
Sample records for university boone nc

  1. Mixed enrichment core design for the NC State University PULSTAR Reactor

    Mayo, C.W.; Verghese, K.; Huo, Y.G.


    The North Carolina State University PULSTAR Reactor license was renewed for an additional 20 years of operation on April 30, 1997. The relicensing period added additional years to the facility operating time through the end of the second license period, increasing the excess reactivity needs as projected in 1988. In 1995, the Nuclear Reactor Program developed a strategic plan that addressed the future maintenance, development, and utilization of the facility. Goals resulting from this plan included increased academic utilization of the facility in accordance with its role as a university research facility, and increased industrial service use in accordance with the mission of a land grant university. The strategic plan was accepted, and it is the intent of the College of Engineering to operate the PULSTAR Reactor as a going concern through at least the end of the current license period. In order to reach the next relicensing review without prejudice due to low excess reactivity, it is desired to maintain sufficient excess reactivity so that, if relicensed again, the facility could continue to operate without affecting users until new fuel assistance was provided. During the NC State University license renewal, the operation of the PULSTAR Reactor at the State University of New York at Buffalo (SUNY Buffalo) was terminated. At that time, the SUNY Buffalo facility had about 240 unused PULSTAR Reactor fuel pins with 6% enrichment. The objective of the work reported here was to develop a mixed enrichment core design for the NC State University PULSTAR reactor which would: (1) demonstrate that 6% enriched SUNY buffalo fuel could be used in the NC State University PULSTAR Reactor within the existing technical specification safety limits for core physics parameters; (2) show that use of this fuel could permit operating the NC State University PULSTAR Reactor to 2017 with increased utilization; and (3) assure that the decision whether or not to relicense the facility would

  2. Radiation: boon or bane?

    Goyal, P.K.


    Mankind has been exposed to radiation ever since the very first stage of its evolutionary development. Radiation is one of the greatest discoveries of mankind. Radiation has turned out to be a razor-sharp double-edged sword. In earlier days, it worried no one, because nobody knew about it. The correct application of radiation, be it in any field, have made lives better. Radiation in reality, a boon as well as a curse. Radiation is important but it is time we have to decide where to draw the line. For example, the match stick by itself is just a harmless object. One can use it to light a lamp or light a fire for cooking. In the hands of a mother lighting the lamp or the cooking fire, it becomes beneficial. The same match stick in the hands of a small careless child could prove to be fatal. The increased use of radiation has created fear in the minds of people regarding its possible adverse effects on living systems. Radiation is highly dangerous if not used with caution. This fear is heightened by nuclear fallouts, nuclear accidents and of high levels of natural background radiation in geographical areas in a number of countries. Terrorists may take advantage of technology and may produce nuclear weapons, which is a great risk for entire world. There are numerous reports about increasing health hazards like headache, sleep disorders, lack of concentration, infertility, memory loss, cardiovascular problems, cancer etc. which arises due to over exposure of radiation. Apart from human race, radiation affects other animals and overall environment. Although it has adverse effects on living beings but it cannot be denied that today radiation is a common and valuable tool in medicine, agriculture, research and industry. Radiation has contributed to significant improvements in fields of communications technology and energy. Radiation has proved to be an excellent source in terms of amount of energy production with generation of minimal waste. Even though it produces small


    Sri Krishna Prakash Sistu


    Full Text Available BACKGROUND Aprons have long been a doctor’s ornamental and symbolic professional wear when a doctor has been recognised, respected and valued as very significant person if he wore a long sleeved white coat with a stethoscope around the neck in the past. There have been many studies done about the safety of wearing aprons by the medical professionals and many countries like Great Britain have discarded and abandoned the use of long white coats as it is considered a serious threat with regards to the nosocomial infections. In India, it has still been a custom and code that a doctor and medical students wear aprons in the Hospital. Various studies have proved that aprons worn by doctors carry dangerous microbial flora. Hence, a prospective study is done to cognise the question if “Aprons are a boon or bane?.” MATERIALS AND METHODS This was a prospective study done to identify the bacteriological flora present on the aprons of 150 students in our institute NRIIMS, Visakhapatnam. The institutional approval and ethical committee clearance were taken. The swabs were taken from the pocket region of the aprons of all the students. The collected swabs were immediately sent to the microbiology department in different culture media including nutrient agar, blood agar and Robertson’s Cooked Meat broth. RESULTS Various bacteria are identified namely; 1. Gram-positive bacilli; 2. Micrococci; 3. Coagulase-negative staphylococcus; 4. Grampositive cocci; 5. Micrococci with gram-positive bacilli; 6. Micrococci with aerobic spore bearing bacilli; 7. Gram-negative coccobacilli; 8. Gram-positive bacilli with ASB. The significance of the study is that majority of the identified organisms were normal body flora. Out of 150 aprons, 38 aprons were found to be sterile and one or more of above-mentioned flora are identified in 112 aprons. 25 out of 38 aprons, which were found sterile were washed regularly at least once in 7 days. 74 (49.2% aprons are found to be

  4. Training of nuclear facility personnel: boon or boondoggle

    Remick, F.J.


    The training of nuclear facility personnel has been a requirement of the reactor licensing process for over two decades. However, the training of nuclear facility personnel remains a combination of boon and boondoggle. The opportunity to develop elite, well trained, professionally aggressive reactor operation staffs is not being realized to its full potential. Improvements in the selection of personnel, training programs, operational tools and professional pride can result in improved plant operation and contribute to improved plant capacity factors. Industry, regulatory agencies, professional societies and universities can do much to improve standards and quality of the training of nuclear facility personnel and to improve the professional level of plant operation

  5. 77 FR 66067 - Amendment of Class E Airspace; Boone, IA


    ...-1432; Airspace Docket No. 11-ACE-25] Amendment of Class E Airspace; Boone, IA AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action amends Class E airspace at Boone, IA... proposed rulemaking (NPRM) to amend Class E airspace for the Boone, IA, area, creating additional...

  6. 77 FR 50650 - Proposed Amendment of Class E Airspace; Boone, IA


    ...-1432; Airspace Docket No. 11-ACE-25] Proposed Amendment of Class E Airspace; Boone, IA AGENCY: Federal... proposes to amend Class E airspace at Boone, IA. Decommissioning of the Boone non-directional beacon (NDB... instrument approach procedures at Boone Municipal Airport, Boone, IA. Airspace reconfiguration is necessary...

  7. An ultracold neutron source at the NC State University PULSTAR reactor

    Korobkina, E.; Wehring, B. W.; Hawari, A. I.; Young, A. R.; Huffman, P. R.; Golub, R.; Xu, Y.; Palmquist, G.


    Research and development is being completed for an ultracold neutron (UCN) source to be installed at the PULSTAR reactor on the campus of North Carolina State University (NCSU). The objective is to establish a university-based UCN facility with sufficient UCN intensity to allow world-class fundamental and applied research with UCN. To maximize the UCN yield, a solid ortho-D 2 converter will be implemented coupled to two moderators, D 2O at room temperature, to thermalize reactor neutrons, and solid CH 4, to moderate the thermal neutrons to cold-neutron energies. The source assembly will be located in a tank of D 2O in the space previously occupied by the thermal column of the PULSTAR reactor. Neutrons leaving a bare face of the reactor core enter the D 2O tank through a 45×45 cm cross-sectional area void between the reactor core and the D 2O tank. Liquid He will cool the disk-shaped UCN converter to below 5 K. Independently, He gas will cool the cup-shaped CH 4 cold-neutron moderator to an optimum temperature between 20 and 40 K. The UCN will be transported from the converter to experiments by a guide with an inside diameter of 16 cm. Research areas being considered for the PULSTAR UCN source include time-reversal violation in neutron beta decay, neutron lifetime determination, support measurements for a neutron electric-dipole-moment search, and nanoscience applications.

  8. Performance analysis of the intense slow-positron beam at the NC State University PULSTAR reactor

    Moxom, J.; Hathaway, A.G.; Bodnaruk, E.W.; Hawari, A.I.; Xu, J.


    An intense positron beam, for application in nanophase characterization, is now under construction at the 1 MW PULSTAR nuclear reactor at North Carolina State University (NCSU). A tungsten converter/moderator is used, allowing positrons to be emitted from the surface with energies of a few electron volts. These slow positrons will be extracted from the moderator and formed into a beam by electrostatic lenses and then injected into a solenoidal magnetic field for transport to one of three experimental stations, via a beam switch. To optimize the performance of the beam and to predict the slow-positron intensity, a series of simulations were performed. A specialized Monte-Carlo routine was integrated into the charged-particle transport calculations to allow accounting for the probabilities of positron re-emission and backscattering from multiple-bank moderator/converter configurations. The results indicate that either a two-bank or a four-bank tungsten moderator/converter system is preferred for the final beam design. The predicted slow-positron beam intensities range from nearly 7x10 8 to 9x10 8 e + /s for the two-bank and the four-bank systems, respectively

  9. The Intense Slow Positron Beam Facility at the NC State University PULSTAR Reactor

    Hawari, Ayman I.; Moxom, Jeremy; Hathaway, Alfred G.; Brown, Benjamin; Gidley, David W.; Vallery, Richard; Xu, Jun


    An intense slow positron beam is in its early stages of operation at the 1-MW open-pool PULSTAR research reactor at North Carolina State University. The positron beam line is installed in a beam port that has a 30-cmx30-cm cross sectional view of the core. The positrons are created in a tungsten converter/moderator by pair-production using gamma rays produced in the reactor core and by neutron capture reactions in cadmium cladding surrounding the tungsten. Upon moderation, slow (∼3 eV) positrons that are emitted from the moderator are electrostatically extracted, focused and magnetically guided until they exit the reactor biological shield with 1-keV energy, approximately 3-cm beam diameter and an intensity exceeding 6x10 8 positrons per second. A magnetic beam switch and transport system has been installed and tested that directs the beam into one of two spectrometers. The spectrometers are designed to implement state-of-the-art PALS and DBS techniques to perform positron and positronium annihilation studies of nanophases in matter.

  10. Marketing Strategy Analysis of Boon Rawd Brewery Company

    Sinee Sankrusme


    Boon Rawd Brewery is a beer company based in Thailand that has an exemplary image, both as a good employer and a well-managed company with a strong record of social responsibility. The most famous of the company’s products is Singha beer. To study the company’s marketing strategy, a case study analysis was conducted together with qualitative research methods. The study analyzed the marketing strategy of Boon Rawd Brewery before the liberalization of the liquor market in 2...

  11. 77 FR 13625 - Notice of Inventory Completion: USDA Forest Service, Daniel Boone National Forest, Winchester, KY


    ... Forest Service, Daniel Boone National Forest, Winchester, KY AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The U.S. Department of Agriculture, Forest Service, Daniel Boone National Forest... culturally affiliated with the human remains may contact the Daniel Boone National Forest, Winchester, KY...

  12. Living among the affluent: boon or bane?

    Tay, Louis; Morrison, Mike; Diener, Ed


    This study examined whether national income can have effects on happiness, or subjective well-being (SWB), over and above those of personal income. To assess the incremental effects of national income on SWB, we conducted cross-sectional multilevel analysis on data from 838,151 individuals in 158 nations. Although greater personal income was consistently related to higher SWB, we found that national income was a boon to life satisfaction but a bane to daily feelings of well-being; individuals in richer nations experienced more worry and anger on average. We also found moderating effects: The income-SWB relationship was stronger at higher levels of national income. This result might be explained by cultural norms, as money is valued more in richer nations. The SWB of more residentially mobile individuals was less affected by national income. Overall, our results suggest that the wealth of the nation one resides in has consequences for one's happiness. © The Author(s) 2014.

  13. Artificial Intelligence: Threat or Boon to Radiologists?

    Recht, Michael; Bryan, R Nick


    The development and integration of machine learning/artificial intelligence into routine clinical practice will significantly alter the current practice of radiology. Changes in reimbursement and practice patterns will also continue to affect radiology. But rather than being a significant threat to radiologists, we believe these changes, particularly machine learning/artificial intelligence, will be a boon to radiologists by increasing their value, efficiency, accuracy, and personal satisfaction. Copyright © 2017 American College of Radiology. Published by Elsevier Inc. All rights reserved.

  14. The legacy of the Olympics: economic burden or boon?

    Ricketts, Lowell R.; Wolla, Scott A.


    Competition, sportsmanship, and national pride are the foundations of the Olympics, but how much do the Olympics cost the host city and country? What are some of the economic benefits and costs? Is the investment in the Olympics worth it in the end? Read about previous host experiences with the economic side of the Olympics in this month's Page One Economics Newsletter “The Legacy of the Olympics: Economic Burden or Boon?” (see related graph: "Olympics-Related Temporary Increase in Employment...

  15. Bomb or Boon: Linking Population, People and Power in Fragile Regions: Comment on "The Pill Is Mightier Than the Sword".

    Gilpin, Raymond


    The relationship between population structure and violent conflict is complex and heavily dependent on the behavior of other variables like governance, economic prospects, and urbanization. While addressing rapid population growth might be a necessary condition for peace, it is by no means sufficient. Concomitant steps must also be taken to foster inclusivity, guarantee broader rights for all, particularly women, rebuild social contracts and ensure that all citizens have equal access to economic opportunity. Measures to control family size could reduce dependency and create greater socio-economic opportunities for women and youth, By so doing, the "youth bulge" phenomenon could be a boon for rapidly growing developing countries. © 2016 by Kerman University of Medical Sciences.

  16. 75 FR 40034 - Northeastern Tributary Reservoirs Land Management Plan, Beaver Creek, Clear Creek, Boone, Fort...


    ... TENNESSEE VALLEY AUTHORITY Northeastern Tributary Reservoirs Land Management Plan, Beaver Creek...-managed public land on Beaver Creek, Clear Creek, Boone, Fort Patrick Henry, South Holston, Watauga, and... Proposed Land Use Alternative) identified in the final environmental impact statement (FEIS). Under the...

  17. Precast concrete elements for accelerated bridge construction : laboratory testing of precast substructure components, Boone County bridge.


    Vol. 1-1: In July 2006, construction began on an accelerated bridge project in Boone County, Iowa that was composed of precast substructure : elements and an innovative, precast deck panel system. The superstructure system consisted of full-depth dec...

  18. [The distribution of intestinal parasites in people admitted to the Yüzüncü Yıl University Parasitology Laboratory of Health Research and Training Hospital, in 2009].

    Yılmaz, Hasan; Taş-Cengiz, Zeynep; Ceylan, Abdulkadir; Ekici, Abdurrahman


    This study was performed to present the distribution of intestinal parasites in parients admitted to the Parasitology Laboratory of the Health Research and Training Hospital of Yüzüncü Yıl University in 2009. A total of 6267 patients (3037 female, 3230 male; 3798 of 13 years and under, 2469 of 14 years and over) were included. The stool samples were examined by native-Lugol, flotation and sedimentation methods in the Parasitology Laboratory of the hospital. Trichrome and modified acid-fast staining methods were also applied to suspicious stools. One or more than one parasite species were found in 28.5% of 6267 examined stool samples. Parasitosis was determined in 28% of female and 29% of male. Distribution of the parasites determined in the patients was as follows: 15.4% Blastocystis hominis, 6.6% Giardia intestinalis, 4.9% Entamoeba coli, 3.2% plenty B. hominis, 1.7% Chilomastix mesnili, 1.3% Hymenolepis nana, 0.7% Iodamoeba butschlii, 0.5% Ascaris lumbricoides, 0.1% Entamoeba histolytica/Entamoeba dispar, 0.1% Endolimax nana, 0.1% Enteromonas hominis, 0.1% Trichomonas hominis, 0.1% Cyclospora cayetanensis, 0.1% Enterobius vermicularis, 0.03% Entamoeba hartmanni, 0.03% Dicrocoelium dendriticum,0.03% Taenia saginata and 0.02% Trichuris trichiura. This research shows that the intestinal parasitosis problem still continues in the province.

  19. ORF Alignment: NC_006361 [GENIUS II[Archive

    Full Text Available NC_006361 gi|54024866 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

  20. ORF Alignment: NC_003450 [GENIUS II[Archive

    Full Text Available NC_003450 gi|19554128 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

  1. 76 FR 14901 - Foreign-Trade Zone 47-Boone County, KY; Application for Reorganization Under Alternative Site...


    ...'' FTZ sites for operators/users located within a grantee's ``service area'' in the context of the Board... current zone project includes the following sites: Site 1 (22 acres)--Northern Kentucky Business Center, 1670 Dolwick Drive, Erlanger, Boone County; and, Site 2 (185 acres)--Park West International Industrial...

  2. Social networking in Bangladesh: Boon or curse for academic engagement?

    Mouri Dey


    Full Text Available The number of social networking services (SNSs users in Bangladesh is increasing at an accelerating rate. There are many who argue that SNS usage is destroying the students’ future by diminishing their academic engagement. The authors aim to investigate whether there is any relationship between students’ academic performance and their SNS usage. The study chose Facebook as a representative of SNSs because this is the most popular platform for online social connectivity and conducted a survey regarding the usage of Facebook among students of Business Administration from three private Bangladeshi private universities. The research results show that Facebook can be used for at least 21 academic tasks or goals and that these can be grouped into six major factors. Moreover, students opine that their online socializing does not reduce their study time, instead it helps them get the latest study related information, sharing courses, class schedules etc. After running a regression analysis, the authors conclude that the students’ level of engagement with the academic life through Facebook does not influence their academic results. The reason for this insignificant relation between academic results and academic engagement through SNSs may be due to the non-diversified course curriculum, the traditional way of delivering lectures and evaluating, limited study materials, non-receptiveness to technology-based learning etc. However, the authors propose to include SNSs as a study tool as it is a popular media and to conduct further research to better understand the effective way of using it in the education system.

