33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

Science.gov (United States)

Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

2017-11-01

TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

The Cellient System for Paraffin Histology Can Be Combined with HPV Testing and Morphotyping the Vaginal Microbiome Thanks to BoonFixing

Directory of Open Access Journals (Sweden)

Mathilde E. Boon

2013-01-01

Full Text Available The Cellient Automated Cell Block System (Hologic can be used to process cervical scrapes to paraffin sections. For the first study on this subject, cervical scrapes were fixed in the formalin-free fixative BoonFix. This pilot study was limited to cases classified as atypical squamous lesion of unknown significance (ASCUS and high-grade squamous lesion (HSIL as diagnosed in the ThinPrep slide. The Cellient paraffin sections were classified into negative, atypical, CIN 1, CIN 2, and CIN 3. Multiple HPV genotypes were encountered in 79% of the scrapes. This study showed that the Cellient system for paraffin sections can be combined with HPV testing thanks to the formalin-free BoonFix. In two additional studies it was shown that such samples can also be used for morphotyping the vaginal microbiome and preparing cytologic ThinPrep slides.

The Cellient System for Paraffin Histology Can Be Combined with HPV Testing and Morphotyping the Vaginal Microbiome Thanks to BoonFixing.

Science.gov (United States)

Boon, Mathilde E

2013-01-01

The Cellient Automated Cell Block System (Hologic) can be used to process cervical scrapes to paraffin sections. For the first study on this subject, cervical scrapes were fixed in the formalin-free fixative BoonFix. This pilot study was limited to cases classified as atypical squamous lesion of unknown significance (ASCUS) and high-grade squamous lesion (HSIL) as diagnosed in the ThinPrep slide. The Cellient paraffin sections were classified into negative, atypical, CIN 1, CIN 2, and CIN 3. Multiple HPV genotypes were encountered in 79% of the scrapes. This study showed that the Cellient system for paraffin sections can be combined with HPV testing thanks to the formalin-free BoonFix. In two additional studies it was shown that such samples can also be used for morphotyping the vaginal microbiome and preparing cytologic ThinPrep slides.

Negative concord and the scope of universals

NARCIS (Netherlands)

Giannakidou, A

2000-01-01

In this paper, I propose an analysis of Greek negative concord (NC) in terms of quantifier scope. It is shown that there is no evidence that Greek NC n-words are indefinites or negative quantifiers, NC n-words are analysed as universal quantifiers, which are sensitive to negative polarity, and which

NSDNA: a manually curated database of experimentally supported ncRNAs associated with nervous system diseases.

Science.gov (United States)

Wang, Jianjian; Cao, Yuze; Zhang, Huixue; Wang, Tianfeng; Tian, Qinghua; Lu, Xiaoyu; Lu, Xiaoyan; Kong, Xiaotong; Liu, Zhaojun; Wang, Ning; Zhang, Shuai; Ma, Heping; Ning, Shangwei; Wang, Lihua

2017-01-04

The Nervous System Disease NcRNAome Atlas (NSDNA) (http://www.bio-bigdata.net/nsdna/) is a manually curated database that provides comprehensive experimentally supported associations about nervous system diseases (NSDs) and noncoding RNAs (ncRNAs). NSDs represent a common group of disorders, some of which are characterized by high morbidity and disabilities. The pathogenesis of NSDs at the molecular level remains poorly understood. ncRNAs are a large family of functionally important RNA molecules. Increasing evidence shows that diverse ncRNAs play a critical role in various NSDs. Mining and summarizing NSD-ncRNA association data can help researchers discover useful information. Hence, we developed an NSDNA database that documents 24 713 associations between 142 NSDs and 8593 ncRNAs in 11 species, curated from more than 1300 articles. This database provides a user-friendly interface for browsing and searching and allows for data downloading flexibility. In addition, NSDNA offers a submission page for researchers to submit novel NSD-ncRNA associations. It represents an extremely useful and valuable resource for researchers who seek to understand the functions and molecular mechanisms of ncRNA involved in NSDs. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.

Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

Science.gov (United States)

Das, Debajyoti; Kar, Debjit

2017-12-01

A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

Non-leptonic kaon decays at large Nc

Science.gov (United States)

Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

2018-03-01

We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

Radioiodine: a boon and a bane emergency preparedness during accidental release of radioiodine

International Nuclear Information System (INIS)

Pahuja, D.N.

1997-01-01

Radioiodine, can be a double edged sword and can be dangerous and lethal. It will turn out to be a bane rather than a boon, exposing millions of individuals in and far away from the side of accident across geographical borders depending upon the weather conditions. Iodine is an indispensable element because of its being a constituent of the thyroid hormones, biosynthesized and released from the thyroid gland for the growth and over all metabolic functions. This gland weighing 20-30 g in a normal human adult, is comparatively very vascular organ with 5 lit. of blood flowing through it every hour. It contains 90% of the body iodine amounting to 5000-7000 μg, in the form of iodo aminoacids

Ground-based hyperspectral imaging and terrestrial laser scanning for fracture characterization in the Mississippian Boone Formation

Science.gov (United States)

Sun, Lei; Khan, Shuhab D.; Sarmiento, Sergio; Lakshmikantha, M. R.; Zhou, Huawei

2017-12-01

Petroleum geoscientists have been using cores and well logs to study source rocks and reservoirs, however, the inherent discontinuous nature of these data cannot account for horizontal heterogeneities. Modern exploitation requires better understanding of important source rocks and reservoirs at outcrop scale. Remote sensing of outcrops is becoming a first order tool for reservoir analog studies including horizontal heterogeneities. This work used ground-based hyperspectral imaging, terrestrial laser scanning (TLS), and high-resolution photography to study a roadcut of the Boone Formation at Bella Vista, northwest Arkansas, and developed an outcrop model for reservoir analog analyses. The petroliferous Boone Formation consists of fossiliferous limestones interbedded with chert of early Mississippian age. We used remote sensing techniques to identify rock types and to collect 3D geometrical data. Mixture tuned matched filtering classification of hyperspectral data show that the outcrop is mostly limestones with interbedded chert nodules. 1315 fractures were classified according to their strata-bounding relationships, among these, larger fractures are dominantly striking in ENE - WSW directions. Fracture extraction data show that chert holds more fractures than limestones, and both vertical and horizontal heterogeneities exist in chert nodule distribution. Utilizing ground-based remote sensing, we have assembled a virtual outcrop model to extract mineral composition as well as fracture data from the model. We inferred anisotropy in vertical fracture permeability based on the dominancy of fracture orientations, the preferential distribution of fractures and distribution of chert nodules. These data are beneficial in reservoir analogs to study rock mechanics and fluid flow, and to improve well performances.

The Built Environment and Childhood Obesity in Durham, NC

Science.gov (United States)

Miranda, Marie Lynn; Edwards, Sharon E.; Anthopolos, Rebecca; Dolinsky, Diana H.; Kemper, Alex R.

2013-01-01

The relationship between childhood obesity and aspects of the built environment characterizing neighborhood social context is understudied. We evaluate the association between seven built environment domains and childhood obesity in Durham, NC. Measures of housing damage, property disorder, vacancy, nuisances, and territoriality were constructed using data from a 2008 community assessment. Renter-occupied housing and crime measures were developed from public databases. We linked these measures to 2008–2009 Duke University Medical Center pediatric preventive care visits. Age- and sex-specific body mass index percentiles were used to classify children as normal weight (>5th and ≤ 85th percentile), overweight (>85th and ≤ 95th percentile), or obese (> 95th percentile). Ordinal logistic regression models with cluster-corrected standard errors evaluated the association between weight status and the built environment. Adjusting for child-level socioeconomic characteristics, nuisances and crime were associated with childhood overweight/obesity (Penvironment characteristics appear important to childhood weight status in Durham, NC. PMID:22563061

A vaccine formulation combining rhoptry proteins NcROP40 and NcROP2 improves pup survival in a pregnant mouse model of neosporosis.

Science.gov (United States)

Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M

2015-01-30

Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.

Geologic map of the Hasty Quadrangle, Boone and Newton Counties, Arkansas

Science.gov (United States)

Hudson, Mark R.; Murray, Kyle E.

2004-01-01

This digital geologic map compilation presents new polygon (for example, geologic map unit contacts), line (for example, fault, fold axis, and structure contour), and point (for example, structural attitude, contact elevations) vector data for the Hasty 7.5-minute quadrangle in northern Arkansas. The map database, which is at 1:24,000-scale resolution, provides geologic coverage of an area of current hydrogeologic, tectonic, and stratigraphic interest. The Hasty quadrangle is located in northern Newton and southern Boone Counties about 20 km south of the town of Harrison. The map area is underlain by sedimentary rocks of Ordovician, Mississippian, and Pennsylvanian age that were mildly deformed by a series of normal and strike-slip faults and folds. The area is representative of the stratigraphic and structural setting of the southern Ozark Dome. The Hasty quadrangle map provides new geologic information for better understanding groundwater flow paths in and adjacent to the Buffalo River watershed.

NC10 bacteria in marine oxygen minimum zones

DEFF Research Database (Denmark)

Padilla, Cory C; Bristow, Laura A; Sarode, Neha

2016-01-01

Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

Virtual NC machine model with integrated knowledge data

International Nuclear Information System (INIS)

Sidorenko, Sofija; Dukovski, Vladimir

2002-01-01

The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

Inflationary universe in deformed phase space scenario

Science.gov (United States)

Rasouli, S. M. M.; Saba, Nasim; Farhoudi, Mehrdad; Marto, João; Moniz, P. V.

2018-06-01

We consider a noncommutative (NC) inflationary model with a homogeneous scalar field minimally coupled to gravity. The particular NC inflationary setting herein proposed, produces entirely new consequences as summarized in what follows. We first analyze the free field case and subsequently examine the situation where the scalar field is subjected to a polynomial and exponential potentials. We propose to use a canonical deformation between momenta, in a spatially flat Friedmann-Lemaî tre-Robertson-Walker (FLRW) universe, and while the Friedmann equation (Hamiltonian constraint) remains unaffected the Friedmann acceleration equation (and thus the Klein-Gordon equation) is modified by an extra term linear in the NC parameter. This concrete noncommutativity on the momenta allows interesting dynamics that other NC models seem not to allow. Let us be more precise. This extra term behaves as the sole explicit pressure that under the right circumstances implies a period of accelerated expansion of the universe. We find that in the absence of the scalar field potential, and in contrast with the commutative case, in which the scale factor always decelerates, we obtain an inflationary phase for small negative values of the NC parameter. Subsequently, the period of accelerated expansion is smoothly replaced by an appropriate deceleration phase providing an interesting model regarding the graceful exit problem in inflationary models. This last property is present either in the free field case or under the influence of the scalar field potentials considered here. Moreover, in the case of the free scalar field, we show that not only the horizon problem is solved but also there is some resemblance between the evolution equation of the scale factor associated to our model and that for the R2 (Starobinsky) inflationary model. Therefore, our herein NC model not only can be taken as an appropriate scenario to get a successful kinetic inflation, but also is a convenient setting to

Geologic map of the Ponca quadrangle, Newton, Boone, and Carroll Counties, Arkansas

Science.gov (United States)

Hudson, Mark R.; Murray, Kyle E.

2003-01-01

This digital geologic map compilation presents new polygon (i.e., geologic map unit contacts), line (i.e., fault, fold axis, and structure contour), and point (i.e., structural attitude, contact elevations) vector data for the Ponca 7 1/2' quadrangle in northern Arkansas. The map database, which is at 1:24,000-scale resolution, provides geologic coverage of an area of current hydrogeologic, tectonic, and stratigraphic interest. The Ponca quadrangle is located in Newton, Boone, and Carroll Counties about 20 km southwest of the town of Harrison. The map area is underlain by sedimentary rocks of Ordovician, Mississippian, and Pennsylvanian age that were mildly deformed by a series of normal and strike-slip faults and folds. The area is representative of the stratigraphic and structural setting of the southern Ozark Dome. The Ponca quadrangle map provides new geologic information for better understanding groundwater flow paths and development of karst features in and adjacent to the Buffalo River watershed.

ncRNA consensus secondary structure derivation using grammar strings.

Science.gov (United States)

Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

2011-04-01

Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

Inherent and antigen-induced airway hyperreactivity in NC mice

Directory of Open Access Journals (Sweden)

Tetsuto Kobayashi

1999-01-01

Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

Nuclear localization of the mitochondrial ncRNAs in normal and cancer cells.

Science.gov (United States)

Landerer, Eduardo; Villegas, Jaime; Burzio, Veronica A; Oliveira, Luciana; Villota, Claudio; Lopez, Constanza; Restovic, Franko; Martinez, Ronny; Castillo, Octavio; Burzio, Luis O

2011-08-01

We have previously shown a differential expression of a family of mitochondrial ncRNAs in normal and cancer cells. Normal proliferating cells and cancer cells express the sense mitochondrial ncRNA (SncmtRNA). In addition, while normal proliferating cells express two antisense mitochondrial ncRNAs (ASncmtRNAs-1 and -2), these transcripts seem to be universally down-regulated in cancer cells. In situ hybridization (ISH) of some normal and cancer tissues reveals nuclear localization of these transcripts suggesting that they are exported from mitochondria. FISH and confocal microscopy, in situ digestion with RNase previous to ISH and electron microscopy ISH was employed to confirm the extra-mitochondrial localization of the SncmtRNA and the ASncmtRNAs in normal proliferating and cancer cells of human and mouse. In normal human kidney and mouse testis the SncmtRNA and the ASncmtRNAs were found outside the organelle and especially localized in the nucleus associated to heterochromatin. In cancer cells, only the SncmtRNA was expressed and was found associated to heterochromatin and nucleoli. The ubiquitous localization of these mitochondrial transcripts in the nucleus suggests that they are new players in the mitochondrial-nuclear communication pathway or retrograde signaling. Down regulation of the ASncmtRNAs seems to be an important step on neoplastic transformation and cancer progression.

Improving Earth Science Metadata: Modernizing ncISO

Science.gov (United States)

O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

2016-12-01

ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

Explorations of the extended ncKP hierarchy

International Nuclear Information System (INIS)

Dimakis, Aristophanes; Mueller-Hoissen, Folkert

2004-01-01

A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

The Cellient System for Paraffin Histology Can Be Combined with HPV Testing and Morphotyping the Vaginal Microbiome Thanks to BoonFixing

OpenAIRE

Boon, Mathilde E.

2013-01-01

The Cellient Automated Cell Block System (Hologic) can be used to process cervical scrapes to paraffin sections. For the first study on this subject, cervical scrapes were fixed in the formalin-free fixative BoonFix. This pilot study was limited to cases classified as atypical squamous lesion of unknown significance (ASCUS) and high-grade squamous lesion (HSIL) as diagnosed in the ThinPrep slide. The Cellient paraffin sections were classified into negative, atypical, CIN 1, CIN 2, and CIN 3. ...

An overview on STEP-NC compliant controller development

Science.gov (United States)

Othman, M. A.; Minhat, M.; Jamaludin, Z.

