WorldWideScience

Sample records for universiteit van amsterdam

  1. Die opleiding van bedryfsielkundiges aan die universiteit van Fort Hare

    Directory of Open Access Journals (Sweden)

    W. Botha

    1977-11-01

    Full Text Available Die Departement Bedryfsielkunde aan die Universiteit van Fort Hare is 'n relatiewe jong departement en het eers in 1965 tot stand gekom. Voor hierdie datum is Bedryfsielkunde as 'n kort kursus deur die departement van suiwer Sielkunde aangebied en een van die destydse dosente, Dr. W. Backer, het die inisiatief geneem om 'n selfstandige departement van Bedryfsielkunde in die Fakulteit van Ekonomiese Wetenskappe op die been te bring.

  2. Erwin van Loo, ‘Eenige wakkere jongens’. Nederlandse oorlogsvliegers in de Britse luchtstrijdkrachten, 1940-1945

    Directory of Open Access Journals (Sweden)

    Marc Dierikx

    2016-11-01

    Full Text Available Erwin van Loo, ‘Eenige wakkere jongens’. Nederlandse oorlogsvliegers in de Britse luchtstrijdkrachten, 1940-1945 (Proefschrift Universiteit van Amsterdam 2013; Amsterdam: Boom, 2013, 515 pp., isbn 978 94 6105 926 0.

  3. Esperanto: een taal van mij, een taal om van te houden = Esperanto: lingvo malfremda, lingvo amida

    NARCIS (Netherlands)

    Jansen, W.

    2010-01-01

    Onderstaande tekst vormt de artikelversie van mijn op 4 september 2009 gehouden oratie bij de aanvaarding van het bijzonder hoogleraarschap in de interlinguïstiek en het Esperanto aan de Universiteit van Amsterdam (Jansen, 2009). Ten opzichte van de oorspronkelijke oratie is de nu volgende tekst op

  4. Die Departement Godsdiens- en Sendingwetenskap (Afd A, Universiteit van Pretoria, 1917-1978

    Directory of Open Access Journals (Sweden)

    P. J. van der Merwe

    1992-01-01

    Full Text Available The Department of Science of Religion and Missiology (Sec A, University of Pretoria, 1917-1978 The Transvaal University College began its Faculty of Theology in 1917 in co-operation with the Presbyterian Church and the Nederduitsch Hervormde Kerk. A Presbyterian minister, Prof E MacMillan, lectured from 1917 till 1934. This marked the end of Presbyterian participation. In the next period, 1935-1937, the Department suffered from a controversy between the Nederduitsch Hervormde Kerk and its new partner, the Nederduitsch Hervormde of Gereformeerde Kerk. The issue was solved when the Faculty divided into two sections, Section A for the Nederduitsch Hervormde Kerk and Section B for the Nederduitsch Hervormde of G ereformeerde Kerk. Prof H P Wolmarans was appointed to the chair of Science of Religion (Sec A in 1938 and served as head of the Department till 1959. He was succeeded by Prof F J van Zyl in 1960, who served till 1978.

  5. Jaarverslag 2003: Erasmus Universiteit Rotterdam

    NARCIS (Netherlands)

    2004-01-01

    textabstractDe Erasmus Universiteit Rotterdam heeft in 2003 resultaten ge- boekt waar zij voor staat, zowel op het gebied van wetenschap- pelijk onderwijs, wetenschappelijk onderzoek als in de sfeer van maatschappelijke dienstverlening. Daarvan kunt u in dit verslag kennisnemen. Veel aandacht is

  6. Jaarverslag 2001: Erasmus Universiteit Rotterdam

    NARCIS (Netherlands)

    2002-01-01

    textabstractDe Erasmus Universiteit Rotterdam heeft in 2001 resultaten geboekt waar zij voor staat, zowel op het gebied van wetenschappelijk onderwijs, wetenschappelijk onderzoek als in de sfeer van maatschappelijke dienstverlening. Met genoegen presenteren we u daarom dit verslag. Daarin laten we

  7. Adriaan van Veldhuizen, De partij. Over het politieke leven in de vroege S.D.A.P.

    Directory of Open Access Journals (Sweden)

    Dirk Jan Wolffram

    2016-11-01

    Full Text Available Adriaan van Veldhuizen, De partij. Over het politieke leven in de vroege S.D.A.P. (Dissertatie Universiteit Leiden 2015; Amsterdam: Prometheus/Bert Bakker, 2015, 375 pp., isbn 978 90 3513 857 5.

  8. Als ze maar van me afblijven : Een onderzoek naar antihomoseksueel geweld in Amsterdam

    NARCIS (Netherlands)

    Buijs, Laurens; Duyvendak, Jan Willem; Hekma, Gert

    2008-01-01

    Geweld tegen homo's is een veelvoorkomend en structureel verschijnsel in Nederlands gay capital. Ondanks de liberale reputatie van Amsterdam zijn vooroordelen over mannelijkheid en (homo)seksualiteit wijdverspreid. Dat leidt, voornamelijk bij jonge mannen, tot het plegen van geweld. Als ze maar van

  9. Hinke Piersma en Jeroen Kemperman, Openstaande rekeningen. De gemeente Amsterdam en de gevolgen van roof en rechtsherstel, 1940-1950.

    Directory of Open Access Journals (Sweden)

    Regina Grüter

    2017-05-01

    Full Text Available Hinke Piersma en Jeroen Kemperman, Openstaande rekeningen. De gemeente Amsterdam en de gevolgen van roof en rechtsherstel, 1940-1950 (Amsterdam: Boom, 2015, 256 pp., isbn 978 908 953 661 7.

  10. Fietsongevallen in Amsterdam : een analyse ten behoeve van de gemeente Amsterdam (Rapport + bijlage).

    NARCIS (Netherlands)

    Polak, P.H.

    1983-01-01

    By order of the municipality of Amsterdam a study has been made into the development of traffic hazards for cyclists in Amsterdam during the period 1977-1980, and into the distribution of this insecurity within the city, and on the type of road in relationship with traffic counts. It is shown that

  11. De waarde van studentensport : onderzoek naar de relatie tussen USC lidmaatschap en studieprestaties van bachelorstudenten in Amsterdam, Utrecht, Wageningen en Nijmegen

    NARCIS (Netherlands)

    Dekkers, Vera; Deutekom, Marije

    Er bestaan significante verschillen tussen het aantal behaalde studiepunten van niet-leden en leden van een Universitair Sportcentrum (USC). Dat blijkt uit onderzoek van het lectoraat “Kracht van Sport” van de Hogeschool van Amsterdam (HvA) en Hogeschool Inholland. Het onderzoek laat zien dat leden

  12. 14 November 2014 - F. van der Duyn Schouten Rector Magnificus Vrije Universiteit University Amsterdam Kingdom of the Netherlands

    CERN Multimedia

    Guillaume, Jeanneret

    2014-01-01

    signing the Guest Book with ATLAS Collaboration, Dutch senior physicist H. ten Kate and visiting the ATLAS cavern with ATLAS Collaboration Deputy Spokesperson T. Wengler; ATLAS Collaboration, Director of Nikhef as of December 1, 2014 S. Bentvelsen and ATLAS Collaboration, Nikhef P. de Jong.

  13. Amsterdam Book Design: Irma Boom, Hansje van Halem, Lesley Moore = Amsterdamskij knižnyj dizajn

    NARCIS (Netherlands)

    Lommen, M.

    2012-01-01

    Published on the occasion of the exhibition 'Amsterdam Book Design : Irma Boom, Hansje van Halem, Lesley Moore', from May 26th until June 17th 2012 in the creative platform Taiga Space, Saint Petersburg. In cooperation with Netherlands Institute Saint-Petersburg.

  14. Book received: Paul van den Akker, Looking for Lines: Theories of the Essence of Art and the Problem of Mannerism, Amsterdam: Amsterdam University Press 2010 including preface, contents and introduction.

    Directory of Open Access Journals (Sweden)

    Paul van den Akker

    2010-12-01

    Full Text Available Paul van den Akker, Looking for Lines: Theories of the Essence of Art and the Problem of Mannerism, Amsterdam: Amsterdam University Press 2010 including preface, contents and introduction.

  15. The Compilation of Multilingual Concept Literacy Glossaries at the University of Cape Town: A Lexicographical Function Theoretical Approach Die samestelling van veeltaligekonsep-geletterheidswoordelyste by die Universiteit van Kaapstad: 'n Leksikografiesefunksieteoretiese benadering.

    Directory of Open Access Journals (Sweden)

    Dion Nkomo

    2012-01-01

    Full Text Available

    This article proposes a lexicographical approach to the compilation of multilingual concept literacy glossaries which may play a very important role in supporting students at institutions of higher education. In order to support concept literacy, especially for students for whom English is not the native language, a number of universities in South Africa are compiling multilingual glossaries through which the use of languages other than English may be employed as auxiliary media. Terminologies in languages other than English are developed by translating English terms or coining new terms in these languages to exploit the native language competence of most students. The glossary project at the University of Cape Town (UCT which was conceived under the auspices of the Multilingualism Education Project (MEP is discussed. It is shown that the UCT glossaries are compiled using methods consistent with those employed in modern lexicography or proffered in lexicographical theory. The lexicographical function theory is specifically used to account for the glossaries and their production. It is suggested that modern lexicography can provide useful guidance for the production of glossaries, given that the earliest glossaries constitute the humble beginnings of lexicography.

    Hierdie artikel stel 'n leksikografiese benadering tot die samestelling van meertaligekonsep-geletterheidswoordelyste voor wat 'n baie belangrike rol kan speel by die ondersteuning van studente by instellings vir hoër onderwys. Om konsepgeletterdheid te ondersteun, veral vir studente vir wie Engels nie die moedertaal is nie, stel 'n aantal universiteite in Suid-Afrika meertalige woordelyste saam waardeur die gebruik van ander tale as Engels as hulpmedia aangewend kan word. Terminologieë in ander tale as Engels word ontwikkel deur Engelse terme te vertaal of nuwe terme in hierdie tale te skep om die moedertaalvaardigheid van die meeste

  16. Career choices of migrant artists between Amsterdam and Antwerp. The Van Nieulandt brothers

    Directory of Open Access Journals (Sweden)

    Eric Jan Sluijter

    2015-12-01

    Full Text Available This essay examines the career choices of the brothers Guilliam II and Adriaen II van Nieulandt. Both were born in Antwerp but moved with their parents to Amsterdam at a young age. Guilliam returned to Antwerp to make his career, while Adriaen became embedded in Amsterdam’s artistic community. All members of their family – in Antwerp, Amsterdam and Rome – remained in close contact with each other, though changes in the religious and political culture left their mark on their professional decisions. Their choices did not yield artistic innovations but conservative styles and subjects based on shared Netherlandish traditions with a strong international flavour.

  17. Values of Development and Educational Goals. Verhandelingen no. 8, tevens publikatie no. 21 van het Sociografisch Instituut der Universiteit van Amsterdam.

    Science.gov (United States)

    Fortuijn, A. B. Droogleever; Oud, P. J.

    This paper examines the concept of national development in terms of the realization of values; it is intended to serve as the basis for a research project focused on the formulation of a development strategy for developing countries, with special attention to the role of education in the development process. Chapter 1 briefly summarizes the…

  18. Hotels 'on hold' : Economische effecten van nieuw hotelbeleid in de gemeente Amsterdam

    NARCIS (Netherlands)

    Tieben, B.; Buunk, E.

    Amsterdam will tighten its licensing policy for new hotels. Under the new policy, the principle of “no, unless” will apply to the entire city. The development of new hotels in Amsterdam will only be possible in exceptional circumstances. SEO Amsterdam Economics has been commissioned by the

  19. Bioprospektering, wetgewing en navorsing by universiteite in Suid-Afrika

    Directory of Open Access Journals (Sweden)

    J.L. Du Plessis

    2006-09-01

    Full Text Available Suid-Afrika is besonder ryk aan biodiversiteit. Dié biodiversiteit kan benut word en het kommersiële potensiaal. Bioprospektering is die sistematiese evaluering van biodiversiteit deur gebruik te maak van gevorderde tegnologie in die soeke na en ontwikkeling van kommersieel waardevolle nuwe produkte. Die internasionale Konvensie vir Biodiversiteit en die nasionale Biodiversiteitwet beklemtoon die volhoubare benutting en bewaring van biodiversiteit en stel sekere vereistes aan bioprospektering en die navorsing daarby betrokke. Navorsing op inheemse biologiese hulpbronne word ook deur die wetgewing geraak. Feitlik elke universiteit in Suid-Afrika is betrokke by bioprospekteringsprojekte en/of navorsing op inheemse biologiese hulpbronne. ’n Kort oorsig oor die ontstaan van die Biodiversiteitwet word gegee. Navorsingsbestuur en navorsers word hiermee meegedeel wat die huidige wetlike implikasies van die Biodiversiteitwet op navorsing by universiteite in Suid-Afrika is.

  20. Grote Hotels in Amsterdam

    NARCIS (Netherlands)

    Vermeer, G.

    2014-01-01

    De reiziger die Amsterdam binnenkomt via het Centraal Station ziet rechts van het Damrak meteen een beknopte geschiedenis van de hotelbouw in Amsterdam. Op de hoek, om twee kleinere huisjes heen, staat het oudste deel van het Victoriahotel (nu Victoria Plaza Hotel), dat in 1890 zijn deuren opende.

  1. De AERA. Gedroomde machines en de praktijk van het rekenwerk aan het Mathematisch Centrum te Amsterdam

    Directory of Open Access Journals (Sweden)

    Gerard Alberts

    2008-06-01

    Full Text Available AERA. Dream machines and computing practices at the Mathematical Center  Dream machines may be just as effective as the ones materialised. Their symbolic thrust can be quite powerful. The Amsterdam ‘Mathematisch Centrum’ (Mathematical Center, founded February 11, 1946, created a Computing Department in an effort to realise its goal of serving society. When Aad van Wijngaarden was appointed as head of the Computing Department, however, he claimed space for scientific research and computer construction, next to computing as a service. Still, the computing service following the five stage style of Hartree’s numerical analysis remained a dominant chara c ter istic of the work of the Computing Department.The high level of ambition held by Aad van Wijngaarden lead to ever renewed projections of big automatic computers, symbolised by the never-built AERA. Even a machine that was actually constructed, the ARRA which followed A.D. Booth’s design of the ARC, never made it into real operation. It did serve Van Wijngaarden to bluff his way into the computer age by midsummer 1952. Not until January 1954 did the computing department have a working stored program computer, which for reasons of policy went under the same name: ARRA. After just one other machine, the ARMAC, had been produced, a separate company, Electrologica, was set up for the manufacture of computers, which produced the rather successful X1 computer.The combination of ambition and absence of a working machine lead to a high level of work on programming, way beyond the usual ideas of libraries of subroutines. Edsger W. Dijkstra in particular led the way to an emphasis on the duties of the programmer within the pattern of numerical analysis. Programs generating programs, known elsewhere as autocoding systems, were at the ‘Mathematisch Centrum’ called ‘superprograms’. Practical examples were usually called a ‘complex’, in Dutch, where in English one might say

  2. Continuïteit en verandering in de handelsgeschiedenis van Amsterdam

    Directory of Open Access Journals (Sweden)

    O. Gelderblom

    2003-01-01

    Full Text Available Continuity and change in the trading history of Amsterdam,Oscar GelderblomThis article argues that Clé Lesger's Handel in Amsterdam (2001 overestimates the impact of the Dutch Revolt on the emergence of the Amsterdam market as the centre for international trade. The immigration of merchants from Brabant and Flanders at the end of the sixteenth century was a direct outcome of the increased economic interaction between Antwerp andAmsterdam after 1540. It was indeed after they had settled in the Dutch port that these newcomers accumulated most of their considerable wealth. Finally, Amsterdam's faceless markets for foodstuffs, raw materials, industrial products, and transportation services played just as important a role in the efficient exchange of information as the international networks of the Antwerp merchants.

  3. Toxische effecten van zink op de worm Eisenia andrei; resultaten proefveldexperimenten Amsterdam 1995 en 1996

    NARCIS (Netherlands)

    Bakker J; Posthuma L; Baerselman R; ECO/EEB

    1997-01-01

    De toxische effecten van zink voor de compostworm Eisenia andrei werden bestudeerd in twee proefveldexperimenten, om de veldrelevantie van laboratorium-toxiciteitsgegevens te onderzoeken indien blootstellingscondities op natuurlijke wijze fluctueren. Coconproductie werd hierbij gebruikt als

  4. Goede resultaten van de behandeling van patiënten met buikklachten op de afdeling Spoedeisende Hulp van het Onze Lieve Vrouwe Gasthuis te Amsterdam

    NARCIS (Netherlands)

    van Geloven, A. A.; Luitse, J. S.; Hoitsma, H. F.

    1998-01-01

    Evaluation of the treatment of patients with abdominal complaints at the first aid department of a city hospital, where patients were treated by emergency doctors (EMD) in combination with specialists. Retrospective, descriptive. Onze Lieve Vrouwe Gasthuis, first aid department, Amsterdam, the

  5. De Amsterdam a Figueroles : Experiencias UNIGIS

    NARCIS (Netherlands)

    Koomen, E.

    2006-01-01

    Eric Koomen es un investigador en SlG del Departamento de Economía Espacial de Ia Vrije Universiteit de Amsterdam. Su principal ámbito de investigacíon es el modelado del cambio del uso del suelo y su tesis doctoral se centra en Ia applicacíon de indicadores de modelos de cambios de usos del suelo.

  6. Educated Guess van gevolgen voor verkeersslachtoffers door maatregel Snorfiets op de rijbaan (SOR) in Amsterdam : een eerste inschatting van effecten gerelateerd aan verkeersveiligheid.

    NARCIS (Netherlands)

    Wijlhuizen, G.J. Dijkstra, A. Bos, N.M. Goldenbeld, C. & Stipdonk, H.L.

    2013-01-01

    Educated Guess about the consequences for casualties as a result of introduction of the measure Light moped in the carriageway (SOR) in Amsterdam : a first estimate of the effects related to road safety. The Board of Mayor and Eldermen of the City of Amsterdam considers moving light mopeds in 50km/h

  7. Hoe verloopt identiteit-verificatie van online studenten?

    OpenAIRE

    Janssen, José

    2018-01-01

    Presentatie over identiteit verificatie van online studenten tijdens een werkbezoek van NUFFIC (https://www.nuffic.nl/) aan de Open Universiteit. Topics: identiteit verificatie, vormen van authenticatie, online toetsen, toetsfraude, TeSLA instrumenten voor authenticatie en verificatie van auteurschap.

  8. Hoe verloopt identiteit-verificatie van online studenten?

    NARCIS (Netherlands)

    Janssen, José

    2018-01-01

    Presentatie over identiteit verificatie van online studenten tijdens een werkbezoek van NUFFIC (https://www.nuffic.nl/) aan de Open Universiteit. Topics: identiteit verificatie, vormen van authenticatie, online toetsen, toetsfraude, TeSLA instrumenten voor authenticatie en verificatie van

  9. Van strijdtonelen en luchtkastelen. Gedachten en observaties over de rol van communicatie bij innovatie in het publieke domein

    NARCIS (Netherlands)

    Leeuwis, C.

    2003-01-01

    In een bewerkte versie van de inaugurele rede, die de auteur heeft uitgesproken bij de aanvaarding van het ambt van hoogleraar Communicatie en Innovatie Studies aan Wageningen Universiteit, volgt een schets van de veranderingen in het denken over communicatie

  10. Case note: Rb Amsterdam (Vzr.) (internet, onrechtmatige publicatie, portretrecht, privacy)

    NARCIS (Netherlands)

    Alberdingk Thijm, C.A.

    2008-01-01

    De Voorzieningenrechter te Amsterdam verbiedt vereniging van pedofielen Martijn foto's van kinderen van leden van de koninklijke familie te publiceren. Door het publiceren van die foto's wordt inbreuk gemaakt op het portretrecht van die kinderen en op de persoonlijke levenssfeer van die leden van de

  11. Extensivering van de begeleiding door het inzetten van peer- en self-assessment in IMTO

    NARCIS (Netherlands)

    Joosten-ten Brinke, Desirée

    2011-01-01

    Joosten-ten Brinke, D. (2011). Extensivering van de begeleiding door het inzetten van peer- en self-Assessment in IMTO. In E. Bakker, W. Giesbertz, J. von Grumbkow, & T. Houtmans (Red.), Ontwikkeling van de onderzoekscompetentie aan de Open Universiteit (pp. 121-128). Heerlen: Open universiteit.

  12. Van die Gasredakteur

    African Journals Online (AJOL)

    cherish and teach.'1. Die Fakulteit Geneeskunde van die Universiteit van die Oranje-Vrystaat het pragtig gegroei ge- durende die eerste 21 jaar van sy bestaan. Die entoesiasme, doelgerigtheid, harde werk en inisia- tiewe van 'n groot aantal persone was hiervoor verantwoordelik. 'If we see a bit more clearly than they, it is ...

  13. Milieukwaliteitsplan Regionaal Orgaan Amsterdam; hoofdlijnenrapport

    NARCIS (Netherlands)

    Borch, ter M.; Coenen, E.; Frederiks, N.; Haas, de W.; Harmsen, T.; Jonker, G.; Kersten, G.; Klundert, van de B.; Loeven, L.; Steinhaus, R.; Timmermans, W.; Tjallingii, S.; Veer, van 't K.; Vink, S.; Wiersinga, W.; Witte, T.

    1995-01-01

    Het Milieukwaliteitsplan van het Regionaal Orgaan Amsterdam (ROA) speelt in op de nieuwe bestuurlijke verhoudingen in het ROA-gebied. Het geeft geen vaste doelstellingen waaraan iedere gemeente moet voldoen, maar is een instrumenteel en faciliërend kader voor uitwisseling van kennis en ervaringen,

  14. Kwaliteit van geo-informatie in kabels en leidingen

    NARCIS (Netherlands)

    Oort, van P.A.J.

    2004-01-01

    Gebrekkige informatie over de ligging van kabels en leidingen leidt tot een verhoogde kans op beschadigingen. Een kosten-baten-analyse zou kunnen bijdragen aan het gerichter aanpakken van de oorzaken van schade. Een analyse vanuit Wageningen Universiteit (aio onderzoek)

  15. Becoming a Teacher Educator: De inductie van beginnende lerarenopleiders

    NARCIS (Netherlands)

    Van der Klink, Marcel

    2010-01-01

    Van der Klink, M. (2010, 12 November). Becoming a Teacher Educator: De inductie van beginnende lerarenopleiders. Presentatie gehouden op de studiedag van de Velon op de Universiteit Utrecht, Utrecht, Nederland.

  16. TCS Amsterdam Marathon 2014 : economische impact, tevredenheid, gezondheidseffecten

    NARCIS (Netherlands)

    Baart de la Faille-Deutekom, Marije; Verhoogt, Pieter

    Op zondag 19 oktober 2014 vond de 39ste editie plaats van de TCS Amsterdam Marathon. Met 44.100 deelnemers is het evenement uitgegroeid tot één van de grootste participatiesportevenementen van ons land. Dankzij het stadsparcours is de TCS Amsterdam Marathon voor zowel de deelnemers als de inwoners

  17. 'Mercator Sapiens' (De Wijze Koopman). Het wereldwijde onderzoek van Nicolaes Witsen (1641-1717), burgemeester en VOC-bewindhebber van Amsterdam

    NARCIS (Netherlands)

    Peters, Marion Hélène

    2008-01-01

    De waardigheid van een regent omvatte de verplichting om als magistraat voor het publieke welzijn verantwoordelijk te zijn. De Amsterdamse burgemeester Nicolaes Witsen (16411717) heeft deze opdracht serieus genomen. Vrijwel alle tijd die hem naast zijn bestuursfuncties restte, besteedde hij aan

  18. The Vision on Wind. Space for Wind Turbines in Amsterdam, Netherlands; De Windvisie. Ruimte voor windmolens in Amsterdam

    Energy Technology Data Exchange (ETDEWEB)

    Godschalk, M.; Jacobs, S.; Van der Linden, K.; Plomp, M.; Rijntjes, R.; Ruiter, R.; Ydema, G.; Zonderland, H.

    2012-07-15

    With drafting the 'Wind Vision' the city of Amsterdam takes the initiative to realize more windmills in Amsterdam. Amsterdam aims for an efficient, sustainable energy, which will also benefit the Amsterdam population economically. The 'Wind Vision' shows that there are enough opportunities to supply one third of the households in Amsterdam with renewable electricity [Dutch] Met de Windvisie neemt Amsterdam het initiatief om meer windmolens in Amsterdam te realiseren. Amsterdam streeft naar een efficiente, duurzame energieopwekking, waar Amsterdammers ook economisch van kunnen profiteren. De Windvisie laat zien dat er op dit moment in de stad kansen zijn om genoeg windmolens te realiseren om een derde van de Amsterdamse huishoudens van duurzaam opgewekte elektriciteit te voorzien.

  19. Conservering bij zoutschade; De Waag in Amsterdam

    NARCIS (Netherlands)

    Lubelli, B.A.; Hees, R.P.J. van

    2007-01-01

    In de Waag in Amsterdam bevinden zich enkele waardevolle meesterproeven van metselwerk. Deze hebben zwaar te lijden onder aantasting van zouten. Aan de auteurs werd gevraagd om de oorzaken van de scahde te onderzoeken en advies uit te brengen over mogelijke interventie om het verval aan te pakken.

