagents management activities and procedures. Also is necessary to generate national regulations focused on university activities (chemical reagents management as well as the existing for the industry chemical products control and regulation.

  9. A Hybrid Integrated Laboratory and Inquiry-Based Research Experience: Replacing Traditional Laboratory Instruction with a Sustainable Student-Led Research Project

    Science.gov (United States)

    Hartings, Matthew R.; Fox, Douglas M.; Miller, Abigail E.; Muratore, Kathryn E.

    2015-01-01

    The Department of Chemistry at American University has replaced its junior- and senior-level laboratory curriculum with two, two-semester long, student-led research projects as part of the department's American Chemical Society-accredited program. In the first semester of each sequence, a faculty instructor leads the students through a set of…

  10. The role of laboratory confirmations and molecular epidemiology in ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-12-29

    Dec 29, 2009 ... Organization Regional Reference Polio Laboratory, World Health ... Statistics and Environmental Health, Faculty of Public Health, College of ... 5Molecular Biology Unit, National TB Lab, Nigerian Institute of Medical Research (NIMR), ... 7Department of Medical Microbiology and Parasitology, University of ...

  11. Safety and health: Principles and practices in the laboratory

    International Nuclear Information System (INIS)

    Fakhrul Razi Ahmadun; Guan, Chuan Teong; Mohd Halim Shah Ismail

    2005-01-01

    Ignorance, carelessness or improper practices in the laboratory or the improper handling of hazardous or toxic materials may lead to work accidents and work-related ill-health. Laboratory users and administrators cannot afford to overlook these possible consequences due to the misconduct of laboratory practices and should decide how best to manage the health and safety aspects in the laboratory. This book has been written for safety representatives of colleges and universities, for lectures, teachers and students, and for researchers working in laboratories. It is also for everyone responsible for laboratory safety, laboratory accidents and their consequences. The emphasis is on hazards to health and safety, with the focus on the general hazards in the laboratory, how they arise and how to prevent, how to eliminate and control them. Special hazards will also be discussed such as radiation hazards and human factors. This book also provides information on governmental and non-governmental agencies and authorities, emergency contact numbers of relevant authorities, a list of Malaysia occupational safety and health related legislation and some useful occupational safety and health web sites. Readers will find that the information contained in this book will serve as the foundation for laboratory users safety policy. A set of Laboratory Safety Forms for a typical laboratory is also available in the appendix for reference. Laboratory users can use and adapt these forms for their own laboratory requirements. (author)

  12. Implementation of 5S Method for Ergonomic Laboratory

    Science.gov (United States)

    Dila Sari, Amarria; Ilma Rahmillah, Fety; Prabowo Aji, Bagus

    2017-06-01

    This article discusses 5S implementation in Work System Design and Ergonomic Laboratory, Department of Industrial Engineering, Islamic University of Indonesia. There are some problems related to equipment settings for activity involving students such as files which is accumulated over the previous year practicum, as well as the movement of waste in the form of time due to the placement of goods that do not fit. Therefore, this study aims to apply the 5S method in DSK & E laboratory to facilitate the work processes and reduce waste. The project is performed by laboratory management using 5S methods in response to continuous improvement (Kaizen). Moreover, some strategy and suggestions are promoted to impose 5S system within the laboratory. As a result, the tidiness and cleanliness can be achieved that lead to the great performance of laboratory users. Score assessment before implementing 5S DSKE laboratory is at 64 (2.56) while the score after implementation is 32 (1.28) and shows an improvement of 50%. This has implications for better use in the laboratory area, save time when looking for tools and materials due to its location and good visual control, as well as improving the culture and spirit of ‘5S’ on staff regarding better working environment

  13. Non-Stop Lab Week: A Real Laboratory Experience for Life Sciences Postgraduate Courses

    Science.gov (United States)

    Freitas, Maria João; Silva, Joana Vieira; Korrodi-Gregório, Luís; Fardilha, Margarida

    2016-01-01

    At the Portuguese universities, practical classes of life sciences are usually professor-centered 2-hour classes. This approach results in students underprepared for a real work environment in a research/clinical laboratory. To provide students with a real-life laboratory environment, the Non-Stop Lab Week (NSLW) was created in the Molecular…

  14. Effect of Virtual Analytical Chemistry Laboratory on Enhancing Student Research Skills and Practices

    Science.gov (United States)

    Bortnik, Boris; Stozhko, Natalia; Pervukhina, Irina; Tchernysheva, Albina; Belysheva, Galina

    2017-01-01

    This article aims to determine the effect of a virtual chemistry laboratory on university student achievement. The article describes a model of a laboratory course that includes a virtual component. This virtual component is viewed as a tool of student pre-lab autonomous learning. It presents electronic resources designed for a virtual laboratory…

  15. Occupational radiation exposures in research laboratories

    International Nuclear Information System (INIS)

    Vaccari, S.; Papotti, E.; Pedrazzi, G.

    2006-01-01

    Radioactive sources are widely used in many research activities at University centers. In particular, the activities concerning use of sealed form ( 57 Co in Moessbauer application) and unsealed form ( 3 H, 14 C, 32 P in radioisotope laboratories) are analyzed. The radiological impact of these materials and potential effective doses to researchers and members of the public were evaluated to show compliance with regulatory limits. A review of the procedures performed by researchers and technicians in the research laboratories with the relative dose evaluations is presented in different situations, including normal operations and emergency situations, for example the fire. A study of the possible exposure to radiation by workers, restricted groups of people, and public in general, as well as environmental releases, is presented. (authors)

  16. Benchmarking and the laboratory

    Science.gov (United States)

    Galloway, M; Nadin, L

    2001-01-01

    This article describes how benchmarking can be used to assess laboratory performance. Two benchmarking schemes are reviewed, the Clinical Benchmarking Company's Pathology Report and the College of American Pathologists' Q-Probes scheme. The Clinical Benchmarking Company's Pathology Report is undertaken by staff based in the clinical management unit, Keele University with appropriate input from the professional organisations within pathology. Five annual reports have now been completed. Each report is a detailed analysis of 10 areas of laboratory performance. In this review, particular attention is focused on the areas of quality, productivity, variation in clinical practice, skill mix, and working hours. The Q-Probes scheme is part of the College of American Pathologists programme in studies of quality assurance. The Q-Probes scheme and its applicability to pathology in the UK is illustrated by reviewing two recent Q-Probe studies: routine outpatient test turnaround time and outpatient test order accuracy. The Q-Probes scheme is somewhat limited by the small number of UK laboratories that have participated. In conclusion, as a result of the government's policy in the UK, benchmarking is here to stay. Benchmarking schemes described in this article are one way in which pathologists can demonstrate that they are providing a cost effective and high quality service. Key Words: benchmarking • pathology PMID:11477112

  17. System for Informatics in the Molecular Pathology Laboratory: An Open-Source End-to-End Solution for Next-Generation Sequencing Clinical Data Management.

    Science.gov (United States)

    Kang, Wenjun; Kadri, Sabah; Puranik, Rutika; Wurst, Michelle N; Patil, Sushant A; Mujacic, Ibro; Benhamed, Sonia; Niu, Nifang; Zhen, Chao Jie; Ameti, Bekim; Long, Bradley C; Galbo, Filipo; Montes, David; Iracheta, Crystal; Gamboa, Venessa L; Lopez, Daisy; Yourshaw, Michael; Lawrence, Carolyn A; Aisner, Dara L; Fitzpatrick, Carrie; McNerney, Megan E; Wang, Y Lynn; Andrade, Jorge; Volchenboum, Samuel L; Furtado, Larissa V; Ritterhouse, Lauren L; Segal, Jeremy P

    2018-04-24

    Next-generation sequencing (NGS) diagnostic assays increasingly are becoming the standard of care in oncology practice. As the scale of an NGS laboratory grows, management of these assays requires organizing large amounts of information, including patient data, laboratory processes, genomic data, as well as variant interpretation and reporting. Although several Laboratory Information Systems and/or Laboratory Information Management Systems are commercially available, they may not meet all of the needs of a given laboratory, in addition to being frequently cost-prohibitive. Herein, we present the System for Informatics in the Molecular Pathology Laboratory, a free and open-source Laboratory Information System/Laboratory Information Management System for academic and nonprofit molecular pathology NGS laboratories, developed at the Genomic and Molecular Pathology Division at the University of Chicago Medicine. The System for Informatics in the Molecular Pathology Laboratory was designed as a modular end-to-end information system to handle all stages of the NGS laboratory workload from test order to reporting. We describe the features of the system, its clinical validation at the Genomic and Molecular Pathology Division at the University of Chicago Medicine, and its installation and testing within a different academic center laboratory (University of Colorado), and we propose a platform for future community co-development and interlaboratory data sharing. Copyright © 2018. Published by Elsevier Inc.

  18. Oak Ridge National Laboratory Next Generation Safeguards Initiative

    Energy Technology Data Exchange (ETDEWEB)

    Kirk, Bernadette Lugue [ORNL; Eipeldauer, Mary D [ORNL; Whitaker, J Michael [ORNL

    2011-12-01

    In 2007, the Department of Energy's National Nuclear Security Administration (DOE/NNSA) Office of Nonproliferation and International Security (NA-24) completed a comprehensive review of the current and potential future challenges facing the international safeguards system. The review examined trends and events impacting the mission of international safeguards and the implications of expanding and evolving mission requirements on the legal authorities and institutions that serve as the foundation of the international safeguards system, as well as the technological, financial, and human resources required for effective safeguards implementation. The review's findings and recommendations were summarized in the report, 'International Safeguards: Challenges and Opportunities for the 21st Century (October 2007)'. One of the report's key recommendations was for DOE/NNSA to launch a major new program to revitalize the international safeguards technology and human resource base. In 2007, at the International Atomic Energy Agency's General Conference, then Secretary of Energy Samuel W. Bodman announced the newly created Next Generation Safeguards Initiative (NGSI). NGSI consists of five program elements: (1) Policy development and outreach; (2) Concepts and approaches; (3) Technology and analytical methodologies; (4) Human resource development; and (5) Infrastructure development. The ensuing report addresses the 'Human Resource Development (HRD)' component of NGSI. The goal of the HRD as defined in the NNSA Program Plan (November 2008) is 'to revitalize and expand the international safeguards human capital base by attracting and training a new generation of talent.' One of the major objectives listed in the HRD goal includes education and training, outreach to universities, professional societies, postdoctoral appointments, and summer internships at national laboratories. ORNL is a participant in the NGSI program, together

  19. Undifferentiated spondyloarthritis is more frequently seen in women than in men

    Directory of Open Access Journals (Sweden)

    Sukran Erten

    2015-01-01

    Conclusion SpA are frequent diseases and physicians other than rheumatologists should also be aware of them. uSpA is more frequent in women than men. Early diagnosis of SpA is important because early treatment with new biological therapies may lead to much better Results than applying them in the advanced stages.