2017-10-01

The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

78 FR 72009 - Establishment of Class E Airspace; Star, NC

Science.gov (United States)

2013-12-02

...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

Science.gov (United States)

2013-04-24

... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

Software module for geometric product modeling and NC tool path generation

International Nuclear Information System (INIS)

Sidorenko, Sofija; Dukovski, Vladimir

2003-01-01

The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)

MOF derived Ni/Co/NC catalysts with enhanced properties for oxygen evolution reaction

Science.gov (United States)

Hu, Jiapeng; Chen, Juan; Lin, Hao; Liu, Ruilai; Yang, Xiaobing

2018-03-01

Designing efficient electrocatalysts for oxygen evolution reaction (OER) is very important for renewable energy storage and conversion devices. In this paper, we introduced a new strategy to synthesize Ni doped Co/NC catalysts (NC is the abbreviation of nitrogen-doped graphitic carbon), which were derived from ZIF-67. All catalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscope (TEM) and oxygen evolution reaction (OER). The results show that Ni was well doped in the Ni/Co/NC catalysts and the doping of Ni has great influence on the OER activity of Ni/Co/NC catalysts. Among these catalysts, 0.50Ni/Co/NC exhibits the highest OER activity. The onset potential of 0.50Ni/Co/NC is 1.47 V, which is superior than the onset potential of Co/NC (1.54 V), 0.25Ni/Co/NC (1.48 V), 1.00Ni/Co/NC (1.53 V). The excellent OER activity of 0.50Ni/Co/NC catalyst makes its potential to be used on renewable energy storage.

Treatment of prehypertension: lifestyle and/or medication

Directory of Open Access Journals (Sweden)

Collier SR

2012-11-01

Full Text Available Scott R Collier,1 Michael Landram21Vascular Biology and Autonomic Studies Laboratory, Appalachian State University, Boone, NC, USA; 2Università degli Studi di Roma “Foro Italico”, Rome, ItalyAbstract: Prehypertension is a warning to individuals with resting blood pressures between 120/80 mmHg and 139/89 mmHg of an insidious progression of blood pressure towards hypertensive levels (≥140/90 mmHg. Prehypertension is associated with increased cardiovascular risk and end organ damage compared with individuals who are normotensive. This review primarily focuses on internal and external factors associated with the prevalence of prehypertension. Elucidating all of the factors associated with a rise in resting blood pressure and comparing the effects of medication versus lifestyle changes may aid the clinician in developing a preventive and/or treatment strategy for each individual.Keywords: sex differences, blood pressure, lifestyle changes

NC-6301, a polymeric micelle rationally optimized for effective release of docetaxel, is potent but is less toxic than native docetaxel in vivo

Directory of Open Access Journals (Sweden)

Harada M

2012-05-01

Full Text Available Mitsunori Harada,1 Caname Iwata,2 Hiroyuki Saito,1 Kenta Ishii,1 Tatsuyuki Hayashi,1 Masakazu Yashiro,3 Kosei Hirakawa,3 Kohei Miyazono,2 Yasuki Kato,1 Mitsunobu R Kano21Research Division, NanoCarrier Co, Ltd, Chiba, Japan; 2Department of Molecular Pathology, Graduate School of Medicine, University of Tokyo, Tokyo, Japan; 3Department of Surgical Oncology, Osaka City University, Osaka, JapanAbstract: Drug release rate is an important factor in determining efficacy and toxicity of nanoscale drug delivery systems. However, optimization of the release rate in polymeric micellar nanoscale drug delivery systems has not been fully investigated. In this study NC-6301, a poly(ethylene glycol-poly(aspartate block copolymer with docetaxel (DTX covalently bound via ester link, was synthesized with various numbers of DTX molecules bound to the polymer backbone. The number of DTX molecules was determined up to 14 to achieve an optimal release rate, based upon the authors' own pharmacokinetic model using known patient data. Efficacy and toxicity of the formulation was then tested in animals. When administered three times at 4-day intervals, the maximum tolerated doses of NC-6301 and native DTX were 50 and 10 mg/kg, respectively, in nude mice. Tissue distribution studies of NC-6301 in mice at 50 mg/kg revealed prolonged release of free DTX in the tumor for at least 120 hours, thus supporting its effectiveness. Furthermore, in cynomolgus monkeys, NC-6301 at 6 mg/kg three times at 2-week intervals showed marginal toxicity, whereas native DTX, at 3 mg/kg with the same schedule, induced significant decrease of food consumption and neutrophil count. NC-6301 at 50 mg/kg in mice also regressed a xenografted tumor of MDA-MB-231 human breast cancer. Native DTX, on the other hand, produced only transient and slight regression of the same tumor xenograft. NC-6301 also significantly inhibited growth of OCUM-2MLN human scirrhous gastric carcinoma in an orthotopic mouse

Development of STEP-NC Adaptor for Advanced Web Manufacturing System

Science.gov (United States)

Ajay Konapala, Mr.; Koona, Ramji, Dr.

2017-08-01

Information systems play a key role in the modern era of Information Technology. Rapid developments in IT & global competition calls for many changes in basic CAD/CAM/CAPP/CNC manufacturing chain of operations. ‘STEP-NC’ an enhancement to STEP for operating CNC machines, creating new opportunities for collaborative, concurrent, adaptive works across the manufacturing chain of operations. Schemas and data models defined by ISO14649 in liaison with ISO10303 standards made STEP-NC file rich with feature based, rather than mere point to point information of G/M Code format. But one needs to have a suitable information system to understand and modify these files. Various STEP-NC information systems are reviewed to understand the suitability of STEP-NC for web manufacturing. Present work also deals with the development of an adaptor which imports STEP-NC file, organizes its information, allowing modifications to entity values and finally generates a new STEP-NC file to export. The system is designed and developed to work on web to avail additional benefits through the web and also to be part of a proposed ‘Web based STEP-NC manufacturing platform’ which is under development and explained as future scope.

Inherent and antigen-induced airway hyperreactivity in NC mice

OpenAIRE

Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

1999-01-01

In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

On pseudorandom generators in NC⁰

DEFF Research Database (Denmark)

Cryan, Mary; Miltersen, Peter Bro

2001-01-01

In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC

Science.gov (United States)

2013-09-04

...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...

Characterizing ncRNAs in human pathogenic protists using high-throughput sequencing technology

Directory of Open Access Journals (Sweden)

Lesley Joan Collins

2011-12-01

Full Text Available ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, snoRNAs and long ncRNAs on a genomic scale making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases.

Characterizing ncRNAs in Human Pathogenic Protists Using High-Throughput Sequencing Technology

Science.gov (United States)

Collins, Lesley Joan

2011-01-01

ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses, and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, small nucleolar RNAs (snoRNAs), and long ncRNAs on a genomic scale, making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational, and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases. PMID:22303390

Mobile financial services and financial inclusion: Is it a boon for savings mobilization?

Directory of Open Access Journals (Sweden)

Shem Alfred Ouma

2017-06-01

Full Text Available The adoption of mobile telephony to provide financial services in Africa has become instrumental in integrating the hitherto unbanked segments of the population to the mainstream financial systems. This study sought to establish this linkage by examining whether the pervasive use of mobile telephony to provide financial services is a boon for savings mobilization in selected countries in sub Saharan Africa. The findings show that availability and usage of mobile phones to provide financial services promotes the likelihood of saving at the household level. Not only does access to mobile financial services boost the likelihood to save, but also has a significant impact on the amounts saved, perhaps due to the frequency and convenience with which such transactions can be undertaken using a mobile phone. Both forms of savings, that is, basic mobile phone savings stored in the phone and bank integrated mobile savings are likely to be promoted by use of mobile phones. Thus, growing and deepening the scope for mobile phone financial services is an avenue for promoting savings mobilization, especially among the poor and low income groups with constrained access to formal financial services.

Modular Universal Scalable Ion-trap Quantum Computer

Science.gov (United States)

2016-06-02

SECURITY CLASSIFICATION OF: The main goal of the original MUSIQC proposal was to construct and demonstrate a modular and universally- expandable ion...Distribution Unlimited UU UU UU UU 02-06-2016 1-Aug-2010 31-Jan-2016 Final Report: Modular Universal Scalable Ion-trap Quantum Computer The views...P.O. Box 12211 Research Triangle Park, NC 27709-2211 Ion trap quantum computation, scalable modular architectures REPORT DOCUMENTATION PAGE 11

The baryon vector current in the combined chiral and 1/Nc expansions

Energy Technology Data Exchange (ETDEWEB)

Flores-Mendieta, Ruben; Goity, Jose L [JLAB

2014-12-01

The baryon vector current is computed at one-loop order in large-Nc baryon chiral perturbation theory, where Nc is the number of colors. Loop graphs with octet and decuplet intermediate states are systematically incorporated into the analysis and the effects of the decuplet-octet mass difference and SU(3) flavor symmetry breaking are accounted for. There are large-Nc cancellations between different one-loop graphs as a consequence of the large-Nc spin-flavor symmetry of QCD baryons. The results are compared against the available experimental data through several fits in order to extract information about the unknown parameters. The large-Nc baryon chiral perturbation theory predictions are in very good agreement both with the expectations from the 1/Nc expansion and with the experimental data. The effect of SU(3) flavor symmetry breaking for the |Delta S|=1 vector current form factors f1(0) results in a reduction by a few percent with respect to the corresponding SU(3) symmetric values.

33 CFR 110.170 - Lockwoods Folly Inlet, N.C.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...

Sulphur and oxygen sequestration of n-C 37 and n-C 38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

Science.gov (United States)

Koopmans, Martin P.; Schaeffer-Reiss, Christine; de Leeuw, Jan W.; Lewan, Michael D.; Maxwell, James R.; Schaeffer, Philippe; Sinninghe Damsté, Jaap S.

1997-06-01

Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature ( Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330°C for 72 h to study the diagenetic fate of n-C 37 and n-C 38 di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260°C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C 37 and n-C 38 skeletons, saturated n-C 37 and n-C38 methyl, ethyl, and mid-chain ketones, C 37 and C 38 mid-chain 2,5-di- n-alkylthiophenes, C 37 and C 38 1,2-di- n-alkylbenzenes, and C 37 and C 38n-alkanes. With increasing thermal maturation, three forms of the n-C 37 and n-C 38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di- n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C 37 and n-C 38 skeleton can be expected as well as the corresponding hydrocarbons.

Sulphur and oxygen sequestration of n-C37 and n-C38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

Science.gov (United States)

Koopmans, M.P.; Schaeffer-Reiss, C.; De Leeuw, J. W.; Lewan, M.D.; Maxwell, J.R.; Schaeffer, P.; Sinninghe, Damste J.S.

1997-01-01

Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330??C for 72 h to study the diagenetic fate of n-C37 and n-C38 di-and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260??C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S-and O-bound n-C37 and n-C38 skeletons, saturated n-C37 and n-C38 methyl, ethyl, and mid-chain ketones, C37 and C38 mid-chain 2,5-di-n-alkylthiophenes, C37 and C38 1,2-di-n-alkylbenzenes, and C37 and C38 n-alkanes. With increasing thermal maturation, three forms of the n-C37 and n-C38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S-and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C37 and n-C38 skeleton can be expected as well as the corresponding hydrocarbons. Copyright ?? 1997 Elsevier Science Ltd.

Noise in NC-AFM measurements with significant tip–sample interaction

Directory of Open Access Journals (Sweden)

Jannis Lübbe

2016-12-01

Full Text Available The frequency shift noise in non-contact atomic force microscopy (NC-AFM imaging and spectroscopy consists of thermal noise and detection system noise with an additional contribution from amplitude noise if there are significant tip–sample interactions. The total noise power spectral density DΔf(fm is, however, not just the sum of these noise contributions. Instead its magnitude and spectral characteristics are determined by the strongly non-linear tip–sample interaction, by the coupling between the amplitude and tip–sample distance control loops of the NC-AFM system as well as by the characteristics of the phase locked loop (PLL detector used for frequency demodulation. Here, we measure DΔf(fm for various NC-AFM parameter settings representing realistic measurement conditions and compare experimental data to simulations based on a model of the NC-AFM system that includes the tip–sample interaction. The good agreement between predicted and measured noise spectra confirms that the model covers the relevant noise contributions and interactions. Results yield a general understanding of noise generation and propagation in the NC-AFM and provide a quantitative prediction of noise for given experimental parameters. We derive strategies for noise-optimised imaging and spectroscopy and outline a full optimisation procedure for the instrumentation and control loops.

ORF Sequence: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

ORF Sequence: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

ORF Sequence: NC_002942 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

Amalgamation of management information system into anaesthesiology practice: A boon for the modern anaesthesiologists

Directory of Open Access Journals (Sweden)

Sukhminder Jit Singh Bajwa

2014-01-01

Full Text Available Over the years, traditional anaesthesia record keeping system has been the backbone of anaesthesiology ever since its introduction in the 1890s by Dr. Harvey Cushing and Dr. Ernest A. Codman. Besides providing the important information regarding patients′ vital physiologic parameters, paper records had been a reliable source for various clinical research activities. The introduction of electronic monitoring gadgets and electronic record keeping systems has revolutionised the anaesthesiology practice to a large extent. Recently, the introduction of anaesthesia information management system (AIMS, which incorporates all the features of monitoring gadgets, such as electronic storage of large accurate data, quality assurance in anaesthesia, enhancing patient safety, ensuring legal protection, improved billing services and effecting an organisational change, is almost a revolution in modern-day anaesthesiology practice. The clinical research activities that are responsible for taking anaesthesiology discipline to higher peaks have also been boosted by the amalgamation of AIMS, enabling multicenter studies and sharing of clinical data. Barring few concerns in its installation, cost factors and functional aspects, the future of AIMS seems to be bright and will definitely prove to be a boon for modern-day anaesthesiology practice.

Correlation between the physical parameters of the i-nc-Si absorber layer grown by 27.12 MHz plasma with the nc-Si solar cell parameters

Science.gov (United States)

Das, Debajyoti; Mondal, Praloy

2017-09-01

Growth of highly conducting nanocrystalline silicon (nc-Si) thin films of optimum crystalline volume fraction, involving dominant crystallographic preferred orientation with simultaneous low fraction of microstructures at a low substrate temperature and high growth rate, is a challenging task for its promising utilization in nc-Si solar cells. Utilizing enhanced electron density and superior ion flux densities of the high frequency (∼27.12 MHz) SiH4 plasma, improved nc-Si films have been produced by simple optimization of H2-dilution, controlling the ion damage and enhancing supply of atomic-hydrogen onto the growing surface. Single junction nc-Si p-i-n solar cells have been prepared with i-nc-Si absorber layer and optimized. The physical parameters of the absorber layer have been systematically correlated to variations of the solar cell parameters. The preferred alignment of crystallites, its contribution to the low recombination losses for conduction of charge carriers along the vertical direction, its spectroscopic correlation with the dominant growth of ultra-nanocrystalline silicon (unc-Si) component and corresponding longer wavelength absorption, especially in the neighborhood of i/n-interface region recognize scientific and technological key issues that pave the ground for imminent advancement of multi-junction silicon solar cells.

ORF Sequence: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

ORF Sequence: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

A Novel Type of Non-coding RNA, nc886, Implicated in Tumor Sensing and Suppression

Directory of Open Access Journals (Sweden)

Yong Sun Lee

2015-06-01

Full Text Available nc886 (=vtRNA2-1, pre-miR-886, or CBL3 is a newly identified non-coding RNA (ncRNA that represses the activity of protein kinase R (PKR. nc886 is transcribed by RNA polymerase III (Pol III and is intriguingly the first case of a Pol III gene whose expression is silenced by CpG DNA hypermethylation in several types of cancer. PKR is a sensor protein that recognizes evading viruses and induces apoptosis to eliminate infected cells. Like viral infection, nc886 silencing activates PKR and induces apoptosis. Thus, the significance of the nc886:PKR pathway in cancer is to sense and eliminate pre-malignant cells, which is analogous to PKR's role in cellular innate immunity. Beyond this tumor sensing role, nc886 plays a putative tumor suppressor role as supported by experimental evidence. Collectively, nc886 provides a novel example how epigenetic silencing of a ncRNA contributes to tumorigenesis by controlling the activity of its protein ligand.

76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-05-23

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-04-05

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-06-29

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

76 FR 23227 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-04-26

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

ORF Sequence: NC_003279 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

Performance of universal adhesives on bonding to leucite-reinforced ceramic.