  20. Onweerlegbaar Bewijs? Over het Belang en de Waarde van empirisch Onderzoek voor Financierings- en Beleggingsvraagstukken

    NARCIS (Netherlands)

    M.J.C.M. Verbeek (Marno)

    2002-01-01

    textabstractRede, in verkorte vorm uitgesproken bij de aanvaarding van het ambt van hoogleraar Ondernemingsfinanciering aan de Faculteit der Bedrijfskunde en de Faculteit der Economische Wetenschappen van de Erasmus Universiteit Rotterdam op vrijdag 21 juni 2002

  1. Environmental space management in the harbor of Amsterdam, Netherlands; Milieuruimtemanagement haven Amsterdam

    Energy Technology Data Exchange (ETDEWEB)

    Klok, L.; Hulskotte, J. [TNO Built Environment and Geosciences, Den Haag (Netherlands); Van Breemen, T. [Haven Amsterdam, Amsterdam (Netherlands)

    2012-02-15

    A new calculation tool will quickly offer the Harbor of Amsterdam insight in the effect of activities in the harbor on the air quality and hence the available environmental space. [Dutch] Een nieuw rekeninstrument geeft Haven Amsterdam snel inzicht in het effect van alle activiteiten in de haven op de luchtkwaliteit en daarmee in de beschikbare milieuruimte.

  2. Board and Deans of Amsterdam University, Netherlands

    CERN Document Server

    Patrice Loïez

    2001-01-01

    L. to r.: Dr Thomas Taylor, CERN IT Deputy Division Leader; Prof. Dymph C. van den Boom, Dean Faculty of Social and Behavioural Sciences, Professor in Empirical Thoretical Pedagogy; Prof. Jos Engelen, NIKHEF/University of Amsterdam, Dutch Delegate to the Scientific Policy Committee and Chairman of the LHC Committee; Prof. Jacob van der Gaag, Dean Faculty of Economic Science and Econometry, Professor in Developmenteconomy;Mr Jan van der Boon, CERN Director of Admnistration; Prof. Jan Robert Bausch, Dean Faculty of Dental Medicine, Professor in general Dentistry; Dr Sijbolt J. Noorda, President of the Board of the University of Amsterdam.

  3. De zin van het economische opnieuw beschouwd

    Directory of Open Access Journals (Sweden)

    T. P. van der Kooy

    1964-03-01

    Full Text Available In 1950 heb ik het hoogleraarschap in de economie aan de juridische faculteit der Vrije Universiteit te Amsterdam aanvaard m et een rede over de zin van het economische. Sinds- dien heeft dit centiaal m elhodologisch vraagstuk van de we- tenschap der economie mij ook verder bezig gehouden. Het is voor een economist een m oeilijk vraagstuk, om dat het tevens een wijsgerig vraagstuk is. Over het algemeen vindt de econo­ m ist daarover weinig in de filosofische liLeratuur. Dit is zeer begrijpelijk, w ant wijsgeren kunnen op zijn best m aar heel sum m ier kennis nem en van wat er in de vakw etenschappen omgaat, terw ijl zij, voor zover mij bekend, in den regel slechts weinig belangstelling voor de economie aan den dag leggen. Omgekeerd zijn econom islen m eestal niet bijzonder filosofisch aangelegd, en hebben zij de handen vol om de storm achtige ontwikkeling van liun eigen literatuur enigzins bij te houden afgezien nog van het l'eit dat zij in den regel vele praktischc beslom m eringen hebben, ten gevolge waarvan zij zich niet ongestoord aan de studie kunnen wijden. Van een behoorlijk sam enspel tussen filosolen en economislen komt over het ge- heel ook niet veel terecht. Wat de wijsgerige kant van m ijn overpeizingen betreft, ben ik dus door de nood gedwongen slechts am ateur. Ik kom daar gaarne voor uit, en ik ben steeds bereid te zwichten voor het beter oordeel der wijsgeren, m its ik dat kan vatten, en in m ijn eigen w erk daar iets mee uit kan richten. Men behoeft nog geen door de wol geverfd prag­ m atist of operationalist te zijn om te weten dat ieder werk zijn eigen eisen stelt.

  4. 'n Vertalende vakwoordeboek van politieke terme

    African Journals Online (AJOL)

    Buro van die WAT

    Political and Related Terminology in Southern African Languages (CEPTSA) in .... king van die Randse Afrikaanse Universiteit en is in sy Departement .... difaqane {displacement of population caused by wars — eg those by Shaka}.

  5. Het veranderende gezicht van reumatoïde artritis

    NARCIS (Netherlands)

    Helm-van, van der Mil A.H.M.

    2016-01-01

    Oratie uitgesproken door Prof.dr. A.H.M. Van der Helm-van Mil bij de aanvaarding van het ambt van hoogleraar op het gebied van Reumatologie, in het bijzonder Vroege Artritis aan de Universiteit Leiden op vrijdag 14 oktober 2016

  6. Liberia : van vrijheidsideaal naar verloren paradijs

    NARCIS (Netherlands)

    Kraaij, van der F.

    2013-01-01

    Als enthousiaste twintiger vertrekt de schrijver in de jaren zeventig van de vorige eeuw naar het West-Afrikaanse land Liberia. Hij gaat er les geven aan de Universiteit van Liberia. Onder zijn studenten bevinden zich latere ministers; een van zijn studenten ontpopt zich als een gevreesde warlord.

  7. Thijs van Vugt, Een arbeidersbuurt onder de rook van ‘De Sphinx’. Eeen sociaal-ruimtelijke geschiedenis van het Boschstraatkwartier-Oost te Maastricht, 1829-1904

    Directory of Open Access Journals (Sweden)

    Christianne Smit

    2015-12-01

    Full Text Available Thijs van Vugt, Een arbeidersbuurt onder de rook van ‘De Sphinx’. Een sociaal-ruimtelijke geschiedenis van het Boschstraatkwartier-Oost te Maastricht, 1829-1904 (Dissertatie Universiteit van Maastricht 2015; Maaslandse Monografieën 78; Hilversum: Verloren, 2015, 228 pp., isbn 978 90 8704 493 0.

  8. Interview met Leon Deben: van tegenstellingen leer je het meeste

    NARCIS (Netherlands)

    van Diepen, A.; Huisman, C.

    2008-01-01

    Wat in de jaren zeventig begonnen is als Sociologie van bouwen en wonen is uitgegroeid tot Stadssociologie. Leon Deben heeft het medeopgebouwd. Hij nam onlangs afscheid van de universiteit met een rede over de openbare ruimte. "Het centrale bestuur van de stad is druk met de waan van de dag en dan

  9. Biologische reiniging van baggerspecie op de landfarm Kreekraksluizen; monitoring 2001

    NARCIS (Netherlands)

    Harmsen, J.; Toorn, van den A.; Dijk-Hooyer, van O.M.; Zweers, A.J.; Bouwman, L.A.; Ma, W.C.; Bodt, J.M.

    2002-01-01

    De monitoring betreft de afbraak van PAK, minerale olie; en het gedrag van zware metalen. De species zijn afkomstig van de Geulhaven (Rotterdam), de havens van Wemeldinge en Zierikzee, de Petroleumhaven (Amsterdam)

  10. Solar vision Amsterdam. Citizens and businesses go for the sun; Zonvisie Amsterdam. Burgers en bedrijven gaan voor de zon

    Energy Technology Data Exchange (ETDEWEB)

    Stam, T.; Diependaal, F.; Van ' t Hull, C.

    2013-06-15

    In the Solar Vision it is explained how the Amsterdam municipality plans to enable its citizens and businesses to realize their own solar energy project. The Solar Vision is prepared based on input from residents, businesses and institutions [Dutch] In de zonvisie staat hoe de gemeente Amsterdam haar burgers en bedrijven in staat wil stellen om hun eigen zonne-energieproject te realiseren. De zonvisie is mede opgesteld op basis van input van bewoners, bedrijven en instellingen.

  11. “As jou broer verkeerd opgetree het teen jou ...”: Enkele aspekte van ...

    African Journals Online (AJOL)

    p1243322

    teen jou ...”: Enkele aspekte van kerklike dissipline uit die Kerkorde van die Nederduitsch Hervormde. Kerk van Afrika. B J (Barry) van Wyk. Hervormde Teologiese Kollege. Universiteit van Pretoria. Abstract. “If a brother sins against you ...”: Certain aspects of church discipline from the Church Ordinance of the. Netherdutch ...

  12. CO2 footprint 2008 District Oud-Zuid, Amsterdam, Netherlands; CO2-voetafdruk 2008 Stadsdeel Oud-Zuid [Amsterdam

    Energy Technology Data Exchange (ETDEWEB)

    Hanekamp, E; Van Merksteijn, C [Partners for Innovation, Amsterdam (Netherlands)

    2009-06-15

    The district 'Oud-Zuid' in Amsterdam, Netherlands, plans to become CO2 neutral in 2015. For this purpose, the CO2 footprint of the district is determined and a plan of action developed. By means of scenarios, the district council can make choices for climate investments [Dutch] Stadsdeel Oud-Zuid van de gemeente Amsterdam wil CO2-neutraal zijn in 2015. Daartoe is de CO2-voetafdruk van Oud-Zuid bepaald en een plan van aanpak uitgewerkt. Met behulp van scenario's zal de stadsdeelraad keuzes kunnen maken over haar klimaatinvesteringen.

  13. De keuze van Vincent

    NARCIS (Netherlands)

    Stolwijk, Chris

    2003-01-01

    Official publication to accompany the important exhibition Vincent's Choice, Van Gogh's 'musee imaginaire' at the Van Gogh Museum, Amsterdam marking the 150th anniversary of the artist's birth.Thanks to van Gogh's correspondence, it has been possible to identify the works he knew and admired. The

  14. Verkeersveiligheidseffecten van het Haagse verkeerscirculatieplan. In opdracht van Universiteit Utrecht, Institute for Risk Assessment Sciences.

    NARCIS (Netherlands)

    Reurings, M.C.B.

    2010-01-01

    The Hague municipality's traffic circulation plan: its road safety effects. The purpose of the European 6th framework project INTARESE is to develop a methodology for assessing the health risks of policy options. One of the policy areas for which some case studies will be performed is traffic and

  15. Die pastorale begeleiding van predikante van die Nederduitse ...

    African Journals Online (AJOL)

    21 Jan 2013 ... Stone, M.F., 1999, Coaching, counselling & mentoring: How to choose & use the right technique to boost employee performance, AMACOM, New York. Strydom, W.A., 2011, 'Pastoraat aan getraumatiseerde kinders in die intensiewesorgeenheid: 'n Gestalt benadering', DD tesis, Universiteit van Suid-. Afrika ...

  16. Zorg voor natuur in de eeuw van de consument

    NARCIS (Netherlands)

    Koppen, van C.S.A.

    2005-01-01

    Rede uitgesproken bij de aanvaarding van het ambt van bijzonder hoogleraar Natuur- en milieueducatie aan de Universiteit Utrecht op 24 februari 2005. Het doel van deze oratie is om op een andere, meer sociologische wijze verband te leggen tussen NME en consumptie. Consumptie geldt dan als een

  17. Training in ontwerpen: opzet en evaluatie van het vak ontwerpmethoden [Training in Design. Outline and Evaluation of the Course Design Methods

    NARCIS (Netherlands)

    Joosten, S.M.M.; van den Berg, Klaas; Weenk, W.

    1993-01-01

    De opzet van het tweedejaarsvak Ontwerpmethoden verschilt nogal van de gebruikelijke opzet van vakken in de informatica-opleiding van de Universiteit Twente. Het strak geplande vak is gericht op integratie van bestaande voorkennis en leidt tot veel activiteit van studenten, zowel in kliene groepen

  18. Johannes Maccovius (1588-1644) zijn bijdrage aan de ontwikkeling van de gereformeerde theologie van de zeventiende eeuw

    NARCIS (Netherlands)

    Asselt, W.J. van

    2006-01-01

    In de kerkelijke geschiedschrijving behoort Jan Makowsky (1588-1644) bepaald niet tot de categorie van auteurs die op enigerlei sympathie kunnen rekenen(1). Deze Poolse aristocraat en zwager van Rembrandt(2), die bijna dertig jaar lang theologie en filosofie doceerde aan de universiteit van

  19. El Plan General de Amsterdam. A.U.P (II

    Directory of Open Access Journals (Sweden)

    Helma Hellinga

    1998-07-01

    Full Text Available El presente texto corresponde a la segunda parte del artículo "Het Algemeen Uitbreidingsplan van Amsterdam"publicado originalmente en el volumen Het Nieuwe Bouwen, Amsterdam 1920-1960, y cuya parte correspondiente a lo relativo a acontecimientos anteriores a la Segunda Guerra Mundial se presentó traducida en Cuaderno de Notas 5. Por consiguiente, en esta segunda entrega se recogen los desarrollos de los nuevos barrios o partir del final de la guerra hasta aproximadamente 1960

  20. Die identifisering van maatstawwe vir die navorsingsprestasie van akademici

    Directory of Open Access Journals (Sweden)

    H. A. Labuschagne

    1990-06-01

    Full Text Available Identification of criteria for academic research performance. At South African universities, the achievement of objectives is usually measured in terms of so-called "process criteria" (e.g. pass rates, instead of performance criteria which reflect the quality of academic personnel. Stimulated by the need to identify valid indices of research performance, as a component of academic performance, this study investigated the dimensionality of several criteria, identified from empirical and literature studies. It was found that various valid criteria could be represented by six constructs, viz.: the stature of the researcher as scientist; scientific contributions; enhancement of own profession; community development; participation in research projects; and giving advice to persons or institutions outside the university. Opsomming By Suid-Afrikaanse universiteite word doelwitbereiking gewoonlik aan die hand van sogenaamde "prosesmaat-stawwe" (bv. slaagsyfers in plaas van prestasiemaatstawwe wat die gehalte van akademiese personeel weerspieel, gemeet. Na aanleiding van 'n behoefte aan die identifisering van geldige rigtingwysers vir navorsingsprestasie as 'n komponent van akademiese prestasie, is daar ondersoek ingestel na die dimensionaliteit van verskillende maatstawwe wat vooraf deur middel van empiriese- en literatuurstudies geidentifiseer is. Daar is gevind dat verskeie geldige maatstawwe deur ses konstrukte verteenwoordig word, te wete: die statuur van die navorser as wetenskaplike, wetenskaplike bydraes, uitbouing van eie professie, gemeenskapsontwikkeling, deelname aan navorsingsprojekte en advieslewering aan persone of instellings buite die Universiteit.

  1. De eeuw van de Beeldenstorm

    Directory of Open Access Journals (Sweden)

    F. Postma

    1988-01-01

    Full Text Available P. van Boheemen, N.P.J. van der Lof, E. van Meurs, Het boek in Nederland in de 16e eeuw S. Groenveld, Ketters en papen onder Filips II. Het godsdienstig leven in de tweede helft van de zestiende eeuw R. Kistemaker, M. Jonker, De smaak van de elite. Amsterdam in de eeuw van de Beeldenstorm W.Th. Kloek, Kunst voor de Beeldenstorm. Noord-Nederlandse kunst ca 1525-1580, [I], Inleiding, [II, Catalogus] J.R. ter Molen, A.P.E. Ruempol, A.G.A. Dongen, Huisraad van een molenaarsweduwe. Gebruiksvoorwerpen uit een 16e eeuwse boedelinventaris M. de Roever, B. Bakker, Woelige tijden. Amsterdam in de eeuw van de Beeldenstorm I.M. Veldman, Leerrijke reeksen van Maarten van Heemskerck

  2. Case-mix classificatie als basis voor bekostiging van wijkverpleging : Een verkennend onderzoek in opdracht van MeanderGroep Zuid-Limburg

    NARCIS (Netherlands)

    Elissen, Arianne; Metzelthin, Silke; van den Bulck, Anne; Verbeek, Hilde; Ruwaard, Dirk

    2017-01-01

    n opdracht van MeanderGroep Zuid‐Limburg is tussen mei 2016 en april 2017 door de Universiteit Maastricht een verkennend onderzoek uitgevoerd naar de relatie tussen cliëntkenmerken en het gebruik en de kosten van wijkverpleging. Doel is om een bijdrage te leveren aan de ontwikkeling van een nieuwe

  3. Community of Learners (2): samen met vakcollega's op zoek naar een betere introductie van telproblemen

    NARCIS (Netherlands)

    Timmer, Mark

    2014-01-01

    Sinds het schooljaar 2009-2010 wordt er op de Universiteit Twente in de vorm van een "Community of Learners" (CoL) gewerkt aan verbetering van het wiskundeonderwijs. Aan de hand van verscheidene praktijkonderzoeken is reeds duidelijk geworden dat we veel kunnen leren door gezamenlijk één of twee

  4. Incidentie van baarmoederhalskanker naar geboorteland bij vrouwen in Noord-Holland in 1988-1998 [Incidence of cervical cancer in women in North-Holland by country of birth from 1988-1998

    NARCIS (Netherlands)

    Visser, O.; Busquet, E.H.; Leeuwen, F.E. van; Aaronson, N.K.; Öry, F.G.

    2003-01-01

    Doel. Beschrijven van de incidentie van baarmoederhalskanker bij vrouwen in Noord-Holland naar geboorteland. Opzet. Beschrijvend epidemiologisch onderzoek op basis van kankerregistratiegegevens. Methode. Met behulp van de regionale kankerregistratie van het Integraal Kankercentrum Amsterdam (IKA)

  5. Agrocentre Amsterdam. Design for agroparks in harbor areas; Agrocentrum Amsterdam. Ontwerpen voor agroparken in havengebieden

    Energy Technology Data Exchange (ETDEWEB)

    Broeze, J. [Agrotechnology en Food Innovations, Wageningen UR, Wageningen (Netherlands); Van Steekelenburg, M.G.N.; Smeets, P.J.A.M. [Alterra, Wageningen UR, Wageningen (Netherlands)

    2006-05-15

    A number of concepts for an Agropark in the Port of Amsterdam is discussed. Several variants are developed that differ in scale and functional combinations. The core of the agrocenter is to set up an energy chain with pig farming, horticulture, animal feed production, manure processing and biogas production. Mushroom cultivation and fisheries are also options [Dutch] Een aantal ontwerpen voor een Agropark in de Amsterdamse Haven wordt besproken. Verschillende varianten worden uitgewerkt die verschillen in schaalgrootte en functiecombinaties. Kern van het agrocentrum is het opzetten van een energieketen met varkenshouderij, glastuinbouw, veevoerproductie, mestverwerking en biogasproductie. Ook champignonteelt en viskweek zijn opties.

  6. Polychaeten aus den Zoologischen Museen von Leiden und Amsterdam I

    NARCIS (Netherlands)

    Augener, H.

    1933-01-01

    In der vorliegenden Arbeit ist die Untersuchung eines sehr umfangreichen Polychaeten-Materials niedergelegt, das mir von Herrn Prof. Dr. E. D. van Oort in Leiden und Herrn Prof. Dr. L. F. de Beaufort in Amsterdam zur Bearbeitung übergeben wurde. Von diesem Material ist der dem Museum in Leiden

  7. Civic crowdfunding is niet alleen een speeltje van zelfredzame burgers

    NARCIS (Netherlands)

    de Graaf, Frank Jan; Bakker, Ezrah

    2017-01-01

    De opkomst van civic crowdfunding biedt mogelijkheden voor gemeentelijke overheden die burgerinitiatieven willen stimuleren. Maar slaat civic crowdfunding vooral aan bij een beperkte groep relatief hoogopgeleide burgers? De Hogeschool van Amsterdam onderzoekt dit.

  8. Die Fakulteit Teologie (Afd A) aan die Universiteit van Pretoria; Vrae ...

    African Journals Online (AJOL)

    definition is called for and some relevant issues are indicated; an honest evaluation in respect of the political and social context which is reflected in positions adopted, a pastoral compassion which takes note of human misery, cognisance of the

  9. Die sentrale openbaring in die Ou Testament en die Christelike grondslag van die Potchefstroomse Universiteit

    Directory of Open Access Journals (Sweden)

    F.N. Lion-Cachet

    1995-03-01

    Full Text Available The central revelation in the Old Testament and the Christian foundation of the Potchefstoom University. The PU for CHE acknowledges the revelation of God in creation and his Word as its foundation. The issue concerning the focus of the revelation in Scripture is answered in different ways. Looking at the Old Testament from a revelatory-cognitive approach, the LORD’S own disclosure as “I am who I am” (Exodus 3:14 may be a meaningful response. The concept “I am who I am” has a incomprehensible as well as a comprehensible meaning which reveals our knowledge of the LORD in a great diversity (He is God, the Creator, the Saviour, the Holy One, etc.. In addition, Christ proclaimed Himself in the New Testament as "I am ... ”. This central concept opens up the opportunity for a Christian university to do scientific work with the full reality of creation as its object.

  10. The Amsterdam proton microbeam

    International Nuclear Information System (INIS)

    Bos, A.J.J.

    1984-01-01

    The aim of the work presented in this thesis is to develop a microbeam setup such that small beam spot sizes can be produced routinely, and to investigate the capabilities of the setup for micro-PIXE analysis. The development and performance of the Amsterdam proton microbeam setup are described. The capabilities of the setup for micro-PIXE are shown with an investigation into the presence of trace elements in human hair. (Auth.)

  11. Clinical highlights from Amsterdam

    Directory of Open Access Journals (Sweden)

    Jouke T. Annema

    2016-07-01

    Full Text Available This article contains highlights and a selection of the scientific advances from the Clinical Assembly that were presented at the 2015 European Respiratory Society International Congress in Amsterdam, the Netherlands. The most relevant topics for clinicians will be discussed, covering a wide range of areas including interventional pulmonology, rehabilitation and chronic care, thoracic imaging, diffuse and parenchymal lung diseases, and general practice and primary care. In this comprehensive review, exciting novel data will be discussed and put into perspective.

  12. Quickscan QTI addendum #1 - Usability study of QTI for De Digitale Universiteit

    NARCIS (Netherlands)

    dr. Pierre Gorissen

    2003-01-01

    De Digitale Universiteit (DU) performed a quickscan to determine the usability of the IMS Question and TestInteroperability (QTI) specification as a format to store questions and tests developed for and by the consortium. The original report is available in Dutch from the website of De Digitale

  13. HIV-surveys bij hoog-risicogroepen in Amsterdam 2003-2004

    NARCIS (Netherlands)

    van Veen MG; Wagemans MAJ; Op de Coul ELM; Fennema JSA; van der Helm TCM; Walter J; Prins M; van de Laar MJW; CIE

    2006-01-01

    Hoog-risicogroepen kunnen een brugfunctie vervullen voor de verspreiding van HIV en SOA naar de rest van de bevolking in Nederland. Dit blijkt uit de HIV-survey onder migranten en prostituees en hun klanten die is uitgevoerd in Amsterdam. Hierbij is gevonden dat de HIV-prevalentie onder

  14. Peter van Dam, James Kennedy, Friso Wielenga (eds., Achter de zuilen. Op zoek naar religie in naoorlogs Nederland

    Directory of Open Access Journals (Sweden)

    Kim Christiaens

    2016-04-01

    Full Text Available Peter van Dam, James Kennedy, Friso Wielenga (eds., Achter de zuilen. Op zoek naar religie in naoorlogs Nederland (Amsterdam: Amsterdam University Press, 2014, 456 pp., isbn 978 90 8964 680 4. 

  15. van den Heuvel, Prof. Edward P J

    Indian Academy of Sciences (India)

    van den Heuvel, Prof. Edward P J . Date of birth: 2 November 1940. Address: Professor of Astrophysics, Astronomical Inst. Anton Pannekoek, Postbus 94249, 1090 GE Amsterdam, The Netherlands Contact: Office: (+31-20) 525 ...

  16. Psalm 98: Sing 'n nuwe lied tot lof van die Koning, Jahwe

    African Journals Online (AJOL)

    Psalm 98: Sing 'n nuwe lied tot lof van die Koning, Jahwe. W S Prinsloo. Universiteit van Pretoria. Abstract. Sing a new song in praise of the king, Yahweh. This article surveys the problems of interpreting Psalm. 98. The chief problems are those concerned with determining the Gattung, the redactional history, strophic ...

  17. Afscheid van de stapelmarkt

    Directory of Open Access Journals (Sweden)

    J.W. Veluwenkamp

    2003-01-01

    Full Text Available C. Lesger, Handel in Amsterdam ten tijde van de Opstand. Kooplieden, commerciële expansie en verandering in de ruimtelijke economie van de Nederlanden ca. 1550-ca. 1630 Farewell to the Staple Market, Jan Willem VeluwenkampLesger argues that Amsterdam's essential function in international trade in the seventeenth century was turnover promotion through price stabilisation. Claiming that the relevant mechanism involved information provision rather than stockpiling, he convincingly bids farewell to the historiographical tradition of the Amsterdam staple market and introduces Amsterdamas the centre of information provision. I contest two aspects of Lesger's argument. Unlike him, I do not think that information provision was decisive in Amsterdam's commercial expansion around 1600: Prior to 1585, information exchange and expansion were characteristic for Antwerp too. The Amsterdam acceleration essentially involved the penetration of Asia and the Atlantic area, which was mainly provoked by the war. In addition, I think that Lesger underestimates the Dutch intermediate trade. On the one hand, Dutch industry-related import and export were more significant than he indicates. On the other hand, he attaches too little meaning to the fact that Dutchmen dominated international commerce even when they did not steer all commodity flows via the Dutch Republic.

  18. Beeldenstorm 3 : Close-ups van kunst uit Nederlandse musea

    NARCIS (Netherlands)

    Os, van Henk; Tromp, Thijs; ; Middag, Ineke

    2003-01-01

    Na het succes van de vorige twee delen in de reeks Beeldenstorm presenteert Amsterdam University Press deze zomer een nieuwe collectie pakkende en heldere beschouwingen van Henk van Os over kunstvoorwerpen uit Nederlandse musea. Opnieuw zijn Van Os' aansprekende televisiecolumns gebundeld tot

  19. Door de ogen van de ander kijken: kunst als veranderkracht

    NARCIS (Netherlands)

    Smilde, Rineke

    2015-01-01

    Presentie gehouden bij een besloten expert meeting van de KNAW en de Boekmanstichting in Amsterdam. Door de ogen van de ander kijken: kunst als veranderkracht. Ik maak graag van de gelegenheid gebruik om iets te vertellen vanuit mijn werk als lector aan het PCC van de Hanzehogeschool Groningen.