  20. Clinical laboratory technologist professional development in Camagüey

    Directory of Open Access Journals (Sweden)

    Mercedes Caridad García González

    2015-05-01

    Full Text Available The paper describes the results of research aimed at assessing the current conditions related to clinical laboratory technologist professional development. A descriptive cross study covering the period between November 2013 and January 2014 is presented. Several techniques for identifying and hierarchically arranging professional developmental related problems were used to study a sample at the Faculty of Health Technology of the Medical University “Carlos Juan Finlay”. The study involved heads of teaching departments and methodologists of health care technology specialties; moreover a survey and a content test were given graduate clinical laboratory technicians. The authors reached at the conclusion that clinical laboratory technologist professional development is limited and usually underestimate the necessities and interests of these graduates. Likewise, a lack of systematization and integration of the biomedical basic sciences contents and the laboratory diagnosis is noticeable.

  1. 75 FR 27372 - University of New Mexico; University of New Mexico AGN-201M Reactor; Environmental Assessment and...

    Science.gov (United States)

    2010-05-14

    ... is housed in the Nuclear Energy Laboratory (NEL) located near the southwest corner of the University.... Therefore, license renewal should not change the environmental impact of facility operation. Data from the... analysis of human health and environmental impacts presented in this environmental assessment, the proposed...

  2. FTIR Laboratory in Support of the PV Program

    International Nuclear Information System (INIS)

    Keyes, B. M.; Gedvilas, L. M.; Bhattacharya, R.; Xu, Y.; Li, X.; Wang, Q.

    2005-01-01

    The Fourier Transform Infrared Spectroscopy (FTIR) Laboratory supports the Solar Energy Technologies Program through the measurement and characterization of solar energy-related materials and devices. The FTIR technique is a fast, accurate, and reliable method for studying molecular structure and composition. This ability to identify atomic species and their bonding environment is a powerful combination that finds use in many research and development efforts. A brief overview of the technical approach used is contained in Section 2 of this report. Because of its versatility and accessibility, the FTIR Laboratory is a valuable contributor to the Solar Energy Technologies Program. The laboratory provides support for, and collaborates with, several in-house programs as well as our industry and university partners. By the end of FY 2004, the FTIR Laboratory performed over 1100 measurements on PV-related materials. These contributions resulted in conference and workshop presentations and several peer-reviewed publications. A brief summary of a few of these efforts is contained in Section 3 of this report

  3. Laboratory implantation for well type ionization chambers calibration

    International Nuclear Information System (INIS)

    Vianello, E.A.; Dias, D.J.; Almeida, C.E. de

    1998-01-01

    The Radiological Science Laboratory is implanting a service for calibration of well type chambers by IAEA training program. The kerma rate in the air (mu Gy/h) of the linear Cs-137 reference source CDCS-J4 have been determined using a well type chamber Standard Imaging HDR-1000 model, which have been calibrated at Secondary Standard Laboratory Calibration of IAEA, whereas two HDR-1000 Plus chambers were calibrated too, following the same standards. The results were compared with Wisconsin University calibration certification and has demonstrated that well type ionization chamber calibration can be used in brachytherapy for several kinds of radionuclides. (Author)

  4. Medical Biochemistry as Subdiscipline of Laboratory Medicine in Serbia.

    Science.gov (United States)

    Jovičić, Snežana; Majkić-Singh, Nada

    2017-04-01

    Medical biochemistry is the usual name for clinical biochemistry or clinical chemistry in Serbia, and medical biochemist is the official name for the clinical chemist (or clinical biochemist). This is the largest sub-discipline of the laboratory medicine in Serbia. It includes all aspects of clinical chemistry, and also laboratory hematology with coagulation, immunology, etc. Medical biochemistry laboratories in Serbia and medical biochemists as a profession are part of Health Care System and their activities are regulated through: the Health Care Law and rules issued by the Chamber of Medical Biochemists of Serbia. The first continuous and organized education for Medical Biochemists (Clinical Chemists) in Serbia dates from 1945, when the Department of Medical Biochemistry was established at the Pharmaceutical Faculty in Belgrade. In 1987 at the same Faculty a five years undergraduate study program was established, educating Medical Biochemists under a special program. Since the academic year 2006/2007 the new five year undergraduate (according to Bologna Declaration) and four-year postgraduate program according to EC4 European Syllabus for Postgraduate Training in Clinical Chemistry and Laboratory Medicine has been established. The Ministry of Education and Ministry of Public Health accredited these programs. There are four requirements for practicing medical biochemistry in the Health Care System: University Diploma of the Faculty of Pharmacy (Study of Medical Biochemistry), successful completion of the professional exam at the Ministry of Health after completion of one additional year of obligatory practical training in the medical biochemistry laboratories, membership in the Serbian Chamber of Medical Biochemists and licence for skilled work issued by the Serbian Chamber of Medical Biochemists. In order to present laboratory medical biochemistry practice in Serbia this paper will be focused on the following: Serbian national legislation, healthcare services

  5. Development of security engineering curricula at US universities

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, M.L.

    1998-08-01

    The Southwest Surety Institute was formed in June 1996 by Arizona State University (ASU), New Mexico Institute of Mining and Technology (NM Tech), New Mexico State University (NMSU), and Sandia National Laboratories (SNL) to provide educational programs in Security Engineering, and to conduct research and development in security technologies. This is the first science-based program of its kind in the US, focused on educating Security Engineers to help government and industry address their security needs. Each member brings a unique educational capability to the Institute. NM Tech has a formidable explosives testing and evaluation facility. ASU is developing a Masters program in Security Engineering at their School of Technology located on a new campus in Mesa, Arizona. NMSU provides a Security Technology minor, merging programs in Criminal Justice and Engineering Technology. The Sandia National Laboratories security system design and evaluation process forms the basis for the Security Engineering curricula. In an effort to leverage the special capabilities of each university, distance education will be used to share courses among Institute members and eventually with other sites across the country.

  6. Adding Vectors across the North: Development of Laboratory Component of Distance Education Physics Course

    Science.gov (United States)

    Spencer, V. K.; Solie, D. J.

    2010-12-01

    Bush Physics for the 21st Century (BP21) is a distance education physics course offered through the Interior Aleutians Campus of the University of Alaska Fairbanks. It provides an opportunity for rural Alaskan high school and community college students, many of whom have no other access to advanced science courses, to earn university science credit. The curriculum is mathematically rigorous and includes a laboratory component to prepare students who wish to pursue science and technology careers. The laboratory component has been developed during the past 3 years. Students learn lab safety, basic laboratory technique, experiment components and group collaboration. Experiments have place-based themes and involve skills that translate to rural Alaska when possible. Preliminary data on the general effectiveness of the labs have been analyzed and used to improve the course.

  7. From black holes to baby universes: Exploring the possibility of creating a cosmos in the laboratory

    International Nuclear Information System (INIS)

    Ansoldi, S.; Merali, Z.; Guendelman, E.I.

    2018-01-01

    We discuss the essential features of baby-universe production, starting from a description of black holes and wormholes, in terms of the causal structure of spacetime, and following a qualitative review of the connection between vacuum decay and inflation in early universe cosmology. Related open questions are also addressed, especially in connection with the possibility that baby universes could be formed within our present universe — either in a future particle accelerator, or spontaneously.

  8. Manual of analytical methods for the Industrial Hygiene Chemistry Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Greulich, K.A.; Gray, C.E. (comp.)

    1991-08-01

    This Manual is compiled from techniques used in the Industrial Hygiene Chemistry Laboratory of Sandia National Laboratories in Albuquerque, New Mexico. The procedures are similar to those used in other laboratories devoted to industrial hygiene practices. Some of the methods are standard; some, modified to suit our needs; and still others, developed at Sandia. The authors have attempted to present all methods in a simple and concise manner but in sufficient detail to make them readily usable. It is not to be inferred that these methods are universal for any type of sample, but they have been found very reliable for the types of samples mentioned.

  9. Manual of analytical methods for the Industrial Hygiene Chemistry Laboratory

    International Nuclear Information System (INIS)

    Greulich, K.A.; Gray, C.E.

    1991-08-01

    This Manual is compiled from techniques used in the Industrial Hygiene Chemistry Laboratory of Sandia National Laboratories in Albuquerque, New Mexico. The procedures are similar to those used in other laboratories devoted to industrial hygiene practices. Some of the methods are standard; some, modified to suit our needs; and still others, developed at Sandia. The authors have attempted to present all methods in a simple and concise manner but in sufficient detail to make them readily usable. It is not to be inferred that these methods are universal for any type of sample, but they have been found very reliable for the types of samples mentioned

  10. An Innovative Multimedia Approach to Laboratory Safety

    Science.gov (United States)

    Anderson, M. B.; Constant, K. P.

    1996-01-01

    A new approach for teaching safe laboratory practices has been developed for materials science laboratories at Iowa State university. Students are required to complete a computerized safety tutorial and pass an exam before working in the laboratory. The safety tutorial includes sections on chemical, electrical, radiation, and high temperature safety. The tutorial makes use of a variety of interactions, including 'assembly' interactions where a student is asked to drag and drop items with the mouse (either labels or pictures) to an appropriate place on the screen (sometimes in a specific order). This is extremely useful for demonstrating safe lab practices and disaster scenarios. Built into the software is a record tracking scheme so that a professor can access a file that records which students have completed the tutorial and their scores on the exam. This paper will describe the development and assessment of the safety tutorials.

  11. Multiprog Virtual Laboratory Applied to PLC Programming Learning

    Science.gov (United States)

    Shyr, Wen-Jye

    2010-01-01

    This study develops a Multiprog virtual laboratory for a mechatronics education designed to teach how to programme a programmable logic controller (PLC). The study was carried out with 34 students in the Department of Industry Education and Technology at National Changhua University of Education in Taiwan. In total, 17 students were assigned to…

  12. [Standardization of terminology in laboratory medicine I].