Science.gov (United States)

Kim, Ryan Jin-Young; Woo, Jung-Soo; Lee, In-Bog; Yi, Young-Ah; Hwang, Ji-Yun; Seo, Deog-Gyu

2015-01-01

This study aimed to investigate the microshear bond strength of universal bonding adhesives to leucite-reinforced glass-ceramic. Leucite-reinforced glass-ceramic blocks were polished and etched with 9.5% hydrofluoric acid for 1 min. The specimens were assigned to one of four groups based on their surface conditioning (n = 16): 1) NC: negative control with no further treatment; 2) SBU: Single Bond Universal (3M ESPE); 3) ABU: ALL-BOND Universal (Bisco); and 4) PC: RelyX Ceramic Primer and Adper Scotchbond Multi-Purpose Adhesive (3M ESPE) as a positive control. RelyX Ultimate resin cement (3M ESPE) was placed on the pretreated ceramic and was light cured. Eight specimens from each group were stored in water for 24 h, and the remaining eight specimens were thermocycled 10,000 times prior to microshear bond strength evaluation. The fractured surfaces were examined by stereomicroscopy and scanning electron microscopy (SEM). After water storage and thermocycling, the microshear bond strength values decreased in the order of PC > SBU and ABU > NC (P universal adhesives were used, conventional surface conditioning using a separate silane and adhesive is preferable to a simplified procedure that uses only a universal adhesive for cementation of leucite-reinforced glass-ceramic.

Effects of carboxylic acids on nC60 aggregate formation

International Nuclear Information System (INIS)

Chang Xiaojun; Vikesland, Peter J.

2009-01-01

The discovery that negatively charged aggregates of C 60 fullerene (nC 60 ) are stable in water has raised concerns regarding the potential environmental and health effects of these aggregates. In this work, we show that nC 60 aggregates produced by extended mixing in the presence of environmentally relevant carboxylic acids (acetic acid, tartaric acid, citric acid) have surface charge and morphologic properties that differ from those produced by extended mixing in water alone. In general, aggregates formed in the presence of these acids have a more negative surface charge and are more homogeneous than those produced in water alone. Carboxylic acid identity, solution pH, and sodium ion concentration, which are all intricately coupled, play an important role in setting the measured surface charge. Comparisons between particle sizes determined by analysis of TEM images and those obtained by dynamic light scattering (DLS) indicate that DLS results require careful evaluation when used to describe nC 60 aggregates. - The effects of carboxylic acids on the formation of nC 60 aggregates are discussed

ORF Sequence: NC_003909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

ORF Sequence: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

Characterization and properties of acetylated nanocrystalline cellulose (aNC) reinforced polylactic acid (PLA) polymer

Science.gov (United States)

Kasa, Siti Norbaya; Omar, Mohd Firdaus; Ismail, Ismarul Nizam

2017-12-01

Nanocrystalline cellulose (NCC) was synthesized from banana stem through strong acid hydrolysis with measured length of approximately 287.0 ± 56.4 nm and diameter of 26.6 ± 4.8 nm. Modification of NCC was carried by acetylation reaction in order to increase the compatibility during reinforcement with polylactic acid (PLA) polymer. The reinforcing effect towards morphology, crystallinity, mechanical and thermal properties of bio-nanocomposites was investigated. Scanning Electron Microscope (SEM) micrograph reveals the uniform dispersion achieved at 1 %, 3 % and 5% aNC loading while agglomeration was found at 7 % aNC loading. Disappearance of crystallinity peak at 2θ = 22.7⁰ for low aNC loading during elemental analysis using X-Ray Diffraction (XRD) indicates the proper dispersion of aNC in PLA polymer. From the tensile test, 1 % aNC loading gives the highest mechanical properties of bio-nanocomposite film with 82.71 %, 118.7 % and 24.18 % increment in tensile strength, tensile modulus and elongation at break. However, 7 % aNC loading gives the highest increment in TGA of aNC-PLA nanocomposites which is from 310 °C to 320 °C.

Design and Investigation of SST/nc-Si:H/M (M = Ag, Au, Ni and M/nc-Si:H/M Multifunctional Devices

Directory of Open Access Journals (Sweden)

A. F. Qasrawi

2013-01-01

Full Text Available Hydrogenated nanocrystalline Silicon thin films prepared by the very high frequency chemical vapor deposition technique (VHF-CVD on stainless steel (SST substrates are used to design Schottky point contact barriers for the purpose of solar energy conversion and passive electronic component applications. In this process, the contact performance between SST and M (M = Ag, Au, and Ni and between Ag, Au, and Ni electrodes was characterized by means of current-voltage, capacitance-voltage, and light intensity dependence of short circuit ( current and open circuit voltage ( of the contacts. Particularly, the devices ideality factors, barrier heights were evaluated by the Schottky method and compared to the Cheung's. Best Schottky device performance with lowest ideality factor suitable for electronic applications was observed in the SST/nc-Si:H/Ag structure. This device reflects a of 229 mV with an of 1.6 mA/cm2 under an illumination intensity of ~40 klux. On the other hand, the highest being 9.0 mA/cm2 and the of 53.1 mV were observed for Ni/nc-Si:H/Au structure. As these voltages represent the maximum biasing voltage for some of the designed devices, the SST/nc-Si:H/M and M/nc-Si:H/M can be regarded as multifunctional self-energy that provided electronic devices suitable for active or passive applications.

EnviroAtlas - Durham, NC - Demo (Parent)

Data.gov (United States)

U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

ORF Sequence: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

ORF Sequence: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

ORF Sequence: NC_003078 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

ORF Sequence: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

77 FR 57063 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC

Science.gov (United States)

2012-09-17

... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...

77 FR 64906 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC

Science.gov (United States)

2012-10-24

... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...

ORF Sequence: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

CAI System with Multi-Media Text Through Web Browser for NC Lathe Programming

Science.gov (United States)

Mizugaki, Yoshio; Kikkawa, Koichi; Mizui, Masahiko; Kamijo, Keisuke

A new Computer Aided Instruction (CAI) system for NC lathe programming has been developed with use of multi-media texts including movies, animations, pictures, sound and texts through Web browser. Although many CAI systems developed previously for NC programming consist of text-based instructions, it is difficult for beginners to learn NC programming with use of them. In the developed CAI system, multi-media texts are adopted for the help of users' understanding, and it is available through Web browser anytime and anywhere. Also the error log is automatically recorded for the future references. According to the NC programming coded by a user, the movement of the NC lathe is animated and shown in the monitor screen in front of the user. If its movement causes the collision between a cutting tool and the lathe, some sound and the caution remark are generated. If the user makes mistakes some times at a certain stage in learning NC, the corresponding suggestion is shown in the form of movies, animations, and so forth. By using the multimedia texts, users' attention is kept concentrated during a training course. In this paper, the configuration of the CAI system is explained and the actual procedures for users to learn the NC programming are also explained too. Some beginners tested this CAI system and their results are illustrated and discussed from the viewpoint of the efficiency and usefulness of this CAI system. A brief conclusion is also mentioned.

precision deburring using NC and robot equipment. Final report

Energy Technology Data Exchange (ETDEWEB)

Gillespie, L.K.

1980-05-01

Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

ORF Sequence: NC_003283 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

ORF Sequence: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

ORF Sequence: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

De Novo Discovery of Structured ncRNA Motifs in Genomic Sequences

DEFF Research Database (Denmark)

Ruzzo, Walter L; Gorodkin, Jan

2014-01-01

De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphas...... on an approach based on the CMfinder CMfinder program as a case study. Applications to genomic screens for novel de novo structured ncRNA ncRNA s, including structured RNA elements in untranslated portions of protein-coding genes, are presented.......De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphasis...

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

ORF Sequence: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

ORF Sequence: NC_001137 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

Explicit flow equations and recursion operator of the ncKP hierarchy

International Nuclear Information System (INIS)

He, Jingsong; Wang, Lihong; Tu, Junyi; Li, Xiaodong

2011-01-01

The explicit expression of the flow equations of the noncommutative Kadomtsev–Petviashvili (ncKP) hierarchy is derived. Compared with the flow equations of the KP hierarchy, our result shows that the additional terms in the flow equations of the ncKP hierarchy indeed consist of commutators of dynamical coordinates {u i }. The recursion operator for the flow equations under n-reduction is presented. Further, under 2-reduction, we calculate a nonlocal recursion operator Φ(2) of the noncommutative Korteweg–de Vries(ncKdV) hierarchy, which generates a hierarchy of local, higher-order flows. Thus we solve the open problem proposed by Olver and Sokolov (1998 Commun. Math. Phys. 193 245–68)

Testing the QCD string at large Nc from the thermodynamics of the hadronic phase

Science.gov (United States)

Cohen, Thomas D.

2007-02-01

It is generally believed that in the limit of a large number of colors (Nc) the description of confinement via flux tubes becomes valid and QCD can be modeled accurately via a hadronic string theory—at least for highly excited states. QCD at large Nc also has a well-defined deconfinement transition at a temperature Tc. In this talk it is shown how the thermodyanmics of the metastable hadronic phase of QCD (above Tc) at large NC can be related directly to properties of the effective QCD string. The key points in the derivation is the weakly interacting nature of hadrons at large Nc and the existence of a Hagedorn temperature TH for the effective string theory. From this it can be seen at large Nc and near TH, the energy density and pressure of the hadronic phase scale as E ˜ (TH - T)-(D⊥-6)/2 (for D⊥ TH - T)-(D⊥-4)/2 (for D⊥ TH > Tc this behavior is of relevance only to the metastable phase. The prospect of using this result to extract D⊥ via lattice simulations of the metastable hadronic phase at moderately large Nc is discussed.

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

ORF Sequence: NC_001147 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc

ORF Sequence: NC_001134 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

ORF Alignment: NC_006569 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

ORF Sequence: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

ORF Sequence: NC_000962 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

ORF Alignment: NC_003228 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...

ORF Sequence: NC_003281 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

ORF Sequence: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

ORF Alignment: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953

ORF Alignment: NC_006274 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Alignment: NC_003306 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Alignment: NC_003064 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Sequence: NC_001145 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

46 CFR 7.55 - Cape Henry, VA to Cape Fear, NC.

Science.gov (United States)

2010-10-01

... 46 Shipping 1 2010-10-01 2010-10-01 false Cape Henry, VA to Cape Fear, NC. 7.55 Section 7.55 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Atlantic Coast § 7.55 Cape Henry, VA to Cape Fear, NC. (a) A line drawn from Rudee Inlet Jetty Light “2” to...

ORF Alignment: NC_006371 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

ORF Sequence: NC_001139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

ORF Alignment: NC_004461 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

ORF Alignment: NC_003075 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003075 gi|42566272 >1ogqA 3 270 31 261 6e-05 ... ref|NP_192248.2| leucine-rich repeat transme...ery: 151 XXXXXXXGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 210 ... GELPDVFQNLVGLINLDISSNNISGTLPPSME...NLLTLTTLRVQNNQLSGTLDV Sbjct: 121 LNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 180 ...

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

ORF Alignment: NC_002928 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002928 gi|33596933 >1kmoA 7 661 65 702 8e-60 ... ref|NP_884576.1| putative ferrisi...derophore receptor [Bordetella parapertussis 12822] ... emb|CAE37631.1| putative ferrisiderophore rec

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep

ORF Alignment: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [Actinoplan...es teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34557077 >1vdkA 1 459 5 463 e-135 ... ref|NP_906892.1| ASPARTATE AMMONIA...-LYASE [Wolinella succinogenes DSM 1740] ... emb|CAE09792.1| ASPARTATE AMMONIA-LYASE [Wolinella ...

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19553429 >1v4aA 22 435 620 1034 4e-69 ... ref|YP_226470.1| GLUTAMATE-AMMONIA...mb|CAF20569.1| ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE ... [Corynebacterium glutami

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17547365 >1gkmA 3 497 10 504 e-143 ... emb|CAD16353.1| PROBABLE HISTIDINE AMMONIA...-LYASE (HISTIDASE) PROTEIN [Ralstonia ... solanacearum] ref|NP_520767.1| PROBABLE HISTIDINE ... AMMONIA

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15966456 >1gkmA 2 501 3 499 e-107 ... emb|CAC47282.1| PUTATIVE HISTIDINE AMMONIA...-LYASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386809.1| PUTATIVE HISTIDINE AMMONIA-LYASE

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19552717 >1vdkA 1 459 57 516 e-127 ... ref|YP_225787.1| ASPARTATE AMMONIA...ynebacterium glutamicum ATCC 13032] emb|CAF21511.1| ... ASPARTATE AMMONIA-LYASE (ASPARTASE) [Coryneba

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

ORF Alignment: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

ORF Alignment: NC_006085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON

ORF Alignment: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39996821 >1v7zA 3 252 1 232 3e-42 ... ref|NP_952772.1| creatinine amidoh...ydrolase [Geobacter sulfurreducens PCA] ... gb|AAR35099.1| creatinine amidohydrolase [Geobacter ...

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21225320 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21225300 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

ORF Alignment: NC_002929 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002929 gi|33592999 >1kmoA 7 661 65 702 1e-60 ... ref|NP_880643.1| putative ferrisi...derophore receptor [Bordetella pertussis Tohama I] ... emb|CAE42244.1| putative ferrisiderophore rece

ORF Alignment: NC_002927 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002927 gi|33600770 >1kmoA 7 661 65 702 2e-60 ... ref|NP_888330.1| putative ferrisi...derophore receptor [Bordetella bronchiseptica RB50] ... emb|CAE32282.1| putative ferrisiderophore rec

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

ORF Alignment: NC_003911 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...

ORF Alignment: NC_003296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003902 gi|21231422 >1iwlA 2 180 23 207 3e-47 ... ref|NP_637339.1| outer-membrane lipoproteins... ... gb|AAM41263.1| outer-membrane lipoproteins carrier ... protein precursor [Xanthomonas campest

Nieuwe Ronde, Nieuwe Kansen: Ontwikkeling in Management Accounting & Control

NARCIS (Netherlands)

A.N.A.M. Boons (Arnick)

2006-01-01

textabstractArnick Boons (1957) is part time Professor in Management Accounting & Control at RSM Erasmus University. He obtained a PhD in financial management at Erasmus University Rotterdam (2000). At the same time he joined Deloitte as a consultant on financial management issues. His

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_005139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006177 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006349 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003869 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006351 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004459 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004461 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

ORF Alignment: NC_006834 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Sequence: NC_001136 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG

ORF Alignment: NC_000964 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B

ORF Alignment: NC_006841 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...

ORF Alignment: NC_002570 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1gxlA 2 204 475 685 1e-34 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_003237 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003237 gi|19075000 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus jannaschii ... DSM 2661] gb|AAB99663.1| chromosome segreta

ORF Alignment: NC_003485 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003485 gi|19746967 >1g5aA 98 625 11 538 6e-94 ... gb|AAL98602.1| putative dextran ...glucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608103.1| putative dextran glucosidase ...

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34556965 >1mzbA 1 134 1 130 7e-21 ... ref|NP_906780.1| PEROXIDE STRESS R...EGULATOR [Wolinella succinogenes DSM 1740] ... emb|CAE09680.1| PEROXIDE STRESS REGULATOR [Wolinella ...

ORF Alignment: NC_006395 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006395 gi|55376664 >1v7zA 1 249 5 243 8e-44 ... ref|YP_134515.1| creatinine amidoh...ydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV44809.1| creatinine amidohydrolase [Haloarcula

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...