  3. Geologic map of the Hasty Quadrangle, Boone and Newton Counties, Arkansas

    Hudson, Mark R.; Murray, Kyle E.


    This digital geologic map compilation presents new polygon (for example, geologic map unit contacts), line (for example, fault, fold axis, and structure contour), and point (for example, structural attitude, contact elevations) vector data for the Hasty 7.5-minute quadrangle in northern Arkansas. The map database, which is at 1:24,000-scale resolution, provides geologic coverage of an area of current hydrogeologic, tectonic, and stratigraphic interest. The Hasty quadrangle is located in northern Newton and southern Boone Counties about 20 km south of the town of Harrison. The map area is underlain by sedimentary rocks of Ordovician, Mississippian, and Pennsylvanian age that were mildly deformed by a series of normal and strike-slip faults and folds. The area is representative of the stratigraphic and structural setting of the southern Ozark Dome. The Hasty quadrangle map provides new geologic information for better understanding groundwater flow paths in and adjacent to the Buffalo River watershed.

  4. Radioiodine: a boon and a bane emergency preparedness during accidental release of radioiodine

    Pahuja, D.N.


    Radioiodine, can be a double edged sword and can be dangerous and lethal. It will turn out to be a bane rather than a boon, exposing millions of individuals in and far away from the side of accident across geographical borders depending upon the weather conditions. Iodine is an indispensable element because of its being a constituent of the thyroid hormones, biosynthesized and released from the thyroid gland for the growth and over all metabolic functions. This gland weighing 20-30 g in a normal human adult, is comparatively very vascular organ with 5 lit. of blood flowing through it every hour. It contains 90% of the body iodine amounting to 5000-7000 μg, in the form of iodo aminoacids

  5. Negative concord and the scope of universals

    Giannakidou, A


    In this paper, I propose an analysis of Greek negative concord (NC) in terms of quantifier scope. It is shown that there is no evidence that Greek NC n-words are indefinites or negative quantifiers, NC n-words are analysed as universal quantifiers, which are sensitive to negative polarity, and which

  6. NSDNA: a manually curated database of experimentally supported ncRNAs associated with nervous system diseases.

    Wang, Jianjian; Cao, Yuze; Zhang, Huixue; Wang, Tianfeng; Tian, Qinghua; Lu, Xiaoyu; Lu, Xiaoyan; Kong, Xiaotong; Liu, Zhaojun; Wang, Ning; Zhang, Shuai; Ma, Heping; Ning, Shangwei; Wang, Lihua


    The Nervous System Disease NcRNAome Atlas (NSDNA) ( is a manually curated database that provides comprehensive experimentally supported associations about nervous system diseases (NSDs) and noncoding RNAs (ncRNAs). NSDs represent a common group of disorders, some of which are characterized by high morbidity and disabilities. The pathogenesis of NSDs at the molecular level remains poorly understood. ncRNAs are a large family of functionally important RNA molecules. Increasing evidence shows that diverse ncRNAs play a critical role in various NSDs. Mining and summarizing NSD-ncRNA association data can help researchers discover useful information. Hence, we developed an NSDNA database that documents 24 713 associations between 142 NSDs and 8593 ncRNAs in 11 species, curated from more than 1300 articles. This database provides a user-friendly interface for browsing and searching and allows for data downloading flexibility. In addition, NSDNA offers a submission page for researchers to submit novel NSD-ncRNA associations. It represents an extremely useful and valuable resource for researchers who seek to understand the functions and molecular mechanisms of ncRNA involved in NSDs. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.

  7. Geologic map of the Ponca quadrangle, Newton, Boone, and Carroll Counties, Arkansas

    Hudson, Mark R.; Murray, Kyle E.


    This digital geologic map compilation presents new polygon (i.e., geologic map unit contacts), line (i.e., fault, fold axis, and structure contour), and point (i.e., structural attitude, contact elevations) vector data for the Ponca 7 1/2' quadrangle in northern Arkansas. The map database, which is at 1:24,000-scale resolution, provides geologic coverage of an area of current hydrogeologic, tectonic, and stratigraphic interest. The Ponca quadrangle is located in Newton, Boone, and Carroll Counties about 20 km southwest of the town of Harrison. The map area is underlain by sedimentary rocks of Ordovician, Mississippian, and Pennsylvanian age that were mildly deformed by a series of normal and strike-slip faults and folds. The area is representative of the stratigraphic and structural setting of the southern Ozark Dome. The Ponca quadrangle map provides new geologic information for better understanding groundwater flow paths and development of karst features in and adjacent to the Buffalo River watershed.

  8. Mobile financial services and financial inclusion: Is it a boon for savings mobilization?

    Shem Alfred Ouma


    Full Text Available The adoption of mobile telephony to provide financial services in Africa has become instrumental in integrating the hitherto unbanked segments of the population to the mainstream financial systems. This study sought to establish this linkage by examining whether the pervasive use of mobile telephony to provide financial services is a boon for savings mobilization in selected countries in sub Saharan Africa. The findings show that availability and usage of mobile phones to provide financial services promotes the likelihood of saving at the household level. Not only does access to mobile financial services boost the likelihood to save, but also has a significant impact on the amounts saved, perhaps due to the frequency and convenience with which such transactions can be undertaken using a mobile phone. Both forms of savings, that is, basic mobile phone savings stored in the phone and bank integrated mobile savings are likely to be promoted by use of mobile phones. Thus, growing and deepening the scope for mobile phone financial services is an avenue for promoting savings mobilization, especially among the poor and low income groups with constrained access to formal financial services.

  9. White spot syndrome virus epizootic in cultured Pacific white shrimp Litopenaeus vannamei (Boone) in Taiwan.

    Cheng, L; Lin, W-H; Wang, P-C; Tsai, M-A; Hsu, J-P; Chen, S-C


    White spot syndrome virus (WSSV) has caused significant losses in shrimp farms worldwide. Between 2004 and 2006, Pacific white shrimp Litopenaeus vannamei (Boone) were collected from 220 farms in Taiwan to determine the prevalence and impact of WSSV infection on the shrimp farm industry. Polymerase chain reaction (PCR) analysis detected WSSV in shrimp from 26% of farms. Juvenile shrimp farms had the highest infection levels (38%; 19/50 farms) and brooder shrimp farms had the lowest (5%; one of 20 farms). The average extent of infection at each farm was as follows for WSSV-positive farms: post-larvae farms, 71%; juvenile farms, 61%; subadult farms, 62%; adult farms, 49%; and brooder farms, 40%. Characteristic white spots, hypertrophied nuclei and basophilic viral inclusion bodies were found in the epithelia of gills and tail fans, appendages, cephalothorax and hepatopancreas, and virions of WSSV were observed. Of shrimp that had WSSV lesions, 100% had lesions on the cephalothorax, 96% in gills and tail fans, 91% on appendages and 17% in the hepatopancreas. WSSV was also detected in copepoda and crustaceans from the shrimp farms. Sequence comparison using the pms146 gene fragment of WSSV showed that isolates from the farms had 99.7-100% nucleotide sequence identity with four strains in the GenBank database--China (AF332093), Taiwan (AF440570 and U50923) and Thailand (AF369029). This is the first broad study of WSSV infection in L. vannamei in Taiwan. © 2013 John Wiley & Sons Ltd.

  10. Amalgamation of management information system into anaesthesiology practice: A boon for the modern anaesthesiologists

    Sukhminder Jit Singh Bajwa


    Full Text Available Over the years, traditional anaesthesia record keeping system has been the backbone of anaesthesiology ever since its introduction in the 1890s by Dr. Harvey Cushing and Dr. Ernest A. Codman. Besides providing the important information regarding patients′ vital physiologic parameters, paper records had been a reliable source for various clinical research activities. The introduction of electronic monitoring gadgets and electronic record keeping systems has revolutionised the anaesthesiology practice to a large extent. Recently, the introduction of anaesthesia information management system (AIMS, which incorporates all the features of monitoring gadgets, such as electronic storage of large accurate data, quality assurance in anaesthesia, enhancing patient safety, ensuring legal protection, improved billing services and effecting an organisational change, is almost a revolution in modern-day anaesthesiology practice. The clinical research activities that are responsible for taking anaesthesiology discipline to higher peaks have also been boosted by the amalgamation of AIMS, enabling multicenter studies and sharing of clinical data. Barring few concerns in its installation, cost factors and functional aspects, the future of AIMS seems to be bright and will definitely prove to be a boon for modern-day anaesthesiology practice.

  11. 33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

  12. Board and Deans of Amsterdam University, Netherlands

    Patrice Loïez


    L. to r.: Dr Thomas Taylor, CERN IT Deputy Division Leader; Prof. Dymph C. van den Boom, Dean Faculty of Social and Behavioural Sciences, Professor in Empirical Thoretical Pedagogy; Prof. Jos Engelen, NIKHEF/University of Amsterdam, Dutch Delegate to the Scientific Policy Committee and Chairman of the LHC Committee; Prof. Jacob van der Gaag, Dean Faculty of Economic Science and Econometry, Professor in Developmenteconomy;Mr Jan van der Boon, CERN Director of Admnistration; Prof. Jan Robert Bausch, Dean Faculty of Dental Medicine, Professor in general Dentistry; Dr Sijbolt J. Noorda, President of the Board of the University of Amsterdam.

  13. Universe


    The Universe, is one book in the Britannica Illustrated Science Library Series that is correlated to the science curriculum in grades 5-8. The Britannica Illustrated Science Library is a visually compelling set that covers earth science, life science, and physical science in 16 volumes.  Created for ages 10 and up, each volume provides an overview on a subject and thoroughly explains it through detailed and powerful graphics-more than 1,000 per volume-that turn complex subjects into information that students can grasp.  Each volume contains a glossary with full definitions for vocabulary help and an index.

  14. EnviroAtlas - Durham, NC - Demo (Parent)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

  15. Ground-based hyperspectral imaging and terrestrial laser scanning for fracture characterization in the Mississippian Boone Formation

    Sun, Lei; Khan, Shuhab D.; Sarmiento, Sergio; Lakshmikantha, M. R.; Zhou, Huawei


    Petroleum geoscientists have been using cores and well logs to study source rocks and reservoirs, however, the inherent discontinuous nature of these data cannot account for horizontal heterogeneities. Modern exploitation requires better understanding of important source rocks and reservoirs at outcrop scale. Remote sensing of outcrops is becoming a first order tool for reservoir analog studies including horizontal heterogeneities. This work used ground-based hyperspectral imaging, terrestrial laser scanning (TLS), and high-resolution photography to study a roadcut of the Boone Formation at Bella Vista, northwest Arkansas, and developed an outcrop model for reservoir analog analyses. The petroliferous Boone Formation consists of fossiliferous limestones interbedded with chert of early Mississippian age. We used remote sensing techniques to identify rock types and to collect 3D geometrical data. Mixture tuned matched filtering classification of hyperspectral data show that the outcrop is mostly limestones with interbedded chert nodules. 1315 fractures were classified according to their strata-bounding relationships, among these, larger fractures are dominantly striking in ENE - WSW directions. Fracture extraction data show that chert holds more fractures than limestones, and both vertical and horizontal heterogeneities exist in chert nodule distribution. Utilizing ground-based remote sensing, we have assembled a virtual outcrop model to extract mineral composition as well as fracture data from the model. We inferred anisotropy in vertical fracture permeability based on the dominancy of fracture orientations, the preferential distribution of fractures and distribution of chert nodules. These data are beneficial in reservoir analogs to study rock mechanics and fluid flow, and to improve well performances.

  16. The Cellient System for Paraffin Histology Can Be Combined with HPV Testing and Morphotyping the Vaginal Microbiome Thanks to BoonFixing

    Mathilde E. Boon


    Full Text Available The Cellient Automated Cell Block System (Hologic can be used to process cervical scrapes to paraffin sections. For the first study on this subject, cervical scrapes were fixed in the formalin-free fixative BoonFix. This pilot study was limited to cases classified as atypical squamous lesion of unknown significance (ASCUS and high-grade squamous lesion (HSIL as diagnosed in the ThinPrep slide. The Cellient paraffin sections were classified into negative, atypical, CIN 1, CIN 2, and CIN 3. Multiple HPV genotypes were encountered in 79% of the scrapes. This study showed that the Cellient system for paraffin sections can be combined with HPV testing thanks to the formalin-free BoonFix. In two additional studies it was shown that such samples can also be used for morphotyping the vaginal microbiome and preparing cytologic ThinPrep slides.

  17. The Cellient System for Paraffin Histology Can Be Combined with HPV Testing and Morphotyping the Vaginal Microbiome Thanks to BoonFixing.

    Boon, Mathilde E


    The Cellient Automated Cell Block System (Hologic) can be used to process cervical scrapes to paraffin sections. For the first study on this subject, cervical scrapes were fixed in the formalin-free fixative BoonFix. This pilot study was limited to cases classified as atypical squamous lesion of unknown significance (ASCUS) and high-grade squamous lesion (HSIL) as diagnosed in the ThinPrep slide. The Cellient paraffin sections were classified into negative, atypical, CIN 1, CIN 2, and CIN 3. Multiple HPV genotypes were encountered in 79% of the scrapes. This study showed that the Cellient system for paraffin sections can be combined with HPV testing thanks to the formalin-free BoonFix. In two additional studies it was shown that such samples can also be used for morphotyping the vaginal microbiome and preparing cytologic ThinPrep slides.

  18. ORF Sequence: NC_002695 [GENIUS II[Archive


  19. ORF Sequence: NC_004307 [GENIUS II[Archive


  20. ORF Sequence: NC_005027 [GENIUS II[Archive


  1. ORF Sequence: NC_002942 [GENIUS II[Archive


  2. ORF Sequence: NC_005027 [GENIUS II[Archive


  3. The Built Environment and Childhood Obesity in Durham, NC

    Miranda, Marie Lynn; Edwards, Sharon E.; Anthopolos, Rebecca; Dolinsky, Diana H.; Kemper, Alex R.


    The relationship between childhood obesity and aspects of the built environment characterizing neighborhood social context is understudied. We evaluate the association between seven built environment domains and childhood obesity in Durham, NC. Measures of housing damage, property disorder, vacancy, nuisances, and territoriality were constructed using data from a 2008 community assessment. Renter-occupied housing and crime measures were developed from public databases. We linked these measures to 2008–2009 Duke University Medical Center pediatric preventive care visits. Age- and sex-specific body mass index percentiles were used to classify children as normal weight (>5th and ≤ 85th percentile), overweight (>85th and ≤ 95th percentile), or obese (> 95th percentile). Ordinal logistic regression models with cluster-corrected standard errors evaluated the association between weight status and the built environment. Adjusting for child-level socioeconomic characteristics, nuisances and crime were associated with childhood overweight/obesity (Penvironment characteristics appear important to childhood weight status in Durham, NC. PMID:22563061

  4. 78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC


    ... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

  5. 78 FR 72009 - Establishment of Class E Airspace; Star, NC


    ...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

  6. Comprehensive review on agro technologies of low-calorie natural sweetener stevia (Stevia rebaudiana Bertoni): a boon to diabetic patients.

    Sharma, Saurabh; Walia, Swati; Singh, Bikram; Kumar, Rakesh


    Stevia rebaudiana Bertoni is a low-calorie natural sweetener plant native to Paraguay. The leaves of stevia have sweetening compounds called steviol glycosides (SGs), which contain different marker compounds, i.e. stevioside (St), rebaudioside (Rb) A, B, C, D and E, dulcoside A and steviol biosides, which are nearly 300 times sweeter than sugar. Stevia is a better alternative to sugar in formulating food products, reducing the harmful effect of sugar and improving the nutrient properties. We have tried to compile a literature on various agronomic and management aspects which are helpful in increasing the yield and quality of stevia to be grown as a crop that will benefit farmers and industrialists. The stevioside thus obtained can be used to make different food products for sweetening purposes, which could be a boon to diabetic patients. Incorporation of different agronomic techniques like propagation method, transplanting time, intercropping, irrigation, mulching, plant geometry, pinching and harvesting time not only improve the biomass but also increase the quality of stevia. Therefore, agronomic considerations are of high priority to utilize its maximum potential. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

  7. Virtual NC machine model with integrated knowledge data

    Sidorenko, Sofija; Dukovski, Vladimir


    The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

  8. NC10 bacteria in marine oxygen minimum zones

    Padilla, Cory C; Bristow, Laura A; Sarode, Neha


    Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

  9. The Cellient System for Paraffin Histology Can Be Combined with HPV Testing and Morphotyping the Vaginal Microbiome Thanks to BoonFixing

    Boon, Mathilde E.


    The Cellient Automated Cell Block System (Hologic) can be used to process cervical scrapes to paraffin sections. For the first study on this subject, cervical scrapes were fixed in the formalin-free fixative BoonFix. This pilot study was limited to cases classified as atypical squamous lesion of unknown significance (ASCUS) and high-grade squamous lesion (HSIL) as diagnosed in the ThinPrep slide. The Cellient paraffin sections were classified into negative, atypical, CIN 1, CIN 2, and CIN 3. ...