    Science.gov (United States)

    Yoon, Soo Young; Yoon, Jong Hyun; Min, Won Ki; Lim, Hwan Sub; Song, Junghan; Chae, Seok Lae; Lee, Chang Kyu; Kwon, Jung Ah; Lee, Kap No

    2007-04-01

    Standardization of medical terminology is essential for data transmission between health-care institutions or clinical laboratories and for maximizing the benefits of information technology. Purpose of our study was to standardize the medical terms used in the clinical laboratory, such as test names, units, terms used in result descriptions, etc. During the first year of the study, we developed a standard database of concept names for laboratory terms, which covered the terms used in government health care centers, their branch offices, and primary health care units. Laboratory terms were collected from the electronic data interchange (EDI) codes from National Health Insurance Corporation (NHIC), Logical Observation Identifier Names and Codes (LOINC) database, community health centers and their branch offices, and clinical laboratories of representative university medical centers. For standard expression, we referred to the English-Korean/ Korean-English medical dictionary of Korean Medical Association and the rules for foreign language translation. Programs for mapping between LOINC DB and EDI code and for translating English to Korean were developed. A Korean standard laboratory terminology database containing six axial concept names such as components, property, time aspect, system (specimen), scale type, and method type was established for 7,508 test observations. Short names and a mapping table for EDI codes and Unified Medical Language System (UMLS) were added. Synonym tables for concept names, words used in the database, and six axial terms were prepared to make it easier to find the standard terminology with common terms used in the field of laboratory medicine. Here we report for the first time a Korean standard laboratory terminology database for test names, result description terms, result units covering most laboratory tests in primary healthcare centers.

  13. Project management: importance for diagnostic laboratories.

    Science.gov (United States)

    Croxatto, A; Greub, G

    2017-07-01

    The need for diagnostic laboratories to improve both quality and productivity alongside personnel shortages incite laboratory managers to constantly optimize laboratory workflows, organization, and technology. These continuous modifications of the laboratories should be conducted using efficient project and change management approaches to maximize the opportunities for successful completion of the project. This review aims at presenting a general overview of project management with an emphasis on selected critical aspects. Conventional project management tools and models, such as HERMES, described in the literature, associated personal experience, and educational courses on management have been used to illustrate this review. This review presents general guidelines of project management and highlights their importance for microbiology diagnostic laboratories. As an example, some critical aspects of project management will be illustrated with a project of automation, as experienced at the laboratories of bacteriology and hygiene of the University Hospital of Lausanne. It is important to define clearly beforehand the objective of a project, its perimeter, its costs, and its time frame including precise duration estimates of each step. Then, a project management plan including explanations and descriptions on how to manage, execute, and control the project is necessary to continuously monitor the progression of a project to achieve its defined goals. Moreover, a thorough risk analysis with contingency and mitigation measures should be performed at each phase of a project to minimize the impact of project failures. The increasing complexities of modern laboratories mean clinical microbiologists must use several management tools including project and change management to improve the outcome of major projects and activities. Copyright © 2017 The Author(s). Published by Elsevier Ltd.. All rights reserved.

  14. Establishing a temporal bone laboratory: considerations for ENT specialist training.

    LENUS (Irish Health Repository)

    Fennessy, B G

    2012-02-01

    Cadaveric temporal bone dissection in a temporal bone laboratory is a vital component in training safe, competent otorhinolaryngologists. Recent controversies pertaining to organ retention have resulted in a more limited supply of temporal bones. Consequently, current trainees are dissecting far fewer bones than their consultants. We discuss the establishment of a temporal bone laboratory in the Department of Anatomy in the University College Cork, from the timely preparation and preservation of the tissue to its disposal. Comparisons are drawn between our experience and that of the United States training schemes. The temporal bone laboratory in Cork is the only one in existence in Ireland. The exposure and experience obtained by registrars rotating through Cork, has resulted in noticeable improvements in their operative abilities. The temporal bone laboratory remains a core component to training. It is hoped that this article may facilitate other units overcoming obstacles to establish a temporal bone laboratory.

  15. Government-University-Industry-Research Roundtable

    Energy Technology Data Exchange (ETDEWEB)

    1995-02-01

    Roundtable projects active during 1993 are described in this section. Projects completed in prior years are not included here, but publications resulting from them are included in the list of publications which are attached. Such prior projects include nurturing science and engineering talent, research facility financing, multidisciplinary research and education, university-industry-federal laboratory partnerships, and federal-state cooperation in science and technology.

  16. Creating and Using a Computer Networking and Systems Administration Laboratory Built under Relaxed Financial Constraints

    Science.gov (United States)

    Conlon, Michael P.; Mullins, Paul

    2011-01-01

    The Computer Science Department at Slippery Rock University created a laboratory for its Computer Networks and System Administration and Security courses under relaxed financial constraints. This paper describes the department's experience designing and using this laboratory, including lessons learned and descriptions of some student projects…

  17. Need Assessment on Jimma University Community Schools (JUCS ...

    African Journals Online (AJOL)

    Journal Home > Vol 3, No 2 (2008) > ... JUCS was institutionalized as one of Jimma University strategic devices for staff retention in providing quality of education for ... laboratories and equipment, library and pedagogical center, lack of parent ...

  18. Environmental Management Plan for the Chemical Engineering Laboratory (LIQ) of the National University of Colombia, Bogotá

    OpenAIRE

    Javier Gama Chávez; Martha Lozano García; Paulo César Narváez Rincón; Óscar Javier Suárez Medina

    2004-01-01

    An Enviromental Management Plan was formulated with the objective of improving the environmental performance of the Chemical Engineering Laboratory (LIQ). The plan was supported on the principles established by the ISO 140001 standard. In a first step, an environmental politic was proposed. Next, by means of an initial review of the laboratory, the most significant impacts related to the activities developed in the Laboratory were identified: dangerous chemical wastes accumulation, water cont...

  19. Fatal laboratory-acquired infection with an attenuated Yersinia pestis Strain--Chicago, Illinois, 2009.

    Science.gov (United States)

    2011-02-25

    On September 18, 2009, the Chicago Department of Public Health (CDPH) was notified by a local hospital of a suspected case of fatal laboratory-acquired infection with Yersinia pestis, the causative agent of plague. The patient, a researcher in a university laboratory, had been working along with other members of the laboratory group with a pigmentation-negative (pgm-) attenuated Y. pestis strain (KIM D27). The strain had not been known to have caused laboratory-acquired infections or human fatalities. Other researchers in a separate university laboratory facility in the same building had contact with a virulent Y. pestis strain (CO92) that is considered a select biologic agent; however, the pgm- attenuated KIM D27 is excluded from the National Select Agent Registry. The university, CDPH, the Illinois Department of Public Health (IDPH), and CDC conducted an investigation to ascertain the cause of death. This report summarizes the results of that investigation, which determined that the cause of death likely was an unrecognized occupational exposure (route unknown) to Y. pestis, leading to septic shock. Y. pestis was isolated from premortem blood cultures. Polymerase chain reaction (PCR) identified the clinical isolate as a pgm- strain of Y. pestis. Postmortem examination revealed no evidence of pneumonic plague. A postmortem diagnosis of hereditary hemochromatosis was made on the basis of histopathologic, laboratory, and genetic testing. One possible explanation for the unexpected fatal outcome in this patient is that hemochromatosis-induced iron overload might have provided the infecting KIM D27 strain, which is attenuated as a result of defects in its ability to acquire iron, with sufficient iron to overcome its iron-acquisition defects and become virulent. Researchers should adhere to recommended biosafety practices when handling any live bacterial cultures, even attenuated strains, and institutional biosafety committees should implement and maintain effective

  20. The LLNL Multiuser Tandem Laboratory computer-controlled radiation monitoring system

    International Nuclear Information System (INIS)

    Homann, S.G.

    1992-01-01

    The Physics Department of the Lawrence Livermore National Laboratory (LLNL) recently constructed a Multiuser Tandem Laboratory (MTL) to perform a variety of basic and applied measurement programs. The laboratory and its research equipment were constructed with support from a consortium of LLNL Divisions, Sandia National Laboratories Livermore, and the University of California. Primary design goals for the facility were inexpensive construction and operation, high beam quality at a large number of experimental stations, and versatility in adapting to new experimental needs. To accomplish these goals, our main design decisions were to place the accelerator in an unshielded structure, to make use of reconfigured cyclotrons as effective switching magnets, and to rely on computer control systems for both radiological protection and highly reproducible and well-characterized accelerator operation. This paper addresses the radiological control computer system

  1. Universal mortality law and immortality

    Science.gov (United States)

    Azbel', Mark Ya.

    2004-10-01

    Well-protected human and laboratory animal populations with abundant resources are evolutionarily unprecedented. Physical approach, which takes advantage of their extensively quantified mortality, establishes that its dominant fraction yields the exact law, which is universal for all animals from yeast to humans. Singularities of the law demonstrate new kinds of stepwise adaptation. The law proves that universal mortality is an evolutionary by-product, which at any given age is reversible, independent of previous life history, and disposable. Life expectancy may be extended, arguably to immortality, by minor biological amendments in the animals. Indeed, in nematodes with a small number of perturbed genes and tissues it increased 6-fold (to 430 years in human terms), with no apparent loss in health and vitality. The law relates universal mortality to specific processes in cells and their genetic regulation.

  2. McMaster Accelerator Laboratory. Annual report 1987

    International Nuclear Information System (INIS)

    1987-01-01

    During the past year the trend has continued of diversification of the research programmes in the laboratory. Research using the techniques of accelerator mass spectrometry is flourishing and there is increased activity in the fields of surface science and nuclear medicine. The nuclear physics activity continues strong but at a reduced level. The FN accelerators performed excellently during the year and the nuclear physics programme benefitted from the acquisition of a computer-controlled analysing-magnet NMR. Surface science at McMaster University is involved with the Ontario Government Centre of Excellence in Materials Science. This will involve new equipment for studies in molecular beam epitaxy. The research studies in brain function is also another growing area in the laboratory

  3. The Benefits of ISO/IEC 17025 Accreditation of Radiopharmacy laboratory

    OpenAIRE

    Apostolova, Paulina; Sterjova, Marija; Smilkov, Katarina; Gjorgieva Ackova, Darinka; Janevik-Ivanovska, Emilija

    2015-01-01

    Laboratory is a part of the Department of Pharmacy in the Faculty of Medical Sciences, at the Goce Delcev University in Štip. Main activities are focused on improving knowledge for radiopharmacy of bachelor students, master students and doing PhD thesis. Also, we are trying to provide services for external associates as a testing laboratory. As a developing country, we are facing with the begging’s of the process of accreditation. The accreditation process is a lengthy and time consuming m...