ORF Alignment: NC_002928 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002928 gi|33596750 >1v7zA 3 253 1 251 8e-40 ... ref|NP_884393.1| putative creatini...ne amidohydrolase [Bordetella parapertussis 12822] ... emb|CAE37436.1| putative creatinine amidohydro

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006576 gi|56750058 >1v7zA 4 251 11 256 7e-49 ... ref|YP_170759.1| creatinine amido...hydrolase [Synechococcus elongatus PCC 6301] ... dbj|BAD78239.1| creatinine amidohydrolase [Synechoco

ORF Alignment: NC_006395 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006395 gi|55376890 >1v7zA 5 250 13 257 5e-37 ... ref|YP_134741.1| creatinine amido...hydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV45035.1| creatinine amidohydrolase [Haloarcul

ORF Alignment: NC_004311 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004311 gi|23500710 >1v7zA 10 254 1 242 2e-43 ... gb|AAN34155.1| creatinine amidohy...drolase, putative [Brucella suis 1330] ... ref|NP_700150.1| creatinine amidohydrolase, putative ...

ORF Alignment: NC_002771 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002771 gi|15829246 >1nm8A 15 579 43 592 3e-82 ... ref|NP_326606.1| CARNITINE O-ACE...TYLTRANSFERASE [Mycoplasma pulmonis UAB CTIP] ... emb|CAC13948.1| CARNITINE O-ACETYLTRANSFERASE ...

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039110 >1kmoA 11 661 79 730 2e-52 ... ref|YP_191074.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60418.1| Hydroxamate-type ferrisid

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039006 >1kmoA 12 661 92 773 1e-43 ... ref|YP_190970.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60314.1| Hydroxamate-type ferrisid

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54310050 >1r0wC 43 281 30 288 6e-50 ... ref|YP_131070.1| putative ABC-type oligopeptide transport...putative ... ABC-type oligopeptide transportsystem, ATPase component ... [Photobacterium profu

ORF Alignment: NC_006361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006361 gi|54022220 >1y7yA 7 68 12 73 3e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

ORF Sequence: NC_001141 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001141 gi|6322114 >gi|6322114|ref|NP_012189.1| Part of a heptameric protein complex that regulates retro...grade Golgi-to-ER protein traffic in eukaryotic cells; coatomer forms the COP I ves

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

ORF Alignment: NC_006274 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006274 gi|52142820 >1kwfA 3 362 53 435 5e-85 ... ref|YP_084010.1| chitosanase; gly...cosyl hydrolases family 8; endoglucanase [Bacillus ... cereus ZK] gb|AAU17839.1| chitosanase; glycosy

ORF Alignment: NC_006348 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006348 gi|53725407 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

ORF Alignment: NC_002976 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002976 gi|57866545 >1dlwA 19 115 47 146 6e-19 ... ref|YP_188173.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... epidermidis RP62A] gb|AAW53991.1| ... protozoa

ORF Alignment: NC_002951 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002951 gi|57650195 >1dlwA 19 115 21 120 3e-19 ... ref|YP_185875.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus COL] gb|AAW36475.1| ... protozoa

ORF Alignment: NC_006350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006350 gi|53718816 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

ORF Alignment: NC_006087 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006087 gi|50955733 >1exqA 11 145 176 318 6e-09 ... ref|YP_063021.1| transposase, undefined... [Leifsonia xyli subsp. xyli str. CTCB07] ... gb|AAT89916.1| transposase, undefined [Leifsoni

ORF Alignment: NC_004668 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004668 gi|29376585 >1pq4B 1 288 29 305 1e-52 ... ref|NP_815739.1| endocarditis spe...cific antigen [Enterococcus faecalis V583] ... gb|AAO81809.1| endocarditis specific antigen ...

ORF Alignment: NC_000921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000921 gi|15612352 >1mwmA 3 314 14 329 4e-45 ... ref|NP_224005.1| ROD SHAPE-DETERMINING... PROTEIN [Helicobacter pylori J99] ... gb|AAD06861.1| ROD SHAPE-DETERMINING PROTEIN ... [

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17544778 >1mwmA 4 314 14 329 3e-49 ... emb|CAD13587.1| PROBABLE ROD SHAPE-DETERMINING... PROTEIN [Ralstonia solanacearum] ... ref|NP_518180.1| PROBABLE ROD SHAPE-DETERMINING PR

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17547375 >1v4aA 29 433 25 452 2e-95 ... emb|CAD16363.1| PROBABLE GLUTAMATE-AMMONIA... ... [Ralstonia solanacearum] ref|NP_520777.1| PROBABLE ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERAS

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17987610 >1v4aA 20 435 2 420 e-106 ... gb|AAL52508.1| GLUTAMATE-AMMONIA-...LIGASE ADENYLYLTRANSFERASE [Brucella melitensis ... 16M] ref|NP_540244.1| GLUTAMATE-AMMONIA-LIGASE ...

ORF Alignment: NC_005126 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005126 gi|37525549 >1iwlA 1 182 22 203 4e-57 ... ref|NP_928893.1| outer-membrane lipoproteins... ... emb|CAE13895.1| outer-membrane lipoproteins carrier ... protein precursor (P20) [Photorhabdus

ORF Alignment: NC_004603 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004603 gi|28897880 >1iwlA 4 181 30 207 4e-54 ... ref|NP_797485.1| outer membrane lipoproteins... carrier protein [Vibrio ... parahaemolyticus RIMD 2210633] dbj|BAC59369.1| outer ... membrane lipoproteins

ORF Alignment: NC_005966 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005966 gi|50085964 >1iwlA 2 180 37 230 6e-44 ... ref|YP_047474.1| outer-membrane lipoproteins... carrier protein [Acinetobacter sp. ... ADP1] emb|CAG69652.1| outer-membrane lipoproteins

ORF Alignment: NC_005139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005139 gi|37679507 >1iwlA 4 181 20 197 6e-54 ... ref|NP_934116.1| outer membrane lipoproteins...tein ... carrier protein precursor dbj|BAC94087.1| outer membrane ... lipoproteins carrier pro

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34497069 >1iwlA 2 178 25 203 1e-46 ... gb|AAQ59290.1| outer membrane lipoproteins... carrier protein [Chromobacterium ... violaceum ATCC 12472] ref|NP_901284.1| outer membrane ... lipoproteins

ORF Alignment: NC_004331 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004331 gi|23619306 >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putativ

ORF Alignment: NC_003911 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003911 gi|56698151 >1wy2A 3 347 27 396 7e-44 ... gb|AAV96554.1| creatinase [Silici...bacter pomeroyi DSS-3] ref|YP_168523.1| ... creatinase [Silicibacter pomeroyi DSS-3] ... Length

ORF Alignment: NC_003366 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29828632 >1w1oA 22 489 11 408 6e-19 ... dbj|BAC69801.1| putative xylitol... oxidase [Streptomyces avermitilis MA-4680] ... ref|NP_823266.1| putative xylitol oxidase [Streptomyc

ORF Alignment: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004605 gi|28900808 >1l3wA 6 536 1265 1798 3e-11 ... ref|NP_800463.1| putative biofilm...-associated surface protein [Vibrio parahaemolyticus ... RIMD 2210633] dbj|BAC62296.1| putative biofilm

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|15221381 >1bq00 2 77 15 90 4e-20 ... ref|NP_177004.1| gravity-responsive... protein / altered response to gravity protein ... (ARG1) [Arabidopsis thaliana] gb|AAD13758.1| Altere

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24

ORF Alignment: NC_002737 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002737 gi|15675767 >1g5aA 89 627 2 535 3e-86 ... gb|AAK34662.1| dextran glucosidas...e [Streptococcus pyogenes M1 GAS] ... ref|NP_269941.1| dextran glucosidase [Streptococcus ...

ORF Alignment: NC_003485 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003485 gi|19746879 >1g5aA 89 627 2 535 1e-86 ... gb|AAL98514.1| putative dextran g...lucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608015.1| putative dextran glucosidase ...

ORF Alignment: NC_002737 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002737 gi|15675852 >1g5aA 98 625 11 538 9e-95 ... gb|AAK34747.1| putative dextran ...glucosidase [Streptococcus pyogenes M1 GAS] ... ref|NP_270026.1| putative dextran glucosidase ...

ORF Alignment: NC_002927 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002927 gi|33600518 >1v7zA 3 253 1 251 1e-39 ... ref|NP_888078.1| putative creatini...ne amidohydrolase [Bordetella bronchiseptica RB50] ... emb|CAE32030.1| putative creatinine amidohydro

ORF Alignment: NC_000853 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000853 gi|15643179 >1v7zA 3 256 7 270 9e-43 ... ref|NP_228223.1| creatinine amidoh...ydrolase, putative [Thermotoga maritima MSB8] ... gb|AAD35498.1| creatinine amidohydrolase, putative

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23464642 >1v7zA 5 255 7 250 1e-55 ... ref|NP_695245.1| creatinine amidohydrolase; creatin...inase [Bifidobacterium longum ... NCC2705] gb|AAN23881.1| creatinine amidohydrolase; ... creatin

ORF Alignment: NC_002944 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002944 gi|41407994 >4uagA 7 413 12 470 1e-38 ... ref|NP_960830.1| MurC [Mycobacter... ... ligase (UDP-N-acetylmuramoyl-L-alanine synthetase) ... gb|AAS04213.1| MurC [Mycobacterium

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

ORF Alignment: NC_000117 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000117 gi|15605507 >2bjiA 3 266 5 313 9e-29 ... ref|NP_220293.1| Sulfite Synthesis.../biphosphate phosphatase [Chlamydia trachomatis ... D/UW-3/CX] gb|AAC68369.1| Sulfite Synthesis/bipho

ORF Alignment: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|25149956 >1qauA 5 99 56 151 2e-04 ... gb|AAN38752.1| axon identity speci...rm b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

ORF Alignment: NC_004722 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004722 gi|30021592 >1vkpA 12 368 2 333 2e-83 ... ref|NP_833223.1| Agmatine deimina...se [Bacillus cereus ATCC 14579] gb|AAP10424.1| ... Agmatine deiminase [Bacillus cereus ATCC 14579] ...

ORF Alignment: NC_002952 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002952 gi|49483165 >1dlwA 19 115 21 120 3e-19 ... ref|YP_040389.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG39975.1| ... protozoa

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34556511 >1mwmA 3 314 14 327 1e-46 ... ref|NP_906326.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09226.1| PUTATIVE ROD SHAPE-DETERMINING

ORF Alignment: NC_000921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000921 gi|15611661 >1vdkA 1 460 2 461 e-141 ... ref|NP_223312.1| ASPARTATE AMMONIA...-LYASE [Helicobacter pylori J99] gb|AAD06167.1| ... ASPARTATE AMMONIA-LYASE [Helicobacter pylori J99

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17986393 >1vdkA 1 459 12 469 e-123 ... gb|AAL51291.1| ASPARTATE AMMONIA-...LYASE [Brucella melitensis 16M] ref|NP_539027.1| ... ASPARTATE AMMONIA-LYASE [Brucella melitensis 16M

ORF Alignment: NC_006348 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006348 gi|53726032 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006840 gi|59711513 >1iwlA 4 181 21 198 9e-49 ... ref|YP_204289.1| outer-membrane lipoproteins... carrier protein [Vibrio fischeri ES114] ... gb|AAW85401.1| outer-membrane lipoproteins ca

ORF Alignment: NC_006350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006350 gi|53720213 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation repa...ir enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23466169 >1u94A 19 326 67 387 5e-28 ... ref|NP_696772.1| alkylation dama...ge repair protein [Bifidobacterium longum NCC2705] ... gb|AAN25408.1| alkylation damage repair protei

ORF Alignment: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair

ORF Alignment: NC_004350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...

ORF Alignment: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17987645 >1j1vA 4 94 20 109 8e-10 ... gb|AAL52543.1| CHROMOSOMAL REPLICATION... INITIATOR PROTEIN DNAA [Brucella melitensis ... 16M] ref|NP_540279.1| CHROMOSOMAL REPLICATION IN

ORF Alignment: NC_003232 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION

ORF Alignment: NC_003071 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003071 gi|18403860 >1rl1A 4 90 215 300 7e-09 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...

ORF Alignment: NC_002952 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002947 gi|26990378 >1wy2A 3 347 23 393 2e-45 ... ref|NP_745803.1| creatinase [Pseu...domonas putida KT2440] gb|AAN69267.1| creatinase ... [Pseudomonas putida KT2440] ... Length = 3

ORF Alignment: NC_002946 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002946 gi|59800954 >1ub4B 4 109 2 113 3e-22 ... ref|YP_207666.1| putative plasmid stable inheritance... ... gb|AAW89254.1| putative plasmid stable inheritance ... protein putative phage associated prote

ORF Alignment: NC_002745 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002745 gi|15925959 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

ORF Alignment: NC_002758 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002758 gi|15923246 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

ORF Alignment: NC_003075 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003075 gi|30692533 >3ullA 5 115 1 104 8e-18 ... ref|YP_063478.1| ssb1 [Campylobact...er jejuni] gb|AAR29567.1| ssb1 [Campylobacter ... jejuni] ... Length = 104 ... Query: 31 ... GQDSDVS

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

ORF Alignment: NC_003106 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003106 gi|15922820 >1n62B 24 793 4 684 e-115 ... ref|NP_378489.1| hypothetical nicotine... dehydrogenase subunit C [Sulfolobus tokodaii ... str. 7] dbj|BAB67598.1| 685aa long hypothetical nicotine

ORF Alignment: NC_006509 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006509 gi|56410456 >1n62C 1 286 1 287 4e-70 ... ref|YP_145830.1| nicotine dehydrog...enase chain A [Geobacillus kaustophilus HTA426] ... dbj|BAD74262.1| nicotine dehydrogenase chain A ...

ORF Alignment: NC_004310 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004310 gi|23502014 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17987131 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54310056 >1r0wC 45 273 39 283 1e-54 ... ref|YP_131076.1| putative ABC-type metal ion transports...ative ... ABC-type metal ion transportsystem, ATPase component ... [Photobacterium profundum

ORF Alignment: NC_001137 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ograde regulon which ... consists of genes whose expression is stimulated by... NC_001137 gi|6320764 >1wvfA 13 508 29 496 1e-67 ... ref|NP_010843.1| D-lactate dehydrogenase, part of the retr

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

ORF Alignment: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|25149956 >1tx4A 1 170 679 853 1e-24 ... gb|AAN38752.1| axon identity spe...form b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

ORF Alignment: NC_006348 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006348 gi|53726196 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

ORF Alignment: NC_004459 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004459 gi|27364633 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

ORF Alignment: NC_004603 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004603 gi|28899659 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

ORF Alignment: NC_004061 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004061 gi|21672661 >1etoB 1 98 1 99 3e-23 ... ref|NP_660728.1| factor-for-inversion... stimulation protein [Buchnera aphidicola ... str. Sg (Schizaphis graminum)] gb|AAM67939.1| ... factor-for-inversion

ORF Alignment: NC_006350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006350 gi|53720503 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

ORF Alignment: NC_005139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005139 gi|37681323 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54310477 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa

ORF Sequence: NC_001146 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001146 gi|6324141 >gi|6324141|ref|NP_014211.1| Essential protein involved in karyoga...he spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p; Kar1p [Saccharomyc

ORF Sequence: NC_001139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001139 gi|50593217 >gi|50593217|ref|NP_011747.2| Subunit of the prohibitin complex (Phb1p-Phb2p...sized proteins; determinant of replicative life span; involved in mitochondrial segregation; Phb2p [Saccharo

ORF Alignment: NC_004917 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004917 gi|32265815 >1iwlA 11 178 23 174 4e-23 ... gb|AAP76913.1| outer membrane lipoproteins... carrier protein LolA [Helicobacter ... hepaticus ATCC 51449] ref|NP_859847.1| outer membrane ... lipoprotein

Comparative Evaluation of Ultrafiltration/Microfiltration Membranes for Removal of Nitrocellulose (NC) Fines from Wastewater

National Research Council Canada - National Science Library

Kim, Byung

1997-01-01

.... In Phase II, a pilot-scale crossflow membrane filtration system was constructed to: (1) investigate the concentration polarization and fouling mechanism caused by NC fines during crossflow filtration of NC wastewater, (2...