  10. Non-leptonic kaon decays at large Nc

    Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando


    We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

  11. ORF Sequence: NC_003909 [GENIUS II[Archive


  12. ORF Sequence: NC_005363 [GENIUS II[Archive

    Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/ [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

  13. ORF Sequence: NC_003078 [GENIUS II[Archive

    Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

  14. ORF Sequence: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

  15. ORF Sequence: NC_005296 [GENIUS II[Archive


  16. ORF Sequence: NC_003047 [GENIUS II[Archive

    Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

  17. ORF Sequence: NC_006155 [GENIUS II[Archive

    Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

  18. ORF Sequence: NC_003279 [GENIUS II[Archive

    Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

  19. ORF Sequence: NC_005027 [GENIUS II[Archive

    Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

  20. ORF Sequence: NC_003070 [GENIUS II[Archive

    Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

  1. ORF Sequence: NC_003280 [GENIUS II[Archive

    Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

  2. ORF Sequence: NC_002162 [GENIUS II[Archive


  3. ORF Sequence: NC_002162 [GENIUS II[Archive


  4. ORF Sequence: NC_002162 [GENIUS II[Archive

    Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

  5. 76 FR 29645 - Safety Zone, Newport River; Morehead City, NC


    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

  6. 76 FR 18669 - Safety Zone, Newport River; Morehead City, NC


    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  7. 76 FR 38018 - Safety Zone, Newport River; Morehead City, NC


    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

  8. 76 FR 23227 - Safety Zone, Newport River; Morehead City, NC


    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  9. ncRNA consensus secondary structure derivation using grammar strings.

    Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh


    Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at

  10. Inherent and antigen-induced airway hyperreactivity in NC mice

    Tetsuto Kobayashi


    Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

  11. On pseudorandom generators in NC0

    Cryan, Mary; Miltersen, Peter Bro


    In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

  12. NC CATCH: Advancing Public Health Analytics.

    Studnicki, James; Fisher, John W; Eichelberger, Christopher; Bridger, Colleen; Angelon-Gaetz, Kim; Nelson, Debi


    The North Carolina Comprehensive Assessment for Tracking Community Health (NC CATCH) is a Web-based analytical system deployed to local public health units and their community partners. The system has the following characteristics: flexible, powerful online analytic processing (OLAP) interface; multiple sources of multidimensional, event-level data fully conformed to common definitions in a data warehouse structure; enabled utilization of available decision support software tools; analytic capabilities distributed and optimized locally with centralized technical infrastructure; two levels of access differentiated by the user (anonymous versus registered) and by the analytical flexibility (Community Profile versus Design Phase); and, an emphasis on user training and feedback. The ability of local public health units to engage in outcomes-based performance measurement will be influenced by continuing access to event-level data, developments in evidence-based practice for improving population health, and the application of information technology-based analytic tools and methods.

  13. Effects of stocking density of the white shrimp Litopenaeus vannamei (Boone) on immunities, antioxidant status, and resistance against Vibrio harveyi in a biofloc system.

    Liu, Gang; Zhu, Songming; Liu, Dezhao; Guo, Xishan; Ye, Zhangying


    Determining optimum stocking density of the white shrimp Litopenaeus vannamei (Boone) is a big concern for shrimp farmers. However, few studies have assessed the influence of stocking density on the antioxidant status, immunology, digestive enzyme activities, and growth performance of white shrimp in biofloc systems. In this study, these parameters of white shrimp in a biofloc system were compared at three stocking densities: 300 orgs m -3 as low stocking density (LD), 400 orgs m -3 as medium stocking density (MD), and 500 orgs m -3 as high stocking density (HD). The feed conversion ratio in the LD group was significantly lower than that in the MD and HD groups (P white shrimp can be seriously impaired in the HD condition (i.e., ≥500 m -3 ) in biofloc systems. These findings can be used to determine suitable stocking densities in the white shrimp farming industry using the biofloc system. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Nuclear localization of the mitochondrial ncRNAs in normal and cancer cells.

    Landerer, Eduardo; Villegas, Jaime; Burzio, Veronica A; Oliveira, Luciana; Villota, Claudio; Lopez, Constanza; Restovic, Franko; Martinez, Ronny; Castillo, Octavio; Burzio, Luis O


    We have previously shown a differential expression of a family of mitochondrial ncRNAs in normal and cancer cells. Normal proliferating cells and cancer cells express the sense mitochondrial ncRNA (SncmtRNA). In addition, while normal proliferating cells express two antisense mitochondrial ncRNAs (ASncmtRNAs-1 and -2), these transcripts seem to be universally down-regulated in cancer cells. In situ hybridization (ISH) of some normal and cancer tissues reveals nuclear localization of these transcripts suggesting that they are exported from mitochondria. FISH and confocal microscopy, in situ digestion with RNase previous to ISH and electron microscopy ISH was employed to confirm the extra-mitochondrial localization of the SncmtRNA and the ASncmtRNAs in normal proliferating and cancer cells of human and mouse. In normal human kidney and mouse testis the SncmtRNA and the ASncmtRNAs were found outside the organelle and especially localized in the nucleus associated to heterochromatin. In cancer cells, only the SncmtRNA was expressed and was found associated to heterochromatin and nucleoli. The ubiquitous localization of these mitochondrial transcripts in the nucleus suggests that they are new players in the mitochondrial-nuclear communication pathway or retrograde signaling. Down regulation of the ASncmtRNAs seems to be an important step on neoplastic transformation and cancer progression.

  15. Inherent and antigen-induced airway hyperreactivity in NC mice

    Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa


    In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

  16. ORF Alignment: NC_003902 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  17. ORF Alignment: NC_003919 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  18. ORF Alignment: NC_004663 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  19. ORF Alignment: NC_004578 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  20. ORF Alignment: NC_005139 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  1. ORF Alignment: NC_003919 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  2. ORF Alignment: NC_006177 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  3. ORF Alignment: NC_006349 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  4. ORF Alignment: NC_006840 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  5. ORF Alignment: NC_006370 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  6. ORF Alignment: NC_003919 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  7. ORF Alignment: NC_003869 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  8. ORF Alignment: NC_006351 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  9. ORF Alignment: NC_004459 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  10. ORF Alignment: NC_006834 [GENIUS II[Archive

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  11. ORF Sequence: NC_001139 [GENIUS II[Archive

    Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

  12. Observations of NC stop nets for bottlenose dolphin takes

    National Oceanic and Atmospheric Administration, Department of Commerce — To observe the NC stop net fishery to document the entanglement of bottlenose dolphins and movement of dolphins around the nets.

  13. ORF Alignment: NC_002947 [GENIUS II[Archive

    Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

  14. ORF Sequence: NC_003281 [GENIUS II[Archive

    Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

  15. ORF Sequence: NC_003282 [GENIUS II[Archive

    Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

  16. ORF Sequence: NC_003282 [GENIUS II[Archive

    Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

  17. ORF Sequence: NC_002945 [GENIUS II[Archive

    Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  18. ORF Sequence: NC_000962 [GENIUS II[Archive

    Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  19. ORF Sequence: NC_000913 [GENIUS II[Archive

    Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

  20. ORF Sequence: NC_000913 [GENIUS II[Archive

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  1. ORF Sequence: NC_002655 [GENIUS II[Archive

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  2. ORF Sequence: NC_006905 [GENIUS II[Archive

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

  3. ORF Alignment: NC_002977 [GENIUS II[Archive

    Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

  4. ORF Alignment: NC_006569 [GENIUS II[Archive

    Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

  5. ORF Sequence: NC_006905 [GENIUS II[Archive

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

  6. Explorations of the extended ncKP hierarchy

    Dimakis, Aristophanes; Mueller-Hoissen, Folkert


    A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

  7. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

  8. ORF Sequence: NC_004307 [GENIUS II[Archive

    Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

  9. ORF Alignment: NC_006371 [GENIUS II[Archive

    Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

  10. ORF Alignment: NC_005296 [GENIUS II[Archive

    Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

  11. ORF Alignment: NC_006155 [GENIUS II[Archive

    Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953

  12. ORF Alignment: NC_004307 [GENIUS II[Archive

    Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

  13. ORF Sequence: NC_006905 [GENIUS II[Archive

    Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler

  14. ORF Sequence: NC_000913 [GENIUS II[Archive

    Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

  15. ORF Sequence: NC_001147 [GENIUS II[Archive

    Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and are regulated by Mg(2+) concentration; overexpression confers increased toleranc

  16. ORF Sequence: NC_004605 [GENIUS II[Archive

    Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

  17. ORF Sequence: NC_006905 [GENIUS II[Archive

    Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

  18. ORF Sequence: NC_003283 [GENIUS II[Archive

    Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

  19. ORF Sequence: NC_003280 [GENIUS II[Archive

    Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

  20. 76 FR 78331 - Environmental Impact Statement: Jackson County, NC


    ... following purpose description: ``The purpose of this project is to relieve traffic congestion in the Sylva... that improves the NC 107 north/south vehicular mobility by increasing average speeds for through...

  1. ORF Sequence: NC_001137 [GENIUS II[Archive

    Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

  2. ORF Sequence: NC_001145 [GENIUS II[Archive

    Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

  3. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  4. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep

  5. ORF Alignment: NC_003306 [GENIUS II[Archive

    Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  6. ORF Alignment: NC_005363 [GENIUS II[Archive

    Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [ teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD

  7. ORF Alignment: NC_003064 [GENIUS II[Archive

    Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  8. ORF Sequence: NC_002162 [GENIUS II[Archive

    Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

  9. 77 FR 46631 - Television Broadcasting Services; Greenville, NC


    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Final... acceptance of full power television rulemaking petitions requesting channel substitutions in May 2011, it... Subjects in 47 CFR Part 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video...

  10. ORF Alignment: NC_005090 [GENIUS II[Archive

    Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

  11. ORF Sequence: NC_003047 [GENIUS II[Archive

    Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

  12. ORF Sequence: NC_001134 [GENIUS II[Archive

    Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

  13. BChPT x 1/Nc: masses and currents

    Goity, Jose L. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States); Fernando, Ishara P. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States)


    A summary of the implementation of the combined BChPT X 1/Nc expansion for three flavors is presented, along with its applications to the octet and decuplet baryon masses, SU(3) charges and axial couplings.

  14. ORF Alignment: NC_003919 [GENIUS II[Archive

    Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

  15. ORF Alignment: NC_006370 [GENIUS II[Archive

    Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

  16. ORF Sequence: NC_002655 [GENIUS II[Archive

    Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

  17. ORF Sequence: NC_000913 [GENIUS II[Archive

    Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

  18. ORF Sequence: NC_006905 [GENIUS II[Archive

    Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

  19. precision deburring using NC and robot equipment. Final report

    Gillespie, L.K.


    Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

  20. Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

    Das, Debajyoti; Kar, Debjit


    A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

  1. Improving Earth Science Metadata: Modernizing ncISO

    O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.


    ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

  2. An overview on STEP-NC compliant controller development

    Othman, M. A.; Minhat, M.; Jamaludin, Z.


    The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

  3. Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

    Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui


    TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

  4. Inflationary universe in deformed phase space scenario

    Rasouli, S. M. M.; Saba, Nasim; Farhoudi, Mehrdad; Marto, João; Moniz, P. V.


    We consider a noncommutative (NC) inflationary model with a homogeneous scalar field minimally coupled to gravity. The particular NC inflationary setting herein proposed, produces entirely new consequences as summarized in what follows. We first analyze the free field case and subsequently examine the situation where the scalar field is subjected to a polynomial and exponential potentials. We propose to use a canonical deformation between momenta, in a spatially flat Friedmann-Lemaî tre-Robertson-Walker (FLRW) universe, and while the Friedmann equation (Hamiltonian constraint) remains unaffected the Friedmann acceleration equation (and thus the Klein-Gordon equation) is modified by an extra term linear in the NC parameter. This concrete noncommutativity on the momenta allows interesting dynamics that other NC models seem not to allow. Let us be more precise. This extra term behaves as the sole explicit pressure that under the right circumstances implies a period of accelerated expansion of the universe. We find that in the absence of the scalar field potential, and in contrast with the commutative case, in which the scale factor always decelerates, we obtain an inflationary phase for small negative values of the NC parameter. Subsequently, the period of accelerated expansion is smoothly replaced by an appropriate deceleration phase providing an interesting model regarding the graceful exit problem in inflationary models. This last property is present either in the free field case or under the influence of the scalar field potentials considered here. Moreover, in the case of the free scalar field, we show that not only the horizon problem is solved but also there is some resemblance between the evolution equation of the scale factor associated to our model and that for the R2 (Starobinsky) inflationary model. Therefore, our herein NC model not only can be taken as an appropriate scenario to get a successful kinetic inflation, but also is a convenient setting to

  5. Comparative Evaluation of Ultrafiltration/Microfiltration Membranes for Removal of Nitrocellulose (NC) Fines from Wastewater

    Kim, Byung


    .... In Phase II, a pilot-scale crossflow membrane filtration system was constructed to: (1) investigate the concentration polarization and fouling mechanism caused by NC fines during crossflow filtration of NC wastewater, (2...

  6. ORF Alignment: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...

  7. ORF Alignment: NC_002570 [GENIUS II[Archive

    Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...

  8. ORF Alignment: NC_002952 [GENIUS II[Archive

    Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis

  9. ORF Alignment: NC_004461 [GENIUS II[Archive

    Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

  10. ORF Alignment: NC_003098 [GENIUS II[Archive

    Full Text Available NC_003098 gi|15902282 >1in4A 3 311 20 328 5e-98 ... ref|NP_357832.1| Branch migration of Holliday structures... [Streptococcus pneumoniae ... R6] gb|AAK99042.1| Branch migration of Holliday ... structures... [Streptococcus pneumoniae R6] pir||F97901 ... branch migration of Holliday structures

  11. ORF Alignment: NC_005363 [GENIUS II[Archive

    Full Text Available NC_005363 gi|42524871 >1tjlA 27 144 16 133 6e-10 ... ref|NP_970251.1| dnaK deletion s...uppressor protein [Bdellovibrio bacteriovorus HD100] ... emb|CAE78310.1| dnaK deletion suppressor pro

  12. ORF Alignment: NC_004463 [GENIUS II[Archive

    Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro

  13. ORF Alignment: NC_003317 [GENIUS II[Archive

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  14. ORF Alignment: NC_002696 [GENIUS II[Archive

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  15. ORF Alignment: NC_002696 [GENIUS II[Archive

    Full Text Available NC_002696 gi|16124962 >1mgtA 4 167 79 239 2e-25 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletio...n [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  16. ORF Alignment: NC_002696 [GENIUS II[Archive

    Full Text Available NC_002696 gi|16124962 >1adn0 1 76 1 75 1e-17 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletion... [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  17. ORF Alignment: NC_004431 [GENIUS II[Archive

    Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...

  18. ORF Alignment: NC_006905 [GENIUS II[Archive

    Full Text Available NC_006905 gi|62179784 >1j9iA 1 68 1 68 5e-21 ... ref|YP_216201.1| Gifsy-1 prophage DNA packaging... ... gb|AAX65120.1| Gifsy-1 prophage DNA packaging protein ... [Phage Gifsy-1] ... Length = 68 ... Q

  19. ORF Sequence: NC_001136 [GENIUS II[Archive

    Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG

  20. ORF Alignment: NC_006840 [GENIUS II[Archive

    Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  1. ORF Alignment: NC_004605 [GENIUS II[Archive

    Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  2. ORF Alignment: NC_002929 [GENIUS II[Archive

    Full Text Available NC_002929 gi|33592330 >1uynX 1 299 352 647 5e-40 ... ref|NP_879974.1| tracheal colonization... factor precursor [Bordetella pertussis Tohama ... I] emb|CAA08832.2| tracheal colonization fac...tor ... [Bordetella pertussis] emb|CAE41497.1| tracheal ... colonization factor precursor [Bor

  3. ORF Alignment: NC_003070 [GENIUS II[Archive

    Full Text Available NC_003070 gi|18397761 >1wocC 2 96 2 97 5e-15 ... ref|YP_063428.1| ssb1 [Campylobacter... ... gb|EAL55921.1| single-strand binding protein, putative ... [Campylobacter coli RM2228] gb|AAR29517.1| ssb1

  4. ORF Alignment: NC_003075 [GENIUS II[Archive

    Full Text Available NC_003075 gi|30692533 >3ullA 5 115 1 104 8e-18 ... ref|YP_063478.1| ssb1 [ jejuni] gb|AAR29567.1| ssb1 [Campylobacter ... jejuni] ... Length = 104 ... Query: 31 ... GQDSDVS

  5. ORF Alignment: NC_003282 [GENIUS II[Archive

    Full Text Available NC_003282 gi|17540144 >1n0rA 2 124 89 212 5e-26 ... gb|AAA96093.1| Feminization of xx and xo animals... ... homolog a, FEMinization of XX and XO animals FEM-1 ... (fem-1) [Caenorhabditis elegans] pir||

  6. ORF Alignment: NC_004605 [GENIUS II[Archive

    Full Text Available NC_004605 gi|28900808 >1l3wA 6 536 1265 1798 3e-11 ... ref|NP_800463.1| putative biofilm...-associated surface protein [Vibrio parahaemolyticus ... RIMD 2210633] dbj|BAC62296.1| putative biofilm

  7. ORF Sequence: NC_002655 [GENIUS II[Archive

    Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA

  8. ORF Alignment: NC_003070 [GENIUS II[Archive

    Full Text Available NC_003070 gi|15221381 >1bq00 2 77 15 90 4e-20 ... ref|NP_177004.1| gravity-responsive... protein / altered response to gravity protein ... (ARG1) [Arabidopsis thaliana] gb|AAD13758.1| Altere

  9. ORF Alignment: NC_004463 [GENIUS II[Archive

    Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  10. ORF Alignment: NC_000909 [GENIUS II[Archive

    Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  11. ORF Alignment: NC_000909 [GENIUS II[Archive

    Full Text Available NC_000909 gi|15669839 >1gxlA 2 204 475 685 1e-34 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  12. ORF Alignment: NC_003237 [GENIUS II[Archive

    Full Text Available NC_003237 gi|19075000 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  13. ORF Alignment: NC_000909 [GENIUS II[Archive

    Full Text Available NC_000909 gi|15669839 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus jannaschii ... DSM 2661] gb|AAB99663.1| chromosome segreta

  14. ORF Alignment: NC_002947 [GENIUS II[Archive

    Full Text Available 1| ... acyl-CoA dehydrogenase, ferrulic acid biotransformation ... protein, putative [Pseudomo...ransformation protein, ... putative [Pseudomonas putida KT2440] gb|AAN68958.... NC_002947 gi|26990069 >1u8vA 9 432 4 458 7e-34 ... ref|NP_745494.1| acyl-CoA dehydrogenase, ferrulic acid biot

  15. ORF Alignment: NC_002947 [GENIUS II[Archive

    Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24

  16. ORF Alignment: NC_004463 [GENIUS II[Archive

    Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

  17. ORF Alignment: NC_004463 [GENIUS II[Archive

    Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

  18. ORF Alignment: NC_002696 [GENIUS II[Archive

    Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...