  4. Technology transfer: federal legislation that helps businesses and universities

    Science.gov (United States)

    Oaks, Bill G.

    1992-05-01

    In 1980, Congress enacted the Stevenson-Wydler Technology Innovation Act to encourage federal laboratories to `spin off' their technology to industry, universities, and state and local governments. The law reflected Congressional concern for the economic well-being of the nation and the need for the United States to maintain its technological superiority. Almost half the nation's research is conducted in federal laboratories. Other legislation, the Small Business Innovation Development Act of 1982 and the National Cooperative Research Act of 1984, was followed by the Technology Transfer Act of 1986 that strengthened and consolidated policy concerning the technology transfer responsibilities of the federal labs. The law allows the labs to directly license their patents and permits the issuance of exclusive licenses. It allows the labs to enter into cooperative research and development agreements with industry, universities, and state and local governments. It institutionalized the Federal Laboratory consortium which, to that point in time, had been a formal but largely unrecognized body. Under the provisions of the law, the United States Air Force Rome Laboratory located in Rome, New York, as the Air Force lead laboratory in photonics research entered into an agreement with the Governor of the State of New York to collaborate in photonics research and development. Subsequent to that agreement, the state established the not-for-profit New York State Photonics Development Corporation in Rome to facilitate business access to Rome Laboratory's photonics research facilities and technologies. Rome Laboratory's photonics research and development program is described in this paper. The Technology Transfer Act of 1986 is summarized, and the roles and missions of the New York State Photonics Development Corporation is explained.

  5. Prevalence of estimated GFR reporting among US clinical laboratories.

    Science.gov (United States)

    Accetta, Nancy A; Gladstone, Elisa H; DiSogra, Charles; Wright, Elizabeth C; Briggs, Michael; Narva, Andrew S

    2008-10-01

    Routine laboratory reporting of estimated glomerular filtration rate (eGFR) may help clinicians detect kidney disease. The current national prevalence of eGFR reporting in clinical laboratories is unknown; thus, the extent of the situation of laboratories not routinely reporting eGFR with serum creatinine results is not quantified. Observational analysis. National Kidney Disease Education Program survey of clinical laboratories conducted in 2006 to 2007 by mail, web, and telephone follow-up. A national random sample, 6,350 clinical laboratories, drawn from the Federal Clinical Laboratory Improvement Amendments database and stratified by 6 major laboratory types/groupings. Laboratory reports serum creatinine results. Reporting eGFR values with serum creatinine results. Percentage of laboratories reporting eGFR along with reporting serum creatinine values, reporting protocol, eGFR formula used, and style of reporting cutoff values. Of laboratories reporting serum creatinine values, 38.4% report eGFR (physician offices, 25.8%; hospitals, 43.6%; independents, 38.9%; community clinics, 47.2%; health fair/insurance/public health, 45.5%; and others, 43.2%). Physician office laboratories have a reporting prevalence lower than other laboratory types (P laboratories reporting eGFR, 66.7% do so routinely with all adult serum creatinine determinations; 71.6% use the 4-variable Modification of Diet in Renal Disease Study equation; and 45.3% use the ">60 mL/min/1.73 m(2)" reporting convention. Independent laboratories are least likely to routinely report eGFR (50.6%; P laboratories across all strata are more likely to report eGFR (P laboratories, federal database did not have names of laboratory directors/managers (intended respondents), assumed accuracy of federal database for sample purposes. Routine eGFR reporting with serum creatinine values is not yet universal, and laboratories vary in their reporting practices.

  6. [Blood volume for biochemistry determinations--laboratory needs and everyday practice].

    Science.gov (United States)

    Sztefko, Krystyna; Mamica, Katarzyna; Bugajska, Jolanta; Maziarz, Barbara; Tomasik, Przemysław

    2014-01-01

    Blood loss due to diagnostic phlebotomy jest a very serious problem, especially for newborn, infants and critically ill patients on intensive care units. Although single blood loss can be easily tolerated in adults, in small babies and in patients who are frequently monitored based on laboratory tests iatrogenic anaemia can occur. To evaluate the blood volume drawn for routine biochemistry tests in relation to patient age and the number of parameters requested. Blood volume drawn for routine biochemistry measurements from patients hospitalized in University Children's Hospital (N = 2980, children age from one day to 18 years) and in University Hospital (N = 859, adults, aged > 1.8 years) in Cracow has been analyzed. Blood volume was calculated based on regular tube diameter and blood heights in the tube. In case of microvettes the blood volume was 0.2 ml. Statistical analysis has been performed by using PRISM 5.0. The statistical significance was set at p nurses and doctors should include the information about current laboratory automation and methods miniaturization; 2) The amount of blood volume needed by laboratory for the requested number of tests should always be taken into account when diagnostic phlebotomy is necessary.

  7. A woman like you: Women scientists and engineers at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Benkovitz, Carmen; Bernholc, Nicole; Cohen, Anita; Eng, Susan; Enriquez-Leder, Rosario; Franz, Barbara; Gorden, Patricia; Hanson, Louise; Lamble, Geraldine; Martin, Harriet; Mastrangelo, Iris; McLane, Victoria; Villela, Maria-Alicia; Vivirito, Katherine; Woodhead, Avril

    1991-01-01

    This publication by the women in Science and Engineering introduces career possibilities in science and engineering. It introduces what work and home life are like for women who have already entered these fields. Women at Brookhaven National Laboratory work in a variety of challenging research roles -- from biologist and environmental scientist to safety engineer, from patent lawyer to technician. Brookhaven National Laboratory is a multi-program laboratory which carries out basic and applied research in the physical, biomedical and environmental sciences and in selected energy technologies. The Laboratory is managed by Associated University, Inc., under contract with the US Department of Energy. Brookhaven and the other national laboratories, because of their enormous research resources, can play a critical role in a education and training of the workforce.

  8. Corrected Launch Speed for a Projectile Motion Laboratory

    Science.gov (United States)

    Sanders, Justin M.; Boleman, Michael W.

    2013-01-01

    At our university, students in introductory physics classes perform a laboratory exercise to measure the range of a projectile fired at an assigned angle. A set of photogates is used to determine the initial velocity of the projectile (the launch velocity). We noticed a systematic deviation between the experimentally measured range and the range…

  9. [Survivability of Candida fungi and workpost safety in the university mycological laboratory].

    Science.gov (United States)

    Ejdys, Elzbieta

    2009-01-01

    To ensure the security for persons using the laboratory for research purposes it was decided to determine the influence of the number of employees and the time of their work on the survivability and vitality of Candida albicans, C. dubliniensis and C. tropicalis. Working time and the number of people in the room were monitored. Temperature and air relative humidity were checked. Every two weeks the vitality and survivability of fungi were assessed with the technique of intravital coloring in methylene blue. During the observation of the examined species no 100% mortality was noted. After half a year of observation, the percentage of living cells in the smear did not exceed 10%. The greatest fluctuations in the survivability and its lowest value (5%) were found in C. albicans in the drop. The mortality rate in similar trials did not exceed 30% in C. dubliniensis and C. tropicalis isolates. To secure the protection of employees one should limit the number of people entering the laboratory, use face masks, refresh archival isolate, and monitor hygiene procedures twice a year, depending on the frequency of changing objects and research team.

  10. The University of Kansas High-Throughput Screening laboratory. Part I: meeting drug-discovery needs in the heartland of America with entrepreneurial flair.

    Science.gov (United States)

    McDonald, Peter R; Roy, Anuradha; Chaguturu, Rathnam

    2011-05-01

    The University of Kansas High-Throughput Screening (KU HTS) core is a state-of-the-art drug-discovery facility with an entrepreneurial open-service policy, which provides centralized resources supporting public- and private-sector research initiatives. The KU HTS core applies pharmaceutical industry project-management principles in an academic setting by bringing together multidisciplinary teams to fill critical scientific and technology gaps, using an experienced team of industry-trained researchers and project managers. The KU HTS proactively engages in supporting grant applications for extramural funding, intellectual-property management and technology transfer. The KU HTS staff further provides educational opportunities for the KU faculty and students to learn cutting-edge technologies in drug-discovery platforms through seminars, workshops, internships and course teaching. This is the first instalment of a two-part contribution from the KU HTS laboratory.

  11. Comparison of the analysis result between two laboratories using different methods

    International Nuclear Information System (INIS)

    Sri Murniasih; Agus Taftazani

    2017-01-01

    Comparison of the analysis result of volcano ash sample between two laboratories using different analysis methods. The research aims to improve the testing laboratory quality and cooperate with the testing laboratory from other country. Samples were tested at the Center for Accelerator of Science and Technology (CAST)-NAA laboratory using NAA, while at the University of Texas (UT) USA using ICP-MS and ENAA method. From 12 elements of target, CAST-NAA able to present 11 elements of data analysis. The comparison results shows that the analysis of the K, Mn, Ti and Fe elements from both laboratories have a very good comparison and close one to other. It is known from RSD values and correlation coefficients of the both laboratories analysis results. While observed of the results difference known that the analysis results of Al, Na, K, Fe, V, Mn, Ti, Cr and As elements from both laboratories is not significantly different. From 11 elements were reported, only Zn which have significantly different values for both laboratories. (author)

  12. Stimulating Manufacturing Excellence through University-Industry Interaction

    DEFF Research Database (Denmark)

    Riis, Jens Ove

    2001-01-01

    This paper considers what a university engineering school can do to stimulate manufacturing excellence in industry. Aalborg University, with its unique use of problem-based learning methods, is used as a case example. This approach is also embedded in a new research initiative, the Centre...... for Industrial Production. Examples of industry involvement in research and development projects are given. Such university–industry collaboration will not only benefit the development of competencies in large and small industrial enterprises, but will also provide a laboratory setting for the study...