  20. Caissons voor het dichten van dijken in Zeeland 1953

    NARCIS (Netherlands)

    Verhagen, H.J.

    1953-01-01

    Foto's van caissons voor het dichten van dijken in Zeeland in 1953. Geleverd werden 493 caissons en 203 manchetten door een combinatie van: • N.V. Amsterdamsche Ballast maatschappij, Amsterdam • Christiani en Nielsen N.V., ’s Gravenhage • N.V. van Hattum en Blankevoort, Beverwijk • Hollandsche Beton

  1. Hoe maak je gebruik van tablets voor leren?

    NARCIS (Netherlands)

    Kalz, Marco; Kluijfhout, Eric; Börner, Dirk; Tabuenca, Bernardo; Kester, Liesbeth; Wolff, Charlotte; Bahreini, Kiavash; Gijselaers, Jérôme; Andeweg, Cisca; De Vries, Fred; Berkhout, Jeroen; Storm, Jeroen

    2012-01-01

    Kalz, M., Kluijfhout, E., Börner, D., Tabuenca, B., Kester, L., Wolff, C., Bahreini, K., Gijselaers. J., De Vries, F., Andeweg, C., Berkhout, J., & Storm, J. (2012, 28 September). Hoe maak je gebruik van tablets voor leren? Masterclass in de OpenU community. Open Universiteit, Heerlen, Nederland.

  2. die relevansie van taalwetenskap in spraak- en taal terapie

    African Journals Online (AJOL)

    Ondene van Dulm

    Departement Spraak-Taal-Gehoorterapie, Universiteit. Stellenbosch. Buitendag, M.M. 1993. Afrikaanse Reseptiewe Woordeskattoets. Raad vir. Geesteswetenskaplike Navorsing. Bus, A.G. and M.H. van Ijzendoorn. 1997. Affective dimension of mother-infant picturebook reading. Journal of School Psychology 35(1): 47-60.

  3. De kloof tussen wetenschap en praktijk dichten Carel hulshof

    NARCIS (Netherlands)

    Putten, D. van

    2011-01-01

    Carel Hulshof is per 1 mei 2011 benoemd tot bijzonder hoogleraar Arbeids- en Bedrijfsgeneeskunde aan de Universiteit van Amsterdam bij het Coronel Instituut voor Arbeid en Gezondheid van het Academisch Medisch Centrum.

  4. Graad 12-punte as voorspeller van sukses in wiskunde by 'n universiteit van tegnologie / I.D. Mulder

    OpenAIRE

    Mulder, Isabella Dorothea

    2011-01-01

    Problems with students’ performance in Mathematics at tertiary level are common in South Africa − as it is worldwide. Pass rates at the university of technology where the researcher is a lecturer, are only about 50%. At many universities it has become common practice to refer students who do not have a reasonable chance to succeed at university level, for additional support to try to rectify this situation. However, the question is which students need such support? Because the Grade 12 marks ...

  5. Walter van der Cruijsen / Walter van der Cruijsen ; interv. Tilman Baumgärtel

    Index Scriptorium Estoniae

    Cruijsen, Walter van der

    2006-01-01

    1997. a. Berliinis tehtud intervjuu hollandi maali, võrgu- ja installatsioonikunstniku Walter van der Cruijseniga (sünd. 1958), kes kuulub Euroopa ühe edukama 1990-ndatel loodud võrguprojekti De Digitale Stad Amsterdam loojate hulka

  6. Diverse artikelen in Gay Amsterdam News

    NARCIS (Netherlands)

    Hekma, G.

    2002-01-01

    Vernedering, in: Gay Amsterdam News 125 (jan 2002), pp. 20-21; Webseks, zaad, zweetseks, in: Gay Amsterdam News 126 (feb 2002), pp. 30-31; Wurgseks, in: Gay Amsterdam News 127 (mrt 2002), pp. 30-31; Wijnandus Johannes Sengers (1927-2002), in: Gay Amsterdam News 133 (sept 2002), pp. 49.

  7. Twee afdelings van een fakulteit 1934−1940

    Directory of Open Access Journals (Sweden)

    J.P. Oberholzer

    2010-09-01

    Full Text Available Die Universiteit benoem op voordrag van die Nederduitsch Hervormde of Gereformeerde Kerk vir dominee G.M. Pellisier in die pos Godsdienswetenskap wat deur die bedanking van professor Macmillan vakant gelaat is. Dit word die begin van ‘n ontwikkeling van twee feitlik selfstandige afdelings binne die Fakulteit Teologie. Die toetrede van H.P. Wolmarans as vierde dosent vanweë die Nederduitsch Hervormde Kerk bring nuwe teologiese aksente. Die verhouding tussen die Nederduitsch Hervormde Kerk en die Universiteit kry beslag in ‘n skriftelike kontrak. In 1937 word dit gevolg deur ‘n tweede kontrak waarin die ruimte geskep word vir die bestaan van twee fakulteitsafdelings. Vanaf 1938 funksioneer die twee afdelings naas mekaar met gelykluidende kontrakte. Hierdie kroniek volg dan verder die gang van Afdeling A, die afdeling beman deur ampsdraers van die Nederduitsch Hervormde Kerk. Die benoeming as lektore van A. van Selms in 1938 en C.H. Rautenbach in 1939 verhoog die akademiese kwaliteit van die afdeling verder.

  8. Een analyse van de mogelijke gevolgen van de aanleg van IJburg tweede fase voor watervogels in de SBZ IJmeer

    NARCIS (Netherlands)

    Schekkerman, H.; Eerden, van M.E.; Rijn, van S.; Roos, M.

    2006-01-01

    De gemeente Amsterdam heeft vergevorderde plannen om in het IJmeer, grenzend aan het Vogelrichtlijngebied (SBZ, Natura 2000 gebied) IJmeer, de tweede fase van de wijk IJburg te realiseren. In dit rapport wordt (1) beschreven welke specifieke waarden van het IJmeer volgens de Vogelrichtlijn dienen te

  9. Interview Vincent de Waal over zijn proefschrift: De vooruitgeschoven middenvelder. De innovatiekracht van middenmanagers van welzijnsorganisaties met het oog op actief burgerschap

    NARCIS (Netherlands)

    Vincent de Waal; Eveline Bolt

    2015-01-01

    Vincent de Waal (1951) promoveerde in 2014 aan de Universiteit voor Humanistiek. Hij is werkzaam als docent- onderzoeker bij Hogeschool Utrecht (HU), Instituut Social Work. Sinds 2002 is hij onderzoeker binnen het Kenniscentrum Sociale Innovatie van de HU en vanaf 2012 betrokken bij de

  10. El Plan General de Amsterdam. A.U.P (I

    Directory of Open Access Journals (Sweden)

    Helma Hellinga

    1997-07-01

    Full Text Available El siguiente texto fue publicado en el volumen Het Nieuwe Bouwen, Amsterdam 1920-1960, Stedelijk Museum-Delft University Press, 1983, pp. 52-111 con el título original "Het Algemeen Uitbreidinsplan van Amsterdam" y es una exposición ampliamente documentada de los antecedentes inmediatos y el desarrollo del Plan General de 1935. La traducción que aquí se ofrece de este largo artículo es solamente parcial, incluyendo exclusivamente lo que corresponde hasta la Segunda Guerra Mundial. Por consiguiente, no se recoge su parte final relativa a la realización efectiva del Plan en los años de posguerra y en las décadas siguientes. Aparte de esta exclusión principal, se han eliminado algunos pasajes intermedios de cierta redundancia a fin de adaptarlo a un formato más reducido.

  11. Digital Amsterdam : Digital Art and Public Space in Amsterdam

    NARCIS (Netherlands)

    Cnossen, Boukje; Franssen, Thomas; De Wilde, Mandy

    2015-01-01

    In this report we explore digital art interventions in public space in Amsterdam as part of the ‘participatory public space’ project lead by the University of Melbourne. We focus specifically on artistic interventions in public space, rather than on the more general ways in which public space is

  12. David van der Linden, Experiencing Exile: Huguenot Refugees in the Dutch Republic 1680-1700

    Directory of Open Access Journals (Sweden)

    Matthew Glozier

    2016-04-01

    Full Text Available David van der Linden, Experiencing Exile: Huguenot Refugees in the Dutch Republic 1680-1700 (PhD Universiteit Utrecht 2013; Politics and Culture in Europe, 1650-1750; Farnham: Ashgate, 2015, xx + 289 pp., ISBN 978 14 7242 927 8.

  13. Op het grensvlak van chemie en biotechnologie (interview met Harry Bitter)

    NARCIS (Netherlands)

    Gool, van J.; Bitter, J.H.

    2015-01-01

    Harry Bitter, sinds twee jaar hoogleraar Biobased Chemistry & Technology aan de Wageningen Universiteit, pleit voor meer chemie en katalyse in het onderzoek naar biobased producten. ‘Mijn onderzoeksfocus ligt op hoe je de omzettingen van biomassa naar product zo optimaal mogelijk kunt uitvoeren.

  14. Heeft de teelt van quinoa een toekomst in België? : Interview met Ruud Timmer

    NARCIS (Netherlands)

    Cillen, L.; Timmer, R.D.

    2014-01-01

    Quinoa (Chenopodium quinoa) is een gewas dat al eeuwenlang in Zuid-Amerika wordt geteeld en gegeten en tegenwoordig aan populariteit wint bij de Europese consument. Maar is het mogelijk om dit gewas ook in België te telen? We vroegen aan Ruud Timmer, onderzoeker aan de Universiteit van Wageningen,

  15. Die verhouding tussen vertroue en diversiteitsklimaat by 'n Suid-Afrikaanse universiteit

    OpenAIRE

    McCallaghan, Sean; Heyns, Marita

    2016-01-01

    Hierdie studie stel ondersoek in na die verwantskap tussen vertroue en die diversiteitsklimaat binne 'n Suid-Afrikaanse tersiêre inrigting. 'n Kwantitatiewe benadering met behulp van 'n nie-waarskynlikheidsgerieflikheidsteekproef (N=350) is gevolg. Die vraelys wat in die studie gebruik is, maak gebruik van 'n kombinasie van drie vooraf-gevalideerde instrumente. Die resultate dui aan dat die werknemers saamstem dat die instelling bereid is tot diversiteitsbestuur en die uitskakeling van diskri...

  16. Bloedzuigers in pluimveestallen

    NARCIS (Netherlands)

    Mul, M.F.; Mullens, B.A.; Koenraadt, C.J.M.

    2009-01-01

    Wageningen UR en Universiteit Amsterdam werken aan mogelijke maatregelen tegen de vogelmijt, Dermanyssus gallinae, in Nederlandse legpluimveestallen. Ook is uitbreiding van een ander vogelmijt-type gesignaleerd: de noordelijke vogelmijt, of Ornithonyssus sylviarum

  17. Tenigblikke op die Fakulteit Teologie (Afd A, Universiteit van Pretoria, en sy lede - ’n literatuurverkenning

    Directory of Open Access Journals (Sweden)

    J. P. Oberholzer

    1992-01-01

    Full Text Available Retrospection on the Faculty of Theology (Sec A, University of Pretoria, and its members - a survey of literature A short, selective survey of literature on the motives for the founding of the Faculty of Theology (Sec A, University of Pretoria, and its history is given. Special attention is given to the typification of the theology of Faculty members by recent writers.

  18. Die Fakulteit Teologie (Afd A aan die Universiteit van Pretoria: Vrae oor sy identiteit en sy problematiek

    Directory of Open Access Journals (Sweden)

    J. P. Oberholzer

    1992-01-01

    Full Text Available The Faculty of Theology (Sec A at the University of Pretoria: Inquiry into its identity and problem areas This article is a short survey of theological viewpoints on the character and task of the church, as reflected in church literature during the past 75 years. It is shown that political history after World War II had a marked effect on thinking in the Nederduitsch Hervormde Kerk and that recent changes on the political scene pose penetrating questions to theologians. A full inquiry into the contours of self-definition is called for and some relevant issues are indicated; an honest evaluation in respect of the political and social context which is reflected in positions adopted, a pastoral compassion which takes note of human misery, cognisance of the ecumenical character of the church, and ethical and academic responsibility.

  19. MijnOU.nl (proef met een sociale netwerkdienst binnen de Open Universiteit)

    NARCIS (Netherlands)

    Eshuis, Jannes; Hermans, Henry

    2010-01-01

    Doel van het project Mijnou.nl Het ideaal van een volledig gepersonaliseerd startportaal, waarin studenten via een Single Sign On (SSO) toegang vinden tot al het leermateriaal waarop zij rechten hebben verworven, relevante informatie vinden over activiteiten op studiecentra, contacten kunnen

  20. Doorbraakinnovaties en ‘omgekeerde’ technologiebeoordeling: het geval van deeleconomie

    NARCIS (Netherlands)

    Frenken, Koen|info:eu-repo/dai/nl/207145253

    2016-01-01

    Dit artikel gaat over de wijze waarop de gemeente Amsterdam is omgegaan met de opkomst van het huizendeelplatform Airbnb. In samenwerking met Airbnb zijn regels opgesteld, die in de praktijk lastig te handhaven zijn zonder toegang tot gebruikersdata van Airbnb. Ook het wetenschappelijk onderzoek

  1. Eglon Hendrik van der Neer (1635/36 - 1703) : Zijn leven en werk

    NARCIS (Netherlands)

    Schavemaker, E.

    2009-01-01

    Eglon van der Neer. His Life and His Work In his own time Eglon van der Neer was highly successful. His acclaim endured throughout the eighteenth century. Nowadays he is rated as a second-rate master. Van der Neer was born in Amsterdam in 1635 or 1636 as the son of the now more famous landscape

  2. SIC Industriemonitor najaar 2003

    NARCIS (Netherlands)

    Brouwer, N.; de Nooij, M.; Pomp, M.

    2003-01-01

    In juni 2000 publiceerde de Stichting voor Economisch Onderzoek (SEO) van de Universiteit van Amsterdam in opdracht van Stichting voor Industriebeleid en Communicatie (SIC) een ontwerp voor een SIC industriemonitor met een voorstel voor de inhoud en de structuur van een dergelijke monitor. Op dat

  3. Measuring drifted dust near coal transhipment in the harbour of Amsterdam, Netherlands; Meten aan verwaaiend stof bij kolenoverslag in het Amsterdams havengebied

    Energy Technology Data Exchange (ETDEWEB)

    Weijers, E.P.; Rodink, R.; Hensen, A. [ECN Environment and Energy Engineering, Petten (Netherlands)

    2013-02-15

    For two months, particulate matter measurements were performed at the Rietlanden coal terminal in the Africa harbour in Amsterdam. At eight places around the coal terminal particulate matter concentrations were measured with relatively simple (and relatively inexpensive) optical sensors (which have been further developed by ECN). The primary purpose of the measurement campaign was to determine the performance and robustness of the sensors 'in the field'. After the satisfactory performance, the feasibility of a monitoring c.q. alarm system were studied and an estimate was made of particulate matter emissions from the terminal with a dispersion model during the measurement period [Dutch] Gedurende twee maanden zijn bij de Rietlanden kolenterminal in de Afrikahaven te Amsterdam fijnstofmetingen uitgevoerd. Op een achttal plaatsen rondom het bedrijf zijn fijnstofconcentraties gemeten met relatief eenvoudige (en relatief goedkope) optische sensoren (die door ECN verder zijn ontwikkeld). In de eerste plaats had de meetcampagne ten doel de prestatie en robuustheid van de sensoren 'in het veld' vast te stellen. Na gebleken geschiktheid is de haalbaarheid van een monitoring- c.q. alarmeringssysteem bestudeerd en is de fijnstofemissie afkomstig van de terminal geschat voor de periode van de metingen met een verspreidingsmodel.

  4. Arnold Roosendaal, Digital Personae and Profiles in Law. Protecting Individuals’ Rights in Online Contexts [Bespreking van: Digital Personae and Profiles in Law

    NARCIS (Netherlands)

    Lodder, A.R.

    2014-01-01

    Op 21 mei 2013 verdedigde Arnold Roosendaal aan de Universiteit Tilburg zijn proefschrift Digital Personae and Profiles in Law, promotoren waren Ronald Leenes en Bert-Jaap Koops. In de openingszin wordt het belang van het proefschrift direct duidelijk: “Personal data is the new oil of the Internet

  5. Civic Crowdfunding-monitor: eerste schets van civic crowdfunding in Nederland : een schatkist aan informatie over slagingspercentages, succesfactoren en donateurs

    NARCIS (Netherlands)

    Bakker, Ezrah; de Graaf, Frank Jan

    2017-01-01

    Crowdfunding door burgers voor lokale maatschappelijke projecten neemt laatste jaren aanzienlijk toe. Hogeschool van Amsterdam deed er onderzoek naar en bundelde de uitkomsten in het eerste civic crowdfunding monitor.

  6. Het bevel 'persoonlijk verschijnen' en de last 'medebrenging' voor het aanhoren van een uitspraak in strafzaken. Naar aanleiding van Mohammed B

    NARCIS (Netherlands)

    van Laanen, F.

    2005-01-01

    Op 21 juli 2005 werd in de media bericht dat de Rechtbank Amsterdam de verdachte Mohammed B. zou dwingen tot het aanhoren van de uitspraak in de strafzaak die tegen hem werd gevoerd, onder meer betreffende de moord op Theo van Gogh. De verdachte was al eerder verplicht om te verschijnen bij het

  7. (1899–1902). Vincent Kuitenbrouwer. Amsterdam

    African Journals Online (AJOL)

    over de ontwikkelingen in Zuid-Afrika Ne- derland via Nederlands-Indië konden berei- ken. Het media-offensief van de Nederlandse pro-Boerorganisaties had dan ook wel iets weg van een guerrilla-oorlog, net als de strijd van de Boeren tegen het Britse leger. De kern van Kuitenbrouwers proefschrift bestaat uit drie delen.

  8. Die organisatoriese werking van Suid-Afrikaanse universiteite : 'n teoretiese en empiriese ondersoek na doelwitformulering, organisasiestruktuur en interne koördinasie by sekere Suid-Afrikaanse universiteite / Simon Geertsema

    OpenAIRE

    Geertsema, Simon

    1981-01-01

    The Aim of the Study - The study aims at describing the organizational functioning of certain South African Universities, mainly in terms of a) The processes of goal formulation, b) The structure of the universities, as well as the relationships between the main structural components, c) The nature of the communication and control processes in the Universities. By doing this the study could be of use in promoting a better understanding of the university as an organizat...

  9. Bestuur van die Nasionale Skoolvoedingsprogram in hulpbronarm skole in Limpopo – praktyk, suksesse en uitdagings

    Directory of Open Access Journals (Sweden)

    Eric Eberlein

    2013-02-01

    Full Text Available Hierdie studie stel ondersoek in na die wyse waarop die implementering van die Nasionale Skoolvoedingsprogram (NSVP bestuur word deur skoolhoofde in hulpbronarm laerskole in die Waterberg-distrik van die Limpopo-provinsie. Dit vorm deel van ’n groter gesamentlike studie van die Universiteit van Pretoria en Northeast Normal University (UP en NENU wat fokus op die stand van prinsipaalskap in beide stedelike en landelike omgewings in SuidAfrika en in China. Data vir hierdie kwalitatiewe studie is met behulp van onderhoude en waarneming verkry binne die raamwerk van die vier bestuursfunksies soos omskryf deur Van Deventer en Kruger: beplanning; organisasie; leiding en rigtinggewing; asook kontrole en evaluering. Die primêre bevinding van die studie is dat hoewel skoolhoofde bewus is van riglyne en praktyke vir die implementering van die NSVP wat deur die Departement van Basiese Onderwys voorgeskryf word, hulle byna volledig op ander rolspelers op skoolvlak staatmaak om die program te bestuur, sonder enige daaglikse betrokkenheid by die proses of enige erkenning van hul eie rol en verantwoordelikhede in hierdie verband.

  10. Institutionele repositories: UvA maakt onderzoek beter zichtbaar en toegankelijk

    NARCIS (Netherlands)

    Woutersen-Windhouwer, S.

    2009-01-01

    De UB Amsterdam (UvA) zet zich in om de onderzoeksresultaten van de universiteit toegankelijk te maken. Dat vergroot de impact van het onderzoek en de zichtbaarheid van de wetenschappers. Hiervoor heeft de UB een nieuwe werkwijze opgezet, waarbij ze de wetenschapppers actief benadert. En met succes:

  11. A newly designed 45 to 60 mer oligonucleotide Agilent platform microarray for global gene expression studies of Synechocystis PCC6803: example salt stress experiment

    NARCIS (Netherlands)

    Aguirre von Wobeser, E.; Huisman, J.; Ibelings, B.; Matthijs, H.C.P.; Matthijs, H.C.P.

    2005-01-01

    A newly designed 45 to 60 mer oligonucleotide Agilent platform microarray for global gene expression studies of Synechocystis PCC6803: example salt stress experiment Eneas Aguirre-von-Wobeser 1, Jef Huisman1, Bas Ibelings2 and Hans C.P. Matthijs1 1 Universiteit van Amsterdam, Amsterdam, The

  12. The upgraded Amsterdam nuclear microprobe

    International Nuclear Information System (INIS)

    Vis, R.D.; Kramer, J.L.A.M.; Tros, G.H.J.; Langevelde, F. van; Mars, L.

    1993-01-01

    The improvement of the facilities at our University consists of three phases. In phase 1, a 1.7 MV NEC tandem-Pelletron accelerator has been installed. The accelerator serves as injector for two beam lines, subsequently for macro- and micro-analysis. Moreover, an interconnection has been made with a beam line from our 400 kV high voltage Van de Graaff accelerator in order to enable injection of these very intense low energy beams in these two lines. Apart from new vacuum equipment and conventional beam steering and focussing elements, the experimental facilities are replaced from the cyclotron experimental hall to the newly organised experimental hall. In the phases 2 and 3, which are not yet completed, a second ion source for the Pelletron and a new or extended focussing unit for the microprobe will complete the overall operation. (orig.)

  13. Winkelen als bevrijding? Vrouwen en stedelijke ruimte in Amsterdam, 1863-1913

    Directory of Open Access Journals (Sweden)

    Jan Hein Furnée

    2015-06-01

    Full Text Available Shopping as Liberation?: Women and Urban Space in Amsterdam, 1863-1913In recent decades several historians have argued that the emergence of shopping as a leisure activity in the second half of the nineteenth century substantially enhanced women’s freedom of movement in public spaces and promoted female emancipation in general. Based on urban descriptions and digitised newspaper articles on nineteenth-century Amsterdam – on its main shopping street, the Kalverstraat, in particular – this article takes a more nuanced stance. Shopping as a leisure activity was older in origin than is often assumed and to some extent was a male activity as well. While shopping, ladies encountered numerous factors thathampered their spatial mobility, from road debris, pawing, mugging, the presence of prostitutes to ‘moral harassment’ over exploited shop girls. Indeed, a single feminist framed the right to shop and to visit restaurants in an explicit discourse of ‘liberation’. However, to argue that shopping promoted female emancipation in general would suggest a too linear and monolithic approach. In de afgelopen decennia hebben diverse historici betoogd dat de opkomst van het winkelen als vrijetijdsbesteding in de tweede helft van de negentiende eeuw de uithuizige bewegingsvrijheid van vrouwen uit de gegoede standen aanzienlijk heeft vergroot en hun emancipatie zo belangrijk heeft bevorderd. Op basis van stadsbeschrijvingen en gedigitaliseerde krantenartikelen over winkelen in Amsterdam – in de Kalverstraat in het bijzonder – neemt dit artikel enig gas terug. Het winkelen als vrijetijdsbesteding had een oudere oorsprong dan vaakis verondersteld en was tot op zekere hoogte ook een mannenzaak. Winkelende dames werden op verschillende manieren in hun ruimtelijke bewegingsvrijheid belemmerd: door straatvuil, handtastelijkheden, straatroof, de aanwezigheid van prostituees of ‘morele kwellingen’ over uitgebuite winkelmeisjes. Zeker, een enkele

  14. Organising smart city projects : lessons from Amsterdam

    NARCIS (Netherlands)

    van Winden, Willem; Oskam, Inge; van den Buuse, Daniel; Schrama, Wieke; van Dijck, Egbert-Jan

    2016-01-01

    We studied 12 smart city projects in Amsterdam, and –among other things- analysed their upscaling potential and dynamics. Here are some of our findings: First, upscaling comes in various forms: rollout, expansion and replication. In roll-out, a technology or solution that was successfully tested and

  15. 'Flying markets': activating public spaces in Amsterdam

    NARCIS (Netherlands)

    Janssens, F.; Sezer, C.

    2013-01-01

    Marketplaces can be used by city planners as urban development strategies because they have the potential to turn open spaces in the city into public space, thereby improving both the social and the spatial qualities of those spaces. In Amsterdam, however, marketplaces currently fail to activate

  16. Drug use trends in Amsterdam nightlife, 2013

    NARCIS (Netherlands)

    Wouters, M.; Nabben, T.; Benschop, A.; Korf, D.J.

    2014-01-01

    The established club scene in Amsterdam is being challenged. Bright young entrepreneurs are organising parties at alternative venues outside the city centre. In 2013, the key word is ‘rave’. The mounting numbers of students in the city are also affecting Amsterdam’s nightlife. Antenna monitors these

  17. Book review : Street Architecture: Work by Hans van der Heijden

    NARCIS (Netherlands)

    Jenniskens, D.P.H.

    The recently published book Street Architecture is the result of a collaboration between Karin Templin, currently pursuing a PhD in architecture at the University of Cambridge, and Hans van der Heijden, an Amsterdam-based architect of mainly urban renewal projects and residential architecture. The

  18. Aldo van Eyck's Playgrounds : Aesthetics, Affordances, and Creativity

    NARCIS (Netherlands)

    Withagen, Rob; Caljouw, Simone R.