  19. ORF Alignment: NC_005090 [GENIUS II[Archive

    Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most

  20. ORF Alignment: NC_006085 [GENIUS II[Archive

    Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

  1. ORF Alignment: NC_000917 [GENIUS II[Archive

    Full Text Available NC_000917 gi|11498546 >1yozA 1 116 1 116 6e-47 ... pdb|1YOZ|B Chain B, Predicted Coding... Region Af0941 From Archaeoglobus Fulgidus ... pdb|1YOZ|A Chain A, Predicted Coding Region Af0941 F

  2. ORF Alignment: NC_003283 [GENIUS II[Archive

    Full Text Available NC_003283 gi|17561408 >1bor0 2 53 282 342 3e-04 ... ref|NP_757385.1| synoviolin 1 iso...form b [Homo sapiens] gb|AAH30530.1| Synoviolin 1, ... isoform b [Homo sapiens] ... Length = 61

  3. ORF Alignment: NC_006841 [GENIUS II[Archive

    Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...

  4. ORF Alignment: NC_003228 [GENIUS II[Archive

    Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...

  5. ORF Alignment: NC_000963 [GENIUS II[Archive

    Full Text Available NC_000963 gi|15604438 >1xvqA 17 163 47 203 4e-07 ... ref|NP_220956.1| SCO2 PROTEIN PRECURSOR (sco2...) [Rickettsia prowazekii str. Madrid E] ... emb|CAA15032.1| SCO2 PROTEIN PRECURSOR (sco2...) ... [Rickettsia prowazekii] pir||F71663 sco2 protein ... precursor (sco2) RP587 - Rickettsia

  6. ORF Alignment: NC_006142 [GENIUS II[Archive

    Full Text Available NC_006142 gi|51473766 >1xvqA 17 163 40 196 7e-07 ... ref|YP_067523.1| Sco2-like [Rickettsia typhi str. Wilmington] gb|AAU04041.1| ... Sco2-like protein [Rickettsia typhi str. Wil

  7. ORF Alignment: NC_003911 [GENIUS II[Archive

    Full Text Available NC_003911 gi|56698151 >1wy2A 3 347 27 396 7e-44 ... gb|AAV96554.1| creatinase [Silici...bacter pomeroyi DSS-3] ref|YP_168523.1| ... creatinase [Silicibacter pomeroyi DSS-3] ... Length

  8. ORF Alignment: NC_003366 [GENIUS II[Archive

    Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...

  9. ORF Alignment: NC_002947 [GENIUS II[Archive

    Full Text Available NC_002947 gi|26990378 >1wy2A 3 347 23 393 2e-45 ... ref|NP_745803.1| creatinase [Pseu...domonas putida KT2440] gb|AAN69267.1| creatinase ... [Pseudomonas putida KT2440] ... Length = 3

  10. ORF Alignment: NC_003030 [GENIUS II[Archive

    Full Text Available NC_003030 gi|15895740 >1w3oA 13 174 5 153 2e-30 ... ref|NP_349089.1| Possible 5-Nitroimidazole antibiotics... ... gb|AAK80429.1| Possible 5-Nitroimidazole antibiotics ... resistance protein, NimA-family [Clost...ridium ... acetobutylicum ATCC 824] pir||B97205 probable ... 5-Nitroimidazole antibiotics

  11. ORF Alignment: NC_000964 [GENIUS II[Archive

    Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B

  12. ORF Alignment: NC_003921 [GENIUS II[Archive

    Full Text Available NC_003921 gi|21264213 >1ub4C 1 63 1 63 4e-10 ... gb|AAM39232.1| plasmid stable inheritance... protein I [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644714.1| plasmid stable ... inheritance

  13. ORF Alignment: NC_002946 [GENIUS II[Archive

    Full Text Available NC_002946 gi|59800954 >1ub4B 4 109 2 113 3e-22 ... ref|YP_207666.1| putative plasmid stable inheritance... ... gb|AAW89254.1| putative plasmid stable inheritance ... protein putative phage associated prote

  14. ORF Alignment: NC_006370 [GENIUS II[Archive

    Full Text Available pothetical stbA Plasmid stable inheritance protein ... [Photobacterium profundum] ... Length = ... NC_006370 gi|54307287 >1mwmA 2 317 24 344 3e-96 ... ref|YP_128307.1| Hypothetical stbA Plasmid stable inherita...nce protein ... [Photobacterium profundum SS9] emb|CAG18505.1| ... Hy

  15. ORF Alignment: NC_003921 [GENIUS II[Archive

    Full Text Available NC_003921 gi|21264212 >1m1fA 1 109 2 110 1e-34 ... gb|AAM39231.1| plasmid stable inheritance... protein K [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644713.1| plasmid stable ... inheritance

  16. ORF Alignment: NC_005791 [GENIUS II[Archive

    Full Text Available NC_005791 gi|45358156 >1wcv1 4 241 4 235 5e-21 ... ref|NP_987713.1| walker type ATPas...e [Methanococcus maripaludis S2] emb|CAF30149.1| ... walker type ATPase [Methanococcus maripaludis S2

  17. ORF Alignment: NC_004547 [GENIUS II[Archive

    Full Text Available NC_004547 gi|50121646 >1kmoA 14 661 37 705 8e-56 ... ref|YP_050813.1| exogenous ferri...c siderophore TonB-dependent receptor [Erwinia ... carotovora subsp. atroseptica SCRI1043] emb|CAG75622.1| ... exogenou

  18. ORF Alignment: NC_003305 [GENIUS II[Archive

    Full Text Available NC_003305 gi|17937619 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

  19. ORF Alignment: NC_003063 [GENIUS II[Archive

    Full Text Available NC_003063 gi|15891046 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

  20. ORF Alignment: NC_002927 [GENIUS II[Archive

    Full Text Available NC_002927 gi|33603734 >1kmoA 3 661 60 754 2e-50 ... ref|NP_891294.1| exogenous ferric... siderophore receptor [Bordetella bronchiseptica ... RB50] gb|AAB51774.1| exogenous ferric siderophor...e ... receptor emb|CAE35124.1| exogenous ferric siderophore ... receptor [Bordetella bronchise

  1. ORF Alignment: NC_005085 [GENIUS II[Archive

    Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...

  2. ORF Alignment: NC_005861 [GENIUS II[Archive

    Full Text Available NC_005861 gi|46446610 >1f39A 5 95 55 141 1e-16 ... ref|YP_007975.1| probable SOS mutagenesis... and repair protein UmuD [Parachlamydia sp. ... UWE25] emb|CAF23700.1| probable SOS mutagenesis

  3. ORF Alignment: NC_005070 [GENIUS II[Archive

    Full Text Available NC_005070 gi|33865578 >1f39A 4 97 54 143 4e-22 ... ref|NP_897137.1| putative SOS mutagenesis... protein UmuD [Synechococcus sp. WH 8102] ... emb|CAE07559.1| putative SOS mutagenesis protein

  4. ORF Alignment: NC_003233 [GENIUS II[Archive

    Full Text Available NC_003233 gi|19074284 >1ltlE 10 233 29 251 7e-31 ... emb|CAD25394.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM5 ... [Encephalitozoon cuniculi GB-M1] ref|NP_585790.1| DNA ... REPLICATION

  5. ORF Alignment: NC_003236 [GENIUS II[Archive

    Full Text Available NC_003236 gi|19074669 >1ewiA 5 113 54 161 1e-18 ... emb|CAD25779.1| DNA REPLICATION F...ACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PROT

  6. ORF Alignment: NC_003238 [GENIUS II[Archive

    Full Text Available NC_003238 gi|19173253 >1a5t0 17 316 29 298 4e-25 ... emb|CAD27104.1| REPLICATION FACT...OR C (ACTIVATOR 1) 37kDa SUBUNIT [Encephalitozoon ... cuniculi GB-M1] ref|NP_597056.1| REPLICATION FA

  7. ORF Alignment: NC_003238 [GENIUS II[Archive

    Full Text Available NC_003238 gi|19173256 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  8. ORF Alignment: NC_002945 [GENIUS II[Archive

    Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)

  9. ORF Alignment: NC_003238 [GENIUS II[Archive

    Full Text Available NC_003238 gi|19173256 >1ltlE 44 240 100 302 2e-23 ... emb|CAD27107.1| DNA REPLICATION... LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  10. ORF Alignment: NC_003364 [GENIUS II[Archive

    Full Text Available NC_003364 gi|18312259 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

  11. ORF Alignment: NC_003236 [GENIUS II[Archive

    Full Text Available NC_003236 gi|19074669 >1jmcA 1 238 213 445 1e-62 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

  12. ORF Alignment: NC_005787 [GENIUS II[Archive

    Full Text Available NC_005787 gi|45198873 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  13. ORF Alignment: NC_002607 [GENIUS II[Archive

    Full Text Available NC_002607 gi|15791012 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

  14. ORF Alignment: NC_003317 [GENIUS II[Archive

    Full Text Available NC_003317 gi|17987645 >1j1vA 4 94 20 109 8e-10 ... gb|AAL52543.1| CHROMOSOMAL REPLICATION... INITIATOR PROTEIN DNAA [Brucella melitensis ... 16M] ref|NP_540279.1| CHROMOSOMAL REPLICATION IN

  15. ORF Alignment: NC_003229 [GENIUS II[Archive

    Full Text Available NC_003229 gi|19074034 >1ltlE 2 242 49 290 7e-40 ... emb|CAD25144.1| DNA REPLICATION L...ICENSING FACTOR OF THE MCM FAMILY (MCM4) ... [Encephalitozoon cuniculi GB-M1] ref|NP_584640.1| DNA ... REPLICATION

  16. ORF Alignment: NC_003236 [GENIUS II[Archive

    Full Text Available NC_003236 gi|19074669 >1l1oC 2 175 456 623 1e-43 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

  17. ORF Alignment: NC_003229 [GENIUS II[Archive

    Full Text Available NC_003229 gi|19073988 >1a5t0 2 324 6 283 2e-17 ... emb|CAD25098.1| DNA REPLICATION FA...CTOR (ACTIVATOR 1) 36 kDa SUBUNIT ... [Encephalitozoon cuniculi GB-M1] ref|NP_584594.1| DNA ... REPLICATION

  18. ORF Alignment: NC_003232 [GENIUS II[Archive

    Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION

  19. Stepping Motor - Hydraulic Motor Servo Drives for an NC Milling ...

    In this paper the retrofit design of the control system of an NC milling machine with a stepping motor and stepping motor - actuated hydraulic motor servo mechanism on the machines X-axis is described. The servo designed in the course of this study was tested practically and shown to be linear - the velocity following errors ...

  20. ORF Alignment: NC_000117 [GENIUS II[Archive

    Full Text Available NC_000117 gi|15605324 >1jgmA 39 326 7 260 4e-33 ... ref|NP_220110.1| PHP superfamily hydrolase [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68196.1| PHP... ... trachomatis D/UW-3/CX] pir||G71494 probable php ... hydrolase - Chlamydia trachomatis (sero

  1. ORF Alignment: NC_003902 [GENIUS II[Archive

    Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...

  2. ORF Alignment: NC_006582 [GENIUS II[Archive

    Full Text Available NC_006582 gi|56962048 >1sd4A 2 99 6 103 1e-24 ... ref|YP_173770.1| methicillin resist...ance regulatory protein MecI [Bacillus clausii ... KSM-K16] dbj|BAD62809.1| methicillin resistance ...

  3. ORF Alignment: NC_003919 [GENIUS II[Archive

    Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...

  4. ORF Alignment: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13472874 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  5. ORF Alignment: NC_006177 [GENIUS II[Archive

    Full Text Available NC_006177 gi|51893967 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  6. ORF Alignment: NC_002967 [GENIUS II[Archive

    Full Text Available NC_002967 gi|42528039 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  7. ORF Alignment: NC_002945 [GENIUS II[Archive

    Full Text Available NC_002945 gi|31792055 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  8. ORF Alignment: NC_002945 [GENIUS II[Archive

    Full Text Available NC_002945 gi|31793631 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  9. ORF Alignment: NC_002755 [GENIUS II[Archive

    Full Text Available NC_002755 gi|15841974 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  10. ORF Alignment: NC_002755 [GENIUS II[Archive

    Full Text Available NC_002755 gi|15840280 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  11. ORF Alignment: NC_000962 [GENIUS II[Archive

    Full Text Available NC_000962 gi|15609587 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  12. ORF Alignment: NC_003155 [GENIUS II[Archive

    Full Text Available NC_003155 gi|29830077 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  13. ORF Alignment: NC_000962 [GENIUS II[Archive

    Full Text Available NC_000962 gi|15608007 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  14. ORF Alignment: NC_004331 [GENIUS II[Archive

    Full Text Available NC_004331 gi|23619306 >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putativ

  15. ORF Alignment: NC_003071 [GENIUS II[Archive

    Full Text Available NC_003071 gi|18403860 >1rl1A 4 90 215 300 7e-09 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative

  16. Large-Nc quantum chromodynamics and harmonic sums


    Jun 8, 2012 ... This has led us to consider a class of analytic number theory .... The self-energy function LR(Q2) in the chiral limit vanishes order by order in QCD ... the 1/Nc expansion, the Goldstone loop corrections are subleading and, ...

  17. ORF Alignment: NC_004310 [GENIUS II[Archive

    Full Text Available NC_004310 gi|23502014 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

  18. ORF Alignment: NC_003317 [GENIUS II[Archive

    Full Text Available NC_003317 gi|17987131 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

  19. ORF Alignment: NC_002771 [GENIUS II[Archive

    Full Text Available NC_002771 gi|15829246 >1nm8A 15 579 43 592 3e-82 ... ref|NP_326606.1| CARNITINE O-ACE...TYLTRANSFERASE [Mycoplasma pulmonis UAB CTIP] ... emb|CAC13948.1| CARNITINE O-ACETYLTRANSFERASE ...

  20. ORF Alignment: NC_002655 [GENIUS II[Archive

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002655 gi|15803232 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  1. ORF Alignment: NC_006370 [GENIUS II[Archive

    Full Text Available NC_006370 gi|54310050 >1r0wC 43 281 30 288 6e-50 ... ref|YP_131070.1| putative ABC-type oligopeptide transport...putative ... ABC-type oligopeptide transportsystem, ATPase component ... [Photobacterium profu

  2. ORF Alignment: NC_006370 [GENIUS II[Archive

    Full Text Available NC_006370 gi|54310056 >1r0wC 45 273 39 283 1e-54 ... ref|YP_131076.1| putative ABC-type metal ion transports...ative ... ABC-type metal ion transportsystem, ATPase component ... [Photobacterium profundum

  3. ORF Alignment: NC_000913 [GENIUS II[Archive

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_000913 gi|49176263 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  4. ORF Alignment: NC_002695 [GENIUS II[Archive

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002695 gi|15832825 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  5. ORF Alignment: NC_006361 [GENIUS II[Archive

    Full Text Available NC_006361 gi|54022220 >1y7yA 7 68 12 73 3e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

  6. ORF Alignment: NC_002758 [GENIUS II[Archive

    Full Text Available NC_002758 gi|15923033 >1sd4A 3 117 7 121 9e-28 ... dbj|BAB56205.1| methicillin resist...ance regulatory protein [Staphylococcus aureus ... subsp. aureus Mu50] sp|Q932L5|MECI_STAAM ... resistance regulatory protein mecI ref|NP_370567.1| ... methicillin resistance regulato

  7. ORF Alignment: NC_002506 [GENIUS II[Archive

    Full Text Available NC_002506 gi|15600953 >1cqxA 1 398 1 388 e-107 ... gb|AAF96096.1| ferrisiderophore re...ductase [Vibrio cholerae O1 biovar eltor str. ... N16961] ref|NP_232583.1| ferrisiderophore reductase... ... [Vibrio cholerae O1 biovar eltor str. N16961] ... pir||F82491 ferrisiderophore reductase

  8. ORF Alignment: NC_000913 [GENIUS II[Archive

    Full Text Available outer ... membrane receptor for iron transport; outer membrane ... porin protein, putative ferris...porin protein, putative ferrisiderophore receptor ... [Escherichia coli K12] gb|AAC73892.1| putative ... NC_000913 gi|16128773 >1kmoA 12 661 63 760 6e-50 ... ref|NP_415326.1| outer membrane

  9. ORF Alignment: NC_002928 [GENIUS II[Archive

    Full Text Available NC_002928 gi|33596933 >1kmoA 7 661 65 702 8e-60 ... ref|NP_884576.1| putative ferrisi...derophore receptor [Bordetella parapertussis 12822] ... emb|CAE37631.1| putative ferrisiderophore rec

  10. ORF Alignment: NC_002929 [GENIUS II[Archive

    Full Text Available NC_002929 gi|33592999 >1kmoA 7 661 65 702 1e-60 ... ref|NP_880643.1| putative ferrisi...derophore receptor [Bordetella pertussis Tohama I] ... emb|CAE42244.1| putative ferrisiderophore rece

  11. ORF Alignment: NC_003143 [GENIUS II[Archive

    Full Text Available NC_003143 gi|16121259 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