  13. The Effect of Using 3E, 5E Learning Cycle in General Chemistry Laboratory to Prospective Science Teachers Attitude and Perceptions to the Science, Chemistry and Laboratory

    OpenAIRE

    Toprak, Fatih; Çelikler, Dilek

    2013-01-01

    The study aimed to investigate the emerging changes in prospective science teachers" attitudes and perceptions towards science, chemistry and laboratory resulting from the implementation of 3E. 5E learning cycles and traditional instruction in laboratory environment in which learning is achieved by doing and experiencing. The study included 74 first grade prospective science teachers from Ondokuz Mayıs University at the Department of Science Education. In the study, quasi-experimental pre-tes...

  14. The Effect of Using 3E, 5E Learning Cycle in General Chemistry Laboratory to Prospective Scinence Teachers’ Attitude and Perceptions to the Science, Chemistry and Laboratory

    OpenAIRE

    Toprak, Fatih; Çelikler, Dilek

    2013-01-01

    The study aimed to investigate the emerging changes in prospective science teachers" attitudes and perceptions towards science, chemistry and laboratory resulting from the implementation of 3E. 5E learning cycles and traditional instruction in laboratory environment in which learning is achieved by doing and experiencing. The study included 74 first grade prospective science teachers from Ondokuz Mayıs University at the Department of Science Education. In the study, quasi-experimental pr...

  15. Occupational radiation exposures in research laboratories

    Energy Technology Data Exchange (ETDEWEB)

    Vaccari, S.; Papotti, E. [Parma Univ., Health Physics (Italy); Pedrazzi, G. [Parma Univ., Dept. of Public Health (Italy)

    2006-07-01

    Radioactive sources are widely used in many research activities at University centers. In particular, the activities concerning use of sealed form ({sup 57}Co in Moessbauer application) and unsealed form ({sup 3}H, {sup 14}C, {sup 32}P in radioisotope laboratories) are analyzed. The radiological impact of these materials and potential effective doses to researchers and members of the public were evaluated to show compliance with regulatory limits. A review of the procedures performed by researchers and technicians in the research laboratories with the relative dose evaluations is presented in different situations, including normal operations and emergency situations, for example the fire. A study of the possible exposure to radiation by workers, restricted groups of people, and public in general, as well as environmental releases, is presented. (authors)

  16. Towards laboratory detection of topological vortices in superfluid phases of QCD

    Science.gov (United States)

    Das, Arpan; Dave, Shreyansh S.; de, Somnath; Srivastava, Ajit M.

    2017-10-01

    Topological defects arise in a variety of systems, e.g. vortices in superfluid helium to cosmic strings in the early universe. There is an indirect evidence of neutron superfluid vortices from the glitches in pulsars. One also expects that the topological defects may arise in various high baryon density phases of quantum chromodynamics (QCD), e.g. superfluid topological vortices in the color flavor locked (CFL) phase. Though vastly different in energy/length scales, there are universal features in the formation of all these defects. Utilizing this universality, we investigate the possibility of detecting these topological superfluid vortices in laboratory experiments, namely heavy-ion collisions (HICs). Using hydrodynamic simulations, we show that vortices can qualitatively affect the power spectrum of flow fluctuations. This can give an unambiguous signal for superfluid transition resulting in vortices, allowing for the check of defect formation theories in a relativistic quantum field theory system, and the detection of superfluid phases of QCD. Detection of nucleonic superfluid vortices in low energy HICs will give opportunity for laboratory controlled study of their properties, providing crucial inputs for the physics of pulsars.

  17. University of Washington Center for Child Environmental Health Risks Research

    Data.gov (United States)

    Federal Laboratory Consortium — The theme of the University of Washington based Center for Child Environmental Health Risks Research (CHC) is understanding the biochemical, molecular and exposure...

  18. A Guide to Undergraduate Science Course and Laboratory Improvements.

    Science.gov (United States)

    Straumanis, Joan, Ed.; Watson, Robert F., Ed.

    Reported are activities carried out at colleges and universities during 1976-1980 with support from the National Science Foundation's Local Course Improvement (LOCI) and Instructional Scientific Equipment Program (ISEP). It is intended as a reference for persons interested in current course and laboratory developments in the sciences at the…

  19. Magnetic mirror fusion research at the Lawrence Livermore Laboratory

    International Nuclear Information System (INIS)

    Post, R.F.

    1979-01-01

    An overall view is given of progress and plans for pressing forward with mirror research at Livermore. No detail is given on any one subject, and many interesting investigations being carried out at University laboratories in the U.S. that augment and support efforts at Livermore are omitted

  20. Transplantation of the heart: An overview of 40 years' clinical and research experience at Groote Schuur Hospital and the University of Cape Town: Part II. Laboratory research experience.

    Science.gov (United States)

    Hassoulas, J

    2012-03-29

    Extensive experimental research on various aspects of heart transplantation was undertaken during the first 2 decades. An overview of this work is presented, and some still unpublished work has been included. Experimental laboratory investigation was an integral activity of the cardiac transplantation programme at the University of Cape Town over these years, and has remained so ever since. These studies provided invaluable fundamental information upon which future clinical work was based. It is therefore necessary to briefly mention and discuss this information, most of which has been published in detail by the various investigators concerned.

  1. Multi-University Southeast INIE Consortium

    Energy Technology Data Exchange (ETDEWEB)

    Ayman Hawari; Nolan Hertel; Mohamed Al-Sheikhly; Laurence Miller; Abdel-Moeze Bayoumi; Ali Haghighat; Kenneth Lewis

    2010-12-29

    2 Project Summary: The Multi-University Southeast INIE Consortium (MUSIC) was established in response to the US Department of Energy’s (DOE) Innovations in Nuclear Infrastructure and Education (INIE) program. MUSIC was established as a consortium composed of academic members and national laboratory partners. The members of MUSIC are the nuclear engineering programs and research reactors of Georgia Institute of Technology (GIT), North Carolina State University (NCSU), University of Maryland (UMD), University of South Carolina (USC), and University of Tennessee (UTK). The University of Florida (UF), and South Carolina State University (SCSU) were added to the MUSIC membership in the second year. In addition, to ensure proper coordination between the academic community and the nation’s premier research and development centers in the fields of nuclear science and engineering, MUSIC created strategic partnerships with Oak Ridge National Laboratory (ORNL) including the Spallation Neutron Source (SNS) project and the Joint Institute for Neutron Scattering (JINS), and the National Institute of Standards and Technology (NIST). A partnership was also created with the Armed Forces Radiobiology Research Institute (AFRRI) with the aim of utilizing their reactor in research if funding becomes available. Consequently, there are three university research reactors (URRs) within MUSIC, which are located at NCSU (1-MW PULSTAR), UMD (0.25-MW TRIGA) and UF (0.10-MW Argonaut), and the AFRRI reactor (1-MW TRIGA MARK F). The overall objectives of MUSIC are: a) Demonstrate that University Research Reactors (URR) can be used as modern and innovative instruments of research in the basic and applied sciences, which include applications in fundamental physics, materials science and engineering, nondestructive examination, elemental analysis, and contributions to research in the health and medical sciences, b) Establish a strong technical collaboration between the nuclear engineering

  2. Designing an undergraduate laboratory course in general chemistry

    Directory of Open Access Journals (Sweden)

    Vianna José F.

    1999-01-01

    Full Text Available From an analysis of a learning model based on the theory of information processing four hypothesis were developed for improving the design of laboratory courses. Three of these hypotheses concerned specific procedures to minimise the load on students' working memories (or working spaces and the fourth hypothesis was concerned with the value of mini-projects in enhancing meaningful learning of the knowledge and skills underpinning the set experiments. A three-year study of a first year undergraduate chemistry laboratory course at a Scottish university has been carried out to test these four hypotheses. This paper reports the results of the study relevant to the three hypotheses about the burden on students' working spaces. It was predicted from the learning model that the load on students working space should be reduced by appropriate changes to the written instructions and the laboratory organisation and by the introduction of prelab-work and prelab-training in laboratory techniques. It was concluded from research conducted over the three years period that all these hypothesised changes were effective both in reducing the load on students' working spaces and in improving their attitudes to the laboratory course.

  3. Developing a Novel USB-PLC Controller for a Mechatronics Cloud Laboratory

    Directory of Open Access Journals (Sweden)

    Wen-Jye Shyr

    2013-04-01

    Full Text Available This study proposes the development and implementation of a novel Universal Serial Bus (USB-Programmable Logic Controller (PLC, called a USB-PLC controller, for a mechatronics cloud laboratory. The aim of a mechatronics cloud laboratory is to provide state of the art research quality equipment to students, allowing them to conduct hands-on experiments via the Internet. One objective of the cloud laboratory is to not only provide equipment for conducting set experiments, but also to provide a means for students to access research equipment in order to conduct individual research experiments. The proposed controller for these cloud laboratory experiments has been chosen in order to expose the students to as many different engineering and technology disciplines as possible.

  4. John Dewey as Administrator: The Inglorious End of the Laboratory School in Chicago

    Science.gov (United States)

    Knoll, Michael

    2015-01-01

    The Laboratory School of the University of Chicago founded by John Dewey in 1896 is considered as one of the most innovative schools of progressive education. Its history, and specifically its sudden end, is still of general interest. In sympathy with Dewey, most historians tend to put the main blame for the tragedy on University President William…

  5. Laboratory evaluation of the improved tube test detection limits for β ...

    African Journals Online (AJOL)

    Administrator

    1Antibiotic research laboratory, Dept. of Food Science, Swedish University of Agricultural Sciences, P.O. Box 7051, S- ... particular commonly utilised in lactating animals (Mandell and Perti ..... for other families of drugs such as sulfa drugs,.

  6. Partnering with Sandia National Laboratories through alliances or consortia

    Energy Technology Data Exchange (ETDEWEB)

    Winchell, B.M.

    1994-12-01

    To better facilitate working with industry, groups of industrial participants, and partners in alliances or consortia, Sandia National Laboratories presents information helpful to those outside groups as to the forms of arrangements that may be used to better facilitate partnering relationships between Sandia National Laboratories and consortia or alliances of outside parties. It is expected that these alliances and consortia will include both large and small for-profit industrial concerns, as well as not-for-profit entities such as universities, institutes, other research facilities, and other nonprofit institutions or consortia containing institutions. The intent of this report is to provide such outside groups with information that will facilitate rapid interactions with Sandia National Laboratories through some of these forms of business which will be discussed in this report. These are not the only approaches to facilitating business interactions with Sandia National Laboratories and it is not intended that this report be legal advice or required approaches to doing business with Sandia National Laboratories. The intent of this report is merely to suggest ways in which Sandia National Laboratories can work with outside parties in the most expeditious manner.