Phytoplanktonic composition of three cultivation systems used in Litopenaeus vannamei (BOONE, 1931 marine shrimp farms = Composição fitoplanctônica em três sistemas de cultivo do camarão marinho Litopenaeus vannamei (BOONE, 1931

Directory of Open Access Journals (Sweden)

Michelle Pereira Melo

2010-07-01

Full Text Available The aim of this work is to assess the different compositions of phytoplankton in three cultivation systems of marine shrimps Litopenaeus vannamei (BOONE, 1931, denominated as organic, intensive and semi intensive. The samples were done fortnightly, when phytoplankton was collected by a net for phytoplankton, 65 ƒÊm mesh, being then filtrated in a total volume of water of 100 L, and preserved in formaldehyde solution at 4% and identified according to the methodology of Cordeiro et al. (1997. The results show that the densities of Diatoms were of 16.65, 10.47 and 7.57 cel. 103 mL-1 for the organic, intensive and semi intensive cultivations, respectively. As for cyanobacteria, the average figures were 42.06 cel. 103 mL-1 forsemi intensive 17.27 cel. 103 mL-1, in the intensive cultivation and 6.11 cel. 103 mL-1 for the organic cultivation system. The dinoflagellates had the highest cellular density in the phytoplankton community analyzed with 61.9 cel. 103 mL-1 in the intensive cultivation, 0.33 and 0.03 cel. 103 mL-1 for both semi intensive and organic cultivation systems respectively. Euglenas presented the results of 4.98 and 14.86 cel. 103 mL-1 only for semi intensive and intensive cultivations. It was then concluded that all cultivations presented average rates below recommended for such studied systems.Conduziu-se esse trabalho com o objetivo de avaliar as diferentes composicoes fitoplanctonicas em tres sistemas de cultivo para o camarao marinho Litopenaeus vannamei (BOONE, 1931, denominados de organico, intensivo e semiintensivo. As amostragens foram realizadas quinzenalmente, onde o fitoplancton foi coletado atraves de uma rede de plancton, com malha de 65 ƒÊm, sendo filtrado um volume de agua total de 100 litros, que foram preservadas em solucao de formol a 4% e identificadas segundo a metodologia de Cordeiro et al. (1997. Os resultados mostram que as densidades de diatomaceas foram de 16,65; 10,47 e 7,57 cel. 103 mL-1, respectivamente

DES-ncRNA: A knowledgebase for exploring information about human micro and long noncoding RNAs based on literature-mining

KAUST Repository

Salhi, Adil

2017-04-07

Noncoding RNAs (ncRNAs), particularly microRNAs (miRNAs) and long ncRNAs (lncRNAs), are important players in diseases and emerge as novel drug targets. Thus, unraveling the relationships between ncRNAs and other biomedical entities in cells are critical for better understanding ncRNA roles that may eventually help develop their use in medicine. To support ncRNA research and facilitate retrieval of relevant information regarding miRNAs and lncRNAs from the plethora of published ncRNA-related research, we developed DES-ncRNA ( www.cbrc.kaust.edu.sa/des_ncrna ). DES-ncRNA is a knowledgebase containing text- and data-mined information from public scientific literature and other public resources. Exploration of mined information is enabled through terms and pairs of terms from 19 topic-specific dictionaries including, for example, antibiotics, toxins, drugs, enzymes, mutations, pathways, human genes and proteins, drug indications and side effects, mutations, diseases, etc. DES-ncRNA contains approximately 878,000 associations of terms from these dictionaries of which 36,222 (5,373) are with regards to miRNAs (lncRNAs). We provide several ways to explore information regarding ncRNAs to users including controlled generation of association networks as well as hypotheses generation. We show an example how DES-ncRNA can aid research on Alzheimer\\'s disease and suggest potential therapeutic role for Fasudil. DES-ncRNA is a powerful tool that can be used on its own or as a complement to the existing resources, to support research in human ncRNA. To our knowledge, this is the only knowledgebase dedicated to human miRNAs and lncRNAs derived primarily through literature-mining enabling exploration of a broad spectrum of associated biomedical entities, not paralleled by any other resource.

DES-ncRNA: A knowledgebase for exploring information about human micro and long noncoding RNAs based on literature-mining.

Science.gov (United States)

Salhi, Adil; Essack, Magbubah; Alam, Tanvir; Bajic, Vladan P; Ma, Lina; Radovanovic, Aleksandar; Marchand, Benoit; Schmeier, Sebastian; Zhang, Zhang; Bajic, Vladimir B

2017-07-03

Noncoding RNAs (ncRNAs), particularly microRNAs (miRNAs) and long ncRNAs (lncRNAs), are important players in diseases and emerge as novel drug targets. Thus, unraveling the relationships between ncRNAs and other biomedical entities in cells are critical for better understanding ncRNA roles that may eventually help develop their use in medicine. To support ncRNA research and facilitate retrieval of relevant information regarding miRNAs and lncRNAs from the plethora of published ncRNA-related research, we developed DES-ncRNA ( www.cbrc.kaust.edu.sa/des_ncrna ). DES-ncRNA is a knowledgebase containing text- and data-mined information from public scientific literature and other public resources. Exploration of mined information is enabled through terms and pairs of terms from 19 topic-specific dictionaries including, for example, antibiotics, toxins, drugs, enzymes, mutations, pathways, human genes and proteins, drug indications and side effects, mutations, diseases, etc. DES-ncRNA contains approximately 878,000 associations of terms from these dictionaries of which 36,222 (5,373) are with regards to miRNAs (lncRNAs). We provide several ways to explore information regarding ncRNAs to users including controlled generation of association networks as well as hypotheses generation. We show an example how DES-ncRNA can aid research on Alzheimer disease and suggest potential therapeutic role for Fasudil. DES-ncRNA is a powerful tool that can be used on its own or as a complement to the existing resources, to support research in human ncRNA. To our knowledge, this is the only knowledgebase dedicated to human miRNAs and lncRNAs derived primarily through literature-mining enabling exploration of a broad spectrum of associated biomedical entities, not paralleled by any other resource.

DES-ncRNA: A knowledgebase for exploring information about human micro and long noncoding RNAs based on literature-mining

KAUST Repository

Salhi, Adil; Essack, Magbubah; Alam, Tanvir; Bajic, Vladan P.; Ma, Lina; Radovanovic, Aleksandar; Marchand, Benoit; Schmeier, Sebastian; Zhang, Zhang; Bajic, Vladimir B.

2017-01-01

Noncoding RNAs (ncRNAs), particularly microRNAs (miRNAs) and long ncRNAs (lncRNAs), are important players in diseases and emerge as novel drug targets. Thus, unraveling the relationships between ncRNAs and other biomedical entities in cells are critical for better understanding ncRNA roles that may eventually help develop their use in medicine. To support ncRNA research and facilitate retrieval of relevant information regarding miRNAs and lncRNAs from the plethora of published ncRNA-related research, we developed DES-ncRNA ( www.cbrc.kaust.edu.sa/des_ncrna ). DES-ncRNA is a knowledgebase containing text- and data-mined information from public scientific literature and other public resources. Exploration of mined information is enabled through terms and pairs of terms from 19 topic-specific dictionaries including, for example, antibiotics, toxins, drugs, enzymes, mutations, pathways, human genes and proteins, drug indications and side effects, mutations, diseases, etc. DES-ncRNA contains approximately 878,000 associations of terms from these dictionaries of which 36,222 (5,373) are with regards to miRNAs (lncRNAs). We provide several ways to explore information regarding ncRNAs to users including controlled generation of association networks as well as hypotheses generation. We show an example how DES-ncRNA can aid research on Alzheimer's disease and suggest potential therapeutic role for Fasudil. DES-ncRNA is a powerful tool that can be used on its own or as a complement to the existing resources, to support research in human ncRNA. To our knowledge, this is the only knowledgebase dedicated to human miRNAs and lncRNAs derived primarily through literature-mining enabling exploration of a broad spectrum of associated biomedical entities, not paralleled by any other resource.

Fluorescent silver nanoclusters capped by polyethyleneimine with different molecular weights: Universal synthesis and application as a temperature sensor

Energy Technology Data Exchange (ETDEWEB)

Qu, Fei, E-mail: qufei3323@163.com [The Key Laboratory of Life-Organic Analysis, Qufu Normal University, Qufu 273165, Shandong (China); Key Laboratory of Pharmaceutical Intermediates and Analysis of Natural Medicine, Qufu Normal University, Qufu 273165, Shandong (China); Li, Qingjin [The Key Laboratory of Life-Organic Analysis, Qufu Normal University, Qufu 273165, Shandong (China); Key Laboratory of Pharmaceutical Intermediates and Analysis of Natural Medicine, Qufu Normal University, Qufu 273165, Shandong (China); You, Jinmao, E-mail: jmyou6304@163.com [The Key Laboratory of Life-Organic Analysis, Qufu Normal University, Qufu 273165, Shandong (China); Key Laboratory of Pharmaceutical Intermediates and Analysis of Natural Medicine, Qufu Normal University, Qufu 273165, Shandong (China); Northwest Institute of Plateau Biology, Chinese Academy of Sciences, Xining 810001 (China)

2016-09-15

In this paper, we developed a universal, applicable and simple synthetic method of Ag nanoclusters capped by polyethyleneimine (PEI) with different molecular weights (AgNC-PEIs), including Mw 600, 1300, 1800, 2000, 10,000, 25,000, 70,000, and 750,000. Using formaldehyde as the sole reducing agent, silver nanoclusters could be successfully prepared by using these templates. Subsequently, several characterization techniques were employed to investigate the properties of AgNC-PEIs, and the results suggested that these AgNC-PEIs had similar sizes, structures, and optical features. However, besides the common characteristics, different temperature sensitivities were found for these nanoclusters, in which AgNC-PEI 25000 was proper to be applied as a temperature sensor. With increasing temperature, the fluorescence quenched dramatically, and this change could be readily observed by naked eyes under UV light. Injection of these temperature sensitive nanoclusters into a glass tube, a simple thermometer could be fabricated easily, thus AgNC-PEI 25000 would be a promising candidate for temperature sensing as a visible indicator.

ORF Alignment: NC_004547 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004547 gi|50121646 >1kmoA 14 661 37 705 8e-56 ... ref|YP_050813.1| exogenous ferri...c siderophore TonB-dependent receptor [Erwinia ... carotovora subsp. atroseptica SCRI1043] emb|CAG75622.1| ... exogenou

ORF Alignment: NC_003364 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003364 gi|18312259 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

ORF Alignment: NC_003236 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003236 gi|19074669 >1jmcA 1 238 213 445 1e-62 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

ORF Alignment: NC_002607 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002607 gi|15791012 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

ORF Alignment: NC_005861 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005861 gi|46446610 >1f39A 5 95 55 141 1e-16 ... ref|YP_007975.1| probable SOS mutagenesis... and repair protein UmuD [Parachlamydia sp. ... UWE25] emb|CAF23700.1| probable SOS mutagenesis

ORF Alignment: NC_005070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005070 gi|33865578 >1f39A 4 97 54 143 4e-22 ... ref|NP_897137.1| putative SOS mutagenesis... protein UmuD [Synechococcus sp. WH 8102] ... emb|CAE07559.1| putative SOS mutagenesis protein

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13472874 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

ORF Alignment: NC_006177 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006177 gi|51893967 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

ORF Alignment: NC_002967 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002967 gi|42528039 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

ORF Alignment: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31792055 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31793631 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_002755 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002755 gi|15841974 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_002755 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002755 gi|15840280 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_000962 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000962 gi|15609587 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29830077 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_000962 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000962 gi|15608007 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_006582 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006582 gi|56962048 >1sd4A 2 99 6 103 1e-24 ... ref|YP_173770.1| methicillin resist...ance regulatory protein MecI [Bacillus clausii ... KSM-K16] dbj|BAD62809.1| methicillin resistance ...

ORF Alignment: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42524871 >1tjlA 27 144 16 133 6e-10 ... ref|NP_970251.1| dnaK deletion s...uppressor protein [Bdellovibrio bacteriovorus HD100] ... emb|CAE78310.1| dnaK deletion suppressor pro

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro

ORF Alignment: NC_003921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003921 gi|21264213 >1ub4C 1 63 1 63 4e-10 ... gb|AAM39232.1| plasmid stable inheritance... protein I [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644714.1| plasmid stable ... inheritance

ORF Alignment: NC_003921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003921 gi|21264212 >1m1fA 1 109 2 110 1e-34 ... gb|AAM39231.1| plasmid stable inheritance... protein K [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644713.1| plasmid stable ... inheritance

ORF Alignment: NC_005791 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005791 gi|45358156 >1wcv1 4 241 4 235 5e-21 ... ref|NP_987713.1| walker type ATPas...e [Methanococcus maripaludis S2] emb|CAF30149.1| ... walker type ATPase [Methanococcus maripaludis S2

ORF Alignment: NC_003283 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003283 gi|17561408 >1bor0 2 53 282 342 3e-04 ... ref|NP_757385.1| synoviolin 1 iso...form b [Homo sapiens] gb|AAH30530.1| Synoviolin 1, ... isoform b [Homo sapiens] ... Length = 61

ORF Alignment: NC_002745 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002745 gi|15925955 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

ORF Alignment: NC_002758 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002758 gi|15923242 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

ORF Alignment: NC_003284 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003284 gi|17551448 >1rw3A 32 443 156 555 3e-25 ... gb|AAF64414.1| Pol [equine foam...y virus] ref|NP_054716.1| Pol [equine foamy virus] ... Length = 400 ... Query: 980 ... KLRIVLD--ASSPPGPEPSL

ORF Alignment: NC_005126 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005126 gi|37527217 >1b12A 1 247 78 326 7e-74 ... ref|NP_930561.1| Signal peptidase I (SPase I) (Leader...| ... Signal peptidase I (SPase I) (Leader peptidase I) ... [Photorhabdus luminescens subsp. l

ORF Alignment: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179485 >1iwlA 1 182 23 204 2e-69 ... ref|YP_215902.1| periplasmic protein effects...ica ... subsp. enterica serovar Choleraesuis str. SC-B67] ... gb|AAX64821.1| periplasmic protein effects

ORF Alignment: NC_004557 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004557 gi|28211518 >1v7zA 1 255 3 250 2e-62 ... ref|NP_782462.1| creatininase [Clo...stridium tetani E88] gb|AAO36399.1| creatininase ... [Clostridium tetani E88] ... Length = 248

ORF Sequence: NC_001136 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001136 gi|6320230 >gi|6320230|ref|NP_010310.1| Component of the GARP (Golgi-associated retrograde... protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for retrograde transport

ORF Alignment: NC_006300 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006300 gi|52425721 >1p3dA 1 463 15 477 e-153 ... ref|YP_088858.1| MurC protein [Ma...nnheimia succiniciproducens MBEL55E] gb|AAU38273.1| ... MurC protein [Mannheimia succiniciproducens M

ORF Alignment: NC_006300 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006300 gi|52425669 >4uagA 6 428 2 453 3e-46 ... ref|YP_088806.1| MurC protein [Man...nheimia succiniciproducens MBEL55E] gb|AAU38221.1| ... MurC protein [Mannheimia succiniciproducens MB

ORF Alignment: NC_002663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002663 gi|15602008 >1p3dA 1 463 17 479 e-156 ... ref|NP_245080.1| MurC [Pasteurell...a multocida subsp. multocida str. Pm70] ... gb|AAK02227.1| MurC [Pasteurella multocida subsp. ...