  12. ORF Alignment: NC_006677 [GENIUS II[Archive

    Full Text Available NC_006677 gi|58039110 >1kmoA 11 661 79 730 2e-52 ... ref|YP_191074.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60418.1| Hydroxamate-type ferrisid

  13. ORF Alignment: NC_003063 [GENIUS II[Archive

    Full Text Available NC_003063 gi|15890948 >1kmoA 11 661 74 716 3e-76 ... ref|NP_534507.1| hydroxamate-type ferris...iderophore receptor [Agrobacterium ... tumefaciens str. C58] gb|AAL44823.1| hydroxamate-type ... ferris...iderophore receptor [Agrobacterium tumefaciens ... str. C58] pir||AI3050 hydroxamate-type ferris

  14. ORF Alignment: NC_005810 [GENIUS II[Archive

    Full Text Available NC_005810 gi|45443224 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

  15. ORF Alignment: NC_002927 [GENIUS II[Archive

    Full Text Available NC_002927 gi|33600770 >1kmoA 7 661 65 702 2e-60 ... ref|NP_888330.1| putative ferrisi...derophore receptor [Bordetella bronchiseptica RB50] ... emb|CAE32282.1| putative ferrisiderophore rec

  16. ORF Alignment: NC_004088 [GENIUS II[Archive

    Full Text Available NC_004088 gi|22127219 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

  17. ORF Alignment: NC_006677 [GENIUS II[Archive

    Full Text Available NC_006677 gi|58039006 >1kmoA 12 661 92 773 1e-43 ... ref|YP_190970.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60314.1| Hydroxamate-type ferrisid

  18. ORF Alignment: NC_003305 [GENIUS II[Archive

    Full Text Available NC_003305 gi|17937718 >1kmoA 11 661 74 716 3e-76 ... ref|NP_534507.1| hydroxamate-type ferris...iderophore receptor [Agrobacterium ... tumefaciens str. C58] gb|AAL44823.1| hydroxamate-type ... ferris...iderophore receptor [Agrobacterium tumefaciens ... str. C58] pir||AI3050 hydroxamate-type ferris

  19. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available NC_003888 gi|21225320 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

  20. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available NC_003888 gi|21225300 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

  1. ORF Alignment: NC_003284 [GENIUS II[Archive

    Full Text Available NC_003284 gi|17551448 >1rw3A 32 443 156 555 3e-25 ... gb|AAF64414.1| Pol [equine foam...y virus] ref|NP_054716.1| Pol [equine foamy virus] ... Length = 400 ... Query: 980 ... KLRIVLD--ASSPPGPEPSL

  2. ORF Alignment: NC_002655 [GENIUS II[Archive

    Full Text Available NC_002655 gi|15800390 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  3. ORF Alignment: NC_004741 [GENIUS II[Archive

    Full Text Available NC_004741 gi|30062138 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  4. ORF Alignment: NC_004431 [GENIUS II[Archive

    Full Text Available NC_004431 gi|26246664 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  5. ORF Alignment: NC_002695 [GENIUS II[Archive

    Full Text Available NC_002695 gi|15829972 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  6. ORF Alignment: NC_004337 [GENIUS II[Archive

    Full Text Available NC_004337 gi|56479698 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  7. ORF Alignment: NC_004337 [GENIUS II[Archive

    Full Text Available NC_004337 gi|24115225 >1e94E 1 443 7 449 e-162 ... pdb|1E94|F Chain F, Hslv-Hslu From E.Coli... pdb|1E94|E Chain E, Hslv-Hslu From ... E.Coli pdb|1HQY|F Chain F, Nucleotide-Dependent ...

  8. ORF Alignment: NC_004337 [GENIUS II[Archive

    Full Text Available NC_004337 gi|56480239 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...

  9. ORF Alignment: NC_000913 [GENIUS II[Archive

    Full Text Available NC_000913 gi|49176300 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...

  10. ORF Alignment: NC_005085 [GENIUS II[Archive

    Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...

  11. ORF Alignment: NC_004307 [GENIUS II[Archive

    Full Text Available NC_004307 gi|23466169 >1u94A 19 326 67 387 5e-28 ... ref|NP_696772.1| alkylation repair protein [Bifidobacterium longum NCC2705] ... gb|AAN25408.1| alkylation damage repair protei

  12. ORF Alignment: NC_006087 [GENIUS II[Archive

    Full Text Available NC_006087 gi|50955643 >1u94A 24 325 68 337 3e-32 ... ref|YP_062931.1| alkylation DNA repair protein [Leifsonia xyli subsp. xyli ... str. CTCB07] gb|AAT89826.1| alkylation damage D

  13. ORF Alignment: NC_005027 [GENIUS II[Archive

    Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair

  14. ORF Alignment: NC_004350 [GENIUS II[Archive

    Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...

  15. ORF Alignment: NC_006348 [GENIUS II[Archive

    Full Text Available NC_006348 gi|53726196 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

  16. ORF Alignment: NC_000907 [GENIUS II[Archive

    Full Text Available NC_000907 gi|16272918 >1etoB 1 97 1 98 9e-28 ... ref|ZP_00320663.1| COG2901: Factor for inversion... ... ref|ZP_00156839.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator [Hae

  17. ORF Alignment: NC_002528 [GENIUS II[Archive

    Full Text Available NC_002528 gi|15617004 >1etoB 1 98 1 98 1e-23 ... ref|NP_240217.1| factor-for-inversion... ... DNA-binding protein fis dbj|BAB13103.1| ... factor-for-inversion stimulation protein [Buchnera ... ... aphidicola str. APS (Acyrthosiphon pisum)] pir||G84976 ... factor-for-inversion

  18. ORF Alignment: NC_004459 [GENIUS II[Archive

    Full Text Available NC_004459 gi|27364633 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  19. ORF Alignment: NC_004603 [GENIUS II[Archive

    Full Text Available NC_004603 gi|28899659 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  20. ORF Alignment: NC_004061 [GENIUS II[Archive

    Full Text Available NC_004061 gi|21672661 >1etoB 1 98 1 99 3e-23 ... ref|NP_660728.1| factor-for-inversion... stimulation protein [Buchnera aphidicola ... str. Sg (Schizaphis graminum)] gb|AAM67939.1| ... factor-for-inversion

  1. ORF Alignment: NC_006512 [GENIUS II[Archive

    Full Text Available NC_006512 gi|56461389 >1etoB 1 98 1 97 7e-25 ... ref|YP_156670.1| Factor for inversion... stimulation Fis, transcriptional activator ... [Idiomarina loihiensis L2TR] gb|AAV83121.1| Factor for ... inversion

  2. ORF Alignment: NC_006350 [GENIUS II[Archive

    Full Text Available NC_006350 gi|53720503 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

  3. ORF Alignment: NC_005139 [GENIUS II[Archive

    Full Text Available NC_005139 gi|37681323 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  4. ORF Alignment: NC_006370 [GENIUS II[Archive

    Full Text Available NC_006370 gi|54310477 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  5. ORF Alignment: NC_006511 [GENIUS II[Archive

    Full Text Available NC_006511 gi|56414667 >1hcrA 1 48 25 72 5e-05 ... ref|YP_151742.1| inversion of adjac... ... 9150] gb|AAV78430.1| inversion of adjacent DNA; at ... locus of e14 element [Salmonella ent

  6. ORF Alignment: NC_003280 [GENIUS II[Archive

    Full Text Available NC_003280 gi|25149956 >1qauA 5 99 56 151 2e-04 ... gb|AAN38752.1| axon identity speci...rm b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

  7. ORF Alignment: NC_003280 [GENIUS II[Archive

    Full Text Available NC_003280 gi|25149956 >1tx4A 1 170 679 853 1e-24 ... gb|AAN38752.1| axon identity spe...form b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

  8. ORF Alignment: NC_004722 [GENIUS II[Archive

    Full Text Available NC_004722 gi|30021592 >1vkpA 12 368 2 333 2e-83 ... ref|NP_833223.1| Agmatine [Bacillus cereus ATCC 14579] gb|AAP10424.1| ... Agmatine deiminase [Bacillus cereus ATCC 14579] ...

  9. ORF Alignment: NC_002607 [GENIUS II[Archive

    Full Text Available NC_002607 gi|15790649 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp ...

  10. ORF Alignment: NC_003551 [GENIUS II[Archive

    Full Text Available NC_003551 gi|20094872 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp

  11. ORF Alignment: NC_000909 [GENIUS II[Archive

    Full Text Available NC_000909 gi|15669589 >1vhtA 3 200 2 186 2e-14 ... ref|NP_248402.1| alignment in /usr/local/projects...408.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ ... [Me

  12. ORF Alignment: NC_005791 [GENIUS II[Archive

    Full Text Available NC_005791 gi|45359158 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ ...

  13. ORF Alignment: NC_000909 [GENIUS II[Archive

    Full Text Available NC_000909 gi|15669211 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ ...

  14. ORF Alignment: NC_000918 [GENIUS II[Archive

    Full Text Available NC_000918 gi|15606868 >1tg6E 33 200 25 196 8e-08 ... ref|NP_214248.1| nodulation competitiveness... protein NfeD [Aquifex aeolicus VF5] ... gb|AAC07639.1| nodulation competitiveness protein... NfeD ... [Aquifex aeolicus VF5] pir||H70456 nodulation ... competitiveness protein NfeD - Aqu

  15. ORF Alignment: NC_005296 [GENIUS II[Archive

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  16. ORF Alignment: NC_002745 [GENIUS II[Archive

    Full Text Available NC_002745 gi|15925955 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

  17. ORF Alignment: NC_006351 [GENIUS II[Archive

    Full Text Available NC_006351 gi|53722258 >1kolA 2 388 1 341 4e-33 ... ref|YP_111243.1| putative zinc-binding xylitol... ... zinc-binding xylitol/sorbitol dehydrogenase ... [Burkholderia pseudomallei K96243] ... .../sorbitol dehydrogenase [Burkholderia ... pseudomallei K96243] emb|CAH38702.1| putative ...

  18. ORF Alignment: NC_002758 [GENIUS II[Archive

    Full Text Available NC_002758 gi|15923242 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

  19. ORF Alignment: NC_002745 [GENIUS II[Archive

    Full Text Available NC_002745 gi|15925959 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

  20. ORF Alignment: NC_003155 [GENIUS II[Archive

    Full Text Available NC_003155 gi|29828632 >1w1oA 22 489 11 408 6e-19 ... dbj|BAC69801.1| putative xylitol... oxidase [Streptomyces avermitilis MA-4680] ... ref|NP_823266.1| putative xylitol oxidase [Streptomyc

  1. ORF Alignment: NC_004461 [GENIUS II[Archive

    Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc

  2. ORF Alignment: NC_002758 [GENIUS II[Archive

    Full Text Available NC_002758 gi|15923246 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

  3. ORF Alignment: NC_006677 [GENIUS II[Archive

    Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...

  4. ORF Alignment: NC_001137 [GENIUS II[Archive

    Full Text Available ograde regulon which ... consists of genes whose expression is stimulated by... NC_001137 gi|6320764 >1wvfA 13 508 29 496 1e-67 ... ref|NP_010843.1| D-lactate dehydrogenase, part of the retr

  5. ORF Sequence: NC_001136 [GENIUS II[Archive

    Full Text Available NC_001136 gi|6320230 >gi|6320230|ref|NP_010310.1| Component of the GARP (Golgi-associated retrograde... protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for retrograde transport

  6. ORF Sequence: NC_001141 [GENIUS II[Archive

    Full Text Available NC_001141 gi|6322114 >gi|6322114|ref|NP_012189.1| Part of a heptameric protein complex that regulates retro...grade Golgi-to-ER protein traffic in eukaryotic cells; coatomer forms the COP I ves

  7. ORF Alignment: NC_006274 [GENIUS II[Archive

    Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera

  8. ORF Alignment: NC_005363 [GENIUS II[Archive

    Full Text Available NC_005363 gi|42522087 >3ncmA 2 92 125 205 3e-07 ... gb|AAQ14642.1| HK97 major tail subunit [Bacteriophage Feli...x 01] ref|NP_944848.1| ... HK97 major tail subunit [Bacteriophage Felix 01

  9. ORF Alignment: NC_000917 [GENIUS II[Archive

    Full Text Available NC_000917 gi|11498586 >1b0uA 5 258 11 250 4e-55 ... ref|NP_069814.1| osmoprotection p...rotein (proV) [Archaeoglobus fulgidus DSM 4304] ... gb|AAB90260.1| osmoprotection protein (proV) ... ... ... [Archaeoglobus fulgidus DSM 4304] pir||E69372 ... osmoprotection protein (proV) homolog - Arch

  10. ORF Alignment: NC_000915 [GENIUS II[Archive

    Full Text Available NC_000915 gi|15645437 >1r9lA 6 291 286 549 7e-39 ... gb|AAD07866.1| osmoprotection pr...otein (proWX) [Helicobacter pylori 26695] ... pir||B64622 osmoprotection protein - Helicobacter pylor...i ... (strain 26695) ref|NP_207611.1| osmoprotection protein ... (proWX) [Helicobacter pylori

  11. ORF Sequence: NC_001146 [GENIUS II[Archive

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during aerobic growth while its isoform Vb (Cox5Bp) is expressed during anaerobic growth; Cox5ap ... NC_001146 gi|6324276 >gi|6324276|ref|NP_014346.1| Subunit Va of cytochrome c oxidase, which is the term

  12. ORF Sequence: NC_001141 [GENIUS II[Archive

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during anaerobic growth while its isoform Va (Cox5Ap) is expressed during aerobic growth; Cox5bp ... NC_001141 gi|6322080 >gi|6322080|ref|NP_012155.1| Subunit Vb of cytochrome c oxidase, which is the term

  13. ORF Alignment: NC_003071 [GENIUS II[Archive

    Full Text Available NC_003071 gi|42569531 >1wd2A 1 58 290 342 7e-13 ... gb|AAD32294.1| similar to Ariadne... protein from Drosophila [Arabidopsis thaliana] ... emb|CAD52893.1| ARIADNE-like protein ARI11 [Arabi...dopsis ... thaliana] pir||A84725 similar to Ariadne protein from ... Drosophila [imported] - A

  14. ORF Alignment: NC_005027 [GENIUS II[Archive

    Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len

  15. ORF Alignment: NC_000912 [GENIUS II[Archive

    Full Text Available NC_000912 gi|13507986 >1txoB 6 236 9 257 6e-28 ... gb|AAB96233.1| protein phoshatase ...iae ... M129] pir||S73911 protein phoshatase 2C homolog ptc1 - ... Mycoplasma pneumoniae (stra... ... ref|NP_109935.1| protein phoshatase 2C homolog; similar ... to Swiss-Prot Accession Number P3518

  16. ORF Alignment: NC_003304 [GENIUS II[Archive

    Full Text Available NC_003304 gi|17934663 >1k4iA 3 216 7 208 1e-70 ... ref|NP_531453.1| 3,4-dihydroxy-2-butanone-4-phosha...9.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclo... ... 3,4-dihydroxy-2-butanone-4-phoshate synthase (AJ000053) ... [imported] - Agrobacterium tumefaci

  17. ORF Alignment: NC_003062 [GENIUS II[Archive

    Full Text Available NC_003062 gi|15888096 >1k4iA 3 216 7 208 1e-70 ... ref|NP_531453.1| 3,4-dihydroxy-2-butanone-4-phosha...9.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclo... ... 3,4-dihydroxy-2-butanone-4-phoshate synthase (AJ000053) ... [imported] - Agrobacterium tumefaci

  18. ORF Alignment: NC_004463 [GENIUS II[Archive

    Full Text Available NC_004463 gi|27377726 >1k4iA 2 216 3 205 5e-67 ... ref|NP_769255.1| 3,4-dihydroxy-2-butanone-4-phosha...0.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclohydrolase II [Bradyrhizobiu

  19. ORF Alignment: NC_005126 [GENIUS II[Archive

    Full Text Available NC_005126 gi|37527217 >1b12A 1 247 78 326 7e-74 ... ref|NP_930561.1| Signal peptidase I (SPase I) (Leader...| ... Signal peptidase I (SPase I) (Leader peptidase I) ... [Photorhabdus luminescens subsp. l

  20. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available ASE AND NICOTINAMIDASE ... HYDROLASE (NICOTINE DEAMIDASE) [Ralstonia solanac...earum] ... ref|NP_519881.1| PROBABLE BIFUNCTIONAL PROTEIN: ... PYRAZINAMIDASE AND NICOTINAMIDAS...E HYDROLASE (NICOTINE ... DEAMIDASE) [Ralstonia solanacearum GMI1000] ... ... NC_003295 gi|17546479 >1j2rA 11 186 9 209 4e-27 ... emb|CAD15462.1| PROBABLE BIFUNCTIONAL PROTEIN: PYRAZINAMID

  1. ORF Alignment: NC_002695 [GENIUS II[Archive

    Full Text Available NC_002695 gi|15830716 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  2. ORF Alignment: NC_002655 [GENIUS II[Archive

    Full Text Available NC_002655 gi|15801201 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  3. ORF Alignment: NC_003197 [GENIUS II[Archive

    Full Text Available NC_003197 gi|16764541 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  4. ORF Alignment: NC_006511 [GENIUS II[Archive

    Full Text Available NC_006511 gi|56413828 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  5. ORF Alignment: NC_003198 [GENIUS II[Archive

    Full Text Available NC_003198 gi|16760062 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  6. ORF Alignment: NC_004631 [GENIUS II[Archive

    Full Text Available NC_004631 gi|29142167 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  7. ORF Alignment: NC_000913 [GENIUS II[Archive

    Full Text Available NC_000913 gi|16129047 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  8. ORF Alignment: NC_004741 [GENIUS II[Archive

    Full Text Available NC_004741 gi|30062618 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  9. ORF Alignment: NC_006905 [GENIUS II[Archive

    Full Text Available NC_006905 gi|62179702 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  10. ORF Alignment: NC_004337 [GENIUS II[Archive

    Full Text Available NC_004337 gi|56479819 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  11. ORF Alignment: NC_004431 [GENIUS II[Archive

    Full Text Available NC_004431 gi|26247224 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  12. ORF Alignment: NC_003070 [GENIUS II[Archive

    Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

  13. ORF Alignment: NC_003070 [GENIUS II[Archive

    Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

  14. ORF Alignment: NC_000854 [GENIUS II[Archive

    Full Text Available NC_000854 gi|14601919 >1n62B 44 802 1 748 0.0 ... ref|NP_148464.1| nicotine dehydroge...nase chain C [Aeropyrum pernix K1] ... dbj|BAA81228.1| 750aa long hypothetical nicotine ... de...hydrogenase chain C [Aeropyrum pernix K1] pir||D72530 ... probable nicotine dehydrogenase chain C APE

  15. ORF Alignment: NC_000854 [GENIUS II[Archive

    Full Text Available NC_000854 gi|14601920 >1n62C 1 286 1 287 2e-71 ... ref|NP_148465.1| nicotine dehydrog...enase chain A [Aeropyrum pernix K1] ... dbj|BAA81231.1| 292aa long hypothetical nicotine ... d...ehydrogenase chain A [Aeropyrum pernix K1] pir||G72530 ... probable nicotine dehydrogenase chain A AP

  16. ORF Alignment: NC_003106 [GENIUS II[Archive

    Full Text Available NC_003106 gi|15922820 >1n62B 24 793 4 684 e-115 ... ref|NP_378489.1| hypothetical nicotine... dehydrogenase subunit C [Sulfolobus tokodaii ... str. 7] dbj|BAB67598.1| 685aa long hypothetical nicotine

  17. ORF Alignment: NC_006509 [GENIUS II[Archive

    Full Text Available NC_006509 gi|56410456 >1n62C 1 286 1 287 4e-70 ... ref|YP_145830.1| nicotine dehydrog...enase chain A [Geobacillus kaustophilus HTA426] ... dbj|BAD74262.1| nicotine dehydrogenase chain A ...