  7. Partnering with Sandia National Laboratories through alliances or consortia

    Energy Technology Data Exchange (ETDEWEB)

    Winchell, B.M.

    1994-04-01

    To better facilitate working with industry, groups of industrial participants, and partners in alliances or consortia, Sandia National laboratories presents information helpful to those outside groups as to the forms of arrangements that may be used to better facilitate partnering relationships between Sandia National Laboratories and consortia or alliances of outside parties. It is expected that these alliances and consortia will include both large and small for-profit industrial concerns, as well as not-for-profit entities such as universities, institutes, other research facilities, and other nonprofit institutions or consortia containing institutions. The intent of this report is to provide such outside groups with information that will facilitate rapid interactions with Sandia National Laboratories through some of these forms of business which will be discussed in this report. These are not the only approaches to facilitating business interactions with Sandia National Laboratories and it is not intended that this report be legal advice or required approaches to doing business with Sandia National Laboratories. The intent of this report is merely to suggest ways in which Sandia National Laboratories can work with outside parties in the most expeditious manner.

  8. Sensitisation to Aspergillus fumigatus and Penicillium notatum in laboratory workers.

    Science.gov (United States)

    Boscolo, P; Piccolomini, R; Benvenuti, F; Catamo, G; Di Gioacchino, M

    1999-01-01

    Four workers in medical research laboratories, located in a basement level of a University facility equipped with a humidified air conditioning system, complained of cough and/or asthma and/or rhinitis during their normal working activities. Since exposure to toxic compounds was very low (similar to that of the outdoor environment) only microbiological monitoring was performed. Aspergillus fumigatus and Penicillium notatum were found in some laboratories. Eight laboratory workers (including the 4 symptomatic subjects) out of 26 investigated were found to be atopic. Specific IgE sensitisation to Aspergillus fumigatus was found in the 8 atopic and in the 6 non-atopic workers, while Penicililum notatum was found in 7 atopic and 4 non-atopic subjects. History, physical examination and laboratory data excluded the presence of aspergillosis or allergic bronchial aspergillosis in the sensitised subjects. Our results suggest that evaluation of immune parameters, along with monitoring of the working environment, may reduce the risk of sensitisation and/or allergic symptoms in atopic laboratory workers.

  9. Subatomic tracking finds clues to the unseen universe

    CERN Multimedia

    Glanz, J

    2004-01-01

    "An experiment that tracks subtle motions of subatomic particles called muons has found tantalizing evidence for a vast shadow universe of normally unseen matter existing side by side with ours, scientists at the Brookhaven National Laboratory said yesterday" (1 page)

  10. Japan acts to speed technology transfer from universities

    CERN Multimedia

    Saegusa, A

    1999-01-01

    A Japanese law will take effect in the autumn to promote technology transfer from universities and laboratories. The new measures aim to encourage collaborations with the commercial sector and allow industrial research partners to retain title to inventions (1 page).

  11. Piloting Blended Strategies to Resolve Laboratory Capacity Issues in a First-Semester General Chemistry Course

    Science.gov (United States)

    Burchett, Shayna; Hayes, Jack; Pfaff, Annalise; Satterfield, Emmalou T.; Skyles, Amy; Woelk, Klaus

    2016-01-01

    Laboratory capacity is an issue that has plagued education for more than a century. New buildings, late night classes, and virtual laboratories have offered transitory relief at great expense. Missouri University of Science and Technology is employing blended strategies to increase capacity and student success. Blended strategies expand learning…

  12. Nuclear science and engineering education at a university research reactor

    International Nuclear Information System (INIS)

    Loveland, W.

    1993-01-01

    The role of an on-site irradiation facility in nuclear science and engineering education is examined. Using the example of a university research reactor, the use of such devices in laboratory instruction, public outreach programs, special instructional programs, research, etc. is discussed. Examples from the Oregon State University curriculum in nuclear chemistry, nuclear engineering and radiation health are given. (author) 1 tab

  13. Virtual and Remote Robotic Laboratory Using EJS, MATLAB and LabVIEW

    Directory of Open Access Journals (Sweden)

    Jose Antonio Lopez-Orozco

    2013-02-01

    Full Text Available This paper describes the design and implementation of a virtual and remote laboratory based on Easy Java Simulations (EJS and LabVIEW. The main application of this laboratory is to improve the study of sensors in Mobile Robotics, dealing with the problems that arise on the real world experiments. This laboratory allows the user to work from their homes, tele-operating a real robot that takes measurements from its sensors in order to obtain a map of its environment. In addition, the application allows interacting with a robot simulation (virtual laboratory or with a real robot (remote laboratory, with the same simple and intuitive graphical user interface in EJS. Thus, students can develop signal processing and control algorithms for the robot in simulation and then deploy them on the real robot for testing purposes. Practical examples of application of the laboratory on the inter-University Master of Systems Engineering and Automatic Control are presented.

  14. Virtual and remote robotic laboratory using EJS, MATLAB and LabVIEW.

    Science.gov (United States)

    Chaos, Dictino; Chacón, Jesús; Lopez-Orozco, Jose Antonio; Dormido, Sebastián

    2013-02-21

    This paper describes the design and implementation of a virtual and remote laboratory based on Easy Java Simulations (EJS) and LabVIEW. The main application of this laboratory is to improve the study of sensors in Mobile Robotics, dealing with the problems that arise on the real world experiments. This laboratory allows the user to work from their homes, tele-operating a real robot that takes measurements from its sensors in order to obtain a map of its environment. In addition, the application allows interacting with a robot simulation (virtual laboratory) or with a real robot (remote laboratory), with the same simple and intuitive graphical user interface in EJS. Thus, students can develop signal processing and control algorithms for the robot in simulation and then deploy them on the real robot for testing purposes. Practical examples of application of the laboratory on the inter-University Master of Systems Engineering and Automatic Control are presented.

  15. Triangle Universities Nuclear Laboratory annual report - TUNL XXIV, 1 July 1984-31 August 1985

    International Nuclear Information System (INIS)

    1985-01-01

    Research programs of the Triangle Nuclear Laboratory are discussed. These studies are based on reactions induced by polarized beam, protons, deuterons and neutrons. Individual programs are cataloged separately

  16. Status and prospects of a deep underground laboratory in China

    International Nuclear Information System (INIS)

    Kang, K J; Cheng, J P; Li, Y J; Yue, Q; Chen, Y H; Shen, M B; Wu, S Y

    2010-01-01

    An excellent candidate location for a deep underground laboratory with more than 2500 m of rock overburden has been identified at Sichuan Province in China. It can be accessed through a road tunnel of length 17.5 km, and is supported by services and amenities near the entrance provided by the local Ertan Hydropower Plant. The particle physics community in China is actively pursuing the construction of an underground laboratory at this location, under the leadership of Tsinghua University. Memorandum has been signed with Ertan Hydropower Plant which permits access to and construction of the underground laboratory - China JinPing Deep Underground Laboratory (CJPL). The basic features of this underground site, as well as the status and schedules of the construction of the first laboratory cavern are presented. The immediate goal is to have the first experiment operational in 2010, deploying an Ultra-Low-Energy Germanium detector for WIMP dark matter searches, with emphasis on the mass range of 1-10 GeV. The conceptual design of the experiment, as well as the future plans and prospects of the laboratory, will be surveyed.

  17. Conceptual design report for the University of Rochester cryogenic target delivery system

    International Nuclear Information System (INIS)

    Fagaly, R.L.; Alexander, N.B.; Bourque, R.F.; Dahms, C.F.; Lindgren, J.R.; Miller, W.J.; Bittner, D.N.; Hendricks, C.D.

    1993-05-01

    The upgrade of the Omega laser at the University of Rochester's Laboratory for Laser Energetics (UR/LLE) will result in a need for large targets filled with D 2 or Dt and maintained at cryogenic temperatures. This mandates a cryogenic target delivery system capable of filling, layering, characterizing and delivering cryogenic targets to the Omega Upgrade target chamber. The program goal is to design, construct, and test the entire target delivery system by June 1996. When completed (including an operational demonstration), the system will be shipped to Rochester for reassembly and commissioning in time for the Omega Upgrade cryogenic campaign, scheduled to start in 1998. General Atomics has been assigned the task of developing the conceptual design for the cryogenic target delivery system. Design and fabrication activities will be closely coordinated with the University of Rochester, Lawrence Livermore National laboratory (LLNL) and Los Alamos National Laboratory (LANL), drawing upon their knowledge base in fuel layering and cryogenic characterization. The development of a target delivery system for Omega could also benefit experiments at Lawrence Livermore National Laboratory and the other ICF Laboratories in that the same technologies could be applied to NOVA, the National Ignition Facility or the future Laboratory Microfusion Facility

  18. Conceptual design report for the University of Rochester cryogenic target delivery system

    Energy Technology Data Exchange (ETDEWEB)

    Fagaly, R.L.; Alexander, N.B.; Bourque, R.F.; Dahms, C.F.; Lindgren, J.R.; Miller, W.J. (General Atomics, San Diego, CA (United States)); Bittner, D.N.; Hendricks, C.D. (W.J. Schafer Associates, Livermore, CA (United States))

    1993-05-01

    The upgrade of the Omega laser at the University of Rochester's Laboratory for Laser Energetics (UR/LLE) will result in a need for large targets filled with D[sub 2] or Dt and maintained at cryogenic temperatures. This mandates a cryogenic target delivery system capable of filling, layering, characterizing and delivering cryogenic targets to the Omega Upgrade target chamber. The program goal is to design, construct, and test the entire target delivery system by June 1996. When completed (including an operational demonstration), the system will be shipped to Rochester for reassembly and commissioning in time for the Omega Upgrade cryogenic campaign, scheduled to start in 1998. General Atomics has been assigned the task of developing the conceptual design for the cryogenic target delivery system. Design and fabrication activities will be closely coordinated with the University of Rochester, Lawrence Livermore National laboratory (LLNL) and Los Alamos National Laboratory (LANL), drawing upon their knowledge base in fuel layering and cryogenic characterization. The development of a target delivery system for Omega could also benefit experiments at Lawrence Livermore National Laboratory and the other ICF Laboratories in that the same technologies could be applied to NOVA, the National Ignition Facility or the future Laboratory Microfusion Facility.