    2017-01-01

    After World War II, the Dutch architect Aldo van Eyck developed hundreds of playgrounds in the city of Amsterdam. These public playgrounds were located in parks, squares, and derelict sites, and consisted of minimalistic aesthetic play equipment that was supposed to stimulate the creativity of

  19. 2. The Amsterdam Declaration on fungal nomenclature

    DEFF Research Database (Denmark)

    Hawksworth, David L.; Crous, Pedro W.; Redhead, Scott A.

    2011-01-01

    The Amsterdam Declaration on Fungal Nomenclature was agreed at an international symposium convened in Amsterdam on 19-20 April 2011 under the auspices of the International Commission on the Taxonomy of Fungi (ICTF). The purpose of the symposium was to address the issue of whether or how the current...... to advise on the problem. The Declaration recognizes the need for an orderly transition to a single-name nomenclatural system for all fungi, and to provide mechanisms to protect names that otherwise then become endangered. That is, meaning that priority should be given to the first described name, except...... where there is a younger name in general use when the first author to select a name of a pleomorphic monophyletic genus is to be followed, and suggests controversial cases are referred to a body, such as the ICTF, which will report to the Committee for Fungi. If appropriate, the ICTF could be mandated...

  20. Nieuwe vormen, nieuwe inkomsten: over schrijvershonoraria

    NARCIS (Netherlands)

    Kuitert, L.

    2012-01-01

    De opkomst van het digitale boek werd al vanaf het begin argwanend bekeken. E-books zouden het papieren boek verdringen en daarmee ook de boekhandels. Lisa Kuitert, hoogleraar Boekwetenschap aan de Universiteit van Amsterdam, bespreekt niet de gevolgen voor de boekverkopers of uitgevers, maar voor

  1. Congenitale afwijkingen in Amsterdam: resultaten 'Amsterdam born children and their development'-studie

    NARCIS (Netherlands)

    Sikkens, J.J.; Eijsden, van M.; Bezemer, P.D.; Bakker, M.K.; Bonsel, G.J.; Wal, van der M.F.; Cornel, M.C.

    2009-01-01

    OBJECTIVE: To describe the prevalence of congenital anomalies in children born in Amsterdam and to analyse potential differences between groups based on risk factors such as ethnicity and maternal age. DESIGN: Secondary analysis of a prospective cohort study. METHODS: Between 2003 and 2004, mothers

  2. The fast Amsterdam multiprocessor (FAMP) operation system

    International Nuclear Information System (INIS)

    Gosman, D.; Hertzberger, L.O.; Holthuizen, D.J.; Por, G.J.A.; Schoorel, M.

    1981-01-01

    The Fast Amsterdam Multi Processor system (FAMP system) is developed for on-line filtering and second stage triggering. The system is based on the MC 68000 microprocessor from MOTOROLA. In this report we will describe: The FAMP operating system software, the features of the slaves and supervisor in the FAMP operating system, the communication between supervisor and slaves using the dual port memories, the communication between user programs and the operating system. The hardware as well as the application of the system will be described elsewhere. (orig.)

  3. Biology, Management and Utilization of Common Reed Pharagnites australis.

    Science.gov (United States)

    1987-02-01

    Vrije Universiteit Waterways Experiment Staticn Department of Ecology and Ecotoxicology Environmental Laboratory P.O. Box 7161 P.O. Box 631 1007 MC...Madelijn van der Werff Vrije Universiteit Department of Ecology and Ecotoxicology Amsterdam and John W. Simmers and Stratford H. Kay Waterways...lowing and cutting 67 5.2.4. Active regulation of the water table 68 5.5. Nature conservation 68 5.4. Reed cultivation 69 Z.4. 1. Reed harvest 69 6

  4. Effectiveness of clean taxi priority incentive at Amsterdam Central Station

    NARCIS (Netherlands)

    van der Flier, A.S.; Dam, J.; van den Hoed, R.

    2017-01-01

    The municipality of Amsterdam wants to have an emission free taxi sector by 2025. In order to reach that goal, the city has taken a number of measures which favour clean taxis above conventional taxis. One of these measures is an innovative priority privilege scheme at the Amsterdam Central Station

  5. Medical anthropology: essays and reflections from an Amsterdam graduate programme

    NARCIS (Netherlands)

    van der Geest, S.; Gerrits, T.; Challinor, J.

    2014-01-01

    This volume is a collection of twenty articles by graduates of the Amsterdam Master’s in Medical Anthropology (AMMA) at the University of Amsterdam. The university is known for outstanding and innovative work in the field of medical anthropology and teaching combines a strong ethnographic basis with

  6. Bepaling van de kwaliteit van reinigingsprocessen.

    NARCIS (Netherlands)

    Terpstra, P.M.J.

    1993-01-01

    Ingegaan wordt op de operationalisering van het begrip schoon voor verschillende toepassingen. Daarna worden twee recent ontwikkelde onderzoekmethoden gepresenteerd voor de meting van respectievelijk het reinigingseffect van textiel reinigen en het reinigen van harde vloeroppervlakken en enkele met

  7. Technische universiteiten en duurzame ontwikkeling in Afrika : Een interfacultair studenten onderzoeksproject voor het 33e lustrumsymposium van de Technische Universiteit Delft

    NARCIS (Netherlands)

    Duijvestein, C.A.J.; de Vries, G.; Bos, M.; Cozijnse, K.; Findlater, J.W.; Fremouw, M.; Jonkman, J.; Oijevaar, K.; Peters, S.; van Rattinghe, K.; Sack-van Straaten, K.; De Vries, G.; Wessels, R.

    2007-01-01

    In 2007, Delft University of Technology celebrates its 165th birthday. This unique occasion is celebrated with several activities revolving around the subject "Sustainable Solutions, with a focus on Africa". For the interdisciplinary course "Technical Universities and Sustainable development of

  8. Arid ways : cultural understandings of insecurity in Fulbe society, Central Mali = Leven met droogte : culturele expressie van onzekerheid bij de Fulbe in Centraal - Mali

    NARCIS (Netherlands)

    Bruijn, de M.; Dijk, van H.

    1995-01-01


    You can obtain a copy of this thesis through your local bookstore or directly from:
    Thela Thesis, Prinseneiland 305, 1013 LP Amsterdam.
    E-mail: office@thelathesis.nl

    Deze studie is het verslag van bijna twee jaar veldwerk bij de Fulbe van Centraal Mali, meer in het bijzonder de Fulbe

  9. Work in Amsterdam on local intelligence

    International Nuclear Information System (INIS)

    Dorenbosch, J.; Gosman, D.; Holthuizen, D.J.; Vermeulen, J.C.; Hertzberger, L.O.; Tuynman, F.

    1984-07-01

    Work on local intelligence at NIKHEF-H was started in 1979 with a proposal to design a multi microprocessor system for real-time event selection in high-energy physics experiments. The outcome of this is the Fast Amsterdam Multi Processor (FAMP) system which has the following properties: a high degree of modularity, facilitating easy system expansion; the possibility to realize hierarchical structures of processing elements; use of commercially available microprocessors. The system consists of modules that mechanically fit into a CAMAC crate. From the CAMAC standard only the CAMAC power supply lines are used. The FAMP system is described as it is used in the NA11/NA32 and UA1 experiments at CERN SPS (inclusive phi-meson production; proton-antiproton collisions.) Moreover, the FAMP distributed operating system (FADOS) is discussed in its present-day and future developments. (Auth.)

  10. Eerste inschatting van vrijkomen van plastics als gevolg van slijtage van Mosselzaad-Invagsystemen (MZI's)

    NARCIS (Netherlands)

    Hartog, E.; Brink, van den A.M.; Kamermans, P.

    2014-01-01

    IMARES heeft onderzoek uitgevoerd naar het ontstaan en de aanwezigheid van microplastic zwerfvuil afkomstig van mosselzaad invangsystemen (hierna MZI’s genoemd). Deze studie is onderdeel van een opdracht van het ministerie van EL&I, om de ecologische effecten van opschaling van MZI’s in de

  11. Over lichtemissie: Albert Einstein en de vroege geschiedenis van de Nederlandse Natuurkundige Vereniging

    NARCIS (Netherlands)

    Tauschinsky, A.; van Dongen, J.A.E.F.

    2008-01-01

    Op 29 april 1922 gaf Albert Einstein een lezing voor de Nederlandse Natuurkundige Vereniging op het Natuurkundig Laboratorium aan de Plantage Muidergracht te Amsterdam. Hij deed er verslag van een experiment dat hij zo’n zes maanden eerder had voorgesteld en dat zou hebben moeten uitmaken of licht

  12. Sustainable cooling of server rooms and data centres; Duurzaam koelen van serverruimtes en datacenters

    Energy Technology Data Exchange (ETDEWEB)

    Opschoor, S.; Drooger, P. [DWA installatie- en energieadvies, Bodegraven (Netherlands)

    2009-12-15

    Reduction of energy consumption of server rooms and data centers with renevvable cooling systems is very efficient. The first step should be to determine the demand for cold and heat. The use of waste energy and renewable eaergy sources in combination with underground energy storage result in substantial saving of energy: up to 40% and a payback period of 4 years. [Dutch] Voor serverruimtes en datacenters loont het om alle opties om energie te besparen te onderzoeken m.b.v. een stappenplan. Daarin gaat het erom de reductie van de energiebehoefte, benutting van de vrijkomende energie, het gebruik van duurzame energiebronnen en efficient gebruik van fossiele brandstoffen te inventariseren. In dit artikel worden enkele voorbeelden gegeven: reduceren van de koelbehoefte bij de Dienst Informatie en Administratie (DIA) van de gemeente Groningen; .realisatie van een installatie met energieopslag en warmtepomp bij het internetbedrijf Cisco Systems in Amsterdam.

  13. Struggles for success : Youth work rituals in Amsterdam and Beirut

    NARCIS (Netherlands)

    Abdallah, S.E.

    2017-01-01

    In Amsterdam and Beirut, Abdallah has ethnographically researched interactional dynamics between disadvantaged young people, regarding experiences of success, in settings of education, work, sports, and music. He analyzed how focus, mood, and bodily deployment produced shared symbols, emotional

  14. Amsterdam and London as financial centers in the eighteenth century

    OpenAIRE

    Ann M. Carlos; Larry Neal

    2011-01-01

    In the seventeenth century, Amsterdam and London developed distinctive innovations in finance through both banks and markets that facilitated the growth of trade in each city. In the eighteenth century, a symbiotic relation developed that led to bank-oriented finance in Amsterdam cooperating with market-oriented finance in London. The relationship that emerged allowed each to rise to unprecedented dominance in Europe, while the respective financial innovations in each city provided the means ...

  15. Katalytisch verbranden van varkensmest

    NARCIS (Netherlands)

    Hendriks, J.

    1995-01-01

    Door het verbranden van mest kan het mestvolume worden verkleind. Binnenkort gaat op het Varkensproefbedrijf 'Zuid- en West-Nederland' in Sterksel onderzoek van start om de mogelijkheden van het katalytisch verbranden van varkensmest te bekijken.

  16. Computer-Assisted Linguistic Analysis of the Peshitta

    NARCIS (Netherlands)

    Roorda, D.; Talstra, Eep; Dyk, Janet; van Keulen, Percy; Sikkel, Constantijn; Bosman, H.J.; Jenner, K.D.; Bakker, Dirk; Volkmer, J.A.; Gutman, Ariel; van Peursen, Wido Th.

    2014-01-01

    CALAP (Computer-Assisted Linguistic Analysis of the Peshitta), a joint research project of the Peshitta Institute Leiden and the Werkgroep Informatica at the Vrije Universiteit Amsterdam (1999-2005) CALAP concerned the computer-assisted analysis of the Peshitta to Kings (Janet Dyk and Percy van

  17. 10 Bel 03.pmd

    African Journals Online (AJOL)

    Owner

    2 maart 2009 ... Congo, de missie en de literatuur: Over David van Reybrouck,. J. G. Schoup en Amaat Vyncke. Jacqueline Bel. Jacqueline Bel is als universitair hoofddocent moderne Nederlandse letterkunde verbonden aan de Vrije. Universiteit in Amsterdam. Zij is onder meer gespecialiseerd in Nederlandse en Vlaamse.

  18. Van der Waals and Molecular Science

    International Nuclear Information System (INIS)

    Kox, A J

    1997-01-01

    For many years it has been a source of amazement to scientists and historians of science that no serious scientific biography of J D van der Waals existed. When, more than ten years ago, I became engaged in a correspondence with the Russian historian of science B E Yavelow on the topic of van der Waals, whose biography he was writing, I was both pleased and a bit puzzled. It was clear that Yavelow had not done any archival research in the Netherlands himself, yet he was intimately familiar with many obscure facts from the life of van der Waals. Naturally, I was very curious to see the end result, which appeared in 1985, but although the Amsterdam University Library obtained a copy, my limited knowledge of Russian kept me from forming a judgement on the book. Finally, after more than ten years, an English edition has appeared. The two original Russian authors have joined forces with the well known scientist J S Rowlinson (who earlier edited an English translation of van der Waals's dissertation) to produce a revised and enlarged English version of the Russian original. Now that I have finally been able to study this work, I must admit to being much impressed. Both the life and the work of van der Waals are dealt with in an exemplary way: the authors' command of primary and secondary sources is impressive, as is their understanding of the Dutch social and educational circumstances in the last century. Teaching and research at the newly-founded University of Amsterdam, as well as activities in the Academy of Sciences, are discussed in great and interesting detail. Van der Waals's education and rise from a simple teacher to one of the foremost theoretical physicists in Europe teaches us much about his personality as well as about the opportunities offered by the Dutch educational system. In their discussion of the development of van der Waals's ideas and their impact (including an interesting chapter on the reception in Russia) the authors are not afraid to go into

  19. Verbeteren van functionele fitheid van brandweermensen

    NARCIS (Netherlands)

    van Orden, Claudia Y.D.

    Posterpresentatie over IAG4-project 'Functional Fitness Monitor', een methodiek voor het verbeteren van functionele fitheid van brandweermensen door een combinatie van meten, presenteren van feedback en coaching. Gepresenteerd op Symposium Healthy Work: Good for Business, gehouden op 29 april 2016

  20. Measured and calculated NO2 concentrations in Amsterdam in 2008

    International Nuclear Information System (INIS)

    Wesseling, J.P.; Nguyen, P.L.; Van der Zee, S.

    2010-08-01

    Calculations using the Dutch standard calculation method for air quality in urban streets performed for 38 streets in Amsterdam in 2008 yield, on average, lower Nitrogen dioxide concentrations than measurements at those locations. This follows from research by the RIVM and the Public Health Service of Amsterdam (GGD Amsterdam). The average difference between measured and calculated concentrations is 11 %. At measuring locations of the National Air Quality Measuring Network in the Netherlands no significant underestimation of concentrations by the model is observed. The research was performed by the Dutch ministry of Housing, Spatial Planning en the Environment (VROM). The air quality in the streets that were investigated is mainly determined by emissions from local traffic. The measurements have been performed during thirteen periods of four weeks each, using so called 'Palmes' diffusion tubes. These measurements have been calibrated using the European reference method that is operational in the permanent measuring stations of the GGD Amsterdam. The calculations were performed using the geometry of the roads and information of the traffic at the measuring locations. Part of the differences can be explained, as some locations are not within the scope of the model. In these situations the model is known to perform slightly less. Apart from local traffic, other sources, like shipping, also contribute to the NO2 background concentrations in streets in Amsterdam. Sources that have only globally been included in the calculation of this background concentration may influence concentrations at specific locations. Further studies on this subject will be conducted in 2010. [nl

  1. Amsterdam wrist rules: A clinical decision aid

    Directory of Open Access Journals (Sweden)

    Bentohami Abdelali

    2011-10-01

    obtained of all patients entering one of the participating hospitals with trauma to the wrist. However, this is ethically and logistically not feasible and one could argue that patients, for whom no radiography is required according to their physician, are not suspected of having a distal radius fracture and thus are not part of the domain. Trial registration This study is registered at the Netherlands Trial Register (NTR 2544 and was granted permission by the Medical Ethical Committee of the Academic Medical Center Amsterdam on 06-01-2011.

  2. Non-pollen palynomorphs: From unknown curiosities to informative fossils. Celebrating the scientific career of Bas van Geel

    NARCIS (Netherlands)

    Hooghiemstra, H.

    2012-01-01

    This paper is dedicated to the scientific career of Bas van Geel at the moment of his retirement from the University of Amsterdam. The development of the research line of non-pollen palynomorph analysis is compared with other developments in palaeoecology.

  3. Verheerlijken, kraken en verguizen: burgerlijke en antiburgerlijke fans rond het Amsterdamse standbeeld van Vondel tussen 1867 en 2010

    NARCIS (Netherlands)

    Jongsma, J.; Rock, J.

    2014-01-01

    This article examines the functions of the statue of early modern Dutch playwright Joost van den Vondel, since its unveiling in 1867 (in the Amsterdam Vondelpark) until the present day. Building on studies of literary memory culture and fandom, we argue that the statue can be understood as a product

  4. Experimental light scattering by small particles in Amsterdam and Granada

    Directory of Open Access Journals (Sweden)

    Volten H.

    2010-06-01

    Full Text Available We report on two light scattering instruments located in Amsterdam and Granada, respectively. These instruments enable measuring scattering matrices as functions of the scattering angle of collections of randomly orieneted irregular particles. In the past decades, the experimental setup located in Amsterdam, The Netherlands, has produced a significant amount of experimental data. Unfortunately, this setup was officially closed a couple of years ago. We also present a modernized descendant of the Dutch experimental setup recently constructed at the Instituto de Astrofísica de Andalucía (IAA in Granada, Spain. We give a brief description of the instruments, and present some representative results.

  5. Kaarten in de Cloud: een inventarisatie van kaart-collecties op basis van Google Maps

    NARCIS (Netherlands)

    de Boer, T.; Hartmann, J.; Hameleers, M.; Carnier, M.; Alkhoven, P.; Kruk, R.

    2016-01-01

    The collections of four major Amsterdam map collections (the Special Collections of the University of Amsterdam, the Library of the Free University of Amsterdam, Amsterdam City Archives and the Library of the Royal Tropical Institute (KIT), Amsterdam) have been made visually accessible beginning

  6. Optimaliseren van een biovergister

    NARCIS (Netherlands)

    van der Bij, Joost; Rademaker, Mark; Visser, Klaas; de Vries, Herman

    2014-01-01

    Dit rapport beschrijft onderzoek van conversie van biomassa in een Swill-gasser geplaatst bij het Van der Valk restaurant in Cuijk. De Swill-gasser is een biomassa vergister voor restaurant afval. Het onderzoek heeft zich gericht op het optimaliseren van de data acquisitie en op het bepalen van de

  7. Effectieve bestrijding van varroa

    NARCIS (Netherlands)

    Cornelissen, B.; Blacquiere, T.; Steen, van der J.J.M.

    2010-01-01

    De varroa mijtziekte (Varroa destructor) is de belangrijkste bedreiging van de Europese honingbij. Wintersterfte van honingbijen is in de meeste gevallen toe te schrijven aan deze ziekte. Deze brochure van de WUR biedt informatie over de biologie van varroa, de effecten van varroa op honingbijen en

  8. The Willingness-to-Pay for Facilities at the Amsterdam Zuidas

    NARCIS (Netherlands)

    de Graaff, T.; de Groot, H.L.F.; Rodenburg, C.A.; Verhoef, E.T.

    2007-01-01

    This paper reports the results of a stated preference study investigating the willingness-to-pay (WTP) of employees at the Amsterdam Zuidas for the presence of nonshopping and shopping facilities. The Amsterdam Zuidas area, surrounding the current train-metro-tram station Amsterdam Zuid

  9. An excellence initiative in liberal arts and science education: the case of Amsterdam University College

    NARCIS (Netherlands)

    van der Wende, Marijk; Wang, Q; Cheng, Y.

    2013-01-01

    Amsterdam University College (AUC) was established in 2009 as an excellence initiative jointly undertaken by the University of Amsterdam (UvA) and VU University Amsterdam (VU). AUC is a selective and residential honours college that offers an international liberal arts and sciences bachelor

  10. Lessons Learned from Field Operational Test of Integrated Network Management in Amsterdam

    NARCIS (Netherlands)

    Hoogendoorn, S.P.; van Kooten, J; Adams, R

    2016-01-01

    The Amsterdam Practical Trial (APT) is a multiyear program initiated by the Dutch Ministry of Transport and the Environment and is carried out in close cooperation by Rijkswaterstaat, the City of Amsterdam, the Province of North Holland, and the Amsterdam Metropolitan Region. The APT aims to

  11. Produktie van pigmenten

    NARCIS (Netherlands)

    Etman EJ; Duesmann HB; Eijssen PHM; LAE

    1994-01-01

    Dit rapport over de produktie van pigmenten is gepubliceerd binnen het Samenwerkingsproject Procesbeschrijvingen Industrie Nederland (SPIN). In het kader van dit project is informatie verzameld over industriele bedrijven of industriele processen ter ondersteuning van het overheidsbeleid op het

  12. Kosten van allogene stamceltransplantaties

    NARCIS (Netherlands)

    M. van Agthoven (Michel); M.T. Groot (Martijn); C.A. Uyl-de Groot (Carin)

    2001-01-01

    textabstractAllogene stamceltransplantatie is een topspecialistische procedure die met succes kan worden ingezet in de behandeling van (hematologische) maligniteiten, met name bij leukemie. Van oudsher worden transplantaten van verwante donoren gebruikt, maar met de mogelijkheden om transplantaten

  13. Superincentive public transport contracting in the greater Amsterdam area

    NARCIS (Netherlands)

    Bakker, B.; Van de Velde, D.M.

    2009-01-01

    All suburban/regional bus services around Amsterdam City have been submitted to competitive tendering. This is done under a very innovative form of revenue-based contract that can be classified as a ‘super incentive’ contract. Payments to operators (‘subsidies’) are based on realised passenger

  14. AMSTERDAM-NIJMEGEN EVERYDAY LANGUAGE TEST - CONSTRUCTION, RELIABILITY AND VALIDITY

    NARCIS (Netherlands)

    BLOMERT, L; KEAN, ML; KOSTER, C; SCHOKKER, J

    1994-01-01

    The Amsterdam-Nijmegen Everyday Language Test (ANELT) is designed to measure, first, the level of verbal communicative abilities of aphasic patients and, second, changes in these abilities over time. The level of communicative effectiveness is determined by the adequacy of bringing a message across.

  15. Data on healthy food accessibility in Amsterdam, the Netherlands

    NARCIS (Netherlands)

    Helbich, M; Hagenauer, J

    2017-01-01

    This data descriptor introduces data on healthy food supplied by supermarkets in the city of Amsterdam, The Netherlands. In addition to two neighborhood variables (i.e., share of autochthons and average housing values), the data comprises three street network-based accessibility measures derived

  16. Fifteen years medical information sciences: the Amsterdam curriculum

    NARCIS (Netherlands)

    Jaspers, Monique W.; Fockens, Paul; Ravesloot, Jan H.; Limburg, Martien; Abu-Hanna, Ameen

    2004-01-01

    Objectives: To inform the medical informatics community on the rational, goals, evolution and present contents of the Medical Information Sciences program of the University of Amsterdam and our achievements. Methods: We elaborate on the history of our program, the philosophy, contents and

  17. The anatomy lessons of the Amsterdam Guild of Surgeons

    NARCIS (Netherlands)

    IJpma, F.F.A.

    2014-01-01

    Mandatory lessons in anatomy, taught by the praelector anatomiae (lecturer in anatomy) of the Amsterdam Guild of Surgeons, were an important part of the surgical training starting in the 16th century. We describe how surgeons were trained approximately 350 years ago at the Surgeons’ Guild. The role

  18. Kinderen in Amsterdam : waar en hoe zij verongelukken.

    NARCIS (Netherlands)

    Wegman, F.C.M.

    1975-01-01

    The report contains a part of the study to the traffic unsafety of children in Amsterdam. Difference is made between the incidental and structural approach. In the last one is thought of intervening changes in the traffic circulation, measures in the field of planning etc. Starting point is the

  19. The acoustics of the Amsterdam Opera House 'Het Muziektheater'

    NARCIS (Netherlands)

    Lange, P.A. de; Luxemburg, L.C.J. van; Muchall, R.C.

    1996-01-01

    The first opera house ever to be built in the Netherlands opened its doors on 26 Septem-ber 1986. Erected in the heart of old Am-sterdam, the building houses the Dutch Op-era Company, the National Ballet and the Ballet Orchestra. The design and planning of the building has an interesting history.

  20. Legionella-uitbraak in Amsterdam: koeltoren als bron

    NARCIS (Netherlands)

    Hoek, J A R van den; IJzerman, E P F; Coutinho, Roel A

    2006-01-01

    During the period 6-28 July 2006, 30 confirmed cases of Legionella infection were identified in Amsterdam, 2 of which were fatal. All had a positive urinary antigen test, by which Legionella pneumophila serogroup I could be demonstrated. Consultations between the parties involved in the control of

  1. The dynamic spatial impact of Amsterdam Airport Schiphol

    NARCIS (Netherlands)

    Warffemius, P.; van der Hoorn, T.; Klaassen, H.

    2008-01-01

    This paper is about the agglomeration effect of Amsterdam Airport Schiphol and its implications for location policy regarding the airport region. We focus on a specific case, namely the important concentration of European Distribution Centers (EDCs) around the airport. The traditional answer to the

  2. Researchcode in het Academisch Medisch Centrum te Amsterdam: nuttig

    NARCIS (Netherlands)

    Vermeulen, M.

    2002-01-01

    At the Academic Medical Centre (AMC) of the University of Amsterdam, the Netherlands, it was decided to set up a research code committee. The first thing that was done was to define what were considered the most relevant types of scientific misconduct: falsification, plagiarism and invasion of

  3. Cyber Resilience in de Bestuurskamer : The Grand Conference in Amsterdam

    NARCIS (Netherlands)

    Klaver, M.H.A.