  18. ORF Alignment: NC_000117 [GENIUS II[Archive

    Full Text Available NC_000117 gi|15605507 >2bjiA 3 266 5 313 9e-29 ... ref|NP_220293.1| Sulfite Synthesis.../biphosphate phosphatase [Chlamydia trachomatis ... D/UW-3/CX] gb|AAC68369.1| Sulfite Synthesis/bipho

  19. ORF Alignment: NC_000117 [GENIUS II[Archive

    Full Text Available NC_000117 gi|15605545 >1u7nA 1 327 4 316 2e-67 ... ref|NP_220331.1| FA/Phospholipid Synthesis... Protein [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68407.1| FA/Phospholipid Synthesis Prote

  20. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

  1. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

  2. ORF Alignment: NC_005090 [GENIUS II[Archive

    Full Text Available NC_005090 gi|34556965 >1mzbA 1 134 1 130 7e-21 ... ref|NP_906780.1| PEROXIDE STRESS R...EGULATOR [Wolinella succinogenes DSM 1740] ... emb|CAE09680.1| PEROXIDE STRESS REGULATOR [Wolinella ...

  3. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON

  4. ORF Alignment: NC_003075 [GENIUS II[Archive


  5. ORF Alignment: NC_002737 [GENIUS II[Archive

    Full Text Available NC_002737 gi|15675767 >1g5aA 89 627 2 535 3e-86 ... gb|AAK34662.1| dextran glucosidas...e [Streptococcus pyogenes M1 GAS] ... ref|NP_269941.1| dextran glucosidase [Streptococcus ...

  6. ORF Alignment: NC_003485 [GENIUS II[Archive

    Full Text Available NC_003485 gi|19746879 >1g5aA 89 627 2 535 1e-86 ... gb|AAL98514.1| putative dextran g...lucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608015.1| putative dextran glucosidase ...

  7. ORF Alignment: NC_003485 [GENIUS II[Archive

    Full Text Available NC_003485 gi|19746967 >1g5aA 98 625 11 538 6e-94 ... gb|AAL98602.1| putative dextran ...glucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608103.1| putative dextran glucosidase ...

  8. ORF Alignment: NC_002737 [GENIUS II[Archive

    Full Text Available NC_002737 gi|15675852 >1g5aA 98 625 11 538 9e-95 ... gb|AAK34747.1| putative dextran ...glucosidase [Streptococcus pyogenes M1 GAS] ... ref|NP_270026.1| putative dextran glucosidase ...

  9. ORF Alignment: NC_004350 [GENIUS II[Archive

    Full Text Available NC_004350 gi|24379337 >1g5aA 90 627 3 535 7e-83 ... gb|AAN58598.1| dextran glucosidas...e DexB [Streptococcus mutans UA159] ... ref|NP_721292.1| dextran glucosidase DexB [Streptococcus ... ... ... (Exo-1,6-alpha-glucosidase) (Glucodextranase) ... Length = 533 ... Que

  10. ORF Alignment: NC_004310 [GENIUS II[Archive

    Full Text Available NC_004310 gi|23502301 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...

  11. ORF Alignment: NC_002942 [GENIUS II[Archive

    Full Text Available NC_002942 gi|52842820 >1p3dA 3 461 10 467 e-125 ... ref|YP_096619.1| UDP-N-acetylmuramate:L-alanine ligase Mur...28672.1| ... UDP-N-acetylmuramate:L-alanine ligase MurC [Legionella ... pneumophila subsp. pne

  12. ORF Alignment: NC_006300 [GENIUS II[Archive

    Full Text Available NC_006300 gi|52425721 >1p3dA 1 463 15 477 e-153 ... ref|YP_088858.1| MurC protein [Ma...nnheimia succiniciproducens MBEL55E] gb|AAU38273.1| ... MurC protein [Mannheimia succiniciproducens M

  13. ORF Alignment: NC_002944 [GENIUS II[Archive

    Full Text Available NC_002944 gi|41407994 >4uagA 7 413 12 470 1e-38 ... ref|NP_960830.1| MurC [Mycobacter... ... ligase (UDP-N-acetylmuramoyl-L-alanine synthetase) ... gb|AAS04213.1| MurC [Mycobacterium

  14. ORF Alignment: NC_006300 [GENIUS II[Archive

    Full Text Available NC_006300 gi|52425669 >4uagA 6 428 2 453 3e-46 ... ref|YP_088806.1| MurC protein [Man...nheimia succiniciproducens MBEL55E] gb|AAU38221.1| ... MurC protein [Mannheimia succiniciproducens MB

  15. ORF Alignment: NC_002663 [GENIUS II[Archive

    Full Text Available NC_002663 gi|15602008 >1p3dA 1 463 17 479 e-156 ... ref|NP_245080.1| MurC [Pasteurell...a multocida subsp. multocida str. Pm70] ... gb|AAK02227.1| MurC [Pasteurella multocida subsp. ...

  16. ORF Alignment: NC_003317 [GENIUS II[Archive

    Full Text Available NC_003317 gi|17986863 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...

  17. ORF Alignment: NC_006322 [GENIUS II[Archive

    Full Text Available NC_006322 gi|52786856 >4uagA 8 419 4 423 5e-47 ... ref|YP_092685.1| MurC [Bacillus li...cheniformis ATCC 14580] gb|AAU41992.1| MurC ... [Bacillus licheniformis DSM 13] sp|Q65G22|MURC_BACLD

  18. ORF Alignment: NC_003911 [GENIUS II[Archive

    Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan

  19. ORF Alignment: NC_006348 [GENIUS II[Archive

    Full Text Available NC_006348 gi|53725407 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

  20. ORF Alignment: NC_002952 [GENIUS II[Archive

    Full Text Available NC_002952 gi|49483165 >1dlwA 19 115 21 120 3e-19 ... ref|YP_040389.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG39975.1| ... protozoa

  1. ORF Alignment: NC_002976 [GENIUS II[Archive

    Full Text Available NC_002976 gi|57866545 >1dlwA 19 115 47 146 6e-19 ... ref|YP_188173.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... epidermidis RP62A] gb|AAW53991.1| ... protozoa

  2. ORF Alignment: NC_002977 [GENIUS II[Archive

    Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa

  3. ORF Alignment: NC_002951 [GENIUS II[Archive

    Full Text Available NC_002951 gi|57650195 >1dlwA 19 115 21 120 3e-19 ... ref|YP_185875.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus COL] gb|AAW36475.1| ... protozoa

  4. ORF Alignment: NC_004578 [GENIUS II[Archive

    Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa

  5. ORF Alignment: NC_006350 [GENIUS II[Archive

    Full Text Available NC_006350 gi|53718816 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

  6. ORF Alignment: NC_003155 [GENIUS II[Archive

    Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...

  7. ORF Alignment: NC_003155 [GENIUS II[Archive

    Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...

  8. ORF Alignment: NC_005085 [GENIUS II[Archive

    Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

  9. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

  10. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available NC_003888 gi|21220505 >1chkA 2 236 70 304 9e-83 ... ref|NP_626284.1| putative chitosan...ase (putative secreted protein) [Streptomyces ... coelicolor A3(2)] emb|CAB52859.1| putative chitosan...ase ... (putative secreted protein) [Streptomyces coelicolor ... A3(2)] pir||T34867 probable chitosan

  11. ORF Alignment: NC_006274 [GENIUS II[Archive

    Full Text Available NC_006274 gi|52142820 >1kwfA 3 362 53 435 5e-85 ... ref|YP_084010.1| chitosanase; gly...cosyl hydrolases family 8; endoglucanase [Bacillus ... cereus ZK] gb|AAU17839.1| chitosanase; glycosy

  12. ORF Alignment: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13475854 >1el5A 4 378 18 430 4e-33 ... ref|NP_107424.1| agaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53210.1| Aga

  13. ORF Alignment: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13475930 >1el5A 6 379 7 420 7e-42 ... ref|NP_107500.1| AgaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53286.1| AgaE

  14. ORF Alignment: NC_002679 [GENIUS II[Archive

    Full Text Available NC_002679 gi|13488188 >1el5A 4 377 26 437 3e-36 ... ref|NP_085608.1| agaE(conversion of agropini...c acid to mannopinic acid) ... [Mesorhizobium loti MAFF303099] dbj|BAB54449.1| AgaE ...

  15. ORF Alignment: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13473528 >1u07A 4 89 172 254 2e-09 ... ref|NP_105096.1| energy transduce...r TonB [Mesorhizobium loti MAFF303099] ... dbj|BAB50882.1| energy transducer; TonB [Mesorhizobium ...

  16. ORF Alignment: NC_005296 [GENIUS II[Archive

    Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  17. ORF Alignment: NC_006905 [GENIUS II[Archive

    Full Text Available NC_006905 gi|62180303 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  18. ORF Alignment: NC_005810 [GENIUS II[Archive

    Full Text Available NC_005810 gi|45441793 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  19. ORF Alignment: NC_002939 [GENIUS II[Archive

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  20. ORF Alignment: NC_006511 [GENIUS II[Archive

    Full Text Available NC_006511 gi|56413338 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  1. ORF Alignment: NC_004088 [GENIUS II[Archive

    Full Text Available NC_004088 gi|22125929 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  2. ORF Alignment: NC_006576 [GENIUS II[Archive

    Full Text Available NC_006576 gi|56751418 >1kgsA 3 222 4 231 2e-39 ... ref|YP_172119.1| two-component response regulator for energ... ... PCC 6301] dbj|BAD79599.1| two-component response ... regulator for energy transfer from ph

  3. ORF Alignment: NC_002939 [GENIUS II[Archive

    Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  4. ORF Alignment: NC_003143 [GENIUS II[Archive

    Full Text Available NC_003143 gi|16122423 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  5. ORF Alignment: NC_002678 [GENIUS II[Archive

    Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

  6. ORF Alignment: NC_004463 [GENIUS II[Archive

    Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  7. ORF Alignment: NC_002940 [GENIUS II[Archive

    Full Text Available NC_002940 gi|33151562 >1u07A 8 84 201 279 1e-08 ... gb|AAP95304.1| TobB energy transd...ucing protein [Haemophilus ducreyi 35000HP] ... ref|NP_872915.1| TobB energy transducing protein ...

  8. ORF Alignment: NC_003197 [GENIUS II[Archive

    Full Text Available NC_003197 gi|16765081 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  9. ORF Alignment: NC_003911 [GENIUS II[Archive

    Full Text Available NC_003911 gi|56698296 >1eljA 1 332 19 332 1e-06 ... gb|AAV96699.1| polyamine ABC trasnporte...snporter, periplasmic polyamine-binding protein ... [Silicibacter pomeroyi D...r, periplasmic polyamine-binding protein ... [Silicibacter pomeroyi DSS-3] ref|YP_168669.1| polyamine ... ABC tra

  10. ORF Alignment: NC_006834 [GENIUS II[Archive

    Full Text Available NC_006834 gi|58581923 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  11. ORF Alignment: NC_004757 [GENIUS II[Archive

    Full Text Available NC_004757 gi|30250333 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  12. ORF Alignment: NC_004572 [GENIUS II[Archive

    Full Text Available NC_004572 gi|28493349 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  13. ORF Alignment: NC_005966 [GENIUS II[Archive

    Full Text Available NC_005966 gi|50085709 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  14. ORF Alignment: NC_003919 [GENIUS II[Archive

    Full Text Available NC_003919 gi|21242823 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  15. ORF Alignment: NC_003116 [GENIUS II[Archive

    Full Text Available NC_003116 gi|15793872 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  16. ORF Alignment: NC_006085 [GENIUS II[Archive

    Full Text Available NC_006085 gi|50842381 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  17. ORF Alignment: NC_006513 [GENIUS II[Archive

    Full Text Available NC_006513 gi|56478742 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  18. ORF Alignment: NC_004551 [GENIUS II[Archive

    Full Text Available NC_004551 gi|28572541 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  19. ORF Alignment: NC_003112 [GENIUS II[Archive

    Full Text Available NC_003112 gi|15676600 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  20. ORF Alignment: NC_006369 [GENIUS II[Archive

    Full Text Available NC_006369 gi|54293610 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  1. ORF Alignment: NC_002488 [GENIUS II[Archive

    Full Text Available NC_002488 gi|15837680 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  2. ORF Alignment: NC_002946 [GENIUS II[Archive

    Full Text Available NC_002946 gi|59800726 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  3. ORF Alignment: NC_005085 [GENIUS II[Archive

    Full Text Available NC_005085 gi|34495926 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  4. ORF Alignment: NC_006368 [GENIUS II[Archive

    Full Text Available NC_006368 gi|54296649 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  5. ORF Alignment: NC_002977 [GENIUS II[Archive

    Full Text Available NC_002977 gi|53803220 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  6. ORF Alignment: NC_002942 [GENIUS II[Archive

    Full Text Available NC_002942 gi|52840863 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  7. ORF Alignment: NC_003869 [GENIUS II[Archive

    Full Text Available NC_003869 gi|20807422 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  8. ORF Alignment: NC_006513 [GENIUS II[Archive

    Full Text Available NC_006513 gi|56476897 >1r0wC 2 267 324 600 2e-59 ... ref|YP_158486.1| putative composite... ATP-binding transmembrane ABC transporter ... protein [Azoarcus sp. EbN1] emb|CAI07585.1| putative ... composite

  9. ORF Alignment: NC_003888 [GENIUS II[Archive

    Full Text Available NC_003888 gi|21218662 >1cxqA 5 133 141 282 2e-06 ... ref|NP_624441.1| putative noncomposite... transposon transposase [Streptomyces ... coelicolor A3(2)] emb|CAB52910.1| putative noncomposite... ... transposon transposase [Streptomyces coelicolor A3(2)] ... pir||T36996 probable noncomposite

  10. ORF Sequence: NC_001135 [GENIUS II[Archive

    Full Text Available h Lrs4p, located in the nucleolus; Lrs4p-Csm1p heterodimer binds to Mam1p at kinetochores during meiosis I t... NC_001135 gi|6319928 >gi|6319928|ref|NP_010009.1| Protein that forms a complex wit

  11. ORF Alignment: NC_006905 [GENIUS II[Archive

    Full Text Available NC_006905 gi|62179485 >1iwlA 1 182 23 204 2e-69 ... ref|YP_215902.1| periplasmic protein effects...ica ... subsp. enterica serovar Choleraesuis str. SC-B67] ... gb|AAX64821.1| periplasmic protein effects

  12. ORF Alignment: NC_006395 [GENIUS II[Archive

    Full Text Available NC_006395 gi|55376664 >1v7zA 1 249 5 243 8e-44 ... ref|YP_134515.1| creatinine amidoh...ydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV44809.1| creatinine amidohydrolase [Haloarcula

  13. ORF Alignment: NC_002927 [GENIUS II[Archive

    Full Text Available NC_002927 gi|33600518 >1v7zA 3 253 1 251 1e-39 ... ref|NP_888078.1| putative amidohydrolase [Bordetella bronchiseptica RB50] ... emb|CAE32030.1| putative creatinine amidohydro

  14. ORF Alignment: NC_003305 [GENIUS II[Archive

    Full Text Available NC_003305 gi|17938192 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium

  15. ORF Alignment: NC_000853 [GENIUS II[Archive

    Full Text Available NC_000853 gi|15643179 >1v7zA 3 256 7 270 9e-43 ... ref|NP_228223.1| creatinine amidoh...ydrolase, putative [Thermotoga maritima MSB8] ... gb|AAD35498.1| creatinine amidohydrolase, putative

  16. ORF Alignment: NC_002939 [GENIUS II[Archive

    Full Text Available NC_002939 gi|39996821 >1v7zA 3 252 1 232 3e-42 ... ref|NP_952772.1| creatinine amidoh...ydrolase [Geobacter sulfurreducens PCA] ... gb|AAR35099.1| creatinine amidohydrolase [Geobacter ...