  19. Conceptual design report for the University of Rochester cryogenic target delivery system

    Energy Technology Data Exchange (ETDEWEB)

    Fagaly, R.L.; Alexander, N.B.; Bourque, R.F.; Dahms, C.F.; Lindgren, J.R.; Miller, W.J. [General Atomics, San Diego, CA (United States); Bittner, D.N.; Hendricks, C.D. [W.J. Schafer Associates, Livermore, CA (US)

    1993-05-01

    The upgrade of the Omega laser at the University of Rochester`s Laboratory for Laser Energetics (UR/LLE) will result in a need for large targets filled with D{sub 2} or Dt and maintained at cryogenic temperatures. This mandates a cryogenic target delivery system capable of filling, layering, characterizing and delivering cryogenic targets to the Omega Upgrade target chamber. The program goal is to design, construct, and test the entire target delivery system by June 1996. When completed (including an operational demonstration), the system will be shipped to Rochester for reassembly and commissioning in time for the Omega Upgrade cryogenic campaign, scheduled to start in 1998. General Atomics has been assigned the task of developing the conceptual design for the cryogenic target delivery system. Design and fabrication activities will be closely coordinated with the University of Rochester, Lawrence Livermore National laboratory (LLNL) and Los Alamos National Laboratory (LANL), drawing upon their knowledge base in fuel layering and cryogenic characterization. The development of a target delivery system for Omega could also benefit experiments at Lawrence Livermore National Laboratory and the other ICF Laboratories in that the same technologies could be applied to NOVA, the National Ignition Facility or the future Laboratory Microfusion Facility.

  20. Virtual laboratory for fusion research in Japan

    International Nuclear Information System (INIS)

    Tsuda, K.; Nagayama, Y.; Yamamoto, T.; Horiuchi, R.; Ishiguro, S.; Takami, S.

    2008-01-01

    A virtual laboratory system for nuclear fusion research in Japan has been developed using SuperSINET, which is a super high-speed network operated by National Institute of Informatics. Sixteen sites including major Japanese universities, Japan Atomic Energy Agency and National Institute for Fusion Science (NIFS) are mutually connected to SuperSINET with the speed of 1 Gbps by the end of 2006 fiscal year. Collaboration categories in this virtual laboratory are as follows: the large helical device (LHD) remote participation; the remote use of supercomputer system; and the all Japan ST (Spherical Tokamak) research program. This virtual laboratory is a closed network system, and is connected to the Internet through the NIFS firewall in order to keep higher security. Collaborators in a remote station can control their diagnostic devices at LHD and analyze the LHD data as they were at the LHD control room. Researchers in a remote station can use the supercomputer of NIFS in the same environment as NIFS. In this paper, we will describe detail of technologies and the present status of the virtual laboratory. Furthermore, the items that should be developed in the near future are also described

  1. Princípios de biossegurança aplicados aos laboratórios de ensino universitário de microbiologia e parasitologia Principles of biosafety applied to microbiology and parasitology laboratories in universities

    Directory of Open Access Journals (Sweden)

    Luis Antônio Sangioni

    2013-01-01

    Full Text Available Os laboratórios de ensino de microbiologia e parasitologia nas universidades brasileiras são ambientes em que as atividades integradas, envolvendo ensino, pesquisa e extensão, demandam a convivência de pessoas, agentes e amostras biológicas, equipamentos, reagentes e resíduos num mesmo espaço, sendo inevitável a exposição das pessoas aos diferentes riscos. As atividades realizadas nesses laboratórios necessitam empregar as normas de segurança; pois, uma vez que o fator humano é susceptível aos acidentes, os programas de educação em biossegurança são imprescindíveis. Entretanto, para que esses programas sejam efetivos, é necessário que os usuários estejam devidamente informados acerca dos princípios de biossegurança, bem como aptos a colocá-los em prática de maneira correta, a fim de garantir a segurança dos profissionais, acadêmicos e do meio ambiente. Esta revisão compila os principais aspectos da biossegurança relacionados aos princípios e à classificação dos riscos, dos agentes biológicos e dos níveis de contenção laboratorial, bem como aborda as boas práticas laboratoriais nos laboratórios de ensino, pesquisa e extensão em microbiologia e parasitologia.The teaching laboratories of microbiology and parasitology in Brazilian universities are places where the integrated activities of teaching, research and extension are performed and require the coexistence in the same space, persons, biological agents and samples, equipment, reagents and waste, and where is inevitable the exposure of people to the different risks. The laboratorial activities practiced in Brazilian universities require the need for safety standards, since the human factor is likely the causes of accidents in laboratories, educational programs in biosafety become indispensable to the prevention of risks. However, for an education program become effective is necessary that the users are fully informed about the biosafety principles, as

  2. Polish Code of Ethics of a Medical Laboratory Specialist.

    Science.gov (United States)

    Elżbieta, Puacz; Waldemar, Glusiec; Barbara, Madej-Czerwonka

    2014-09-01

    Along with the development of medicine, increasingly significant role has been played by the laboratory diagnostics. For over ten years the profession of the medical laboratory specialist has been regarded in Poland as the autonomous medical profession and has enjoyed a status of one of public trust. The process of education of medical laboratory specialists consists of a five-year degree in laboratory medicine, offered at Medical Universities, and of a five-year Vocational Specialization in one of the fields of laboratory medicine such as clinical biochemistry, medical microbiology, medical laboratory toxicology, medical laboratory cytomorphology and medical laboratory transfusiology. An important component of medical laboratory specialists' identity is awareness of inherited ethos obtained from bygone generations of workers in this particular profession and the need to continue its further development. An expression of this awareness is among others Polish Code of Ethics of a Medical Laboratory Specialist (CEMLS) containing a set of values and a moral standpoint characteristic of this type of professional environment. Presenting the ethos of the medical laboratory specialist is a purpose of this article. Authors focus on the role CEMLS plays in areas of professional ethics and law. Next, they reconstruct the Polish model of ethos of medical diagnostic laboratory personnel. An overall picture consists of a presentation of the general moral principles concerning execution of this profession and rules of conduct in relations with the patient, own professional environment and the rest of the society. Polish model of ethical conduct, which is rooted in Hippocratic medical tradition, harmonizes with the ethos of medical laboratory specialists of other European countries and the world.

  3. Two web-based laboratories of the FisLabs network: Hooke's and Snell's laws

    International Nuclear Information System (INIS)

    De la Torre, L; Sanchez, J; Dormido, S; Sanchez, J P; Yuste, M; Carreras, C

    2011-01-01

    FisLabs is a network of remote and virtual laboratories for physics university education via the Internet that offers students the possibility of performing hands-on experiments in different fields of physics in two ways: simulation and real remote operation. This paper gives a detailed account of a novel way in physics in which distance learning students can gain practical experience autonomously. FisLabs uses the same structure as AutomatLabs, a network of virtual and remote laboratories for learning/teaching of control engineering, which has been in operation for four years. Students can experiment with the laboratories offered using an Internet connection and a Java-compatible web browser. This paper, specially intended for university educators but easily comprehensible even for undergraduate students, explains how the portal works and the hardware and software tools used to create it. In addition, it also describes two physics experiments already available: spring elasticity and the laws of reflection and refraction.

  4. Tests of lepton flavour universality at LHCb

    CERN Document Server

    Lupato, Anna

    2018-01-01

    In the Standard Model the electroweak coupling of the gauge bosons to leptons is independent of the lepton flavour. Semileptonic and rare decays of b quarks provide an ideal laboratory to test this property. Any violation of Lepton Flavour Universality would be a clear sign of physics beyond the Standard Model. In this work a review of the Lepton Flavour Universality tests performed using data collected by the LHCb experiment in 2011 and 2012 at a centre of mass energy of 7 and 8 TeV is presented.

  5. Comparison of a gross anatomy laboratory to online anatomy software for teaching anatomy.

    Science.gov (United States)

    Mathiowetz, Virgil; Yu, Chih-Huang; Quake-Rapp, Cindee

    2016-01-01

    This study was designed to assess the grades, self-perceived learning, and satisfaction between occupational therapy students who used a gross anatomy laboratory versus online anatomy software (AnatomyTV) as tools to learn anatomy at a large public university and a satellite campus in the mid-western United States. The goal was to determine if equivalent learning outcomes could be achieved regardless of learning tool used. In addition, it was important to determine why students chose the gross anatomy laboratory over online AnatomyTV. A two group, post-test only design was used with data gathered at the end of the course. Primary outcomes were students' grades, self-perceived learning, and satisfaction. In addition, a survey was used to collect descriptive data. One cadaver prosection was available for every four students in the gross anatomy laboratory. AnatomyTV was available online through the university library. At the conclusion of the course, the gross anatomy laboratory group had significantly higher grade percentage, self-perceived learning, and satisfaction than the AnatomyTV group. However, the practical significance of the difference is debatable. The significantly greater time spent in gross anatomy laboratory during the laboratory portion of the course may have affected the study outcomes. In addition, some students may find the difference in (B+) versus (A-) grade as not practically significant. Further research needs to be conducted to identify what specific anatomy teaching resources are most effective beyond prosection for students without access to a gross anatomy laboratory. © 2015 American Association of Anatomists.

  6. Laboratory Safety Awareness Among General Physics Undergraduate Students

    Directory of Open Access Journals (Sweden)

    C. O. Ponferrada

    2017-12-01

    Full Text Available Safety awareness in the laboratory is essential to reduce occupational risks. This study was conducted to determine the students’ safety awareness in a Physics laboratory. This study determined the student perception towards safety awareness by factors of gender and college from which students are enrolled. A sum of 324 students enrolled in Physics10 (Mechanics and Heat and Physics11 (Electricity and Magnetism in the Mindanao University of Science and Technology (MUST were randomly selected as survey respondents. A modified survey questionnaire was used as research instrument. The results show that the students had positive level of safety awareness and perceived positively on the preventive measures to reduce laboratory risk. Further, regardless of gender students enrolled in Physics 10 were more positively aware towards safety awareness than students enrolled in Physics 11. Similarly, a variation among the students perception towards safety awareness from the College of Engineering and Architecture (CEA and College of Industrial and Information Technology (CIIT occurred. Overall, present findings indicate a need to introduce laboratory safety awareness in Physics classes.