    2013-01-01

    Op 16 oktober 2012 vond in Amsterdam The Grand Conference plaats. Deze conferentie werd georganiseerd door het Centre for the Protection of National lnfrastructure (CPNI.NL) in nauwe samenwerking met de Europese Commissie, de Europese Networkand Information Security Agency (ENISA), het Amerikaanse

  4. Gentrification in Amsterdam: assessing the importance of context

    NARCIS (Netherlands)

    Hochstenbach, C.; Musterd, S.; Teernstra, A.

    2015-01-01

    This paper investigates the income levels and income developments of in-migrating, out-migrating, and sitting households in gentrifying neighbourhoods in Amsterdam over a 10-year period (1999-2008). First, to analyse these data, this paper discusses the impact of institutional and housing market

  5. HIV testing behaviour among heterosexual migrants in Amsterdam

    NARCIS (Netherlands)

    Stolte, I. G.; Gras, M.; van Benthem, B. H.; Coutinho, R. A.; van den Hoek, J. A. R.

    2003-01-01

    This cross-sectional study among heterosexual migrant groups in south-eastern Amsterdam, the city area where the largest migrant groups live, provides an insight into HIV testing behaviour in this particular group. Participants were recruited at street locations (May 1997-July 1998) and interviewed

  6. Capturing the imaginary: Students and other tribes in Amsterdam

    NARCIS (Netherlands)

    Arbonés Aran, N.

    2015-01-01

    This thesis wants to contribute to operationalize insights into student identities, urban images and city/educational marketing and management communication. Instead of harping on the discourse of managing and increasing the positive image of Amsterdam, this thesis aims to give insight into a more

  7. Mass casualty triage after an airplane crash near Amsterdam

    NARCIS (Netherlands)

    Postma, Ingri L. E.; Weel, Hanneke; Heetveld, Martin J.; van der Zande, Ineke; Bijlsma, Taco S.; Bloemers, Frank W.; Goslings, J. Carel

    2013-01-01

    Triage is an important aspect of the management of mass casualty incidents. This study describes the triage after the Turkish Airlines Crash near Amsterdam in 2009. The results of the triage and the injuries of P3 casualties were evaluated. In addition, the role of the trauma mechanism and its

  8. De Hollandsche Schouwburg : lieu de mémoire [Amsterdam

    NARCIS (Netherlands)

    van Montfrans, M.; Mesnard, P.; Jurgenson, L.

    2016-01-01

    The Hollandsche Schouwburg, a memorial Site Until 1940, The Hollandsche Schouwburg, located just outside the Jewish quarter of Amsterdam, was a popular theatre, putting on many well-known Dutch plays. In 1941 the Nazi occupiers changed the theatre's name into Joodsche Schouwburg (Jewish Theatre).

  9. Supporting electric vehicles in freight transport in Amsterdam

    NARCIS (Netherlands)

    Trip, J.J.; Konings, J.W.

    2014-01-01

    Report written within the framework of Activity 7.4 of the Interreg IVB project E-Mobility NSR, file nr. 35-2-6-11. During the last decade the Municipality of Amsterdam has initiated quite elaborate policies to improve the air quality within the city, both for reasons of public health and spatial

  10. De flexibiliteit van het recht van erfpacht

    NARCIS (Netherlands)

    Vonck, Fokke Jan

    2013-01-01

    Until a few decades ago, the right of leasehold was a popular tool among various governments. That has changed. Of all the municipalities that were accustomed to use this figure, only Amsterdam is now referred to as a ‘real’ leasehold municipality. Nowadays, in particular others have discovered the

  11. Een revisie van de taxonomie van gifkikkers

    NARCIS (Netherlands)

    Poelman, E.H.

    2007-01-01

    Recent kwam het lang verwachte ruim tweehonderdvijftig pagina`s tellende manuscript uit met daarin een revisie van de taxonomie van gifkikkers. De auteurs onder leiding van Taran Grant stellen een nieuwe taxonomie voor, die de familie Dendrobatidae met haar tien algemener geaccepteerde genera

  12. Detectie van ziektesymptomen met behulp van fluorescentiebeelden

    NARCIS (Netherlands)

    Loon, van P.C.C.

    2004-01-01

    Rapport over de positie van de biologische paddestoelenteelt op intersectoraal en (inter)-regionaal niveau. Het overzicht in tabel- en schemavorm van de stromen grondstoffen en producten verduidelijkt de intersectorale positie van de champignonteelt. Dit kan een aanzet zijn bij het signaleren en

  13. Een geschiedenis van vleesloos eten

    NARCIS (Netherlands)

    Dagevos, H.

    2009-01-01

    Recensie van de populaire editie van het proefschrift van Dirk-Jan Verdonk: Het dierloze gerecht: een vegetarische geschiedenis in Nederland. Hierin wordt de geschiedenis van het vegetarisme vanaf de tweede helft van de 19e eeuw tot nu beschreven

  14. Verder met inclusie en diversiteit : resultaten en actiepunten Onderwijsconferentie Hogeschool van Amsterdam 2017

    NARCIS (Netherlands)

    van Diepen, Mieke; Essen, Erik; Hogenstijn, Maarten; Veraa, Fiona

    ‘Hartstikke leuk om een dagje onder collega’s te zijn en te praten over onderwijs, maar wat heb ik erverder aan? Morgen moet ik gewoon weer aan het werk’. Deze houding over de onderwijsconferentie, en misschien wel conferenties in het algemeen, zal velen bekend in de oren klinken. Het is vaak lastig

  15. Kodak in Amsterdam : de opkomst van de amateurfotografie in Nederland 1880-1910

    OpenAIRE

    Boom, Mattie

    2017-01-01

    textabstractThis dissertation develops an appropriate model to interpret and understand the early stages of amateur photography (1880-1910). The origin of amateur photography is a neglected field, however it tells us more about our own ways of visual communication. Driven by fierce competition in the international photo industry on the one hand and ambitious societies for amateur photographers on the other hand, by the end of the 19th century new groups emerged in the field of photography: ma...

  16. Kodak in Amsterdam : de opkomst van de amateurfotografie in Nederland 1880-1910

    NARCIS (Netherlands)

    M.M. Boom (Mattie)

    2017-01-01

    textabstractThis dissertation develops an appropriate model to interpret and understand the early stages of amateur photography (1880-1910). The origin of amateur photography is a neglected field, however it tells us more about our own ways of visual communication. Driven by fierce competition in

  17. Achter de schermen van het stadstoneel. Theaterbedrijf en toneelpolemiek in Amsterdam en Hamburg 1675-1750

    NARCIS (Netherlands)

    van der Haven, C.J.

    2008-01-01

    The usual delimitation in carrying out literary-historical research still is formed by the political and linguistic unity of ‘the nation.’ For this reason, the regional and local aspects of historical literary developments have long remained underexposed. This is also true for research into German

  18. Ziekten van het ruggenmerg

    NARCIS (Netherlands)

    Groen, Robertus; Kuks, Joannes; Snoek, Jozef; Kuks, Jan B.M.; Snoek, Jos W.

    2016-01-01

    Er zijn vele oorzaken voor een myelopathie. Beschadiging van het myelum kan compleet zijn (zoals in het geval van een complete dwarslaesie), maar is vaker incompleet (zoals bij een incomplete traumatische dwarslaesie en de meeste vormen van myelopathie op basis van niet-traumatische oorzaken). Er

  19. Economische gevolgen van ontwapening

    NARCIS (Netherlands)

    Duisenberg, Willem Frederik

    1965-01-01

    Samenvatting van de gehele studie 4.1. Economie en ontwapening Ontwapening betekent in deze studie de algehele, snelle afschaffing van alle militaire maatregelen in aIle landen. Het negeren van de politieke waarschijnlijkheden die veeleer wijzen op een zeer geleidelijke afschaffing van slechts

  20. Gevolgen van hydrocephalus

    NARCIS (Netherlands)

    Tromp, Cornelis Nicolaas

    1984-01-01

    Hydrocephalus is een aandoening van het centrale zenuwstelsel die de clinicus vrij lang voor grote problemen ten aanzien van de behandeling heeft qesteld. Door de toepassing van de ventriculo-atriale shunttechniek zijn de behandelingsmogelijkheden van hydrocephalus sterk verbeterd. Deze studie

  1. Geochemische bodematlas van Nederland

    NARCIS (Netherlands)

    Mol, G.; Spijker, J.H.; Gaans, van P.; Römkens, P.F.A.M.

    2012-01-01

    Deze Geochemische bodematlas geeft een uniek overzicht van de chemische samenstelling van de bodem in Nederland. Bodemmonsters van meer dan 350 locaties zijn geanalyseerd op meer dan 40 chemische elementen. De atlas geeft niet alleen informatie over de door de mens beïnvloede toplaag van de bodem,

  2. Neurotoxische effecten van broomcyclohexaan

    NARCIS (Netherlands)

    Velsen; F.L.van; Danse; L.H.J.C.; Vries; L.J.de; Liefde; A.de

    1984-01-01

    Kortdurende toediening (4-7 dagen) van broomcyclohexaan (BCH) veroorzaakt in een dosering van 1200 mg/kg lichaamsgewicht (per maagsonde) necrose van gegranuleerde cellen in de korrellaag van de kleine hersenen. In deze doseringen zijn ook gedragsafwijkingen waargenomen d.m.v. een objectieve

  3. Amsterdam's Airport Library Serves Passengers in 30 Languages

    Science.gov (United States)

    Dempsey, Kathy

    2011-01-01

    In the summer of 2010, Schiphol Airport in Amsterdam started offering the world's first library in an airport. This article describes Airport Library which is no ordinary library. It holds more than 1,200 items, but it lends nothing. It operates 24/7, yet it's only staffed by volunteers for 2 or 3 hours a day. It offers just nine public-access…

  4. Het planetarium van Hartog van Laun

    Directory of Open Access Journals (Sweden)

    Hans Hooijmaaijers

    2009-12-01

    Full Text Available The instrument maker Hartog van Laun devised a special table for an orrery, a lunarium and a tellurium. Van Laun made these instruments for educational purposes, but what makes his planetariums so interesting is the great variety and accuracy of demonstrations one can perform with them. In this paper I will deal with Van Laun and his instrument makers business. I will outline the design of the planetarium and some of the firm’s other instruments. Furthermore I will demonstrate that the detailed description of the planetarium made by Professor Jan Hendrik van Swinden boosted the spread of the instrument.

  5. B. J. van der Merwe . Pentateugtradisies in die prediking van ...

    African Journals Online (AJOL)

    B. J. van der Merwe . Pentateugtradisies in die prediking van Deuterojesaja. Proefschrift ter verkrijging van de graad van Doctor in de Godgeleerdheid aan de Rijkuniversiteit te Groningen. Uitg. J. B. Wolters, Groningen, Djakarta. 1955. 280 bls.

  6. Capita Selecta Early Music Amsterdam : Kas eestlastele ainus koht varajase muusika õpinguteks? / Taavi-Mats Utt

    Index Scriptorium Estoniae

    Utt, Taavi-Mats

    2000-01-01

    SICi (Stichting Internationale Concerten en Werkgroepen) korraldatavast varajase muusika koolitusest, seminaride sarjast "Capita Selecta Early Music Amsterdam", SICi plaanist laiendada tegevust Kiievi ja Peterburi konservatooriumidesse

  7. De fysica van polymere materialen

    NARCIS (Netherlands)

    Struik, L.C.E.

    1987-01-01

    Rede, uitgesproken ter gelegenheid van de aanvaarding van het ambt van buitengewoon hoogleraar in de fysica van polymere materialen aan de Universitelt Twente op donderdag 22 januarì 1987 door Dr.lr. L.C.E. Struik.

  8. Mogelijkheden tot productie van beertjes

    NARCIS (Netherlands)

    Scholten, R.; Huiskes, J.

    1994-01-01

    In opdracht van het Produktschap Vee en Vlees is het project Mogelijkheden tot productie van vleesbeertjes en afzet van vlees en vleesproducten hiervan uitgevoerd. De afzetmogelijkheden voor vlees van beertjes zijn en blijven vooralsnog minimaal

  9. Van verenigingsondersteuning naar verenigingsontwikkeling

    NARCIS (Netherlands)

    Slender, Hans; Meijburg, Heleen; Boven, Magda; Dijk, Bake; de Jong, Johan

    2017-01-01

    Sportverenigingen staan momenteel voor grote uitdagingen zoals bijvoorbeeld vermeend consumentgedrag van leden (Van der Roest, 2015), steeds meer eisen vanuit de overheid om bij te dragen aan maatschappelijke vraagstukken (Waardenburg, 2016) en teruglopende ledenaantal in krimpregio’s. Enkele

  10. Teelt van hybride wintertarwerassen

    NARCIS (Netherlands)

    Timmer, R.D.; Paauw, J.G.M.

    2003-01-01

    Om de mogelijkheden van de teelt van hybride wintertarwerassen onder Nederlandse omstandigheden in beeld te brengen zijn er van 2000-2002 proeven uitgevoerd op het PPO-proefbedrijf te Lelystad. In deze proeven zijn een 4-tal hybriderassen (Hybnos, Hyno-braba, Hyno-esta, Mercury) vergeleken met een

  11. Het presteren van FM

    NARCIS (Netherlands)

    van der Voordt, D.J.M.

    2008-01-01

    Prestatieafspraken. Prestatiespecificaties. Prestatiecontracten. Het woord prestatie duikt steeds vaker op in de wereld van FM. Maar wat bedoelen we er nu precies mee? En kunnen we de prestaties van FM wel op een betrouwbare en valide manier meten? Een beschouwing vanuit de wereld van een

  12. Handelsstromen van pluimveevlees

    NARCIS (Netherlands)

    Tacken, G.M.L.; Horne, van P.L.M.

    2006-01-01

    Dit onderzoek geeft inzicht in de goederenstromen van (rauw) pluimveevlees binnen envooral naar Nederland en de daarmee gepaard gaande zoönoserisico's. Het onderzoek biedtinput voor het nog op te zetten controlebeleid, waarmee handhaving van het beleidsvoornemenom het aanbieden van rauw

  13. De Smartcard van 2010

    NARCIS (Netherlands)

    Hartel, Pieter H.; Jacobs, Bart

    2001-01-01

    Aan de universiteiten van Twente en Nijmegen zijn twee onderzoeksgroepen onder leiding van de auteurs intensief bezig met smartcards. Beide auteurs zijn eerder dit jaar betrokken geweest bij het opstellen van de nieuwe Europese onderzoeksagenda voor smartcards, binnen het zogenaamde zesde kader

  14. Benaderingen van over

    NARCIS (Netherlands)

    Boer, M.G. de

    2010-01-01

    SAMENVATTING In dit hoofdstuk wordt de relatie tussen de betekenissen van het Nederlandse voorzetsel over en een aantal corpora bestudeerd. Het hoofdstuk begint met een analyse van de voorbeelden uit Uit het leven van Dik Trom (1891); daarna wordt de woordenboekinformatie behandeld en vergeleken

  15. van der Waals

    Indian Academy of Sciences (India)

    University education was beyond reach for van der Waals as he had to work for earning his daily bread ... languages, which was a prerequisite for entering a University those days. van der Waals worked as a school ... take academic examinations at the University yet, van der Waals continued studying at Leiden. University ...

  16. Falende Universiteit: Voer voor Methodologen.

    NARCIS (Netherlands)

    Verschuren, P.J.M.

    2002-01-01

    Universities do not come up to a growing demand for practice oriented research and for students trained in this type of activity. Existing methodology mainly is theory oriented. We in large part miss methodology for producing prescriptive knowledge, for a holistic approach and for design oriented

  17. Versterking van de loopbaanladder van leraren : wat kunnen we leren van Singapore?

    NARCIS (Netherlands)

    Elffers, L.

    2015-01-01

    In de Lerarenagenda 2013-2020 is een aantal doelstellingen geformuleerd ten aanzien van de bevordering van de loopbaan en professionele ontwikkeling van leraren. Enerzijds wordt ingezet op het stimuleren van professionalisering van leraren na hun initiële opleiding, anderzijds op het versterken van

  18. Impact of AIDS on premature mortality in Amsterdam, 1982-1992

    NARCIS (Netherlands)

    Bindels, P. J.; Reijneveld, S. A.; Mulder-Folkerts, D. K.; Coutinho, R. A.; van den Hoek, A. A.

    1994-01-01

    OBJECTIVE: To study the impact of AIDS on premature mortality in the city of Amsterdam (1982-1992). METHODS: We combined aggregated data from the Netherlands Central Bureau for Statistics with data from the municipal death and population registry and data from the Amsterdam AIDS surveillance system

  19. Religious and territorial identities in a cosmopolitan and secular city: youth in Amsterdam

    NARCIS (Netherlands)

    Mamadouh, V.; van der Welle, I.; Brunn, S.D.

    2015-01-01

    Religion is a much contested issue in Dutch politics and more specifically in Amsterdam. We investigate whether and how religion works as an obstacle or a vehicle for integration for youth in the secular and cosmopolitan Amsterdam. First, we describe the role religion played in the process of nation

  20. Quiet Areas and the Need for Quietness in Amsterdam

    Directory of Open Access Journals (Sweden)

    Hester Booi

    2012-03-01

    Full Text Available This paper describes the Quiet Places Project in Amsterdam. The purpose of the study was to find out: (1 which public quiet places there are according to Amsterdam residents; (2 what characterizes a quiet place; (3 to what extent do residents want peace and quiet; (4 how do residents realize these needs. The factors determining the need for quietness are presented in a model showing the influence of demographic and socio-economic issues, health status, sensitiveness to noise, daily activities and the noisiness in and around home. Most important of these factors is sensitivity to noise. Elderly and less healthy people are more often sensitive to noise. People who are annoyed by sound from traffic, airplanes and the like show a higher need for quietness. People with a lively household or neighbourhood report lower needs for quietness. Visiting a quiet place and going outside to walk or bike can have a compensating effect on the need for quietness. This suggests that creating quiet places and enhancing possibilities for quiet recreation in urban environments can have a positive effect on the quality of life in the city. Objective noise levels at the quiet places were taken from environmental noise maps. This shows that there may be a preference for low transportation noise levels, but levels up to 60 dB Lday are acceptable. Apparently this depends on a relative quietness or on non-acoustic characteristics of an area: the presence of vegetation and other pleasant stimuli.

  1. Kwaliteit van leven bij kinderen met sikkelcelziekte in de regio Amsterdam [Quality of life of children with sickle cell disease in the Amsterdam area

    NARCIS (Netherlands)

    Kater, A.P.; Heijboer, H.; Peters, M.; Vogels, T.; Prins, M.H.; Heymans, H.S.A.

    1999-01-01

    Objective. To determine the differences in quality of life between children with sickle cell disease and healthy immigrant children. Design. Descriptive, comparative. Method. The quality of life of children with sickle cell disease between 5 and 15 years old being treated in the Emma Children's

  2. Karakterisering van het "Etimologiewoordeboek van Afrikaans" (EWA)

    African Journals Online (AJOL)

    Als etymologisch woordenboek bezit EWA een aantal bijzondere, eigen kenmerken. De selectie van de woorden is bepaald door het beoogde gebruikerspubliek. Als gevolg daarvan bevat EWA verscheidene typen woorden die in traditionele etymologische woordenboeken doorgaans veronachtzaamd worden, zoals ...

  3. Dwaasheid of retoriek? Cornelis van Leeuwen en de ‘Belachelijke Geometristen’

    Directory of Open Access Journals (Sweden)

    Tim Nicolaije

    2012-06-01

    Full Text Available Foolishness or rhetoric? Cornelis van Leeuwen and the 'Ridiculous Geometrists'In 1663–1664 the inhabitants of Amsterdam were – probably much to their amusement – confronted with a pamphlet war between teachers of mathematics. This exchange of verbal and mathematical violence was instigated by Cornelis van Leeuwen, a young mathematics master ('rekenmeester' who had just taken over the school of his former teacher at the Zeedijk. In his pamphlet he ridiculed some of his colleagues who, according to Van Leeuwen, were loudly proclaiming their mathematical skills while their publications merely showed trivialities or ideas they had stolen from others. The fact that Van Leeuwen resorted to such abusive language and mockery is generally seen as foolishness and an act of desperation on the part of someone who did not have the mathematical skills to keep up with his fellow 'rekenmeesters'. In this article, however, it is argued that when analysing the content of Van Leeuwen's name-calling, a rhetorical strategy can be discovered that aimed at undermining the expertise and the honour of his opponents. Van Leeuwen argued that since they presented textbooks or exercises of others as their own, his opponents clearly did not comprehend the material themselves, thereby making them unsuitable to be teachers of mathematics. He furthermore claimed that by stealing from the works of other mathematicians, these 'ridiculous geometrists' had acted dishonourably and should be seen as unreliable, an accusation with potentially serious consequences given the importance of honour and reliability in early-modern Dutch society. Even though Van Leeuwen's attempt to discredit and dishonour some of his competitors on the Amsterdam mathematical market completely backfired, it is nevertheless instructive to see the rhetorical strategy of his pamphlet, which shows us how interwoven mathematical practices were with the general culture of that time.

  4. Aldo van Eyck’s Playgrounds: Aesthetics, Affordances, and Creativity

    Directory of Open Access Journals (Sweden)

    Rob Withagen

    2017-07-01

    Full Text Available After World War II, the Dutch architect Aldo van Eyck developed hundreds of playgrounds in the city of Amsterdam. These public playgrounds were located in parks, squares, and derelict sites, and consisted of minimalistic aesthetic play equipment that was supposed to stimulate the creativity of children. Over the last decades, these playgrounds have been studied by sociologists, theorists of art and architecture, and psychologists. Adopting an ecological approach to the human environment, it is argued that the abstract forms of van Eyck’s play sculptures indeed stimulate the creativity of the child. Whereas a slide or a swing almost dictates what a child is supposed to do, van Eyck’s play equipment invites the child to actively explore the numerous affordances (action possibilities it provided. However, it is argued that the standardization (e.g., equal distances between blocks or bars that tends to characterize van Eyck’ play equipment has negative effects on the playability. This standardization, which was arguably the result of the aesthetic motives of the designer, might be appealing to children when simply looking at the equipment, but it is not of overriding importance to them when playing in it. Indeed, a recent study indicates that the affordances provided by messy structures appear to have a greater appeal to playing children.

  5. Verslag van de voorstudie: Paddenstoelen bedrijf van de toekomst

    NARCIS (Netherlands)

    Tuijl, van B.A.J.; Bos, A.P.; Sonnenberg, A.S.M.

    2013-01-01

    Het rapport ‘Paddenstoelenbedrijf van de toekomst’ is het resultaat van een uitgebreid vooronderzoek en geeft de eerste aanzet tot het creëren van gemeenschappelijke visie van de sector op een betere toekomst voor paddenstoelenkwekerijen. Het rapport doet verslag van een reeks interviews en een

  6. Onderzoek naar vermindering van de bijvangst van een boomkortuig

    NARCIS (Netherlands)

    Marlen, van B.; Ybema, M.S.; Duijn, van J.B.

    2005-01-01

    In het kader van EU-project RECOVERY werden vergelijkende visserij- en selectiviteitsproeven uitgevoerd in 2002 en 2003 aan boord van MS “Tridens” aan 12 m boomkortuigen. De resultaten van een negental vistuigproeven zijn hier gegeven, gericht op het bepalen van het effect van een grote mazen kap

  7. Verdeling van oxytetraxycline (afkomstig van versleping) in diervoeders

    NARCIS (Netherlands)

    Stolker, A.A.M.; Zuidema, T.; Egmond, van H.J.; Jong, de J.; Haelermans, P.J.M.; Hooglugt, J.H.

    2012-01-01

    De laatste jaren is er een toenemende aandacht voor de mogelijke bijdrage van therapeutisch gebruik van antibiotica in de dierhouderij op de ontwikkeling van antimicrobiële resistentie. Een additionele bron van blootstelling van landbouwhuisdieren aan antibiotica is versleping via diervoeders. In

  8. Selectie van Italiaanse werkwoordsvormen op basis van frequentieonderzoek

    NARCIS (Netherlands)

    Boer, M.G. de

    2009-01-01

    SAMENVATTING Dit artikel is een vroege recensie (mei 1972) van het LIF, de frequentielijst van IBM Italia uit 1971. De auteur concentreert zich op de verschillen met het project van Juilland, dat als uitgangspunt voor het LIF heeft gefungeerd. Op grond van de gegevens van het LIF is een basislijst

  9. n Oorsig van die huidige stand van navorsing oor die

    African Journals Online (AJOL)

    Test

    7 Jun 2011 ... Die eerste maal wat dit as deel van die teks van 1 Johannes aangehaal word, is in die. 4de eeu in 'n Latynse teks, Liber Apologeticus (hf 4). Eers aan die einde van die 16de eeu is dit in 'n amptelike Katolieke uitgawe van die Vulgaat ingesluit. Die doel van die Johannesbriewe. Waarom is die Briewe ...

  10. Biologische effectiviteit van bespuitingen: effecten van druppelgrootte en waterkwaliteit

    NARCIS (Netherlands)

    Zande, van de J.C.; Schans, van der D.A.; Koster, A.T.J.

    2004-01-01

    Deze rapportage beschrijft de invloed van watervolume, druppelgrootte en kwaliteit van het tankmengsel op de biologische effectiviteit van bespuitingen. Onder kwaliteit van het tankmengsel wordt in dit verband verstaan: temperatuur, hardheid, pH en zoutgehalte (chloor en ijzerzouten) van de

  11. How environment friendly is sustainable building? The quantification of the environmental burden of houses; Hoe milieuvriendelijk is duurzaam bouwen? De milieubelasting van woningen gekwantificeerd

    Energy Technology Data Exchange (ETDEWEB)

    Klunder, G.