  17. ORF Alignment: NC_005296 [GENIUS II[Archive

    Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...

  18. ORF Alignment: NC_003063 [GENIUS II[Archive

    Full Text Available NC_003063 gi|15890482 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium

  19. ORF Alignment: NC_002928 [GENIUS II[Archive

    Full Text Available NC_002928 gi|33596750 >1v7zA 3 253 1 251 8e-40 ... ref|NP_884393.1| putative amidohydrolase [Bordetella parapertussis 12822] ... emb|CAE37436.1| putative creatinine amidohydro

  20. ORF Alignment: NC_004307 [GENIUS II[Archive

    Full Text Available NC_004307 gi|23464642 >1v7zA 5 255 7 250 1e-55 ... ref|NP_695245.1| creatinine amidohydrolase; creatin...inase [Bifidobacterium longum ... NCC2705] gb|AAN23881.1| creatinine amidohydrolase; ... creatin

  1. ORF Alignment: NC_006576 [GENIUS II[Archive

    Full Text Available NC_006576 gi|56750058 >1v7zA 4 251 11 256 7e-49 ... ref|YP_170759.1| creatinine amido...hydrolase [Synechococcus elongatus PCC 6301] ... dbj|BAD78239.1| creatinine amidohydrolase [Synechoco

  2. ORF Alignment: NC_003318 [GENIUS II[Archive

    Full Text Available NC_003318 gi|17988654 >1v7zA 9 254 21 263 2e-44 ... ref|NP_541287.1| creatininase [Br...ucella melitensis 16M] gb|AAL53551.1| creatininase ... [Brucella melitensis 16M] pir||AD3548 creatini

  3. ORF Alignment: NC_006395 [GENIUS II[Archive

    Full Text Available NC_006395 gi|55376890 >1v7zA 5 250 13 257 5e-37 ... ref|YP_134741.1| creatinine amido...hydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV45035.1| creatinine amidohydrolase [Haloarcul

  4. ORF Alignment: NC_004311 [GENIUS II[Archive

    Full Text Available NC_004311 gi|23500710 >1v7zA 10 254 1 242 2e-43 ... gb|AAN34155.1| creatinine amidohy...drolase, putative [Brucella suis 1330] ... ref|NP_700150.1| creatinine amidohydrolase, putative ...

  5. ORF Alignment: NC_004557 [GENIUS II[Archive

    Full Text Available NC_004557 gi|28211518 >1v7zA 1 255 3 250 2e-62 ... ref|NP_782462.1| creatininase [Clo...stridium tetani E88] gb|AAO36399.1| creatininase ... [Clostridium tetani E88] ... Length = 248

  6. 33 CFR 117.822 - Beaufort Channel, NC.


    ... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.822 Beaufort Channel, NC. The... bridge need not open between the hours of 6:30 a.m. to 8 a.m. and 4:30 p.m. to 6 p.m. (b) From 10 p.m. to...

  7. ORF Alignment: NC_005364 [GENIUS II[Archive

    Full Text Available ... emb|CAE77440.1| phosphoglycerate mutase ... (2,3-diphosphoglycerate-independent) [Mycoplasma ... NC_005364 gi|42561347 >1o98A 2 508 4 528 e-163 ... ref|NP_975798.1| phosphoglycerate mutase (2,3-diphosphoglyc...erate-independent) ... [Mycoplasma mycoides subsp. mycoides SC str. PG1] ...

  8. ORF Sequence: NC_001146 [GENIUS II[Archive

    Full Text Available NC_001146 gi|6324141 >gi|6324141|ref|NP_014211.1| Essential protein involved in karyoga...he spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p; Kar1p [Saccharomyc

  9. ORF Alignment: NC_006087 [GENIUS II[Archive

    Full Text Available NC_006087 gi|50955733 >1exqA 11 145 176 318 6e-09 ... ref|YP_063021.1| transposase, undefined... [Leifsonia xyli subsp. xyli str. CTCB07] ... gb|AAT89916.1| transposase, undefined [Leifsoni

  10. ORF Alignment: NC_003037 [GENIUS II[Archive

    Full Text Available NC_003037 gi|16263035 >1nyoA 11 162 8 158 4e-30 ... ref|NP_435828.1| Nex18 Symbiotica...lly induced conserved protein [Sinorhizobium ... meliloti 1021] gb|AAK65240.1| Nex18 Symbiotically ... ... ... induced conserved protein [Sinorhizobium meliloti 1021] ... pir||F95334 Nex18 Symbiotically

  11. ORF Alignment: NC_006155 [GENIUS II[Archive

    Full Text Available NC_006155 gi|51596443 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  12. ORF Alignment: NC_004668 [GENIUS II[Archive

    Full Text Available NC_004668 gi|29376585 >1pq4B 1 288 29 305 1e-52 ... ref|NP_815739.1| endocarditis spe...cific antigen [Enterococcus faecalis V583] ... gb|AAO81809.1| endocarditis specific antigen ...

  13. ORF Alignment: NC_005296 [GENIUS II[Archive

    Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...

  14. ORF Sequence: NC_001139 [GENIUS II[Archive

    Full Text Available NC_001139 gi|50593217 >gi|50593217|ref|NP_011747.2| Subunit of the prohibitin complex (Phb1p-Phb2p...sized proteins; determinant of replicative life span; involved in mitochondrial segregation; Phb2p [Saccharo

  15. ORF Alignment: NC_002162 [GENIUS II[Archive

    Full Text Available NC_002162 gi|13358092 >6mhtA 61 323 7 298 3e-31 ... ref|NP_078366.1| cytosine-specifi...ic ... methyltransferase [Ureaplasma parvum serovar 3 str. ATCC ... 700970] pir||D82880 methyltransferase ... UU528 [imported] - Ureaplasma urealyticu...FGMKKGSGTRSGLLWEIERILFDLQKLNQ 60 ... Query: 127 LNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNY...KIEKYYQEAYLAQPNRTFSRIKYV 186 ... LNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYKIEKYYQEAYLAQPNRTFSRIKYV Sbjct: 121 LNYDGLIDSNGNILDLEAP

  16. ORF Alignment: NC_002162 [GENIUS II[Archive

    Full Text Available ... antitermination factor [Ureaplasma parvum serovar 3 str. ... ATCC 700970] pir||A82874 tran...scription antitermination ... factor UU581 [imported] - Ureaplasma urealyt...icum ... Length = 137 ... Query: 24 ... HQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLXXXXXXXXXXXXYEPSEAPRSMKN 83 ... ... ... HQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDL ... YEPSEAPRSMKN Sbjct: 1 ... HQWYIVTVVSGNEQKVIENIKDKLNGYG... NC_002162 gi|13358146 >1nz8A 2 112 24 160 9e-13 ... ref|NP_078420.1| transcription an

  17. ORF Alignment: NC_002162 [GENIUS II[Archive

    Full Text Available [imported] - ... Ureaplasma urealyticum ... Length = 313 ... Query: 8... NC_002162 gi|13357852 >1esc0 2 302 87 399 2e-29 ... ref|NP_078126.1| hypothetical protein UU292 [Ureap...lasma parvum serovar 3 str. ATCC ... 700970] gb|AAF30701.1| conserved hypothetical ... [Ureap...7 ... KINYLAIGDSITAGFNSELGWEAPGRYDPITNKISGLSFPSFIAQYINKVEPNRLASYEN 146 ... KINYLAIGDSITAGFNSELGWEAPGRYDP...ITNKISGLSFPSFIAQYINKVEPNRLASYEN Sbjct: 1 ... KINYLAIGDSITAGFNSELGWEAPGRYDPITNKISGLSFPSFIAQYINKVEPNRLASYEN 60 ...

  18. ORF Alignment: NC_002162 [GENIUS II[Archive

    Full Text Available NC_002162 gi|13358063 >1t71A 5 267 1 262 2e-78 ... ref|NP_078337.1| hypothetical protein UU500 [Ureap...lasma parvum serovar 3 str. ATCC ... 700970] gb|AAF30912.1| conserved hypothetical ... [Ureap...[imported] - ... Ureaplasma urealyticum ... Length = 262 ... Query: 1 ...ery: 121 GNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKLSLVYGTHT 180 ... ... ... GNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKLSLVYGTHT Sbjct: 121 GNSIDMKGLQTNPFESLDKIIAFNEAPIHIVD

  19. 77 FR 33997 - Television Broadcasting Services; Greenville, NC


    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Proposed... freeze on the acceptance of rulemaking petitions by full power television stations requesting channel... filed by full power television stations seeking to relocate from channel 51 pursuant to a voluntary...

  20. ORF Alignment: NC_000963 [GENIUS II[Archive

    Full Text Available NC_000963 gi|15604602 >1mwmA 4 314 14 327 1e-47 ... ref|NP_221120.1| ROD SHAPE-DETERMINING... PROTEIN MREB (mreB) [Rickettsia prowazekii ... str. Madrid E] emb|CAA15196.1| ROD SHAPE-DETERMINING

  1. ORF Alignment: NC_005090 [GENIUS II[Archive

    Full Text Available NC_005090 gi|34557359 >1mwmA 3 314 11 322 5e-28 ... ref|NP_907174.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN (FRAGMENT) [Wolinella ... succinogenes DSM 1740] emb|CAE10074.1| PUTATIVE ROD ... SHAPE-DETERMIN...ING PROTEIN (FRAGMENT) [Wolinella ... succinogenes] ... Length = 312 ...

  2. ORF Alignment: NC_005090 [GENIUS II[Archive

    Full Text Available NC_005090 gi|34556511 >1mwmA 3 314 14 327 1e-46 ... ref|NP_906326.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09226.1| PUTATIVE ROD SHAPE-DETERMINING

  3. ORF Alignment: NC_000921 [GENIUS II[Archive

    Full Text Available NC_000921 gi|15612352 >1mwmA 3 314 14 329 4e-45 ... ref|NP_224005.1| ROD SHAPE-DETERMINING... PROTEIN [Helicobacter pylori J99] ... gb|AAD06861.1| ROD SHAPE-DETERMINING PROTEIN ... [

  4. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available NC_003295 gi|17544778 >1mwmA 4 314 14 329 3e-49 ... emb|CAD13587.1| PROBABLE ROD SHAPE-DETERMINING... PROTEIN [Ralstonia solanacearum] ... ref|NP_518180.1| PROBABLE ROD SHAPE-DETERMINING PR

  5. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING

  6. ORF Alignment: NC_000921 [GENIUS II[Archive

    Full Text Available NC_000921 gi|15611661 >1vdkA 1 460 2 461 e-141 ... ref|NP_223312.1| ASPARTATE AMMONIA...-LYASE [Helicobacter pylori J99] gb|AAD06167.1| ... ASPARTATE AMMONIA-LYASE [Helicobacter pylori J99

  7. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available NC_003295 gi|17547375 >1v4aA 29 433 25 452 2e-95 ... emb|CAD16363.1| PROBABLE GLUTAMATE-AMMONIA... ... [Ralstonia solanacearum] ref|NP_520777.1| PROBABLE ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERAS

  8. ORF Alignment: NC_003047 [GENIUS II[Archive

    Full Text Available NC_003047 gi|15964777 >1v4aA 24 435 49 467 e-101 ... emb|CAC45596.1| PUTATIVE GLUTAMATE-AMMONIA...-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti] ref|NP_385130.1| PUTATIVE ... GLUTAMATE-AMMO...NIA-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti 1021] sp|

  9. ORF Alignment: NC_005090 [GENIUS II[Archive

    Full Text Available NC_005090 gi|34557077 >1vdkA 1 459 5 463 e-135 ... ref|NP_906892.1| ASPARTATE AMMONIA...-LYASE [Wolinella succinogenes DSM 1740] ... emb|CAE09792.1| ASPARTATE AMMONIA-LYASE [Wolinella ...

  10. ORF Alignment: NC_003318 [GENIUS II[Archive

    Full Text Available NC_003318 gi|17988713 >1gkpA 3 425 8 405 2e-19 ... ref|NP_541346.1| IMIDAZOLONEPROPIONASE / HISTIDINE AMMONIA...-LYASE [Brucella ... melitensis 16M] gb|AAL53610.1| IMIDAZOLONEPROPIONASE / ... HISTIDINE AMMON...IA-LYASE [Brucella melitensis 16M] ... pir||AG3555 histidine ammonia-lyase (

  11. ORF Alignment: NC_003450 [GENIUS II[Archive

    Full Text Available NC_003450 gi|19553429 >1v4aA 22 435 620 1034 4e-69 ... ref|YP_226470.1| GLUTAMATE-AMMONIA...mb|CAF20569.1| ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE ... [Corynebacterium glutami

  12. ORF Alignment: NC_003295 [GENIUS II[Archive

    Full Text Available NC_003295 gi|17547365 >1gkmA 3 497 10 504 e-143 ... emb|CAD16353.1| PROBABLE HISTIDINE AMMONIA...-LYASE (HISTIDASE) PROTEIN [Ralstonia ... solanacearum] ref|NP_520767.1| PROBABLE HISTIDINE ... AMMONIA

  13. ORF Alignment: NC_004311 [GENIUS II[Archive

    Full Text Available NC_004311 gi|23500656 >1gkpA 3 425 8 405 2e-19 ... ref|NP_541346.1| IMIDAZOLONEPROPIONASE / HISTIDINE AMMONIA...-LYASE [Brucella ... melitensis 16M] gb|AAL53610.1| IMIDAZOLONEPROPIONASE / ... HISTIDINE AMMON...IA-LYASE [Brucella melitensis 16M] ... pir||AG3555 histidine ammonia-lyase (

  14. ORF Alignment: NC_003047 [GENIUS II[Archive

    Full Text Available NC_003047 gi|15966456 >1gkmA 2 501 3 499 e-107 ... emb|CAC47282.1| PUTATIVE HISTIDINE AMMONIA...-LYASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386809.1| PUTATIVE HISTIDINE AMMONIA-LYASE

  15. ORF Alignment: NC_003296 [GENIUS II[Archive

    Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA

  16. ORF Alignment: NC_003317 [GENIUS II[Archive

    Full Text Available NC_003317 gi|17987610 >1v4aA 20 435 2 420 e-106 ... gb|AAL52508.1| GLUTAMATE-AMMONIA-...LIGASE ADENYLYLTRANSFERASE [Brucella melitensis ... 16M] ref|NP_540244.1| GLUTAMATE-AMMONIA-LIGASE ...

  17. ORF Alignment: NC_003450 [GENIUS II[Archive

    Full Text Available NC_003450 gi|19552717 >1vdkA 1 459 57 516 e-127 ... ref|YP_225787.1| ASPARTATE AMMONIA...ynebacterium glutamicum ATCC 13032] emb|CAF21511.1| ... ASPARTATE AMMONIA-LYASE (ASPARTASE) [Coryneba

  18. ORF Alignment: NC_003317 [GENIUS II[Archive

    Full Text Available NC_003317 gi|17986393 >1vdkA 1 459 12 469 e-123 ... gb|AAL51291.1| ASPARTATE AMMONIA-...LYASE [Brucella melitensis 16M] ref|NP_539027.1| ... ASPARTATE AMMONIA-LYASE [Brucella melitensis 16M

  19. ORF Alignment: NC_003281 [GENIUS II[Archive

    Full Text Available NC_003281 gi|17554732 >1yovB 5 426 11 433 e-114 ... ref|NP_498534.1| UBiquitin Activating enzme related, ectop...ic membrane RuFfLes in ... embryo RFL-1, CYtoKinesis defect CYK-5 (rfl-1) ...

  20. ORF Alignment: NC_005126 [GENIUS II[Archive

    Full Text Available NC_005126 gi|37525549 >1iwlA 1 182 22 203 4e-57 ... ref|NP_928893.1| outer-membrane lipoproteins... ... emb|CAE13895.1| outer-membrane lipoproteins carrier ... protein precursor (P20) [Photorhabdus

  1. ORF Alignment: NC_004603 [GENIUS II[Archive

    Full Text Available NC_004603 gi|28897880 >1iwlA 4 181 30 207 4e-54 ... ref|NP_797485.1| outer membrane lipoproteins... carrier protein [Vibrio ... parahaemolyticus RIMD 2210633] dbj|BAC59369.1| outer ... membrane lipoproteins

  2. ORF Alignment: NC_006834 [GENIUS II[Archive

    Full Text Available NC_006834 gi|58582167 >1iwlA 2 180 70 254 2e-49 ... ref|YP_201183.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas oryzae pv. oryzae KAC... carrier protein precursor [Xanthomonas ... oryzae pv. oryzae KACC10331] gb|AAW75798.1| ...