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13473528 >1u07A 4 89 172 254 2e-09 ... ref|NP_105096.1| energy transduce...r TonB [Mesorhizobium loti MAFF303099] ... dbj|BAB50882.1| energy transducer; TonB [Mesorhizobium ...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

ORF Alignment: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62180303 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

ORF Alignment: NC_006511 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006511 gi|56413338 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

ORF Alignment: NC_002940 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002940 gi|33151562 >1u07A 8 84 201 279 1e-08 ... gb|AAP95304.1| TobB energy transd...ucing protein [Haemophilus ducreyi 35000HP] ... ref|NP_872915.1| TobB energy transducing protein ...

ORF Alignment: NC_003197 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003197 gi|16765081 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

ORF Alignment: NC_000117 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000117 gi|15605545 >1u7nA 1 327 4 316 2e-67 ... ref|NP_220331.1| FA/Phospholipid Synthesis... Protein [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68407.1| FA/Phospholipid Synthesis Prote

ORF Alignment: NC_000907 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000907 gi|16272918 >1etoB 1 97 1 98 9e-28 ... ref|ZP_00320663.1| COG2901: Factor for inversion... ... ref|ZP_00156839.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator [Hae

ORF Alignment: NC_006512 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006512 gi|56461389 >1etoB 1 98 1 97 7e-25 ... ref|YP_156670.1| Factor for inversion... stimulation Fis, transcriptional activator ... [Idiomarina loihiensis L2TR] gb|AAV83121.1| Factor for ... inversion

ORF Alignment: NC_006511 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006511 gi|56414667 >1hcrA 1 48 25 72 5e-05 ... ref|YP_151742.1| inversion of adjac... ... 9150] gb|AAV78430.1| inversion of adjacent DNA; at ... locus of e14 element [Salmonella ent

ORF Alignment: NC_003281 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003281 gi|17554732 >1yovB 5 426 11 433 e-114 ... ref|NP_498534.1| UBiquitin Activating enzme related, ectop...ic membrane RuFfLes in ... embryo RFL-1, CYtoKinesis defect CYK-5 (rfl-1) ...

ORF Alignment: NC_000963 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000963 gi|15604602 >1mwmA 4 314 14 327 1e-47 ... ref|NP_221120.1| ROD SHAPE-DETERMINING... PROTEIN MREB (mreB) [Rickettsia prowazekii ... str. Madrid E] emb|CAA15196.1| ROD SHAPE-DETERMINING

Electrochemical characteristics of nc-Si/SiC composite for anode electrode of lithium ion batteries

International Nuclear Information System (INIS)

Jeon, Bup Ju; Lee, Joong Kee

2014-01-01

Graphical abstract: Cycling performances and coulombic efficiencies of the nc-Si/SiC composite anodes at different CH 4 /SiH 4 mole ratios. -- Highlights: • Our work has focused on irreversible discharge capacity and capacity retention of nc-Si/SiC composite particles. • Particles comprised a mixed construction of nc-Si/SiC structure with dual phases. • The SiC phase acted as retarding media, leading to enhanced cycle stability. -- Abstract: nc-Si/SiC composite particles were prepared as an anode material for lithium ion batteries using a plasma jet with DC arc discharge. The composition of the nc-Si/SiC composite particles was controlled by setting the mole ratio of CH 4 and SiH 4 precursor gases. X-ray diffraction, TEM images, and Raman shift analyses revealed that the synthesized nc-Si/SiC composite particles comprised a construction of nano-nocaled structure with crystalline phases of active silicon, highly disordered amorphous carbon of graphite and crystalline phases of β-SiC. In the experimental range examined, the nc-Si/SiC composite particles showed good coulombic efficiency in comparison with particles high Si–Si bonding content due to the interplay of particles with a small proportion of carbon and the buffering effect against volume expansion by structural stabilization, and played a role as retarding media for the rapid electrochemical reactions of the SiC crystal against lithium

Electrochemical characteristics of nc-Si/SiC composite for anode electrode of lithium ion batteries

Energy Technology Data Exchange (ETDEWEB)

Jeon, Bup Ju [Department of Energy Resources, Shinhan University, 233-1, Sangpae-dong, Dongducheon, Gyeonggi-do, 483-777 (Korea, Republic of); Lee, Joong Kee, E-mail: leejk@kist.re.kr [Advanced Energy Materials Processing Laboratory, Center for Energy Convergence Research, Green City Technology Institute, Korea Institute of Science and Technology, Hwarangno 14-gil 5, Seongbuk-gu, Seoul 136-791 (Korea, Republic of)

2014-03-25

Graphical abstract: Cycling performances and coulombic efficiencies of the nc-Si/SiC composite anodes at different CH{sub 4}/SiH{sub 4} mole ratios. -- Highlights: • Our work has focused on irreversible discharge capacity and capacity retention of nc-Si/SiC composite particles. • Particles comprised a mixed construction of nc-Si/SiC structure with dual phases. • The SiC phase acted as retarding media, leading to enhanced cycle stability. -- Abstract: nc-Si/SiC composite particles were prepared as an anode material for lithium ion batteries using a plasma jet with DC arc discharge. The composition of the nc-Si/SiC composite particles was controlled by setting the mole ratio of CH{sub 4} and SiH{sub 4} precursor gases. X-ray diffraction, TEM images, and Raman shift analyses revealed that the synthesized nc-Si/SiC composite particles comprised a construction of nano-nocaled structure with crystalline phases of active silicon, highly disordered amorphous carbon of graphite and crystalline phases of β-SiC. In the experimental range examined, the nc-Si/SiC composite particles showed good coulombic efficiency in comparison with particles high Si–Si bonding content due to the interplay of particles with a small proportion of carbon and the buffering effect against volume expansion by structural stabilization, and played a role as retarding media for the rapid electrochemical reactions of the SiC crystal against lithium.

ORF Alignment: NC_006087 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006087 gi|50955643 >1u94A 24 325 68 337 3e-32 ... ref|YP_062931.1| alkylation dama...ge DNA repair protein [Leifsonia xyli subsp. xyli ... str. CTCB07] gb|AAT89826.1| alkylation damage D

ORF Alignment: NC_006142 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006142 gi|51473766 >1xvqA 17 163 40 196 7e-07 ... ref|YP_067523.1| Sco2-like prote...in [Rickettsia typhi str. Wilmington] gb|AAU04041.1| ... Sco2-like protein [Rickettsia typhi str. Wil

ORF Alignment: NC_003233 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003233 gi|19074284 >1ltlE 10 233 29 251 7e-31 ... emb|CAD25394.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM5 ... [Encephalitozoon cuniculi GB-M1] ref|NP_585790.1| DNA ... REPLICATION

ORF Alignment: NC_003236 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003236 gi|19074669 >1ewiA 5 113 54 161 1e-18 ... emb|CAD25779.1| DNA REPLICATION F...ACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PROT

ORF Alignment: NC_003238 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003238 gi|19173256 >1ltlE 44 240 100 302 2e-23 ... emb|CAD27107.1| DNA REPLICATION... LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

ORF Alignment: NC_003229 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003229 gi|19074034 >1ltlE 2 242 49 290 7e-40 ... emb|CAD25144.1| DNA REPLICATION L...ICENSING FACTOR OF THE MCM FAMILY (MCM4) ... [Encephalitozoon cuniculi GB-M1] ref|NP_584640.1| DNA ... REPLICATION

ORF Alignment: NC_003236 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003236 gi|19074669 >1l1oC 2 175 456 623 1e-43 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

ORF Alignment: NC_000917 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000917 gi|11498546 >1yozA 1 116 1 116 6e-47 ... pdb|1YOZ|B Chain B, Predicted Coding... Region Af0941 From Archaeoglobus Fulgidus ... pdb|1YOZ|A Chain A, Predicted Coding Region Af0941 F

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669589 >1vhtA 3 200 2 186 2e-14 ... ref|NP_248402.1| alignment in /usr/local/projects...408.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R584_orf2.nr ... [Me

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|18397761 >1wocC 2 96 2 97 5e-15 ... ref|YP_063428.1| ssb1 [Campylobacter... ... gb|EAL55921.1| single-strand binding protein, putative ... [Campylobacter coli RM2228] gb|AAR29517.1| ssb1

ORF Alignment: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002695 gi|15830716 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15801201 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_003197 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003197 gi|16764541 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_006511 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006511 gi|56413828 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_003198 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003198 gi|16760062 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_004631 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004631 gi|29142167 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16129047 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_004741 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004741 gi|30062618 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179702 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_004337 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004337 gi|56479819 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_004431 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004431 gi|26247224 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_003318 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003318 gi|17988654 >1v7zA 9 254 21 263 2e-44 ... ref|NP_541287.1| creatininase [Br...ucella melitensis 16M] gb|AAL53551.1| creatininase ... [Brucella melitensis 16M] pir||AD3548 creatini

ORF Alignment: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42522087 >3ncmA 2 92 125 205 3e-07 ... gb|AAQ14642.1| HK97 major tail subunit [Bacteriophage Feli...x 01] ref|NP_944848.1| ... HK97 major tail subunit [Bacteriophage Felix 01

ORF Alignment: NC_004310 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004310 gi|23502301 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...

ORF Alignment: NC_002942 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002942 gi|52842820 >1p3dA 3 461 10 467 e-125 ... ref|YP_096619.1| UDP-N-acetylmuramate:L-alanine ligase Mur...28672.1| ... UDP-N-acetylmuramate:L-alanine ligase MurC [Legionella ... pneumophila subsp. pne

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17986863 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...

ORF Alignment: NC_006513 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006513 gi|56476897 >1r0wC 2 267 324 600 2e-59 ... ref|YP_158486.1| putative composite... ATP-binding transmembrane ABC transporter ... protein [Azoarcus sp. EbN1] emb|CAI07585.1| putative ... composite

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13475854 >1el5A 4 378 18 430 4e-33 ... ref|NP_107424.1| agaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53210.1| Aga

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13475930 >1el5A 6 379 7 420 7e-42 ... ref|NP_107500.1| AgaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53286.1| AgaE

ORF Alignment: NC_002679 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002679 gi|13488188 >1el5A 4 377 26 437 3e-36 ... ref|NP_085608.1| agaE(conversion of agropini...c acid to mannopinic acid) ... [Mesorhizobium loti MAFF303099] dbj|BAB54449.1| AgaE ...

ORF Alignment: NC_005810 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005810 gi|45441793 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

ORF Alignment: NC_004088 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004088 gi|22125929 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006576 gi|56751418 >1kgsA 3 222 4 231 2e-39 ... ref|YP_172119.1| two-component response regulator for energ... ... PCC 6301] dbj|BAD79599.1| two-component response ... regulator for energy transfer from ph

ORF Alignment: NC_003143 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003143 gi|16122423 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

ORF Alignment: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006155 gi|51596443 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

External electric field effects on Schottky barrier at Gd3N@C80/Au interface

Science.gov (United States)

Onishi, Koichi; Nakashima, Fumihiro; Jin, Ge; Eto, Daichi; Hattori, Hayami; Miyoshi, Noriko; Kirimoto, Kenta; Sun, Yong

2017-08-01

The effects of the external electric field on the height of the Schottky barrier at the Gd3N@C80/Au interface were studied by measuring current-voltage characteristics at various temperatures from 200 K to 450 K. The Gd3N@C80 sample with the conduction/forbidden/valence energy band structure had a face-centered cubic crystal structure with the average grain size of several nanometers. The height of the Gd3N@C80/Au Schottky barrier was confirmed to be 400 meV at a low electric field at room temperature. Moreover, the height decreases with the increasing external electric field through a change of permittivity in the Gd3N@C80 sample due to a polarization of the [Gd3] 9 +-[N3 -+("separators="|C80 ) 6 -] dipoles in the Gd3N@C80 molecule. The field-dependence of the barrier height can be described using a power math function of the electric field strength. The results of the field-dependent barrier height indicate that the reduction in the Schottky barrier is due to an image force effect of the transport charge carrier at the Gd3N@C80/Au interface.

Ultraconserved regions encoding ncRNAs are altered in human leukemias and carcinomas.

Science.gov (United States)

Calin, George A; Liu, Chang-gong; Ferracin, Manuela; Hyslop, Terry; Spizzo, Riccardo; Sevignani, Cinzia; Fabbri, Muller; Cimmino, Amelia; Lee, Eun Joo; Wojcik, Sylwia E; Shimizu, Masayoshi; Tili, Esmerina; Rossi, Simona; Taccioli, Cristian; Pichiorri, Flavia; Liu, Xiuping; Zupo, Simona; Herlea, Vlad; Gramantieri, Laura; Lanza, Giovanni; Alder, Hansjuerg; Rassenti, Laura; Volinia, Stefano; Schmittgen, Thomas D; Kipps, Thomas J; Negrini, Massimo; Croce, Carlo M

2007-09-01

Noncoding RNA (ncRNA) transcripts are thought to be involved in human tumorigenesis. We report that a large fraction of genomic ultraconserved regions (UCRs) encode a particular set of ncRNAs whose expression is altered in human cancers. Genome-wide profiling revealed that UCRs have distinct signatures in human leukemias and carcinomas. UCRs are frequently located at fragile sites and genomic regions involved in cancers. We identified certain UCRs whose expression may be regulated by microRNAs abnormally expressed in human chronic lymphocytic leukemia, and we proved that the inhibition of an overexpressed UCR induces apoptosis in colon cancer cells. Our findings argue that ncRNAs and interaction between noncoding genes are involved in tumorigenesis to a greater extent than previously thought.

Connecticut State University System Initiative for Nanotechnology-Related Equipment, Faculty Development and Curriculum Development

Energy Technology Data Exchange (ETDEWEB)

Broadbridge, Christine C. [Southern Connecticut State University

2013-03-28

DOE grant used for partial fulfillment of necessary laboratory equipment for course enrichment and new graduate programs in nanotechnology at the four institutions of the Connecticut State University System (CSUS). Equipment in this initial phase included variable pressure scanning electron microscope with energy dispersive x-ray spectroscopy elemental analysis capability [at Southern Connecticut State University]; power x-ray diffractometer [at Central Connecticut State University]; a spectrophotometer and spectrofluorimeter [at Eastern Connecticut State University; and a Raman Spectrometer [at Western Connecticut State University]. DOE's funding was allocated for purchase and installation of this scientific equipment and instrumentation. Subsequently, DOE funding was allocated to fund the curriculum, faculty development and travel necessary to continue development and implementation of the System's Graduate Certificate in Nanotechnology (GCNT) program and the ConnSCU Nanotechnology Center (ConnSCU-NC) at Southern Connecticut State University. All of the established outcomes have been successfully achieved. The courses and structure of the GCNT program have been determined and the program will be completely implemented in the fall of 2013. The instrumentation has been purchased, installed and has been utilized at each campus for the implementation of the nanotechnology courses, CSUS GCNT and the ConnSCU-NC. Additional outcomes for this grant include curriculum development for non-majors as well as faculty and student research.