  7. External quality assurance performance of clinical research laboratories in sub-saharan Africa.

    Science.gov (United States)

    Amukele, Timothy K; Michael, Kurt; Hanes, Mary; Miller, Robert E; Jackson, J Brooks

    2012-11-01

    Patient Safety Monitoring in International Laboratories (JHU-SMILE) is a resource at Johns Hopkins University that supports and monitors laboratories in National Institutes of Health-funded international clinical trials. To determine the impact of the JHU-SMILE quality assurance scheme in sub-Saharan African laboratories, we reviewed 40 to 60 months of external quality assurance (EQA) results of the College of American Pathologists (CAP) in these laboratories. We reviewed the performance of 8 analytes: albumin, alanine aminotransferase, creatinine, sodium, WBC, hemoglobin, hematocrit, and the human immunodeficiency virus antibody rapid test. Over the 40- to 60-month observation period, the sub-Saharan laboratories had a 1.63% failure rate, which was 40% lower than the 2011 CAP-wide rate of 2.8%. Seventy-six percent of the observed EQA failures occurred in 4 of the 21 laboratories. These results demonstrate that a system of remote monitoring, feedback, and audits can support quality in low-resource settings, even in places without strong regulatory support for laboratory quality.

  8. Book Review "Advances on remote laboratories and e-learning experiences"

    Directory of Open Access Journals (Sweden)

    Jesús A. del Alamo

    2007-08-01

    Full Text Available Book Review "Advances on remote laboratories and e-learning experiences", book editors: Luís Gomes and Javier García-Zubía, University of Deusto, Spain. Reviewed by Jesús A. del Alamo, Massachusetts Institute of Technology, M.I.T.

  9. Interactive screen experiments-innovative virtual laboratories for distance learners

    International Nuclear Information System (INIS)

    Hatherly, P A; Jordan, S E; Cayless, A

    2009-01-01

    The desirability and value of laboratory work for physics students is a well-established principle and issues arise where students are inherently remote from their host institution, as is the case for the UK's Open University. In this paper, we present developments from the Physics Innovations Centre for Excellence in Teaching and Learning (piCETL) in the production and technology of the virtual laboratory resources, interactive screen experiments, and the benefits and drawbacks of such resources. We also explore the motivations behind current implementation of interactive screen experiments and examine evaluation strategies and outcomes through a series of case studies

  10. MSU-DOE Plant Research Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    1991-01-01

    This document is the compiled progress reports of research funded through the Michigan State University/Department of Energy Plant Research Laboratory. Fourteen reports are included, covering the molecular basis of plant/microbe symbiosis, cell wall biosynthesis and proteins, gene expression, stress responses, plant hormone biosynthesis, interactions between the nuclear and organelle genomes, sensory transduction and tropisms, intracellular sorting and trafficking, regulation of lipid metabolism, molecular basis of disease resistance and plant pathogenesis, developmental biology of Cyanobacteria, and hormonal involvement in environmental control of plant growth. 320 refs., 26 figs., 3 tabs. (MHB)

  11. Center for Molecular Electronics, University of Missouri, St. Louis. Environmental Assessment

    Energy Technology Data Exchange (ETDEWEB)

    1994-06-01

    The Department of Energy (DOE) proposes to authorize the University of Missouri, St. Louis to proceed with the detailed design and construction of the proposed Center for Molecular Electronics. The proposed Center would consist of laboratories and offices housed in a three-story building on the University campus. The proposed modular laboratories would be adaptable for research activities principally related to physics, chemistry, and electrical engineering. Proposed research would include the development and application of thin-film materials, semi-conductors, electronic sensors and devices, and high-performance polymers. Specific research for the proposed Center has not yet been formulated, therefore, specific procedures for any particular process or study cannot be described at this time. The proposed construction site is an uncontaminated panel of land located on the University campus. This report contains information about the environmental assessment that was performed in accordance with this project.

  12. A Laboratory Practical on the House Building Behaviour of Caddis Larvae

    Science.gov (United States)

    Hansell, M. H.

    1973-01-01

    Describes a laboratory practical on animal behavior suitable for senior secondary school or university biology classes. Several separate exercises relating to the house building behavior of caddis fly larvae are detailed, together with the time required for preparation. (JR)

  13. The ATLAS Experiment Laboratory - Overview

    International Nuclear Information System (INIS)

    Malecki, P.

    1999-01-01

    Full text: ATLAS Experiment Laboratory has been created by physicists and engineers preparing a research programme and detector for the LHC collider. This group is greatly supported by members of other Departments taking also part (often full time) in the ATLAS project. These are: J. Blocki, J. Godlewski, Z. Hajduk, P. Kapusta, B. Kisielewski, W. Ostrowicz, E. Richter-Was, and M. Turala. Our ATLAS Laboratory realizes its programme in very close collaboration with the Faculty of Physics and Nuclear Technology of the University of Mining and Metallurgy. ATLAS, A Toroidal LHC ApparatuS Collaboration groups about 1700 experimentalists from about 150 research institutes. This apparatus, a huge system of many detectors, which are technologically very advanced, is going to be ready by 2005. With the start of the 2 x 7 TeV LHC collider ATLAS and CMS (the sister experiment at LHC) will begin their fascinating research programme at beam energies and intensities which have never been exploited. (author)

  14. New Laboratory Course for Senior-Level Chemical Engineering Students

    Science.gov (United States)

    Aronson, Mark T.; Deitcher, Robert W.; Xi, Yuanzhou; Davis, Robert J.

    2009-01-01

    A new laboratory course has been developed at the University of Virginia for senior- level chemical engineering students. The new course is based on three 4-week long experiments in bioprocess engineering, energy conversion and catalysis, and polymer synthesis and characterization. The emphasis is on the integration of process steps and the…

  15. University of Michigan workscope for 1991 DOE University program in robotics for advanced reactors

    International Nuclear Information System (INIS)

    Wehe, D.K.

    1990-01-01

    The University of Michigan (UM) is a member of a team of researchers, including the universities of Florida, Texas, and Tennessee, along with Oak Ridge National Laboratory, developing robotic for hazardous environments. The goal of this research is to develop the intelligent and capable robots which can perform useful functions in the new generation of nuclear reactors currently under development. By augmenting human capabilities through remote robotics, increased safety, functionality, and reliability can be achieved. In accordance with the established lines of research responsibilities, our primary efforts during 1991 will continue to focus on the following areas: radiation imaging; mobile robot navigation; three-dimensional vision capabilities for navigation; and machine-intelligence. This report discuss work that has been and will be done in these areas

  16. High Energy Ion Bombardment Simulation Facility at the University of Pittsburgh

    International Nuclear Information System (INIS)

    McGruer, J.N.; Choyke, W.J.; Doyle, N.J.; Spitznagel, J.A.

    1975-01-01

    The High Energy Ion Bombardment Simulation (HEIBS) Facility located at the University of Pittsburgh is now operational. The E-22 tandem accelerator of the Nuclear Physics Laboratory, fitted with a UNIS source, provides the heavy high energy ions. An auxiliary Van de Graaff accelerator is used for the simultaneous production of He ions. Special features of the simulation laboratory are reported

  17. Laboratory preparation questionnaires as a tool for the implementation of the Just in Time Teaching in the Physics I laboratories: Research training

    Science.gov (United States)

    Miranda, David A.; Sanchez, Melba J.; Forero, Oscar M.

    2017-06-01

    The implementation of the JiTT (Just in Time Teaching) strategy is presented to increase the previous preparation of students enrolled in the subject Physics Laboratory I offered at the Industrial University of Santander (UIS), Colombia. In this study, a laboratory preparation questionnaire (CPL) was applied as a tool for the implementation of JiTT combined with elements of mediated learning. It was found that the CPL allows to improve the students’ experience regarding the preparation of the laboratory and the development of the experimental session. These questionnaires were implemented in an academic manager (Moodle) and a web application (lab.ciencias.uis.edu.co) was used to publish the contents essential for the preparation of the student before each practical session. The most significant result was that the students performed the experimental session with the basic knowledge to improve their learning experience.

  18. Clinical Laboratory Tests in Some Acute Exogenous Poisonings.

    Science.gov (United States)

    Tufkova, Stoilka G; Yankov, Ivan V; Paskaleva, Diana A

    2017-09-01

    There is no specific toxicological screening of clinical laboratory parameters in clinical toxicology when it comes to acute exogenous poisoning. To determine routine clinical laboratory parameters and indicators for assessment of vital functions in patients with acute intoxications. One hundred and fifty-three patients were included in the present study. They were hospitalized in the Department of Clinical Toxicology at St. George University Hospital, Plovdiv for cerebral toxicity inducing medication (n = 45), alcohol (n = 40), heroin abuse (n = 33). The controls were 35. The laboratory tests were conducted in compliance with the standards of the clinical laboratory. We used the following statistical analyses: analysis of variance (the ucriterion of normal distribution, the Student's t-test, dispersion analysis based on ANOVA) and non-parametric analysis. Based on the routine hematological parameters with statistically significant changes in three groups of poisoning are: red blood cells, hematocrit, hemoglobin (except alcohol intoxication) and leukocytes. We found statistically significant changes in serum total protein, sodium and bilirubin. The highest statistical significance is the increased activity of AST and ALT. We present a model for selection of clinical laboratory tests for severe acute poisoning with modern equipment under standardized conditions. The results of the study suggest that the clinical laboratory constellation we used can be used as a mandatory element in the diagnosis of moderate and severe intoxication with the mentioned toxic substances.

  19. Glycobiology, How to Sugar-Coat an Undergraduate Advanced Biochemistry Laboratory

    Science.gov (United States)

    McReynolds, Katherine D.

    2006-01-01

    A second semester biochemistry laboratory has been implemented as an independent projects course at California State University, Sacramento since 1999. To incorporate aspects of carbohydrate biochemistry, or glycobiology, into our curriculum, projects in lectin isolation and purification were undertaken over the course of two semesters. Through…

  20. An Investigative, Cooperative Learning Approach to the General Microbiology Laboratory

    Science.gov (United States)

    Seifert, Kyle; Fenster, Amy; Dilts, Judith A.; Temple, Louise

    2009-01-01

    Investigative- and cooperative-based learning strategies have been used effectively in a variety of classrooms to enhance student learning and engagement. In the General Microbiology laboratory for juniors and seniors at James Madison University, these strategies were combined to make a semester-long, investigative, cooperative learning experience…