    2002-07-01

    The aim of the study on the title subject is to identify developments, strategies, chances and bottlenecks with respect to sustainable construction of houses as an integrated part of an ecological city. The main subject of the study is to determine and assess options to reduce the environmental burden of dwellings, focusing on building materials, energy consumption and use of water. [Dutch] Het DIOC-DGO (Delfts Interfacultair Onderzoekscentrum Duurzaam Gebouwde omgeving) van de Technische Universiteit Delft verricht onderzoek naar een duurzame en leefbare omgeving. De doelstelling van het onderzoek is: het identificeren van ontwikkelingen, strategieen, kansen en knelpunten met betrekking tot duurzame nieuwbouw van woningen als integraal onderdeel van een ecologische stad. De probleemstelling luidt: hoe kan de milieubelasting van woningen substantieel worden verminderd? De stand van zaken anno 2002 is dat 30 procent van de woningen duurzaam wordt gebouwd. In de Voorbeeldprojecten duurzaam en energiezuinig bouwen worden bijna standaard rogips of natuurgips, beton met puingranulaat, naadafdichting met PE of EPDM en oplosmiddelarme verf toegepast. Uit de milieuanalyse blijkt dat de milieubelasting in de pas loopt met de grootte van de woning. De fundering, gevels en binnenwanden en vloeren zijn verantwoordelijk voor 80 tot 90 procent van de materiaalstroom. Verwacht wordt dat in de komende decennia de bestaande materialen verder worden geoptimaliseerd en ontwikkeld. Er worden vooruitstrevende ontwikkelingen voorzien in bouwtechnieken. Energiegebruik kan in drie stappen verminderd worden: het voorkomen van onnodig gebruik, het gebruik van eindeloze bronnen en het verstandige gebruik van eindige bronnen, dat wil zeggen schoon en met een hoog rendement. Enkele conclusies zijn: de milieubelasting van watergebruik speelt een ondergeschikte rol, innovaties in materialen en bouwtechnieken blijven sterk achter bij innovaties in installaties. Aanbevolen wordt: de overheid moet

  12. 09 Van Coller 03.pmd

    African Journals Online (AJOL)

    Owner

    29 Jul 2010 ... strangeness, awakening in it a drama whose actors are all those assumptions and operations which make the text the work of another period”. Die spore van Raka: Oor herskrywing en kanonisering. (Deel 2). H.P. van Coller en A. van Jaarsveld. H. P. van Coller is hoof van die Departement. Afrikaans ...

  13. De auteursrechtelijke groeipijnen van Google

    NARCIS (Netherlands)

    Hugenholtz, P.B.

    2011-01-01

    Het succesverhaal van Google behoort tot de canon van de geschiedenis van onze informatiemaatschappij. In 1998 begonnen in een studentenkamer op de campus van Stanford University, groeide Google in enkele jaren uit tot het orakel van het internet. Zo werd ‘googelen’ de gebruikelijke term voor zoeken

  14. Invoering van algemene vaardigheden: mogelijkheden van een vakoverstijgende aanpak

    NARCIS (Netherlands)

    Leenders, F.J.

    2003-01-01

    Centrale vraag: Het onderzoek richtte zich op de implementatie van vakoverstijgend vaardighedenonderwijs in de Tweede Fase van het voortgezet onderwijs. Belangrijkste conclusies: De brochure bevat onder meer een beschrijving van vijf scholen waar op verschillende wijze vaardighedenonderwijs

  15. Civil society in beweging: Vier moskeeorganisaties in Amsterdam Slotervaart

    Directory of Open Access Journals (Sweden)

    Inge de Jong

    2007-03-01

    Full Text Available In this article, a picture is drawn of four mosques and affiliated foundations in the civil society of the Amsterdam city district Slotervaart. The focus in this article is concerned with civil society and religion. We took a closer look at what activities were being organised, what developments were underway, and what view the boards of the foundations and mosque councils held with respect to citizenship and the function of places of worship in Dutch society. The results of the study show that members of the board and volunteers try to build a bridge to Dutch society by appealing to the community from the perspective of theirn bonding function. The organisations find themselves in a field of force with internal and external developments in which they must function and within which they try to give their social responsibility shape.

  16. Karakterisering van het Etimologiewoordeboek van Afrikaans (EWA

    Directory of Open Access Journals (Sweden)

    Fons Moerdijk

    2011-10-01

    Full Text Available

    Samenvatting: Zesendertig jaar na Afrikaanse etimologieë van Boshoff en Nienaber verscheener in 2003 een nieuw etymologisch woordenboek van het Afrikaans: het Etimologiewoordeboek vanAfrikaans (EWA. Tussen die twee woordenboeken bestaat een wezenlijk verschil. Het werk vanBoshoff en Nienaber is vrijwel alleen toegankelijk voor specialisten en niet specifiek bedoeld vooreen breed publiek. EWA is juist allereerst bestemd voor de leek die zich interesseert voor de oorsprongen de geschiedenis van de eigen taal. Daarnaast biedt het ook de etymoloog en historischtaalkundige een hoop gegevens en inspiratie voor nader onderzoek. Als etymologisch woordenboekbezit EWA een aantal bijzondere, eigen kenmerken. De selectie van de woorden is bepaalddoor het beoogde gebruikerspubliek. Als gevolg daarvan bevat EWA verscheidene typen woordendie in traditionele etymologische woordenboeken doorgaans veronachtzaamd worden, zoals afleidingen,samenstellingen, neologismen en gemeenzame spreektaalwoorden. De artikelstructuurwordt gekenmerkt door een hoge graad van uniformiteit en consistentie. Het accent ligt op dezogenaamde etymologia proxima, de etymologie waarbij men één stap teruggaat en de meestdirecte herkomst van het woord biedt. Voorts is speciale aandacht besteed aan polysemie: nietalleen de herkomst van de dominante betekenis van een woord wordt gegeven, maar ook die vanzijn eventuele andere betekenis(sen. Benoemingsmotieven komen ook veelvuldig aan bod. In eeneventuele tweede druk zouden opvallende verschillen in vorm of betekenis altijd verklaard of inieder geval besproken moeten worden. Dat blijft nu nogal eens achterwege. Ook zou voorafgaandaan zo'n volgende editie meer onderzoek naar woordhistorisch materiaal uit primaire bronnenvoor met name de 17de–19de eeuw verricht moeten worden. Het zou mooi zijn als deze eersteuitgave van EWA de aanleiding tot een dergelijk onderzoek zou vormen.

    Sleutelwoorden: BENOEMINGSMOTIEF, ETYMOLOGIA PROXIMA

  17. Exploring public databases to characterize urban flood risks in Amsterdam

    Science.gov (United States)

    Gaitan, Santiago; ten Veldhuis, Marie-claire; van de Giesen, Nick

    2015-04-01

    Cities worldwide are challenged by increasing urban flood risks. Precise and realistic measures are required to decide upon investment to reduce their impacts. Obvious flooding factors affecting flood risk include sewer systems performance and urban topography. However, currently implemented sewer and topographic models do not provide realistic predictions of local flooding occurrence during heavy rain events. Assessing other factors such as spatially distributed rainfall and socioeconomic characteristics may help to explain probability and impacts of urban flooding. Several public databases were analyzed: complaints about flooding made by citizens, rainfall depths (15 min and 100 Ha spatio-temporal resolution), grids describing number of inhabitants, income, and housing price (1Ha and 25Ha resolution); and buildings age. Data analysis was done using Python and GIS programming, and included spatial indexing of data, cluster analysis, and multivariate regression on the complaints. Complaints were used as a proxy to characterize flooding impacts. The cluster analysis, run for all the variables except the complaints, grouped part of the grid-cells of central Amsterdam into a highly differentiated group, covering 10% of the analyzed area, and accounting for 25% of registered complaints. The configuration of the analyzed variables in central Amsterdam coincides with a high complaint count. Remaining complaints were evenly dispersed along other groups. An adjusted R2 of 0.38 in the multivariate regression suggests that explaining power can improve if additional variables are considered. While rainfall intensity explained 4% of the incidence of complaints, population density and building age significantly explained around 20% each. Data mining of public databases proved to be a valuable tool to identify factors explaining variability in occurrence of urban pluvial flooding, though additional variables must be considered to fully explain flood risk variability.

  18. Die Romeinse nastrewing van onsterflikheid deur middel van memoria

    Directory of Open Access Journals (Sweden)

    D. R. Fouché

    1985-05-01

    Full Text Available Benewens die omvangryke en nasionale manifestasies van die oorspronklike onsterflikheidsgedagte in die Romeinse gemeenskap, vind ons by die Romein op kleiner skaal in groepe of indiwidueel ’n strewe na onsterflikheid langs die weg van memoria. Soos aangetoon sal word, verskil die pogings van die verskillende groepe radikaal van mekaar, hoewel die strewe en einddoel dieselfde bly, naamlik om deur die daarstelling van memoria op die gebied van woord of daad onsterflikheid te bekom.

  19. Duurzame inzetbaarheid van ouderen: resultaten van de eerste twee metingen van STREAM

    NARCIS (Netherlands)

    Heuvel, S. van den; Ybema, J.F; Leijten, F.; Wind, A. de

    2013-01-01

    In deze notitie richten we ons op voorspellers van duurzame inzetbaarheid, waarbij we gebruik maken van de resultaten van de eerste twee metingen van STREAM en van een interviewstudie bij deelnemers aan STREAM. Meer specifiek gaan we na hoe personen met gezondheidsproblemen toch productief kunnen

  20. De democratische kwaliteit van gemeenteraadsverkiezingen’

    NARCIS (Netherlands)

    Boogers, Marcel; Reynaert, Herwig

    2018-01-01

    Gemeenteraadsverkiezingen horen ertoe bij te dragen dat het lokale beleid overeenkomt met de beleidsvoorkeuren van inwoners. Dat is immers de democratische functie van verkiezingen. De gedachte hierachter is dat als kiezers zich uitspreken over de beleidsprestaties en verkiezingsbeloften van

  1. The Impact of Anti-Immigration Parties on Mainstream Parties' Immigration Positions in the Netherlands, Flanders and the UK 1987-2010: Divided electorates, left-right politics and the pull towards restrictionism

    OpenAIRE

    DAVIS, Amber

    2012-01-01

    Defence date: 20 April 2012; Examining Board: Professor Rainer Bauböck, EUI, for Professor Peter Mair (†), EUI (supervisor); Professor Virginie Guiraudon, National Center for Scientific Research, Paris; Professor Meindert Fennema, Universiteit van Amsterdam; Professor Dirk Jacobs, Université Libre de Bruxelles The rise of anti-immigration parties across Western Europe has put enormous pressure on mainstream parties to adapt their competitive strategies. This thesis tests the hypothesis tha...

  2. ‘Men zou Virgilius zien opgaen in zijn’ tolck’. De functie van Vergilius in het artistiek ondernemerschap van Joost van den Vondel

    Directory of Open Access Journals (Sweden)

    Sophie Reinders

    2012-03-01

    Full Text Available This article analyzes Joost van den Vondel's career strategies and shows that the ambition for obtaining patronage as a poet played a crucial role in the dedications of his consecutive Vergil translations. In the period 1646-1660 Vondel published three Dutch translations of Vergil, one in prose, one 'preview' of the poetry translation, and a final translation of the complete works rendered in verse. For each of the individual dedicatees, the Prince of Orange, the son of the Amsterdam burgomaster Cornelis de Graeff, and the mighty burgomaster himself, the publications' paratexts work to achieve a single goal by means of this work of art: obtaining structural patronage for composing an epic.

  3. Late effecten van kankerbehandeling

    NARCIS (Netherlands)

    Langeveld, Nelia E.

    2004-01-01

    In dit artikel wordt ingegaan op de lange termijn effecten van kanker op de kinderleeftijd. Vervolgens wordt een kort overzicht gegeven van de belangrijkste late gevolgen die kunnen optreden na een oncologische behandeling met radio- en/of chemotherapie toegepast in de kinderleeftijd. Er wordt kort

  4. Het geheim van Alibaba

    NARCIS (Netherlands)

    den Butter, F.A.G.; Wu, X.

    2016-01-01

    Alibaba is in korte tijd uitgegroeid tot het grootste internet handelsplatform in de wereld. Volgens de Amsterdamse hoogleraar Frank den Butter en de Chinese studente Xiaoyi Wu weet Alibaba uitstekend in te spelen op de Chinese cultuur en instituties bij het omlaag brengen van de kosten van

  5. Een kwestie van vertrouwen

    NARCIS (Netherlands)

    Bastiaansen, H.J.M.; Wijk, Y.W. van; Wortmann, H.; Bakkers, J.P.

    2013-01-01

    Generieke Logius-producten en diensten zoals DigiD en Digipoort zijn onderdeel van een ICT-keten waarin veel organisaties samenwerken. Deze diensten moeten continu in de lucht zijn om bijvoorbeeld een uitkering bij UWV te kunnen aanvragen of goederen bij de Douane in te voeren. Als er bij een van de

  6. van der Waals

    Indian Academy of Sciences (India)

    in the world without learning the 'van der Waals equation'. ... theory”. Those days, however, molecules were assumed to be point masses occupying no .... was 36 to obtain his PhD due to the prevailing social conditions. van der Waals died in ...

  7. 'De 'lijmwaarde' van merken

    NARCIS (Netherlands)

    Mossinkoff, Marco

    2013-01-01

    Marketingwetenschap en -praktijk lijken in een crisis te verkeren: de consument en haar koopgedrag lijken steeds minder voorspelbaar, met alle nadelige gevolgen van dien voor het aanzien van marketing als vakgebied. Bij nadere beschouwing blijkt die onvoorspelbaarheid echter vooral betrekking te

  8. Classificatie van biologische agentia

    NARCIS (Netherlands)

    Klein MR; LIS; cib

    2012-01-01

    Deze rapportage omvat een inventarisatie van de problematiek rond de classificatie van biologische agentia, die ziekte bij de mens kunnen veroorzaken.

    De constatering is dat de Europese lijst met classificaties verouderd is en geactualiseerd en uitgebreid zou moeten worden. De lijst bevat

  9. De magie van plekken

    NARCIS (Netherlands)

    Hospers, Gerrit J.

    2015-01-01

    Maakt het in deze tijd eigenlijk nog uit waar we ons bevinden? Sommige experts beweren van niet. Ze bespeuren een death of distance: onder invloed van informatie- en communicatietechnologie zou afstand steeds minder relevant worden. Door mobiele telefonie, internet, Facebook en Skype lijkt het niet

  10. TIEN VAN DO

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. TIEN VAN DO. Articles written in Sadhana. Volume 41 Issue 8 August 2016 pp 817-823. A closed-form solution for a two-server heterogeneous retrial queue with threshold policy · TIEN VAN DO DENES PAPP RAM CHAKKA JINTING WANG JANOS SZTRIK · More Details Abstract Fulltext PDF.

  11. De aantrekkingskracht van gebouwen

    NARCIS (Netherlands)

    Frank van Enckevort; Ronald Beckers

    2012-01-01

    Hogescholen zijn de laatste jaren flink bezig met de ontwikkeling van gebouwen, met de nodige investeringen. In rap tempo worden er ultramoderne gebouwen neergezet of worden oude gebouwen gerenoveerd. Natuurlijk zijn deze ontwikkelingen in eerste instantie gericht op het nog beter ondersteunen van

  12. Praktijkevaluatie van 'piglet snatching'

    NARCIS (Netherlands)

    Smits, J.M.; Binnendijk, G.P.; Eijck, I.A.J.M.

    2002-01-01

    Bij piglet snatching worden biggen van een zeug direct bij de geboorte weggevangen en overgelegd naar een zeug op een ander bedrijf. In de praktijk is dit een goede, welzijnsvriendelijke manier om biggen van een bedrijf met een lage ziektevrij-status maar met een hoge genetische waarde over te

  13. Keuzeprocessen van Consumenten

    NARCIS (Netherlands)

    B. Wierenga (Berend)

    1987-01-01

    textabstractVoor de aanbieder van een voedingsmiddel, of dit nu een merkprodukt a la Mona is of een 'commodity', bijvoorbeeld karnemelk, is het van groot belang te weten welke factoren bepalen of een consument het betreffende produkt zal kiezen dan wel voor een concurrerend alternatief zal opteren.

  14. Kroniek van het mededingingsrecht

    NARCIS (Netherlands)

    Wesseling, R.; Truijens Martinez, J.

    2015-01-01

    Waar liggen de grenzen van het bereik van het mededingingsrecht? Die vraag komt steeds vaker op. Buiten het mededingingsrecht heeft de Europese Commissie beperkte handhavingsbevoegdheden. Voor de Commissie is een probleem dus al snel een mededingingsrechtelijke kwestie. De Libor-affaire en

  15. Interpretation of SO2 dry deposition measurements made in Portugal and Spain within the framework of SREMP

    NARCIS (Netherlands)

    Erisman JW; LLO

    1996-01-01

    Het RIVM heeft deelgenomen aan het internationale project SREMP (Surface Resistance Emergency Measurement Program), tezamen met de Universiteit van Aveiro, Portugal ; de Universiteit Politecnica uit Madrid, Spanje ; de Universiteit Paul Sabatier de Toulouse, Frankrijk ; Joint Research Center,

  16. Proeven van tekstkritiek. Een onderzoek betreffende de tekstgeschiedenis van de Renout van Montalbaen en de Perceval

    NARCIS (Netherlands)

    Hogenhout-Mulder, Maaike Janna

    1984-01-01

    In dit proefschrift wordt een poging gedaan de tekstgeschiedenis te achterhalen van twee Middelnederlandse tekstfragmenten: een gedeelte uit de RENOUT VAN MONTALBAEN en een gedeelte uit de PERCEVAL. ... Zie: Twee tekstfragmenten als object van onderzoek

  17. Hogere verwachtingen van technologie dan van elkaar?

    NARCIS (Netherlands)

    Dr. Stijn Verhagen

    2012-01-01

    Boekbespeking van Sherrie Turkle, 2011, Alone Together: Why We Expect More from Technology and Less from Each Other. New York: Basic Books. Mails, sms’jes, instant messages, tweets, Skype, voicemails, Facebookberichten – via smartphones en andere apparaten zijn we vrijwel non-stop in contact met

  18. Distinct Neisseria gonorrhoeae Transmission Networks Among Men Who Have Sex With Men in Amsterdam, the Netherlands

    NARCIS (Netherlands)

    Heymans, Raymond; A Matser, Amy; Bruisten, Sylvia M.; Heijman, Titia; Geskus, Ronald B.; Speksnijder, Adrianus G. C. L.; Davidovich, Udi; de Vries, Henry J. C.; Coutinho, Roel A.; Schim van der Loeff, Maarten F.

    2012-01-01

    Background. Molecular typing was used to elucidate Neisseria gonorrhoeae transmission networks among men who have sex with men (MSM) in Amsterdam, the Netherlands. We determined whether clusters of patients infected with specific N. gonorrhoeae genotypes were related to various epidemiological

  19. Assembly of an endcap of the ATLAS silicon strip detector at NIKHEF, Amsterdam.

    CERN Multimedia

    Ginter, P

    2005-01-01

    Assembly of an endcap of the ATLAS silicon strip detector (SCT) at NIKHEF, Amsterdam. Technicians are mounting the power distribution cables on the cylinder that houses nine disks with silicon sensors.

  20. Housing liberalisation and gentrification: the social effects of tenure conversions in Amsterdam

    NARCIS (Netherlands)

    Boterman, W.R.; van Gent, W.P.C.

    2014-01-01

    Privatisation and liberalisation of the housing market are often used as governmental strategies for engineering the social composition of urban neighbourhoods. Drawing on longitudinal register data, this study reports findings from the highly-regulated housing context of Amsterdam. Through

  1. Lichtdoorlatendheid van kasdekken onder verschillende omstsndigheden

    NARCIS (Netherlands)

    Bot, G.P.A.

    1984-01-01

    Aandacht voor lichtonderschepping; bewolkingsgraad; direkte straling; diffuse straling en gevolgen van veranderingen in kaskonstruktie of materiaaleigenschappen ten aanzien van de lichtdoorlatendheid. Bij vergelijking van de lichttransmissie van diverse kasdekken dient te worden uitgegaan van

  2. Looking back on a successful project. The Restoration of the Royal Palace in Amsterdam

    Directory of Open Access Journals (Sweden)

    Bert van Bommel

    2013-06-01

    Full Text Available After 1968, few changes were made to the Royal Palace in Amsterdam and eventually the palace was no longer functionally and technically up-to-date. Initially, the most recent restoration was only aimed at remedying that situation. Also, the project was split up and priority was given to fixing up the interior. Gradually, the actual restoration gained prominence. In 2007 it was decided to also restore the 1808 furniture. Until 2006, the government architect had hardly been involved in the restoration of the interior. This architect, Krijn van den Ende, was advised by various committees. Prior restorations (1929-1939 and 1960-1968 had restored the palace to its 17th-century state as best as possible. The most recent restoration respected this, while at the same time it aimed at connecting the 17th century character of the building to the unique collection of Empire furniture. This furniture was restored, as were the chandeliers and candelabras. All the ceilings on the first floor were studied and treated and the paintings between the beams were meticulously restored. A very important aspect was the restoration of the so-called ‘Bataven’ series in the galleries. Much of the work concerned making the building conform to contemporary standards. Once again the palace is now a suitable venue for official occasions. The inevitable addition of a lift did however cause quite a stir. Accessibility was improved and more representative rooms are now open to the public than before. The government architect was involved already in the preparatory stages of the second part of the restoration, which concerned the façades and the roofs. In executing the actual work a support committee provided advice and direction on his behalf. Although the sandstone is generally of a high quality, before 1968 a limited number of deteriorating blocks had been replaced. This time too, a number of blocks needed attention. The heavy scaffolding that needed to be installed for

  3. Bepaling van de optredende temperaturen bij tunnelcompostering van geitenmest

    NARCIS (Netherlands)

    Melse, R.W.; Sauvage, de G.J.; Roest, H.I.J.

    2010-01-01

    Het doel van het project is om inzicht te krijgen in de composteerbaarheid van geitenmest en het hiermee samenhangende temperatuursverloop . Bepaald dient te worden welke temperaturen tijdens het composteren van geitenmest worden bereikt om op basis daarvan een inschatting te kunnen maken van de

  4. Kleinschalige raffinage van bietenblad : eerste verkenning van de moglijkheden

    NARCIS (Netherlands)

    Wolf, de P.L.; Visser, de C.L.M.; Keijsers, E.R.P.; Meesters, K.P.H.; Heesakkers, J.W.M.; Aerts, M.

    2013-01-01

    Doelstelling van de eerste fase van het onderzoek was ‘het verkennen van kleinschalige keten(s) voor de raffinage van bietenblad’, met aandacht voor de technologische en economische haalbaarheid. Deze verkenning vormt de basis voor de volgende fase, waarin kansrijke opties verder worden uitgewerkt

  5. Inclusie door interprofessionele samenwerking. : Resultaten van de proeftuinen van PACT.

    NARCIS (Netherlands)

    Doornenbal, Jeannette; Fukkink, Ruben; van Yperen, Tom; Balledux, Mariëlle; Spoelstra, Jolanda; Verseveld, Marloes

    2017-01-01

    Deze rapportage gaat over de resultaten van de PACT-proeftuinen waaraan in opdracht van Het Kinderopvangfonds van 2015 tot 2017 is gewerkt. PACT-proeftuinen zijn innovatieve praktijken waarin door middel van interprofessionele samenwerking tussen de kinderopvang, het basisonderwijs en de zorg wordt

  6. Digitale incunabelen : Over het belang van het archiveren van websites

    NARCIS (Netherlands)

    Voerman, Gerrit; Keyzer, Andreas; den Hollander, Franciscus

    'Het geheugen van Nederland verpulvert'. Zo luidde de noodkreet van ruim twintig grote bibliotheken in het voorjaar van 1998. In een advertentie in enkele landelijke dagbladen vroegen deze bibliotheken om honderden miljoenen guldens voor het restaureren, fotograferen en digitaliseren van boeken en

  7. Digitale incunabelen : Over het belang van het archiveren van websites

    NARCIS (Netherlands)

    Voerman, Gerrit; Keyzer, Andreas; den Hollander, Franciscus

    2000-01-01

    'Het geheugen van Nederland verpulvert'. Zo luidde de noodkreet van ruim twintig grote bibliotheken in het voorjaar van 1998. In een advertentie in enkele landelijke dagbladen vroegen deze bibliotheken om honderden miljoenen guldens voor het restaureren, fotograferen en digitaliseren van boeken en

  8. A. VAN SELMS. LUKAS SE SEGSMAN VIR DIE GESKIEDENIS VAN ...

    African Journals Online (AJOL)

    Test

    oordele aan die eerste drie hoofstukke van sy Evangelie, het Lukas onder „van ..... Simon te onderskei van Simon Petrus, hoef ons nie erns te maak nie. .... op hulle beurt vereenselwig met Mosa van Jos. .... i&) Lukas der Arzt. Leipzig, 1906.

  9. De maatschappelijke impact van de Nederlandse Hartstichting

    NARCIS (Netherlands)

    Maas, K.; Booijink, P.; Commandeur, H.R.; Burger, F.

    2009-01-01

    China may be the world’s largest growth market, but it has not always been hospitable to foreign companies. This appears from a survey of 381 managers of foreign companies active in China done by the Center for International Business of Universiteit Nyenrode, Breukelen, the Netherlands. The survey

  10. Eenvoudige statistische berekeningen met behulp van Excel.

    NARCIS (Netherlands)

    A.A.J. van Peet; H.A. Everaert

    2007-01-01

    In de loop der tijd hebben wij op zowel universiteits- als hogeschoolniveau studenten en collega’s zien worstelen en soms ook verdrinken in het computerprograma SPSS. Daar zijn vele oorzaken voor aan te wijzen. Dat gaan we hier niet doen. Wel willen we hier wijzen op een wijdverbreid misverstand. In

  11. Management van World-Wide Web Servers

    NARCIS (Netherlands)

    van Hengstum, F.P.H.; Pras, Aiko

    1996-01-01

    Het World Wide Web is een populaire Internet toepassing waarmee het mogelijk is documenten aan willekeurige Internet gebruikers aan te bieden. Omdat hiervoor nog geen voorzieningen zijn getroffen, was het tot voor kort niet goed mogelijk het World Wide Web op afstand te beheren. De Universiteit

  12. Controle van spectrofotometers in ziekenhuislaboratoria

    NARCIS (Netherlands)

    Ham; W.A.van den; Steentjes; G.M.; Buitenhuis; S.G.; Terlingen; J.B.A.