ORF Alignment: NC_003238 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003238 gi|19173253 >1a5t0 17 316 29 298 4e-25 ... emb|CAD27104.1| REPLICATION FACT...OR C (ACTIVATOR 1) 37kDa SUBUNIT [Encephalitozoon ... cuniculi GB-M1] ref|NP_597056.1| REPLICATION FA

ORF Alignment: NC_003238 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003238 gi|19173256 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

ORF Alignment: NC_005787 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005787 gi|45198873 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

ORF Alignment: NC_003229 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003229 gi|19073988 >1a5t0 2 324 6 283 2e-17 ... emb|CAD25098.1| DNA REPLICATION FA...CTOR (ACTIVATOR 1) 36 kDa SUBUNIT ... [Encephalitozoon cuniculi GB-M1] ref|NP_584594.1| DNA ... REPLICATION

Large-Nc quantum chromodynamics and harmonic sums

Indian Academy of Sciences (India)

2012-06-08

Jun 8, 2012 ... This has led us to consider a class of analytic number theory .... The self-energy function LR(Q2) in the chiral limit vanishes order by order in QCD ... the 1/Nc expansion, the Goldstone loop corrections are subleading and, ...

ORF Alignment: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179784 >1j9iA 1 68 1 68 5e-21 ... ref|YP_216201.1| Gifsy-1 prophage DNA packaging... ... gb|AAX65120.1| Gifsy-1 prophage DNA packaging protein ... [Phage Gifsy-1] ... Length = 68 ... Q

ORF Alignment: NC_006351 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006351 gi|53722258 >1kolA 2 388 1 341 4e-33 ... ref|YP_111243.1| putative zinc-binding xylitol... ... zinc-binding xylitol/sorbitol dehydrogenase ... [Burkholderia pseudomallei K96243] ... .../sorbitol dehydrogenase [Burkholderia ... pseudomallei K96243] emb|CAH38702.1| putative ...

ORF Alignment: NC_005791 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005791 gi|45359158 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669211 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

ORF Alignment: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003282 gi|17540144 >1n0rA 2 124 89 212 5e-26 ... gb|AAA96093.1| Feminization of xx and xo animals... ... homolog a, FEMinization of XX and XO animals FEM-1 ... (fem-1) [Caenorhabditis elegans] pir||

ORF Alignment: NC_004337 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004337 gi|56480239 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From E.Coli...re ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...

ORF Alignment: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|49176300 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From E.Coli...re ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27377726 >1k4iA 2 216 3 205 5e-67 ... ref|NP_769255.1| 3,4-dihydroxy-2-butanone-4-phosha...0.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclohydrolase II [Bradyrhizobiu

ORF Alignment: NC_006322 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006322 gi|52786856 >4uagA 8 419 4 423 5e-47 ... ref|YP_092685.1| MurC [Bacillus li...cheniformis ATCC 14580] gb|AAU41992.1| MurC ... [Bacillus licheniformis DSM 13] sp|Q65G22|MURC_BACLD

ORF Sequence: NC_001135 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available h Lrs4p, located in the nucleolus; Lrs4p-Csm1p heterodimer binds to Mam1p at kinetochores during meiosis I t... NC_001135 gi|6319928 >gi|6319928|ref|NP_010009.1| Protein that forms a complex wit

33 CFR 117.822 - Beaufort Channel, NC.

Science.gov (United States)

2010-07-01

... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.822 Beaufort Channel, NC. The... bridge need not open between the hours of 6:30 a.m. to 8 a.m. and 4:30 p.m. to 6 p.m. (b) From 10 p.m. to...

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15964777 >1v4aA 24 435 49 467 e-101 ... emb|CAC45596.1| PUTATIVE GLUTAMATE-AMMONIA...-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti] ref|NP_385130.1| PUTATIVE ... GLUTAMATE-AMMO...NIA-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti 1021] sp|

Large Nc from Seiberg–Witten curve and localization

Directory of Open Access Journals (Sweden)

Jorge G. Russo

2015-09-01

Full Text Available When N=2 gauge theories are compactified on S4, the large Nc limit then selects a unique vacuum of the theory determined by saddle-point equations, which remains determined even in the flat-theory limit. We show that exactly the same equations can be reproduced purely from Seiberg–Witten theory, describing a vacuum where magnetically charged particles become massless, and corresponding to a specific degenerating limit of the Seiberg–Witten spectral curve where 2Nc−2 branch points join pairwise giving aDn=0, n=1,…,Nc−1. We consider the specific case of N=2 SU(Nc SQCD coupled with 2Nf massive fundamental flavors. We show that the theory exhibits a quantum phase transition where the critical point describes a particular Argyres–Douglas point of the Riemann surface.

ORF Alignment: NC_002696 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter crescent...us CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...

ORF Alignment: NC_003305 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003305 gi|17938192 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium

ORF Alignment: NC_003063 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003063 gi|15890482 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium

ORF Alignment: NC_005364 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... emb|CAE77440.1| phosphoglycerate mutase ... (2,3-diphosphoglycerate-independent) [Mycoplasma ... NC_005364 gi|42561347 >1o98A 2 508 4 528 e-163 ... ref|NP_975798.1| phosphoglycerate mutase (2,3-diphosphoglyc...erate-independent) ... [Mycoplasma mycoides subsp. mycoides SC str. PG1] ...

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34557359 >1mwmA 3 314 11 322 5e-28 ... ref|NP_907174.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN (FRAGMENT) [Wolinella ... succinogenes DSM 1740] emb|CAE10074.1| PUTATIVE ROD ... SHAPE-DETERMIN...ING PROTEIN (FRAGMENT) [Wolinella ... succinogenes] ... Length = 312 ...

BChPT x 1/Nc: masses and currents

Energy Technology Data Exchange (ETDEWEB)

Goity, Jose L. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States); Fernando, Ishara P. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States)

2018-04-01

A summary of the implementation of the combined BChPT X 1/Nc expansion for three flavors is presented, along with its applications to the octet and decuplet baryon masses, SU(3) charges and axial couplings.

ORF Alignment: NC_002927 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002927 gi|33603734 >1kmoA 3 661 60 754 2e-50 ... ref|NP_891294.1| exogenous ferric... siderophore receptor [Bordetella bronchiseptica ... RB50] gb|AAB51774.1| exogenous ferric siderophor...e ... receptor emb|CAE35124.1| exogenous ferric siderophore ... receptor [Bordetella bronchise

ORF Alignment: NC_000117 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000117 gi|15605324 >1jgmA 39 326 7 260 4e-33 ... ref|NP_220110.1| PHP superfamily hydrolase [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68196.1| PHP... ... trachomatis D/UW-3/CX] pir||G71494 probable php ... hydrolase - Chlamydia trachomatis (sero

ORF Alignment: NC_002929 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002929 gi|33592330 >1uynX 1 299 352 647 5e-40 ... ref|NP_879974.1| tracheal colonization... factor precursor [Bordetella pertussis Tohama ... I] emb|CAA08832.2| tracheal colonization fac...tor ... [Bordetella pertussis] emb|CAE41497.1| tracheal ... colonization factor precursor [Bor

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available pothetical stbA Plasmid stable inheritance protein ... [Photobacterium profundum] ... Length = ... NC_006370 gi|54307287 >1mwmA 2 317 24 344 3e-96 ... ref|YP_128307.1| Hypothetical stbA Plasmid stable inherita...nce protein ... [Photobacterium profundum SS9] emb|CAG18505.1| ... Hy

ORF Alignment: NC_004337 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004337 gi|24115225 >1e94E 1 443 7 449 e-162 ... pdb|1E94|F Chain F, Hslv-Hslu From E.Coli... pdb|1E94|E Chain E, Hslv-Hslu From ... E.Coli pdb|1HQY|F Chain F, Nucleotide-Dependent ...

ORF Alignment: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available outer ... membrane receptor for iron transport; outer membrane ... porin protein, putative ferris...porin protein, putative ferrisiderophore receptor ... [Escherichia coli K12] gb|AAC73892.1| putative ... NC_000913 gi|16128773 >1kmoA 12 661 63 760 6e-50 ... ref|NP_415326.1| outer membrane

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21218662 >1cxqA 5 133 141 282 2e-06 ... ref|NP_624441.1| putative noncomposite... transposon transposase [Streptomyces ... coelicolor A3(2)] emb|CAB52910.1| putative noncomposite... ... transposon transposase [Streptomyces coelicolor A3(2)] ... pir||T36996 probable noncomposite

ORF Alignment: NC_003911 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003911 gi|56698296 >1eljA 1 332 19 332 1e-06 ... gb|AAV96699.1| polyamine ABC trasnporte...snporter, periplasmic polyamine-binding protein ... [Silicibacter pomeroyi D...r, periplasmic polyamine-binding protein ... [Silicibacter pomeroyi DSS-3] ref|YP_168669.1| polyamine ... ABC tra

ORF Alignment: NC_002528 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002528 gi|15617004 >1etoB 1 98 1 98 1e-23 ... ref|NP_240217.1| factor-for-inversion... ... DNA-binding protein fis dbj|BAB13103.1| ... factor-for-inversion stimulation protein [Buchnera ... ... aphidicola str. APS (Acyrthosiphon pisum)] pir||G84976 ... factor-for-inversion

ORF Alignment: NC_003318 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003318 gi|17988713 >1gkpA 3 425 8 405 2e-19 ... ref|NP_541346.1| IMIDAZOLONEPROPIONASE / HISTIDINE AMMONIA...-LYASE [Brucella ... melitensis 16M] gb|AAL53610.1| IMIDAZOLONEPROPIONASE / ... HISTIDINE AMMON...IA-LYASE [Brucella melitensis 16M] ... pir||AG3555 histidine ammonia-lyase (

ORF Alignment: NC_004311 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004311 gi|23500656 >1gkpA 3 425 8 405 2e-19 ... ref|NP_541346.1| IMIDAZOLONEPROPIONASE / HISTIDINE AMMONIA...-LYASE [Brucella ... melitensis 16M] gb|AAL53610.1| IMIDAZOLONEPROPIONASE / ... HISTIDINE AMMON...IA-LYASE [Brucella melitensis 16M] ... pir||AG3555 histidine ammonia-lyase (

ORF Alignment: NC_006834 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006834 gi|58582167 >1iwlA 2 180 70 254 2e-49 ... ref|YP_201183.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas oryzae pv. oryzae KAC... carrier protein precursor [Xanthomonas ... oryzae pv. oryzae KACC10331] gb|AAW75798.1| ...

ORF Alignment: NC_004547 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004547 gi|50121570 >1iwlA 1 182 22 203 1e-59 ... ref|YP_050737.1| outer-membrane lipoproteins...oproteins carrier protein [Erwinia ... carotovora subsp. atroseptica SCRI104... carrier protein [Erwinia carotovora ... subsp. atroseptica SCRI1043] emb|CAG75546.1| ... outer-membrane lip

Total synthesis of haterumalides NA and NC via a chromium-mediated macrocyclization.

Science.gov (United States)

Schomaker, Jennifer M; Borhan, Babak

2008-09-17

The syntheses of haterumalides NA and NC were accomplished via the macrocyclization of a chlorovinylidene chromium carbenoid onto a pendant aldehyde to generate the C8-C9 bond with the desired stereoisomer as the major product. Utilizing the latter chemistry enables access to both C9 hydroxylated (haterumalides NC and ND) and C9 deoxygenated forms (haterumalides NA, NB, and NE; via deoxygenation of the C9-hydroxyl).

ORF Alignment: NC_003305 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003305 gi|17937619 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

ORF Alignment: NC_003063 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003063 gi|15891046 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

ORF Alignment: NC_002696 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002696 gi|16124962 >1adn0 1 76 1 75 1e-17 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletion... [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 1| ... acyl-CoA dehydrogenase, ferrulic acid biotransformation ... protein, putative [Pseudomo...ransformation protein, ... putative [Pseudomonas putida KT2440] gb|AAN68958.... NC_002947 gi|26990069 >1u8vA 9 432 4 458 7e-34 ... ref|NP_745494.1| acyl-CoA dehydrogenase, ferrulic acid biot

ORF Alignment: NC_004350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004350 gi|24379337 >1g5aA 90 627 3 535 7e-83 ... gb|AAN58598.1| dextran glucosidas...e DexB [Streptococcus mutans UA159] ... ref|NP_721292.1| dextran glucosidase DexB [Streptococcus ... ... ... (Exo-1,6-alpha-glucosidase) (Glucodextranase) ... Length = 533 ... Que

ORF Alignment: NC_003063 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003063 gi|15890948 >1kmoA 11 661 74 716 3e-76 ... ref|NP_534507.1| hydroxamate-type ferris...iderophore receptor [Agrobacterium ... tumefaciens str. C58] gb|AAL44823.1| hydroxamate-type ... ferris...iderophore receptor [Agrobacterium tumefaciens ... str. C58] pir||AI3050 hydroxamate-type ferris

ORF Alignment: NC_003305 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003305 gi|17937718 >1kmoA 11 661 74 716 3e-76 ... ref|NP_534507.1| hydroxamate-type ferris...iderophore receptor [Agrobacterium ... tumefaciens str. C58] gb|AAL44823.1| hydroxamate-type ... ferris...iderophore receptor [Agrobacterium tumefaciens ... str. C58] pir||AI3050 hydroxamate-type ferris

ORF Alignment: NC_000915 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000915 gi|15645437 >1r9lA 6 291 286 549 7e-39 ... gb|AAD07866.1| osmoprotection pr...otein (proWX) [Helicobacter pylori 26695] ... pir||B64622 osmoprotection protein - Helicobacter pylor...i ... (strain 26695) ref|NP_207611.1| osmoprotection protein ... (proWX) [Helicobacter pylori

ORF Alignment: NC_002607 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002607 gi|15790649 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp ...

ORF Alignment: NC_003551 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003551 gi|20094872 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp

ORF Alignment: NC_003037 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003037 gi|16263035 >1nyoA 11 162 8 158 4e-30 ... ref|NP_435828.1| Nex18 Symbiotica...lly induced conserved protein [Sinorhizobium ... meliloti 1021] gb|AAK65240.1| Nex18 Symbiotically ... ... ... induced conserved protein [Sinorhizobium meliloti 1021] ... pir||F95334 Nex18 Symbiotically

DincRNA: a comprehensive web-based bioinformatics toolkit for exploring disease associations and ncRNA function.

Science.gov (United States)

Cheng, Liang; Hu, Yang; Sun, Jie; Zhou, Meng; Jiang, Qinghua

2018-06-01

DincRNA aims to provide a comprehensive web-based bioinformatics toolkit to elucidate the entangled relationships among diseases and non-coding RNAs (ncRNAs) from the perspective of disease similarity. The quantitative way to illustrate relationships of pair-wise diseases always depends on their molecular mechanisms, and structures of the directed acyclic graph of Disease Ontology (DO). Corresponding methods for calculating similarity of pair-wise diseases involve Resnik's, Lin's, Wang's, PSB and SemFunSim methods. Recently, disease similarity was validated suitable for calculating functional similarities of ncRNAs and prioritizing ncRNA-disease pairs, and it has been widely applied for predicting the ncRNA function due to the limited biological knowledge from wet lab experiments of these RNAs. For this purpose, a large number of algorithms and priori knowledge need to be integrated. e.g. 'pair-wise best, pairs-average' (PBPA) and 'pair-wise all, pairs-maximum' (PAPM) methods for calculating functional similarities of ncRNAs, and random walk with restart (RWR) method for prioritizing ncRNA-disease pairs. To facilitate the exploration of disease associations and ncRNA function, DincRNA implemented all of the above eight algorithms based on DO and disease-related genes. Currently, it provides the function to query disease similarity scores, miRNA and lncRNA functional similarity scores, and the prioritization scores of lncRNA-disease and miRNA-disease pairs. http://bio-annotation.cn:18080/DincRNAClient/. biofomeng@hotmail.com or qhjiang@hit.edu.cn. Supplementary data are available at Bioinformatics online.