  3. ORF Alignment: NC_005966 [GENIUS II[Archive

    Full Text Available NC_005966 gi|50085964 >1iwlA 2 180 37 230 6e-44 ... ref|YP_047474.1| outer-membrane lipoproteins... carrier protein [Acinetobacter sp. ... ADP1] emb|CAG69652.1| outer-membrane lipoproteins

  4. ORF Alignment: NC_006348 [GENIUS II[Archive

    Full Text Available NC_006348 gi|53726032 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

  5. ORF Alignment: NC_004547 [GENIUS II[Archive

    Full Text Available NC_004547 gi|50121570 >1iwlA 1 182 22 203 1e-59 ... ref|YP_050737.1| outer-membrane lipoproteins...oproteins carrier protein [Erwinia ... carotovora subsp. atroseptica SCRI104... carrier protein [Erwinia carotovora ... subsp. atroseptica SCRI1043] emb|CAG75546.1| ... outer-membrane lip

  6. ORF Alignment: NC_005139 [GENIUS II[Archive

    Full Text Available NC_005139 gi|37679507 >1iwlA 4 181 20 197 6e-54 ... ref|NP_934116.1| outer membrane lipoproteins...tein ... carrier protein precursor dbj|BAC94087.1| outer membrane ... lipoproteins carrier pro

  7. ORF Alignment: NC_003902 [GENIUS II[Archive

    Full Text Available NC_003902 gi|21231422 >1iwlA 2 180 23 207 3e-47 ... ref|NP_637339.1| outer-membrane lipoproteins... ... gb|AAM41263.1| outer-membrane lipoproteins carrier ... protein precursor [Xanthomonas campest

  8. ORF Alignment: NC_004917 [GENIUS II[Archive

    Full Text Available NC_004917 gi|32265815 >1iwlA 11 178 23 174 4e-23 ... gb|AAP76913.1| outer membrane lipoproteins... carrier protein LolA [Helicobacter ... hepaticus ATCC 51449] ref|NP_859847.1| outer membrane ... lipoprotein

  9. ORF Alignment: NC_006840 [GENIUS II[Archive

    Full Text Available NC_006840 gi|59711513 >1iwlA 4 181 21 198 9e-49 ... ref|YP_204289.1| outer-membrane lipoproteins... carrier protein [Vibrio fischeri ES114] ... gb|AAW85401.1| outer-membrane lipoproteins ca

  10. ORF Alignment: NC_005085 [GENIUS II[Archive

    Full Text Available NC_005085 gi|34497069 >1iwlA 2 178 25 203 1e-46 ... gb|AAQ59290.1| outer membrane lipoproteins... carrier protein [Chromobacterium ... violaceum ATCC 12472] ref|NP_901284.1| outer membrane ... lipoproteins

  11. ORF Alignment: NC_006350 [GENIUS II[Archive

    Full Text Available NC_006350 gi|53720213 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

  12. 78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC


    ...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...

  13. A vaccine formulation combining rhoptry proteins NcROP40 and NcROP2 improves pup survival in a pregnant mouse model of neosporosis.

    Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M


    Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Effect of dietary poly-β-hydroxybutyrate (PHB) on growth performance, intestinal health status and body composition of Pacific white shrimp Litopenaeus vannamei (Boone, 1931).

    Duan, Yafei; Zhang, Yue; Dong, Hongbiao; Zheng, Xiaoting; Wang, Yun; Li, Hua; Liu, Qingsong; Zhang, Jiasong


    In the present study, the effect of dietary supplementation of poly-β-hydroxybutyrate (PHB) on the growth performance, intestinal digestive and immune function, intestinal short-chain fatty acids (SCFA) content and body composition of Pacific white shrimp Litopenaeus vannamei (Boone, 1931) was evaluated. The shrimp was fed for 35 days with four different diets: 0%, 1%, 3% and 5% PHB supplemented feed. The results indicated that supplementation of PHB significantly increased the growth performance of the shrimp, and the feed conversion rate (FCR) in 3%PHB treatment group was significantly lower than the control (P PHB treatment groups were all significantly higher than that of the control (P PHB treatment (P > 0.05). The activities of intestinal immune enzymes such as total antioxidant capacity (T-AOC) and inducible nitric oxide synthase (iNOS) was significantly induced by 3%PHB treatment (P PHB treatment and nitric oxide (NO) content was significantly induced in three PHB treatments. Meanwhile, PHB induced significantly the expression level of intestinal heat shock protein 70 (HSP70), Toll and immune deficiency (Imd) gene. HE staining showed that PHB induced the intestinal health status of L. vannamei. Intestinal SCFA content analysis revealed that the content of propionic and butyric acid of 3%PHB treatment were significantly higher than that of the control (P PHB treatments, and the crude lipid in 1% and 5%PHB treatments were all significantly higher than the control (P PHB could improve the growth performance, modulated intestinal digestive and immune function, increased intestinal SCFA content and body composition in L. vannamei, and the optimum dietary PHB requirement by L. vannamei was estimated at 3% (w/w) diet. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Software module for geometric product modeling and NC tool path generation

    Sidorenko, Sofija; Dukovski, Vladimir


    The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)

  16. Large Nc from Seiberg–Witten curve and localization

    Jorge G. Russo


    Full Text Available When N=2 gauge theories are compactified on S4, the large Nc limit then selects a unique vacuum of the theory determined by saddle-point equations, which remains determined even in the flat-theory limit. We show that exactly the same equations can be reproduced purely from Seiberg–Witten theory, describing a vacuum where magnetically charged particles become massless, and corresponding to a specific degenerating limit of the Seiberg–Witten spectral curve where 2Nc−2 branch points join pairwise giving aDn=0, n=1,…,Nc−1. We consider the specific case of N=2 SU(Nc SQCD coupled with 2Nf massive fundamental flavors. We show that the theory exhibits a quantum phase transition where the critical point describes a particular Argyres–Douglas point of the Riemann surface.

  17. ORF Alignment: NC_003304 [GENIUS II[Archive

    Full Text Available NC_003304 gi|17935259 >1tjlA 17 141 10 134 5e-37 ... ref|NP_532049.1| dnaK deletion s...uppressor protein [Agrobacterium tumefaciens str. ... C58] gb|AAL42365.1| dnaK deletion suppressor pr...otein ... [Agrobacterium tumefaciens str. C58] pir||AG2743 dnaK ... deletion suppressor protei

  18. ORF Alignment: NC_003062 [GENIUS II[Archive

    Full Text Available NC_003062 gi|15888685 >1tjlA 17 141 10 134 5e-37 ... ref|NP_532049.1| dnaK deletion s...uppressor protein [Agrobacterium tumefaciens str. ... C58] gb|AAL42365.1| dnaK deletion suppressor pr...otein ... [Agrobacterium tumefaciens str. C58] pir||AG2743 dnaK ... deletion suppressor protei

  19. ORF Alignment: NC_002505 [GENIUS II[Archive

    Full Text Available NC_002505 gi|15640858 >1atg0 1 226 25 253 1e-12 ... gb|AAF94004.1| accessory colonization... factor AcfC [Vibrio cholerae O1 biovar eltor ... str. N16961] ref|NP_230489.1| accessory colonization... ... factor AcfC [Vibrio cholerae O1 biovar eltor str. ... N16961] pir||F82273 accessory colonization

  20. ORF Alignment: NC_004757 [GENIUS II[Archive

    Full Text Available NC_004757 gi|30248965 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro

  1. ORF Alignment: NC_004757 [GENIUS II[Archive

    Full Text Available NC_004757 gi|30250266 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro

  2. ORF Alignment: NC_004757 [GENIUS II[Archive

    Full Text Available NC_004757 gi|30249984 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro

  3. ORF Alignment: NC_004851 [GENIUS II[Archive

    Full Text Available NC_004851 gi|31983537 >1mwmA 1 315 2 316 e-100 ... ref|NP_858328.1| plasmid stable inheritance... protein [Shigella flexneri 2a str. 301] ... gb|AAL72301.1| plasmid stable inheritance prote...7.1| plasmid stable ... inheritance protein [Shigella flexneri] ref|NP_085...361.1| ... plasmid stable inheritance protein [Shigella flexneri] ... Length = 315 ... Query: 2 ...

  4. The UXO Classification Demonstration at the Former Camp Butner, NC


    Symposium and Workshop, Technical Session 2D: Classification Methods for Military Munitions Response. 1 December 2010. [49] Pasion , L. Personal...Communication. 15 June 2011. [50] Pasion , L. “Practical Strategies for UXO Discrimination: Camp Butner Analysis.” ESTCP Munitions Management In-Progress...Review. 9 February 2011. [51] Pasion , L., et al. “UXO Discrimination Using Full Coverage and Cued Interrogation Data Sets at Camp Butner, NC.” Partners

  5. ORF Alignment: NC_003423 [GENIUS II[Archive

    Full Text Available ... ref|NP_596412.1| ccaat-binding factor subunit php5p. ... [Schizosaccharomyces pombe] sp|P79007|PHP... NC_003423 gi|19113204 >1n1jA 1 86 107 194 5e-20 ... emb|CAA18291.1| php5 [Schizosacch...5_SCHPO ... Transcriptional activator php5 pir||T40338 ccaat-binding ... ... factor subunit php5p - fission yeast ... (Schizosaccharomyces pombe) ... Length = 88

  6. ORF Alignment: NC_003424 [GENIUS II[Archive

    Full Text Available nscriptional activator [Schizosaccharomyces pombe] ... sp|P36611|PHP3_SCHPO Transcriptional activator php... NC_003424 gi|19114551 >1n1jA 3 87 12 96 7e-28 ... emb|CAA52966.1| PHP3 [Schizosacchar...omyces pombe] emb|CAB11161.1| php3 ... [Schizosaccharomyces pombe] ref|NP_593639.1| php3 ... tra...3 ... pir||S42744 transcription factor PHP3 - fission yeast ... (S

  7. ORF Alignment: NC_002755 [GENIUS II[Archive

    Full Text Available NC_002755 gi|15841902 >1xsfA 1 103 24 123 7e-24 ... ref|NP_216905.1| PROBABLE RESUSCITATION...-PROMOTING FACTOR RPFD [Mycobacterium ... tuberculosis H37Rv] ref|NP_856059.1| PROBABLE ... RESUSCITATION...-PROMOTING FACTOR RPFD [Mycobacterium bovis ... AF2122/97] emb|CAB03736.1| PROBABLE ... RESUSCITATION...berculosis CDC1551] emb|CAD97271.1| ... PROBABLE RESUSCITATION-PROMOTING FACTOR RPFD ... [Myco

  8. ORF Alignment: NC_002755 [GENIUS II[Archive

    Full Text Available NC_002755 gi|15841354 >1xsfA 3 107 45 146 4e-23 ... ref|NP_216400.1| PROBABLE RESUSCITATION...-PROMOTING FACTOR RPFC [Mycobacterium ... tuberculosis H37Rv] ref|NP_855568.1| PROBABLE ... RESUSCITATION... emb|CAB10065.1| PROBABLE RESUSCITATION-PROMOTING FACTOR ... RPFC [Mycobacterium tuberculosis H37Rv] ...emb|CAD94619.1| ... PROBABLE RESUSCITATION-PROMOTING FACTOR RPFC ... [Mycobacterium bovis AF21

  9. ORF Alignment: NC_000962 [GENIUS II[Archive

    Full Text Available NC_000962 gi|15609021 >1xsfA 3 107 45 146 4e-23 ... ref|NP_216400.1| PROBABLE RESUSCITATION...-PROMOTING FACTOR RPFC [Mycobacterium ... tuberculosis H37Rv] ref|NP_855568.1| PROBABLE ... RESUSCITATION... emb|CAB10065.1| PROBABLE RESUSCITATION-PROMOTING FACTOR ... RPFC [Mycobacterium tuberculosis H37Rv] ...emb|CAD94619.1| ... PROBABLE RESUSCITATION-PROMOTING FACTOR RPFC ... [Mycobacterium bovis AF21

  10. ORF Alignment: NC_002945 [GENIUS II[Archive

    Full Text Available NC_002945 gi|31793075 >1xsfA 3 107 45 146 4e-23 ... ref|NP_216400.1| PROBABLE RESUSCITATION...-PROMOTING FACTOR RPFC [Mycobacterium ... tuberculosis H37Rv] ref|NP_855568.1| PROBABLE ... RESUSCITATION... emb|CAB10065.1| PROBABLE RESUSCITATION-PROMOTING FACTOR ... RPFC [Mycobacterium tuberculosis H37Rv] ...emb|CAD94619.1| ... PROBABLE RESUSCITATION-PROMOTING FACTOR RPFC ... [Mycobacterium bovis AF21

  11. ORF Alignment: NC_002945 [GENIUS II[Archive

    Full Text Available NC_002945 gi|31793566 >1xsfA 1 103 24 123 7e-24 ... ref|NP_216905.1| PROBABLE RESUSCITATION...-PROMOTING FACTOR RPFD [Mycobacterium ... tuberculosis H37Rv] ref|NP_856059.1| PROBABLE ... RESUSCITATION...-PROMOTING FACTOR RPFD [Mycobacterium bovis ... AF2122/97] emb|CAB03736.1| PROBABLE ... RESUSCITATION...berculosis CDC1551] emb|CAD97271.1| ... PROBABLE RESUSCITATION-PROMOTING FACTOR RPFD ... [Myco

  12. ORF Alignment: NC_000962 [GENIUS II[Archive

    Full Text Available NC_000962 gi|15609526 >1xsfA 1 103 24 123 7e-24 ... ref|NP_216905.1| PROBABLE RESUSCITATION...-PROMOTING FACTOR RPFD [Mycobacterium ... tuberculosis H37Rv] ref|NP_856059.1| PROBABLE ... RESUSCITATION...-PROMOTING FACTOR RPFD [Mycobacterium bovis ... AF2122/97] emb|CAB03736.1| PROBABLE ... RESUSCITATION...berculosis CDC1551] emb|CAD97271.1| ... PROBABLE RESUSCITATION-PROMOTING FACTOR RPFD ... [Myco

  13. ORF Alignment: NC_004741 [GENIUS II[Archive

    Full Text Available NC_004741 gi|30064861 >1ogiA 15 282 6 231 1e-18 ... ref|NP_709648.2| ferrisiderophore... reductase, flavin reductase (NADPH:flavin ... oxidoreductase) [Shigella flexneri 2a str. 301] ... gb|AAN45355.2| ferri...higella ... flexneri 2a str. 301] ref|NP_839032.1| ferrisiderophore ... ... ... gb|AAP18843.1| ferrisiderophore reductase, flavin ... reductase (NADPH:flavin oxidoreducta

  14. ORF Alignment: NC_002516 [GENIUS II[Archive

    Full Text Available NC_002516 gi|15595667 >1kmoA 10 661 142 802 6e-74 ... ref|NP_249161.1| probable hydroxamate-type ferris...le hydroxamate-type ... ferrisiderophore receptor PA0470 [imported] - ... ... ... hydroxamate-type ferrisiderophore receptor [Pseudomonas ... aeruginosa PAO1] pir||C83588 probab...iderophore receptor [Pseudomonas ... aeruginosa PAO1] gb|AAG03859.1| probable ...

  15. ORF Alignment: NC_004337 [GENIUS II[Archive

    Full Text Available NC_004337 gi|56480453 >1ogiA 15 282 6 231 1e-18 ... ref|NP_709648.2| ferrisiderophore... reductase, flavin reductase (NADPH:flavin ... oxidoreductase) [Shigella flexneri 2a str. 301] ... gb|AAN45355.2| ferri...higella ... flexneri 2a str. 301] ref|NP_839032.1| ferrisiderophore ... ... ... gb|AAP18843.1| ferrisiderophore reductase, flavin ... reductase (NADPH:flavin oxidoreducta

  16. ORF Alignment: NC_002755 [GENIUS II[Archive

    Full Text Available NC_002755 gi|15841371 >1wc3A 2 197 10 178 6e-16 ... pdb|1YBU|D Chain D, Mycobacterium Tuberculosis...C, ... Mycobacterium Tuberculosis Adenylyl Cyclase Rv1900c Chd, ... In Complex With A Substrat...e Analog. pdb|1YBU|B Chain B, ... Mycobacterium Tuberculosis Adenylyl Cycl...ase Rv1900c Chd, ... In Complex With A Substrate Analog. pdb|1YBU|A Chain A, ... Mycobacterium Tuberculosis

  17. ORF Alignment: NC_000962 [GENIUS II[Archive

    Full Text Available NC_000962 gi|15609037 >1wc3A 2 197 10 178 6e-16 ... pdb|1YBU|D Chain D, Mycobacterium Tuberculosis...C, ... Mycobacterium Tuberculosis Adenylyl Cyclase Rv1900c Chd, ... In Complex With A Substrat...e Analog. pdb|1YBU|B Chain B, ... Mycobacterium Tuberculosis Adenylyl Cycl...ase Rv1900c Chd, ... In Complex With A Substrate Analog. pdb|1YBU|A Chain A, ... Mycobacterium Tuberculosis

  18. ORF Alignment: NC_002945 [GENIUS II[Archive

    Full Text Available NC_002945 gi|31793093 >1wc3A 2 197 10 178 6e-16 ... pdb|1YBU|D Chain D, Mycobacterium Tuberculosis...C, ... Mycobacterium Tuberculosis Adenylyl Cyclase Rv1900c Chd, ... In Complex With A Substrat...e Analog. pdb|1YBU|B Chain B, ... Mycobacterium Tuberculosis Adenylyl Cycl...ase Rv1900c Chd, ... In Complex With A Substrate Analog. pdb|1YBU|A Chain A, ... Mycobacterium Tuberculosis

  19. ORF Alignment: NC_006905 [GENIUS II[Archive

    Full Text Available NC_006905 gi|62181272 >1gdtA 1 182 1 183 1e-47 ... ref|YP_217689.1| H inversion: regu...lation of flagellar gene expression by ... site-specific inversion of DNA [Salmonella enterica ... ... ... subsp. enterica serovar Choleraesuis str. SC-B67] ... gb|AAX66608.1| H inversion: regulation of ...flagellar gene ... expression by site-specific inversion of DNA [Salmonell

  20. ORF Alignment: NC_004337 [GENIUS II[Archive

    Full Text Available NC_004337 gi|56480138 >1gdtA 3 177 2 177 8e-49 ... ref|NP_415676.1| e14 prophage; inversion... of adjacent DNA [Escherichia coli K12] ... gb|AAC74242.1| inversion of adjacent DNA; at locus ...of ... e14 element; e14 prophage; inversion of adjacent DNA ... [Escherichia coli K12] dbj|BAA