    1985-01-01

    In dit rapport worden de resultaten beschreven van een onderzoek dat door twee medewerkers van het Laboratorium voor Klinische Chemie en Hematologie werd ingesteld naar de toestand van 22 fotometers in ziekenhuislaboratoria. Onderzocht werden: - juistheid van de golflengte-instelling - juistheid

  13. Siektes van peroksisome - 'n oorsig

    African Journals Online (AJOL)

    (x 14 SOO). Peroksisoomsiektes2. ,3,5.6. Ongeveer 12 genetiese siektes wat as gevolg van foute in die ontwikkeling of in die samestelling van peroksisome antstaan, is reeds beskryf. Volgens die omvang van die biogenetiese fout en die graad van verlies aan peroksisoomfunksies word hierdie sindrome in 3 groepe.

  14. Preventie van slaapgebrek en vermoeidheid

    NARCIS (Netherlands)

    Simons, R; Valk, P.

    2006-01-01

    Korte schets van de bijdrage aan het Europese Fit-to Fly project ( Early Warning Systems sensoren) van TNO Defensie en Veiligheid en hun eigen onderzoek naar fase-verschuiving van de slaap en strategisch gedoseerde slaapperioden. De eisen die een missie aan het personeel stelt, de verstoring van het

  15. Algemene principes van palliatieve zorg

    NARCIS (Netherlands)

    de Graeff, A; Jobse, A.; Teunissen, SCCM; Verkuijlen, S.; Vissers, K.C.P.; Zylicz, Z; Gilsing, M.

    2017-01-01

    Palliatieve zorg is een benadering die de kwaliteit van leven verbetert van patiënten (kinderen en volwassenen) en hun naasten die te maken hebben met een levensbedreigende aandoening, door het voorkomen en verlichten van lijden door middel van vroegtijdige signalering en zorgvuldige beoordeling en

  16. Burnout : de stand van zaken

    NARCIS (Netherlands)

    Taris, T.; Houtman, I.L.D.; Schaufeli, W.

    2013-01-01

    Dit artikel geeft een overzicht van de stand van zaken in het onderzoek naar burnout. Burnout is een syndroom van extreme vermoeidheid (uitputting), afstand nemen van het werk (distantie) en weinig vertrouwen in het eigen kunnen (verminderde competentie), waarbij de oorzaken voor deze aspecten

  17. Microbewerking met behulp van lasers

    NARCIS (Netherlands)

    Ezendam, M.M.M.

    1994-01-01

    Het bewerken van materialen met behulp van lasers staat momenteel enorm in de belangstelling, en terecht. De ontwikkeling van bestaande en nieuwe typen lasers staat alles behalve stil. Ontwikkelingen bevinden zich met name in het gebied van hogere vermogens, betere bundelkwaliteit en hogere

  18. Bestrijding van duist in wintertarwe

    NARCIS (Netherlands)

    Timmer, R.D.

    2006-01-01

    Duist, en speciaal resistente duist, is één van de grootste problemen in het graantelend gebied het Oldambt. De wintertarwegewassen ondervinden sterke concurrentie van de groeiende duistpopulatie, hetgeen ten koste gaat van de opbrengst. De inzet en kosten van de toegepaste herbiciden nemen toe

  19. Ingredienten voor kwaliteitsborging van modelonderzoek

    NARCIS (Netherlands)

    Grinsven JJM van; Haan BJ de; Braat LC; MNV; LBG; CIM

    1995-01-01

    In dit rapport wordt een aanzet gepresenteerd tot harmonisatie van de kwaliteitsborging van modelonderzoek in het RIVM. Het rapport komt voort uit initiatieven van leden van het Intersectoraal Modellen Overleg. Het rapport is in eerste instantie bedoeld voor onderzoekers die modellen

  20. Do Neighborhood Characteristics in Amsterdam Influence Adiposity at Preschool Age?

    Directory of Open Access Journals (Sweden)

    E. Jessica Hrudey

    2015-05-01

    Full Text Available Background: Neighborhood characteristics may contribute to adiposity in young children, but results in the current literature are inconsistent. This study aimed to investigate whether objective (socioeconomic status (SES and subjective (perceived safety, satisfaction with green spaces and perceived physical disorder neighborhood characteristics directly influence child adiposity (as measured by BMI, percent body fat (%BF and waist-to-height ratio (WHtR. Methods: Data on child BMI, %BF and WHtR were obtained from the Amsterdam Born Children and their Development cohort at 5–6 years of age. Three thousand four hundred and sixty nine (3469 children were included in the analyses. Mixed models, using random intercepts for postal code area to account for neighborhood clustering effects, were used to analyze the relationships of interest. Results: Associations were observed for both perceived safety and neighborhood SES with %BF after adjustment for maternal education and ethnicity. All relationships were eliminated with the inclusion of individual covariates and parental BMI into the models. Conclusions: In general, child adiposity at age 5–6 years was not independently associated with neighborhood characteristics, although a small relationship between child %BF and both neighborhood SES and perceived safety cannot be ruled out. At this young age, familial and individual factors probably play a more important role in influencing child adiposity than neighborhood characteristics.

  1. Italian validation of the Amsterdam Preoperative Anxiety and Information Scale.

    Science.gov (United States)

    Buonanno, Pasquale; Laiola, Anna; Palumbo, Chiara; Spinelli, Gianmario; Terminiello, Virginia; Servillo, Giuseppe

    2017-07-01

    Preoperative anxiety is usually experienced by patients awaiting surgical procedures and it can negatively impact patient's outcome. The Amsterdam Preoperative Anxiety and Information Scale (APAIS) is a questionnaire created to identify anxious patients and their need for information: it has been translated and validated in many languages because of its reliability and ease of completion. To date, no Italian version of the APAIS has been produced; our aim was to translate and validate the APAIS in Italian. We produced an Italian version of the APAIS and we administered it to 110 patients undergoing elective surgery; we explored its structure by factor analysis and its reliability by Cronbach's alpha. We analyzed its external validity by confronting it to the Spielberg's State-Trait Anxiety Inventory (STAI). Sensitivity, specificity, and positive and negative predictive values of the Italian version of the APAIS were determined. The Italian version of the APAIS confirmed the original structure of the questionnaire and its internal consistency; it well correlated with the STAI-Y1, the subscale of the STAI which explore the anxiety "state." An APAIS score of 14 was found as best cutoff to distinguish anxious and non-anxious patients. The Italian translation of the APAIS showed psychometric properties similar to the original version. Its reliability and its efficiency make it a powerful tool even in Italian population to detect anxiety and need for information.

  2. Soil Investigation Aspects of a Complex Metro Project in Amsterdam

    Science.gov (United States)

    Herbschleb, Jurgen

    The municipality of Amsterdam wishes to reduce the level of car traffic within the City Centre. As a consequence the public transport is to be extended by a new (bored) North/South Metro line. The excavation depths for the stations will exceed 30 m and will be constructed in difficult soft soil conditions. A further significant aspect is that the building pits are very near (3 to 5 m) to buildings of historical importance. The design philosophy of the station boxes was to determine an acceptable balance between the safety requirements and construction costs. The guidelines for the design, both for the building pits and the bored tunnel, are the predicted deformations of the adjacent building foundations. One of the more important geotechnical risks for this project is incorrect determination of the deformations arising from the building processes alongside the route of the metro. As such it should be realised that advanced finite element programs with second order material models require different geotechnical parameters than analytical models. The careful selection of calculation (soil) models, the level of safety (risk analysis), and site investigation is the start of the determination of the geotechnical parameters. This paper will focus on the interpretation of the site investigation for this complex project and will concentrate on the process followed, the problems encountered with the interpretation, the obtained results, and the used tools for geotechnical risk management.

  3. The Amsterdam model for control of tattoo parlours and businesses.

    Science.gov (United States)

    Veenstra, Thijs

    2015-01-01

    In the early 1980s, an outbreak of hepatitis B in Amsterdam stood at the start of the development of the first hygiene guidelines for tattooists in The Netherlands. Ever since, infection control in tattoo practice has continued to prove its importance as tattoo-related outbreaks of infectious diseases have continued to be reported in Europe. Furthermore, the act of tattooing includes breaking the skin barrier but is performed by professionals who are not medically trained. The Ministry of Health has now implemented uniform regulations that apply to professionals who perform tattooing and apply permanent make-up. These regulations include hygiene guidelines that were developed by the National Institute for Public Health and the Environment in cooperation with representatives of the tattooing associations. The guidelines contain a list of requirements, including for the studio interior, the cleanness of the studio, the safe use of permitted equipment and products, sterilization methods, and the information provided to the customer. A permit may be granted after an inspection by the local health service, during which the act of tattooing has to be performed. It is now estimated that over 95% of all tattoos in The Netherlands were obtained at one of the almost 900 licensed studios. Reports of complications are generally low in number. We suggest that uniform European hygiene guidelines would further contribute to the safety of tattooing. © 2015 S. Karger AG, Basel.

  4. Inguinal hernia repair in the Amsterdam region 1994-1996.

    Science.gov (United States)

    Schoots, I G; van Dijkman, B; Butzelaar, R M; van Geldere, D; Simons, M P

    2001-03-01

    In the Netherlands, approximately 30,000 inguinal hernia repairs are performed yearly. At least 15% are for recurrence. New procedures are being introduced creating discussion on which technique is the best. Currently it is not possible to choose on evidence alone because of the long follow-up that is needed. In 1996 an inventory was taken of all inguinal hernia repairs that were performed in the Amsterdam region (9 hospitals). These results were compared with the results from a similar study performed in 1994. Major changes in treatment strategy were noted. The Bassini repair was replaced by Shouldice and Lichtenstein techniques. There was a significant increase in the use of prostheses for both primary and recurrent inguinal hernias. There was no significant decrease in the percentage of operations performed for recurrent hernia from 19.5% to 16.8%. However, there was a significant decrease in operations performed for early recurrences (5.1%-3.4%) (p = 0.05). These results suggest that the Shouldice and Lichtenstein repairs may be superior to the Bassini repair in terms of early hernia recurrence.

  5. HIV testing behaviour among heterosexual migrants in Amsterdam.

    Science.gov (United States)

    Stolte, I G; Gras, M; Van Benthem, B H; Coutinho, R A; van den Hoek, J A

    2003-08-01

    This cross-sectional study among heterosexual migrant groups in south-eastern Amsterdam, the city area where the largest migrant groups live, provides an insight into HIV testing behaviour in this particular group. Participants were recruited at street locations (May 1997-July 1998) and interviewed using structured questionnaires. They also donated saliva for HIV testing. In total, 705 males and 769 females were included in this study (Afro-Surinamese (45%), Dutch-Antilleans (15%) and West Africans (40%)). Prior HIV testing was reported by 38% of all migrants (556/1479), of which only a minority (28%) had actively requested HIV testing. Multivariate logistic regression showed that not actively requesting HIV testing was more likely among younger (migrants, especially women (ORwomen: 4.79, p risk should be facilitated by promoting HIV testing and by improving accurate self-assessment of risk for HIV infection, especially among the groups that do not actively request HIV testing. This would increase HIV awareness and provide the opportunity of better medical care earlier in HIV infection.

  6. Municipal climate change policies. A case study for Amsterdam

    International Nuclear Information System (INIS)

    Schol, E.; Van den Bosch, A.; Ligthart, F.A.T.M.; Roemer, J.C.; Ruijg, G.J.; Schaeffer, G.J.; Dinkelman, G.H.; Kok, I.C.; De Paauw, K.F.B.

    1999-01-01

    Insight in the local policy options with respect to climate change is provided, in this case within the sphere of influence of Amsterdam local authorities. A list of new policy options for CO 2 reduction has been made with the assistance of local policy makers and representatives of interest groups. These policy options have been divided into three qualitative scenarios: Institutional Cultural Change, Technological Innovation and Least-Regrets. The environmental, economic and other effects have been described for each policy option. The three most interesting policy options have been selected by local policymakers and representatives of interest groups during a workshop. Implementation strategies have been developed for the options selected. These strategies have been discussed during a second workshop. The reduction target, stabilisation of CO 2 emissions in 2015 compared to 1993, can be reached by a combination of all the new policy options. The three selected policy options count for 40% of this total CO 2 emission reduction. Finally, a general outline on the methodology can also be applied to other cities and municipalities. For example, this methodology can be used by participants of Cities for Climate Protection, an initiative of the International Council for Local Environmental Initiatives, or the Netherlands Climate Association. 136 refs

  7. Ondersteuning van mobiele hulpverleners

    NARCIS (Netherlands)

    Huis in 't Veld, M.M.A.; Streefkerk, J.W.

    2007-01-01

    TNO onderzoekt hoe mobiele hulpverleners beter ondersteund kunnen worden. Wat is de visie van TNO? Twee praktijkvoorbeelden geven inzicht. In het project "Decision Support Tools" zijn twee typen beslisondersteuningsconcepten ontwikkeld en getest, een Simulatie tool (CFSim) en een Critical Thinking

  8. Ontwerpen van productkwaliteit

    NARCIS (Netherlands)

    Boxtel, van A.J.B.; Stigter, J.D.; Entius, S.D.J.

    2004-01-01

    Bij het ontwerpen van productie- en voedselbereidingsapparatuur worden fysische grootheden als uitgangspunt genomen. Het ligt echter meer voor de hand om de berekeningen op de beoogde producteigenschappen te baseren. Tot nu toe zijn de rekenmethoden voor complexere producten ontoereikend. Wageningen

  9. Effectief leren van multimedia

    NARCIS (Netherlands)

    Kester, Liesbeth

    2013-01-01

    Kester, L. (2012, March). Effectief leren van multimedia [Effective learning from multimedia]. Keynote presented at a miniconference Learning Sciences of the Open University of the Netherlands, Eindhoven, the Netherlands.

  10. Ellis Van Creveld syndrome

    Directory of Open Access Journals (Sweden)

    Shilpy S

    2007-05-01

    Full Text Available Ellis Van Creveld syndrome is a rare disorder and is a form of short-limbed dwarfism. It is an autosomal recessive disorder characterized by tetrad of disproportionate dwarfism, post-axial polydactyly, ectodermal dysplasia and heart defects. This case report presents a classical case of a seven-year-old boy with Ellis Van Creveld syndrome presented with discrete clinical findings.

  11. De valkuilen van de historische sensatie Een pleidooi voor nuchter ‘getrennt marschieren’ inzake archeologisch-historische contradicties

    Directory of Open Access Journals (Sweden)

    R.M.R. van Oosten

    2015-12-01

    Full Text Available The Danger of Historical Sensation: A Plea for a Sober ‘getrennt marschieren’ regarding Archaeological-Historical ContradictionsThree issues will be discussed in this article – the castle of Amsterdam (1994-1995, the mikveh of Venlo and the King’s tomb of Middelburg – where initially a tangible archaeological find seems to support a spectacular historical theory. On closer inspection, the combination of archaeological and historical sources has not rendered conclusive interdisciplinary evidence, but only generated castles in the air, fairy tales or at least a version of the past that fails to do justice to both disciplines. These issues are reason to highlight four methodological rules of thumb concerning historical-archaeological research. In order to prevent collective disillusionment, the most self-evident is to stay sober and down-to-earth and not to get stuck in a stage of enthusiastic intoxication or haze of ‘historical sensation’. Particularly in the case of fascinating historical-archaeological challenges this is a pitfall into which even very experienced researchers risk falling.In dit artikel worden drie kwesties besproken – het kasteel van Amsterdam (1994-1995, de mikwe van Venlo (2004-2014 en het koningsgraf van Willem II in Middelburg – waarbij een tastbare archeologische vondst aanvankelijk een sensationele historische theorie leek te ondersteunen. De combinatie van archeologische en historische bronnen bleek bij nader inzien geen sluitend interdisciplinair bewijs te leveren, maar slechts luchtkastelen, sprookjes of in elk geval een versie van het verleden die aan geen van beide disciplines recht deed.Deze kwesties zijn aanleiding om vier methodische vuistregels inzake historischarcheologisch onderzoek voor het voetlicht te brengen. Het meest voor de hand liggend om een collectieve maatschappelijke kater te voorkomen is nuchter blijven en niet in de enthousiasmerende dronkenschap of roes van historische sensatie

  12. Space Van system update

    Science.gov (United States)

    Cormier, Len

    1992-07-01

    The Space Van is a proposed commercial launch vehicle that is designed to carry 1150 kg to a space-station orbit for a price of $1,900,000 per flight in 1992 dollars. This price includes return on preoperational investment. Recurring costs are expected to be about $840,000 per flight. The Space Van is a fully reusable, assisted-single-stage-to orbit system. The most innovative new feature of the Space Van system is the assist-stage concept. The assist stage uses only airbreathing engines for vertical takeoff and vertical landing in the horizontal attitude and for launching the rocket-powered orbiter stage at mach 0.8 and an altitude of about 12 km. The primary version of the orbiter is designed for cargo-only without a crew. However, a passenger version of the Space Van should be able to carry a crew of two plus six passengers to a space-station orbit. Since the Space Van is nearly single-stage, performance to polar orbit drops off significantly. The cargo version should be capable of carrying 350 kg to a 400-km polar orbit. In the passenger version, the Space Van should be able to carry two crew members - or one crew member plus a passenger.

  13. De toekomst van flex : een onderzoek van tno naar flexstrategieën van Nederlandse bedrijven

    NARCIS (Netherlands)

    Verbiest, S.E.; Goudswaard, A.; Wijk, E.B. van

    2014-01-01

    In 2020 zal het personeelsbestand van organisaties voor 30% uit flexkrachten bestaan. Op dit moment is dat 25%. Dit blijkt uit een onderzoek van TNO onder 900 ondernemingen in opdracht van de ABU (Algemene Bond Uitzendondernemingen). Het blijkt dat met name organisaties die al gebruikmaken van

  14. De trek van kruiden van volgroeid wortelmateriaal : handleiding van A tot Z in beknopte vorm

    NARCIS (Netherlands)

    Wijk, van C.A.P.

    2005-01-01

    Deze teelthandleiding richt zich op de trek van vooral dragon, krulpeterselie, rucola en munt, uitgaande van wortelmateriaal dat in de vollegrond wordt geteeld. Deze forcering richt zich zowel op aanbod van kruiden in potjes als de meermalige oogst van het gesneden product in een kas of een

  15. On the Computation of Finite Invariant Sets of Mappings.

    Science.gov (United States)

    1988-02-01

    for the calculation of such invariant cycles. We refer here only to Doedel [1], looss et al [3], Kevrekidis et al [4], Van Veldhuizen ,[6], where further... van Veldhuizen , On Polygonal Approximations of an Invariant Curve, Dept.of Mathem. and Comp. Science, Vrije Universiteit Amsterdam, Techni- cal Report 1987, Math. Comp. to appear DATE Fl .LMED ...of van der Pol’s equation " x2) x - A(l - x ) X’ + x - 0 (16) As shown, for example in [2], the solution satisfies x - 2 cos(wt)+ A (0.75 sin(wt

  16. Plaatsen van beschaafd vertier

    Directory of Open Access Journals (Sweden)

    James Kennedy

    2014-09-01

    Full Text Available Plaatsen van beschaafd vertier [Places of civilised amusement] by Jan Hein Furnée, which appeared as a PhD thesis in 2007 and was adapted and extended into a book in 2012, is regarded by historians of the Low Countries as an impressive tour de force. In a stimulating manner Furnée demonstrates with this profound urban history that for the elite of The Hague leisure activities played an important role in acquiring status and maintaining their position. His study is based on extensive and systematic research into a great variety of sources, from census registers, membership lists of clubs and societies to address books. This gives the reader an extraordinarily detailed picture of the changing social relations in the upper echelons of society in The Hague in the latter half of the nineteenth century. The sophisticated use of both qualitative and quantitative methods can serve as a model for other historians in the field of urban history. In a lively fashion Furnée shows that the inhabitants of The Hague grasped at all kinds of pastimes in order to distinguish themselves from others, and when possible to increase their own status through their participation in elegant societies, theatre visits or supporting the proposed zoo: but the book also makes statements about status and class, the history of gender and of politics at the end of the nineteenth century. Plaatsen van beschaafd vertier van Jan Hein Furnée dat in 2007 als proefschrift en in 2012 bewerkt en uitgebreid als boek verscheen, staat onder historici van de Lage Landen bekend als een imponerende tour de force. Op prikkelende wijze laat Furnée in deze diepgravende stadsgeschiedenis zien dat vrijetijdsbesteding voor Haagse elites een belangrijke rol speelde in standsvorming en handhaving van hun positie. Zijn studie is gebaseerd op uitgebreid en systematisch onderzoek van veelsoortige bronnen, van volkstellingsregisters, ledenlijsten van verenigingen en sociëteiten tot adresboeken

  17. Energy in the fast lane. Energy consumption of datahotels and ICT in Amsterdam, Netherlands; Energie snel weg. Bitspakhuizen in Amsterdam vreten ruimte en vermogen

    Energy Technology Data Exchange (ETDEWEB)

    Schrauwers, A. [ed.

    2000-11-29

    The rise of Information and Communication Technology (ICT) businesses (also known as datahotels) in the region of Amsterdam, Netherlands, causes electric power capacity problems. A brief overview is given of the required capacity of the ICT-sector in the Netherlands and the energy balance of a datahotel.

  18. Psigologiese benadering van pastorale arbeid

    Directory of Open Access Journals (Sweden)

    D. J. Strümpfer

    1969-03-01

    Full Text Available In die spreektaal van ons Afrikaanse kerke is ons lief om die bedienaar van die Woord aan te dui as „die predikant”, „die leraar” of „die dominee”. Miskien plaas ons met hierdie semantiese gebruik van terme wat lering en proklamering impliseer, ’n ongelukkige klem op die preekamp. Daarteenoor, het ons semanties miskien iets te leer van die Pinkstersektes wat die benaming „pastoor” verkies, of die Amerikaanse ge­ bruik van die term „the pastor”. Ons is wel lief om te praat van „ons herder en leraar”. Veelal word die herderlike, of pastorale, deel van die taak van die bedienaar van die Woord egter in sy eie gedagtes, asook in die gedagtes van sy gemeentelede, deur die leraarskap op die agtergrond gedwing. Al te dikwels word hy deur gemeentelede beskou as iemand wat op Sondag op die kansel gesien moet word en wat niks met die res van hul lewens te doen het nie. Herstel van die pastoraat sal deel moet wees van die proses om die ontkerstening van die hedendaagse lewe teen te gaan.

  19. Smart Policies and Metropolitan Vision: the Spatial Dimension in the Experience of Amsterdam Smart City Platform

    Directory of Open Access Journals (Sweden)

    Giulia Fini

    2014-11-01

    Full Text Available The paper aims at presenting the main projects and policies recently developed by the Municipality of Amsterdam in the field of energy policies, with particular reference to the projects promoted in the context of the ASC - Amsterdam Smart City Platform. The analyzed projects and policies seem to be relevant for at least three aspects and for the matters raised by them:I. for the aim to connect policies and projects of the Amsterdam Smart City with the definition of a territorial vision for the Amsterdam metropolitan area;II. for the strong connection characterizing this experience between energy-management policies on the territory and the management’s choices related to urban planning and urban design;III. finally, the experience is relevant in relation with the consolidation of the ACS’s platform as a place where several individuals are directly involved in the management of public good and where all requests and peculiarities contribute to defining a common planning process on the energy and environmental subjects in the urban and metropolitan area.  Based on the latest, most significant information of the activities performed by Amsterdam Smart City Platform, the paper focuses on the results after four years since the projects and tests have been carried out, on the basis of a network structuring, predetermined energy-saving targets and of some space-related choices regarding the whole territory as well as ASC’s policies.

  20. Additional value of typing Noroviruses in gastroenteritis outbreaks in Amsterdam, The Netherlands.

    Science.gov (United States)

    Koek, A G; Bovée, L P M J; van den Hoek, J A R; Bos, A J; Bruisten, S M

    2006-02-01

    In Amsterdam, 17 of the 55 gastroenteritis (GI) outbreaks reported from January 2002 to May 2003 were confirmed to be caused by noroviruses (NV). In this study, we describe the molecular epidemiology of a group of nine outbreaks associated with a catering firm and two outbreaks, 5 months apart, in an Amsterdam hospital. All outbreaks were typed to confirm their linkage, and the hospital-related cases were studied to see if the two outbreaks were caused by one persisting NV strain or by a reintroduction after 5 months. For the outbreaks associated with the catering firm one NV genogroup I strain was found which was identical in sequence among customers and employees of the caterer. This was not the strain that predominantly circulated in 2002/2003 in and around Amsterdam, which was the NV genogroup II4 "new variant" (GgII4nv) strain. In the Amsterdam hospital, the two outbreaks were caused by this predominant GgII4nv type, and we argue that NV was most likely reintroduced in the second outbreak from the Amsterdam community.

  1. De auteursrechtelijke aansprakelijkheid van intermediairs, het kabelpiratenarrest revisited in de tijd van Internet

    NARCIS (Netherlands)

    Dommering, E.J.; Verkade, D.W.F.; Visser, D.J.G.

    1998-01-01

    Het kabelpiratenarrest vestigde de auteursrechtelijke aansprakelijkheid van de kabelexploitant voor het verspreiden van gestolen films die clandestien na de uitzendingen van de reguliere omroepen werden uitgezonden met gebruikmaking van de centrale antenne-inrichting van KTA. Zouden wij de

  2. Praktijkkennis van leerkrachten als ontwerpers van een ICT rijke leeromgeving

    NARCIS (Netherlands)

    Boschman, Ferry; McKenney, Susan; Voogt, Joke

    2011-01-01

    Ormel, B., Pareja, N., & McKenney, S. (2011, 8-10 June). Praktijkkennis van leerkrachten als ontwerpers van een ICT rijke leeromgeving. Presentation at the ORD annual meeting, Maastricht, The Netherlands.