77 FR 46631 - Television Broadcasting Services; Greenville, NC

Science.gov (United States)

2012-08-06

...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Final... acceptance of full power television rulemaking petitions requesting channel substitutions in May 2011, it... Subjects in 47 CFR Part 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video...

77 FR 33997 - Television Broadcasting Services; Greenville, NC

Science.gov (United States)

2012-06-08

...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Proposed... freeze on the acceptance of rulemaking petitions by full power television stations requesting channel... filed by full power television stations seeking to relocate from channel 51 pursuant to a voluntary...

Observations of NC stop nets for bottlenose dolphin takes

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — To observe the NC stop net fishery to document the entanglement of bottlenose dolphins and movement of dolphins around the nets.

ORF Alignment: NC_002696 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002696 gi|16124962 >1mgtA 4 167 79 239 2e-25 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletio...n [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

ORF Alignment: NC_003098 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003098 gi|15902282 >1in4A 3 311 20 328 5e-98 ... ref|NP_357832.1| Branch migration of Holliday structures... [Streptococcus pneumoniae ... R6] gb|AAK99042.1| Branch migration of Holliday ... structures... [Streptococcus pneumoniae R6] pir||F97901 ... branch migration of Holliday structures

ORF Alignment: NC_003030 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003030 gi|15895740 >1w3oA 13 174 5 153 2e-30 ... ref|NP_349089.1| Possible 5-Nitroimidazole antibiotics... ... gb|AAK80429.1| Possible 5-Nitroimidazole antibiotics ... resistance protein, NimA-family [Clost...ridium ... acetobutylicum ATCC 824] pir||B97205 probable ... 5-Nitroimidazole antibiotics

ORF Alignment: NC_000918 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000918 gi|15606868 >1tg6E 33 200 25 196 8e-08 ... ref|NP_214248.1| nodulation competitiveness... protein NfeD [Aquifex aeolicus VF5] ... gb|AAC07639.1| nodulation competitiveness protein... NfeD ... [Aquifex aeolicus VF5] pir||H70456 nodulation ... competitiveness protein NfeD - Aqu

ORF Alignment: NC_002506 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002506 gi|15600953 >1cqxA 1 398 1 388 e-107 ... gb|AAF96096.1| ferrisiderophore re...ductase [Vibrio cholerae O1 biovar eltor str. ... N16961] ref|NP_232583.1| ferrisiderophore reductase... ... [Vibrio cholerae O1 biovar eltor str. N16961] ... pir||F82491 ferrisiderophore reductase

ORF Alignment: NC_003143 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003143 gi|16121259 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

ORF Alignment: NC_005810 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005810 gi|45443224 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

ORF Alignment: NC_004088 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004088 gi|22127219 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

ORF Alignment: NC_003071 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003071 gi|42569531 >1wd2A 1 58 290 342 7e-13 ... gb|AAD32294.1| similar to Ariadne... protein from Drosophila [Arabidopsis thaliana] ... emb|CAD52893.1| ARIADNE-like protein ARI11 [Arabi...dopsis ... thaliana] pir||A84725 similar to Ariadne protein from ... Drosophila [imported] - A

ORF Alignment: NC_000917 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000917 gi|11498586 >1b0uA 5 258 11 250 4e-55 ... ref|NP_069814.1| osmoprotection p...rotein (proV) [Archaeoglobus fulgidus DSM 4304] ... gb|AAB90260.1| osmoprotection protein (proV) ... ... ... [Archaeoglobus fulgidus DSM 4304] pir||E69372 ... osmoprotection protein (proV) homolog - Arch

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21220505 >1chkA 2 236 70 304 9e-83 ... ref|NP_626284.1| putative chitosan...ase (putative secreted protein) [Streptomyces ... coelicolor A3(2)] emb|CAB52859.1| putative chitosan...ase ... (putative secreted protein) [Streptomyces coelicolor ... A3(2)] pir||T34867 probable chitosan

ORF Alignment: NC_006834 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006834 gi|58581923 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_004757 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004757 gi|30250333 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_004572 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004572 gi|28493349 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_005966 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005966 gi|50085709 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003919 gi|21242823 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_003116 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003116 gi|15793872 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_006085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006085 gi|50842381 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_006513 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006513 gi|56478742 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_004551 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004551 gi|28572541 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_003112 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003112 gi|15676600 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_006369 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006369 gi|54293610 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_002488 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002488 gi|15837680 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_002946 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002946 gi|59800726 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34495926 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_006368 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006368 gi|54296649 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53803220 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_002942 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002942 gi|52840863 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

ORF Alignment: NC_003869 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003869 gi|20807422 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

76 FR 78331 - Environmental Impact Statement: Jackson County, NC

Science.gov (United States)

2011-12-16

... following purpose description: ``The purpose of this project is to relieve traffic congestion in the Sylva... that improves the NC 107 north/south vehicular mobility by increasing average speeds for through...

Structure and bonding of ScCN and ScNC: Ground and low-lying states

International Nuclear Information System (INIS)

Kalemos, Apostolos; Metropoulos, Aristophanes; Mavridis, Aristides

2012-01-01

Graphical abstract: The experimentally unknown systems ScCN and ScNC have been studied through single reference CISD and CCSD(T) methods. A total of 20 = 10 (ScCN) + 10 (ScNC) states were examined. All states are quite ionic whereas ScNC(X ∼3 Δ) is stabler than ScCN(X ∼3 Δ) by ∼5 kcal/mol. Display Omitted Highlights: ► We have studied through ab initio methods the polytopic system Sc[CN]. ► A series of low lying states for both isomeric forms have been examined. ► Around equilibrium the system displays a pronounced Sc + [CN] − ionic character. - Abstract: We have studied the experimentally unknown Sc[CN] molecular system in both its isomeric forms, scandium cyanide (ScCN) and isocyanide (ScNC), through ab initio computations. We report energetics, geometries, harmonic frequencies, and dipole moments for the first 20 Sc[CN] states correlating diabatically to Sc + ( 3 D, 1 D, 3 F) + CN − (X 1 Σ + ). Both isomers have a pronounced ionic character around equilibrium due to the high electron affinity of the CN group and the low ionization energy of the Sc atom. According to our calculations the ScNC isomer (X ∼3 Δ) is stabler than the ScCN(X ∼3 Δ) by ∼5 kcal/mol.

An expanding universe of the non-coding genome in cancer biology.

Science.gov (United States)

Xue, Bin; He, Lin

2014-06-01

Neoplastic transformation is caused by accumulation of genetic and epigenetic alterations that ultimately convert normal cells into tumor cells with uncontrolled proliferation and survival, unlimited replicative potential and invasive growth [Hanahan,D. et al. (2011) Hallmarks of cancer: the next generation. Cell, 144, 646-674]. Although the majority of the cancer studies have focused on the functions of protein-coding genes, emerging evidence has started to reveal the importance of the vast non-coding genome, which constitutes more than 98% of the human genome. A number of non-coding RNAs (ncRNAs) derived from the 'dark matter' of the human genome exhibit cancer-specific differential expression and/or genomic alterations, and it is increasingly clear that ncRNAs, including small ncRNAs and long ncRNAs (lncRNAs), play an important role in cancer development by regulating protein-coding gene expression through diverse mechanisms. In addition to ncRNAs, nearly half of the mammalian genomes consist of transposable elements, particularly retrotransposons. Once depicted as selfish genomic parasites that propagate at the expense of host fitness, retrotransposon elements could also confer regulatory complexity to the host genomes during development and disease. Reactivation of retrotransposons in cancer, while capable of causing insertional mutagenesis and genome rearrangements to promote oncogenesis, could also alter host gene expression networks to favor tumor development. Taken together, the functional significance of non-coding genome in tumorigenesis has been previously underestimated, and diverse transcripts derived from the non-coding genome could act as integral functional components of the oncogene and tumor suppressor network. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

ORF Alignment: NC_002696 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

ORF Alignment: NC_003304 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003304 gi|17935259 >1tjlA 17 141 10 134 5e-37 ... ref|NP_532049.1| dnaK deletion s...uppressor protein [Agrobacterium tumefaciens str. ... C58] gb|AAL42365.1| dnaK deletion suppressor pr...otein ... [Agrobacterium tumefaciens str. C58] pir||AG2743 dnaK ... deletion suppressor protei

ORF Alignment: NC_003062 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003062 gi|15888685 >1tjlA 17 141 10 134 5e-37 ... ref|NP_532049.1| dnaK deletion s...uppressor protein [Agrobacterium tumefaciens str. ... C58] gb|AAL42365.1| dnaK deletion suppressor pr...otein ... [Agrobacterium tumefaciens str. C58] pir||AG2743 dnaK ... deletion suppressor protei

ORF Alignment: NC_004431 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...

ORF Sequence: NC_001146 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during aerobic growth while its isoform Vb (Cox5Bp) is expressed during anaerobic growth; Cox5ap ... NC_001146 gi|6324276 >gi|6324276|ref|NP_014346.1| Subunit Va of cytochrome c oxidase, which is the term

ORF Sequence: NC_001141 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during anaerobic growth while its isoform Va (Cox5Ap) is expressed during aerobic growth; Cox5bp ... NC_001141 gi|6322080 >gi|6322080|ref|NP_012155.1| Subunit Vb of cytochrome c oxidase, which is the term

ORF Alignment: NC_003028 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003028 gi|15901711 >1g5aA 110 627 26 540 4e-96 ... ref|NP_346315.1| dextran glucos...idase DexS, putative [Streptococcus pneumoniae TIGR4] ... gb|AAK75955.1| dextran glucosidase DexS, pu...tative ... [Streptococcus pneumoniae TIGR4] pir||B95220 dextran ... glucosidase DexS, probable

ORF Alignment: NC_003304 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003304 gi|17934663 >1k4iA 3 216 7 208 1e-70 ... ref|NP_531453.1| 3,4-dihydroxy-2-butanone-4-phosha...9.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclo... ... 3,4-dihydroxy-2-butanone-4-phoshate synthase (AJ000053) ... [imported] - Agrobacterium tumefaci

ORF Alignment: NC_003062 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003062 gi|15888096 >1k4iA 3 216 7 208 1e-70 ... ref|NP_531453.1| 3,4-dihydroxy-2-butanone-4-phosha...9.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclo... ... 3,4-dihydroxy-2-butanone-4-phoshate synthase (AJ000053) ... [imported] - Agrobacterium tumefaci

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ASE AND NICOTINAMIDASE ... HYDROLASE (NICOTINE DEAMIDASE) [Ralstonia solanac...earum] ... ref|NP_519881.1| PROBABLE BIFUNCTIONAL PROTEIN: ... PYRAZINAMIDASE AND NICOTINAMIDAS...E HYDROLASE (NICOTINE ... DEAMIDASE) [Ralstonia solanacearum GMI1000] ... ... NC_003295 gi|17546479 >1j2rA 11 186 9 209 4e-27 ... emb|CAD15462.1| PROBABLE BIFUNCTIONAL PROTEIN: PYRAZINAMID

ORF Alignment: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002655 gi|15803232 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

ORF Alignment: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_000913 gi|49176263 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

ORF Alignment: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002695 gi|15832825 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

ORF Alignment: NC_002758 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002758 gi|15923033 >1sd4A 3 117 7 121 9e-28 ... dbj|BAB56205.1| methicillin resist...ance regulatory protein [Staphylococcus aureus ... subsp. aureus Mu50] sp|Q932L5|MECI_STAAM Methicill...in ... resistance regulatory protein mecI ref|NP_370567.1| ... methicillin resistance regulato

ORF Alignment: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358092 >6mhtA 61 323 7 298 3e-31 ... ref|NP_078366.1| cytosine-specifi...ic ... methyltransferase [Ureaplasma parvum serovar 3 str. ATCC ... 700970] pir||D82880 cytosi...ne-specific methyltransferase ... UU528 [imported] - Ureaplasma urealyticu...FGMKKGSGTRSGLLWEIERILFDLQKLNQ 60 ... Query: 127 LNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNY...KIEKYYQEAYLAQPNRTFSRIKYV 186 ... LNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYKIEKYYQEAYLAQPNRTFSRIKYV Sbjct: 121 LNYDGLIDSNGNILDLEAP

33 CFR 165.530 - Safety Zone: Cape Fear and Northeast Cape Fear Rivers, NC.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone: Cape Fear and Northeast Cape Fear Rivers, NC. 165.530 Section 165.530 Navigation and Navigable Waters COAST GUARD... § 165.530 Safety Zone: Cape Fear and Northeast Cape Fear Rivers, NC. (a) Location. The following area is...

White spot syndrome virus epizootic in cultured Pacific white shrimp Litopenaeus vannamei (Boone) in Taiwan.

Science.gov (United States)

Cheng, L; Lin, W-H; Wang, P-C; Tsai, M-A; Hsu, J-P; Chen, S-C

2013-12-01

White spot syndrome virus (WSSV) has caused significant losses in shrimp farms worldwide. Between 2004 and 2006, Pacific white shrimp Litopenaeus vannamei (Boone) were collected from 220 farms in Taiwan to determine the prevalence and impact of WSSV infection on the shrimp farm industry. Polymerase chain reaction (PCR) analysis detected WSSV in shrimp from 26% of farms. Juvenile shrimp farms had the highest infection levels (38%; 19/50 farms) and brooder shrimp farms had the lowest (5%; one of 20 farms). The average extent of infection at each farm was as follows for WSSV-positive farms: post-larvae farms, 71%; juvenile farms, 61%; subadult farms, 62%; adult farms, 49%; and brooder farms, 40%. Characteristic white spots, hypertrophied nuclei and basophilic viral inclusion bodies were found in the epithelia of gills and tail fans, appendages, cephalothorax and hepatopancreas, and virions of WSSV were observed. Of shrimp that had WSSV lesions, 100% had lesions on the cephalothorax, 96% in gills and tail fans, 91% on appendages and 17% in the hepatopancreas. WSSV was also detected in copepoda and crustaceans from the shrimp farms. Sequence comparison using the pms146 gene fragment of WSSV showed that isolates from the farms had 99.7-100% nucleotide sequence identity with four strains in the GenBank database--China (AF332093), Taiwan (AF440570 and U50923) and Thailand (AF369029). This is the first broad study of WSSV infection in L. vannamei in Taiwan. © 2013 John Wiley & Sons Ltd.

Role of the NC-loop in catalytic activity and stability in lipase from Fervidobacterium changbaicum.

Directory of Open Access Journals (Sweden)

Binchun Li

Full Text Available Flexible NC-loops between the catalytic domain and the cap domain of the α/β hydrolase fold enzymes show remarkable diversity in length, sequence, and configuration. Recent investigations have suggested that the NC-loop might be involved in catalysis and substrate recognition in many enzymes from the α/β hydrolase fold superfamily. To foster a deep understanding of its role in catalysis, stability, and divergent evolution, we here systemically investigated the function of the NC-loop (residues 131-151 in a lipase (FClip1 from thermophilic bacterium Fervidobacterium changbaicum by loop deletion, alanine-scanning mutagenesis and site-directed mutagenesis. We found that the upper part of the NC-loop (residues 131-138 was of great importance to enzyme catalysis. Single substitutions in this region could fine-tune the activity of FClip1 as much as 41-fold, and any deletions from this region rendered the enzyme completely inactive. The lower part of the NC-loop (residues 139-151 was capable of enduring extensive deletions without loss of activity. The shortened mutants in this region were found to show both improved activity and increased stability simultaneously. We therefore speculated that the NC-loop, especially the lower part, would be a perfect target for enzyme engineering to optimize the enzymatic properties, and might present a hot zone for the divergent evolution of α/β hydrolases. Our findings may provide an opportunity for better understanding of the mechanism of divergent evolution in the α/β hydrolase fold superfamily, and may also guide the design of novel biocatalysts for industrial applications.