  3. Richtlijnen voor selectie en weergave van residugehaltes van bestrijdingsmiddelen

    NARCIS (Netherlands)

    van den Velde-Koerts T; van Hoeven-Arentzen PH; Ossendorp BC; CSR

    2002-01-01

    Residubeoordelingen van bestrijdingsmiddelen worden uitgevoerd om wettelijke residulimieten (MRLs = maximum residue limits) vast te leggen. MRLs worden afgeleid uit de resultaten van die residuproeven met bestrijdingsmiddelen die volgens kritisch "Good Agricultural Practice" zijn

  4. Onderrig van Generasie Y

    Directory of Open Access Journals (Sweden)

    Elza Venter

    2016-02-01

    Full Text Available Generasie Y-leerders is jongmense wat ongeveer tussen 1977 en 2000 gebore is. Hierdie leerders het voor skerms grootgeword, ongeag of dit televisie-, rekenaar- of selfoonskerms was. Hulle is gebore in ’n samelewing waar inligting, opvoeding en vermaak net ’n klik ver was. Navorsers meen dat dié leerders se kritiese denke en ander kognitiewe vaardighede geaffekteer is omdat hulle ’n aansienlike hoeveelheid tyd daaraan bestee het om woorde en beelde passief te absorbeer, eerder as om met insig te lees. Leerders uit die generasie is dikwels ongemotiveerd en onbetrokke by hul eie leerervaring omdat hulle hul gelyktydig op ’n menigte digitale toestelle vermaak, terwyl die opvoeder hulle aandag probeer kry. Hulle verkies multitaakverrigting eerder as om op een taak of persoon op ’n slag te fokus en stel dikwels meer belang in wat op die skerm voor hulle aangaan as in wat die onderwyser hulle kan bied. Opvoeders op sekondêre en tersiêre vlak moet kennis hiervan neem en opnuut dink oor hulle onderrig- en leerstrategieë. Die klem in hierdie navorsing val op leerders, studente en opvoeders op sekondêre en tersiêre vlak. Die navorsing is deur die toepassing van ’n literatuuroorsig gedoen. Die hoofnavorsingsvraag van die studie is: ‘Hoe kan Generasie Y-leerders beter deur opvoeders by hulle eie leer in die klaskamer of lesinglokaal betrek word?’ Die twee subvrae is: (1 ‘Wat is sommige van die eienskappe van Generasie Y-leerders wat leer beïnvloed?’ en (2 ‘Watter onderrigstrategieë kan gebruik word om Generasie Y-leerders meer by hulle eie leer te betrek?’ Die outeur van hierdie artikel wil poog om opvoeders deur die literatuurstudie van riglyne in hierdie verband te voorsien.

  5. Analise van die Tswanaraaisel

    Directory of Open Access Journals (Sweden)

    S. A. Swanepoel

    1984-05-01

    Full Text Available ’n Strukturele, stilistiese en funksionele bcskrywing van die Twanaraaisel bring mee dat daar aan die volgende aspekte aandag gegee moet word: •\tWat is ’n raaisel en lioe word dit in Tswana genoem. •\tTot watter studiegebied en literere genre hoort die raaisel en watter subvorme kan vir Tswana onderskei word. •\tHoe sien die struktuur van Tswanaraaisels daar uit. •\tDeur wie, waar, wanneer en hoe word Tswanaraaisels voorgedra. •\tWatter stilistiese kenmcrke kan in Tswanaraaisels onderskei word. •\tWatter funksies vervul raaisels in ’n Tswanagcmeenskap.

  6. De verleidelijkheid van het grote gebaar : Het werk van Dogma

    NARCIS (Netherlands)

    Teerds, P.J.

    2013-01-01

    In vier portacabins op het parkeerterrein van de Delftse Faculteit Bouwkunde is nog tot volgende week de tentoonstelling 11+1 projects te zien, een overzichtstentoonstelling van het intrigerende werk van het Brusselse bureau Dogma. Met de tentoonstelling zet de faculteit na de brand in 2008 weer een

  7. ʼn Kritiese evaluering van wetgewing wat die gesondheid van ...

    African Journals Online (AJOL)

    User

    gereguleer wat "basiese watervoorsiening" omskryf as "die voorgeskrewe minimum standaard van watervoorsieningsdienste wat nodig is vir die betroubare voorsiening van ʼn toereikende hoeveelheid en gehalte water aan huishoudings, met inbegrip van informele huishoudings, om lewe en persoonlike higiëne te steun".

  8. Prediking aan die hand van die metafoor van fiksieskryf

    African Journals Online (AJOL)

    p1243322

    HTS 64(3) 2008 siening van die self en waarheid. In die pre-moderne paradigma kan die dominante metafoor verstaan word aan die hand van 'n spieël wat die lig uit 'n transendente oorsprong weerkaats, terwyl die moderne paradigma uitgedruk word met die metafoor van 'n lamp wat 'n eie, oorspronklike lig binne die self.

  9. "Die beiteltjie" van N.P. van Wyk Louw en

    African Journals Online (AJOL)

    Tom

    belangrike kenmerk van die postmodernisme is, wil ek dit nie tot abso- lute kenmerk verhef nie. Een van die .... oorgang vanaf 'n epistemologiese ingesteldheid tot 'n ontologiese ingesteldheid demonstreer en ..... the neglected and a whole range of phenomena which have been denied a history. Die formulering van die ...

  10. Kwantificatie van de invloed van regen op de verkeerdoorstroming

    NARCIS (Netherlands)

    Calvert, S.C.; Van Stralen, W.; Molin, E.J.E.

    2013-01-01

    Kwantificatie van de invloed van regen op de verkeerdoorstroming Het is bekend dat het weer invloed heeft op het verkeer op snelwegen, en in het bijzonder filevorming. Op de eerste plaats wordt de wegcapaciteit tijdelijk beïnvloed door een verandering in rijgedrag van bestuurders. Ten tweede

  11. Toepassing van de basisvrachtbenadering op fosfaat van compost; advies

    NARCIS (Netherlands)

    Ehlert, P.A.I.

    2005-01-01

    Bij het vormgeven van het stelsel van gebruiksnormen is een maatschappelijke discussie ontstaan over de aanvoer van fosfaat met grond in compost en zwarte grond. Deze deskstudie gaat in op vragen die hierbij gesteld zijn. Het aandeel grond in compost en zwarte grond en de hoeveelheid fosfaat daarin

  12. Beheersing van valse meeldauw in de akkerbouwmatige teelt van peterselie

    NARCIS (Netherlands)

    Mheen, van der H.J.C.J.; Lamers, J.G.

    2009-01-01

    In 2007 en 2008 heeft PPO-agv in opdracht van het Productwschap Akkerbouw onderzoek gedaan naar de beheersing van valse meeldauw in de akkerbouwmatige teelt van peterselie. Diverse fungicidentoepassingen zijn in staat om de peterselie (in meer of mindere mate) tegen valse meeldauw te beschermen.

  13. Die ontwikkeling van menslike potensiaal in die Republiek van Suid ...

    African Journals Online (AJOL)

    Erna Kinsey

    Dit het dus ook te doen met lewenstandaard, aangesien lewenstandaard `n bepalende faktor is met betrekking tot die optimale ontwikkeling van menslike potensiaal. Ander minder materiële aspekte van menslike potensiaal het te doen met menslike vryheid, waaronder vryheid van spraak, beweging en keuse ter sake is.

  14. De afschaffing van de bezwaarfase bij boetebesluiten van de ACM

    NARCIS (Netherlands)

    Jans, J.H.; Outhuijse, A.

    Per 1 maart 2013 ontstaat door samenvoeging van de NMa, de OPTA en de Consumentenautoriteit, de Autoriteit Consument en Markt. Om de ACM slagvaardig te laten functioneren, wordt voorgesteld het handhavingsinstrumentarium m.b.t. het markttoezicht van de ACM te vereenvoudigen. Eén van de voorstellen

  15. Invioed van de zuurtegraad van varkensurine op de ammoniakemissie

    NARCIS (Netherlands)

    Eizing, A.; Aarnink, A.J.A.

    1996-01-01

    Dit rapport beschrijft het effect van een lagere urine-pH op de ammoniakemissie in een varkensstal. Het onderzoek is uitgevoerd in een modelopstelling met de zogenaamde stalsimulator, waarbij de invloed van de urine-pH op de ammoniakemissie werd onderzocht. Hiervoor werd de urine van vleesvarkens op

  16. DIE ROL VAN DIE TAALWETENSKAP IN DIE ONTWIKKELING VAN ...

    African Journals Online (AJOL)

    aanslag op die sogenaamde "Intentional Fallacy", heelwat verder. n. Mens sou hier eintlik ook op die invloed van Lacan se toepassing van. De Sacs sure op Freud moet wys, en op Macherey se Theory of Literary. Production. Barthes is naamlik besig om repressie teen te werk, en die teks as produksieproses in stede van ...

  17. 'n Voordrag van Adrianus van Seims oor hermeneutiek | Boshoff ...

    African Journals Online (AJOL)

    A lecture on hermeneutics by Adrianus van Seims This article is the content of a lecture on hermeneutics given by A van Seims. After a few opening words on the introduction to the lecture and its content, the presentation is reproduced in its entirety. Van Seims considers that hermeneutics is concerned not only with ...

  18. Implementatie van de Surviving Sepsis Campaign bundels : Monitoring van ervaringen

    NARCIS (Netherlands)

    Lilian Vloet; J. Schouten; N. Stevens; A. Rensen; A. Willems; F. Zeegers

    2011-01-01

    Sepsis komt vaak voor in ziekenhuizen. Ernstige sepsis is verantwoordelijk voor 10 - 20% van alle Intensive Care (IC) opnames en is de belangrijkste doodsoorzaak op niet-cardiale IC?s. De gemiddelde mortaliteit van volwassenen met ernstige sepsis op de IC is 33% en van volwassenen met septische

  19. Kwaliteitskosten door niet nuchter afleveren van vleesvarkens

    NARCIS (Netherlands)

    Huiskes, J.

    1998-01-01

    Voor het maken en verkopen van kwaliteitsham moet de vleeskwaliteit van het karkas na het slachten goed zijn. De vleesvarkenshouder speelt een belangrijke rol in het vormen van de juiste omstandigheden voor het verkrijgen van de gewenste vleeskwaliteit.

  20. Dilemma's of sustainable consumption. A study of public support for making consumption more sustainable; Dilemma's rond duurzame consumptie. Een onderzoek naar het draagvlak voor verduurzaming van consumptie

    Energy Technology Data Exchange (ETDEWEB)

    Vringer, K.; Vollebergh, H.; Dietz, F. [Planbureau voor de Leefomgeving PBL, Den Haag (Netherlands); Van Soest, D. [VU University, Amsterdam (Netherlands); Van der Heijden, E. [Tilburg University, Tilburg (Netherlands)

    2013-02-15

    onderzocht in samenwerking met de Universiteit van Tilburg, de Vrije Universiteit en bureau Veldkamp-TNS/NIPO. Het onderzoek bevestigt dat een flinke groep consumenten verduurzaming belangrijk vindt, maar er niet altijd naar handelt. Aangezien mensen zich niet altijd gedragen naar wat zij belangrijk vinden, zijn de huidige geringe marktaandelen van duurzamere productvarianten geen goede voorspellers van het draagvlak voor overheidsbeleid. Om verduurzaming van consumptie te stimuleren, lijkt het zinvol dat de overheid het plezier van het individueel bijdragen aan duurzaamheid benadrukt en ervoor zorgt dat de individuele consument er zeker van is dat voldoende anderen ook duurzamere productvarianten kopen. Consumenten geven daarbij de voorkeur aan zachte drang met bijvoorbeeld subsidies, ook als dat voor hen duurder uitvalt dan harde dwang.

  1. Samenstelling van de vluchtige olie van Origanum vulgare L. ssp. vulgare gedurende de ontwikkeling van de plant

    NARCIS (Netherlands)

    Maarse, Henk

    1971-01-01

    INLEIDING EN DOEL VAN HET ONDERZOEK Vele onderzoekers hebben de laatste jaren de vorming van de verbindingen in vluchtige olien van planten bestudeerd door het bepalen van de verandering in de samenstelling van de vluchtige olie tijdens de groei van de plant. Lemli (68) wees als eerste op de

  2. Nederlands pensioenstelsel verre van af

    NARCIS (Netherlands)

    Boot, A.

    2008-01-01

    Het Nederlandse pensioenstelsel wordt verblijd met een nieuw type pensioeninstelling, de API (Algemene Pensioeninstelling). In optimale vrijheid moet deze kunnen functioneren met een toezichtregime dat aansluit op zowel dat van verzekeraars als dat van pensioenfondsen. Het pensioenstelsel is daarmee

  3. Ordinary People in the New World: The City of Amsterdam, Colonial Policy, and Initiatives from Below, 1656-1664

    NARCIS (Netherlands)

    Blom, F.; Looijesteijn, H.; Jacob, M.C.; Secretan, C.

    2013-01-01

    Between 1656 and 1664 the City of Amsterdam, uniquely, possessed a "City Colony" in the Dutch colony of New Netherland. Called New Amstel, this fledgling colony on the South River—the current Delaware—for a brief time cemented the commitment of Amsterdam to the preservation of the Dutch colony in

  4. Urinary uranium and kidney function parameters in professional assistance workers in the Epidemiological Study Air Disaster in Amsterdam (ESADA)

    NARCIS (Netherlands)

    J.A. Bijlsma (Joost); P. Slottje (Pauline); A.C. Huizink (Anja); J.W.R. Twisk (Jos); G.B. van der Voet (Gijsbert); F.A. de Wolff (Frederik); F. Vanhaecke (Frank); L. Moens (Luc); T. Smid (Tjabe)

    2008-01-01

    textabstractBackground. The Epidemiological Study Air Disaster in Amsterdam (ESADA) aimed to assess long-term health effects in professional assistance workers involved in the 1992 air disaster in Amsterdam. As part of ESADA indications of nephrotoxicity due to exposure to uranium from the balance

  5. Urinary uranium and kidney function parameters in professional assistance workers in the Epidemiological Study Air Disaster in Amsterdam (ESADA)

    NARCIS (Netherlands)

    Bijlsma, Joost A.; Slottje, Pauline; Huizink, Anja C.; Twisk, Jos W. R.; van der Voet, Gijsbert B.; de Wolff, Frederik A.; Vanhaecke, Frank; Moens, Luc; Smid, Tjabe

    2008-01-01

    The Epidemiological Study Air Disaster in Amsterdam (ESADA) aimed to assess long-term health effects in professional assistance workers involved in the 1992 air disaster in Amsterdam. As part of ESADA indications of nephrotoxicity due to exposure to uranium from the balance weights of the crashed

  6. The creation of play spaces in twentieth-century Amsterdam: from an intervention of civil actors to a public policy

    NARCIS (Netherlands)

    Verstrate, L.; Karsten, L.

    2011-01-01

    This case study uncovers a turning point in the production of play space in Amsterdam. Whereas over the first half of the twentieth century the creation of play spaces used to be the primary responsibility of the Amsterdam civil society, this situation started to change after the Second World War.

  7. Speaking of Belonging: Learning to Be "Good Citizens" in the Context of Voluntary Language Coaching Projects in Amsterdam, the Netherlands

    Science.gov (United States)

    Mosher, Rhiannon

    2015-01-01

    This article explores citizenship education for adult immigrants through informal language education in Amsterdam, the Netherlands. Based on data collected over thirteen months of ethnographic research among volunteer Dutch language coaches in Amsterdam, the primary methods used in this study were in-depth semi-structured interviews and…

  8. The air quality impact of the port of Amsterdam on its environment: Development of an air quality tool

    NARCIS (Netherlands)

    Klok, L.; Breemen, T. van; Hulskotte, J.

    2011-01-01

    Due to the expansion of the Port of Amsterdam, Urban development and the construction of new highways, air pollution levels are about to exceed European guidelines in and around the port region of Amsterdam. To assess the air quality in this region and the impact of theport emissions on its

  9. Travelling Concepts : Text, Subjectivity, Hybridity : Amsterdam, 11, 12 y 13 de enero de 2000

    OpenAIRE

    Barros, Claudia; Zusman, Perla Brígida

    2000-01-01

    La Amsterdam School for Cultural Analysis, Theory and Intepretation (ASCA) ha organizado, los días 11, 12 y 13 de enero del 2000, el evento: Travelling Concepts: Text, Subjectivity, Hybridity. A la luz del «giro cultural» que la geografía ha realizado a partir de la década de 1990, la participación en encuentros de esta índole resultan de interés para incentivar los intercambios entre el campo de la geografía y el de los estudios culturales. L'Amsterdam School for Cultural Analysis, Theory...

  10. Designing Public Space for Mobility: Contestation, Negotiation and Experiment at Amsterdam Airport Schiphol

    DEFF Research Database (Denmark)

    Nikolaeva, Anna

    2012-01-01

    The paper investigates airport design, using the example of Amsterdam Airport Schiphol, from the point of view of managers, architects and designers. It is argued that existing accounts of the airport as a space of transit as well as a place for shopping and entertainment have underrated the comp......The paper investigates airport design, using the example of Amsterdam Airport Schiphol, from the point of view of managers, architects and designers. It is argued that existing accounts of the airport as a space of transit as well as a place for shopping and entertainment have underrated...

  11. More than Welgelegen (well-situated: Abraham van der Hart and the Hope family

    Directory of Open Access Journals (Sweden)

    Jacqueline Heijenbrok

    2008-11-01

    Full Text Available Pavilion Welgelegen in Haarlem was built in 1785-1792 as the country house of the fabulously rich Amsterdam citizen Henry Hope (1735-1811, partner of the internationally renowned commercial bank Hope & Co. Since 1930 the Pavilion has been the seat of the provincial authorities of North Holland. So far, it was assumed that the consul of the Kingdom of Sardinia in the Dutch Republic, Michel (de Triquetti (1748-1821, had designed Welgelegen, whose plans were said to have been executed by Jean-Baptiste Dubois (1762-1851, an architect from Dendermonde. However, it has now been ascertained that the designer was Abraham van der Hart (1747-1820, town architect of Amsterdam at that time. This is the result of new research in the records, confirmed by the conclusions of a study of Henry Hope's network of relations in connection with known buildings of Van der Hart. Research of Pavilion Welgelegen itself showed that the L-shaped building originally consisted of two rather autonomous parts: a residential wing on the Dreef and a picture gallery on Haarlemmerhout. It also appeared that the residential wing is in fact the refurbished country house that Hope had bought in 1769. This functional distinction was also evident from the very expensive interior, for instance, the soft furnishings: chintz for the residential wing and silk for the gallery. The soft furnishings were the work of the French decorator Louis le Houx, who had probably settled in Haarlem especially for this assignment. Because of the imperfect connection between the wings it may be assumed that initially the design of the picture gallery on Haarlemmerhout was not intended for Welgelegen, but for the country estate Groenendaal in Heemstede, the property of John Hope, Henry's cousin. Just as Henry, John was a partner of Hope & Co, but he was a collector in the first place; around 1780 his collection of paintings was the most important of Amsterdam. Everything indicates that John had plans for

  12. Maatskaplike aspekte van geriatriese sorg

    Directory of Open Access Journals (Sweden)

    D. Louw

    1979-09-01

    Full Text Available Dit is maar enkele dekades gelede dat Westerse gemeenskappe bewus geword het van die besondere behoeftes van die relatief groot en nog steeds groeiende persentasie bejaardes in hulle midde. Nie alleen het die liggaamlike behoeftes van liggaamlike afgetakelde bejaardes die aandag getrek nie maar die gemeenskappe het ook bewus geword van die maatskaplike behoeftes van ouerwordendes in ’n tydperk wat gekenmerk is deur die dramatiese veranderings in die lewenswyses van ons mense — veranderinge wat in baie opsigte ’n negatiewe invloed gehad het op die lewensomstandighede van ’n groot groep bejaardes. Welsynsbeplanners het besef dat hulle in hulle beplanning spesiale voorsiening moes maak vir die lewensbehoeftes van hierdie groep in die gemeenskap en dat hulle in die verband ’n groot agterstand het om in te haal. Geneeshere wat belang begin stel het in die gesondheidsbehoeftes van bejaardes het ook besef dat gevestigde geneeskundige praktyke geensins voldoen aan die spesifieke behoeftes van ’n groot groep bejaardes nie en dat groot aanpassings gemaak moes word met betrekking tot hulle benaderings en metodes van behandeling van hierdie pasiente.

  13. Effect van Moddus op graszaad

    NARCIS (Netherlands)

    Borm, G.E.L.

    2005-01-01

    Het onderzoek was de eerste jaren gericht op het verkrijgen van een brede toelating van de groeiregulator Moddus in graszaadgewassen en in de laatste jaren op het optimaliseren van de toepassing hiervan. Moddus kan goed worden ingezet in graszaadgewassen, maar het optimale toepassingtijdstip is

  14. Energie- en eiwitbehoefte van schapen

    NARCIS (Netherlands)

    Sebek, L.B.J.; Gosselink, J.M.J.

    2006-01-01

    In 2004 is een literatuuronderzoek uitgevoerd om een betere onderbouwing en eventuele aanpassing van de behoeftenormen voor schapen mogelijk te maken. Op basis van deze literatuurstudie is aanpassing van de normen mogelijk. Het rapport levert echter geen ‘kant-en-klare’ voedernormen voor schapen,

  15. Implementatie van EU-handhavingsvoorschriften

    NARCIS (Netherlands)

    Adriaanse, P.C.; Barkhuysen, T.; Boswijk, P.; Habib, K.; Kruif, C. de; Luchtman, M.J.J.P.; Ouden, W. den; Prechal, A.; Steunenberg, B.; Vervaele, J.A.E.; Voermans, W.J.M.; Vries, S.A. de; Widdershoven, R.J.G.M.

    2008-01-01

    Na een verkennend onderzoek op twaalf beleidsterreinen naar aard, wijze en variatie van de EU/EG-beïnvloeding van nationale handhaving, zijn aan de hand van ‘beïnvloedingsscores’ acht beleidsterreinen geselecteerd voor nadere analyse. In het onderzoek staan de volgende vragen centraal:Hoe is de

  16. Van wie zijn zij? De ambtenaren

    NARCIS (Netherlands)

    Peters, Jit

    2011-01-01

    Aan de hand van actuele voorbeelden gaat Jit Peters tijdens zijn afscheidscollege in op de toegenomen macht van ambtenaren. De loyaliteit van de ambtenaar is volgens hem nu te veel gericht op het ondersteunen van de eigen minister. Als tegenwichten van de macht van de ambtenaar staat Peters stil bij

  17. Van de leestafel

    NARCIS (Netherlands)

    Hedrén, M.

    1996-01-01

    Door middel van allo-enzymstudies toont de Zweedse auteur aan dat D. praetermissa een permanente tetraploide hybride is die is ontstaan uit D. incarnata en D. maculata/ fuchsii, een resultaat dat eerdere studies gebaseerd op morfologische eigenschappen ondersteunt. Daarnaast noemt de auteur het

  18. Pythagoras Meets Van Hiele.

    Science.gov (United States)

    Flores, Alfinio

    1993-01-01

    Develops the Pythagorean Theorem in the context of the Van Hiele levels by presenting activities appropriate for each level. Activities point to preparatory development (level 0), give 3 different versions of Euclid's proof (levels 1, 2, and 3), give some generalizations of the theorem (level 3), and explore the Pythagorean relationship in other…

  19. Beheersing van het Schmallenbergvirus

    NARCIS (Netherlands)

    Poel, van der W.H.M.

    2013-01-01

    Schmallenbergvirus (SVB) werd in 2011 voor het eerst in Europa gezien en veroorzaakte een epidemie van aangeboren afwijkingen, vooral misvormde ledematen en hersenafwijkingen, bij kalveren en lammeren. Het ging om een niet eerder gevonden virus, dat om die reden aanvankelijk moeilijk onderkend kon

  20. Van Bahrein tot Bitcoin

    NARCIS (Netherlands)

    Lodder, A.R.

    2014-01-01

    Door het internet kan de burger rechtstreeks contact krijgen met zijn publiek zonder hulp van derden als omroepen, kranten, uitgevers, muziekindustrie, etc. Bij al deze communicaties is prominent (Youtube) of minder prominent (Wordpress) een derde partij betrokken die de communicatie faciliteert.

  1. Van Gogh's Sunflowers

    Science.gov (United States)

    Daddino, Michelle

    2010-01-01

    In this article, the author describes an art project wherein kindergarten students painted sunflowers. These beautiful and colorful sunflowers were inspired by the book "Camille and the Sunflowers" by Laurence Anholt, which does an amazing job of introducing young children to the art and life of Vincent van Gogh.

  2. Het importeren van honingbijen

    NARCIS (Netherlands)

    Cornelissen, B.

    2007-01-01

    Er wordt in de wereld volop gehandeld in bijen en bijenproducten. De globalisering is niet aan de bijenteelt voorbij gegaan. Producten als honing en propolis, maar ook raszuivere koninginnen worden over heel de wereld gemaakt en verspreid. Met deze wereldwijde verplaatsing van bijen kunnen ook

  3. Najaarsteelt van leeuwebek (Antirrhinum)

    NARCIS (Netherlands)

    Krogt, van der T.M.

    1982-01-01

    Een sortiment handelsrassen dat ook in de voorjaarsteelt gebruikt wordt, is getoetst op de gebruiksmogelijkheden in het najaar. Met enkele kultivars is een temperatuurproef gedaan. In de twee daaropvolgende jaren is een gekombineerde zaaitijden-rassenproef genomen, waarbij gebruik werd gemaakt van

  4. Bacteriologisch Onderzoek van slachtdieren

    NARCIS (Netherlands)

    Engel HWB; van Leusden FM; Erne EHW

    1986-01-01

    Door zes vleeskeuringsdiensten en het RIVM werd gezamenlijk onderzoek verricht naar het in de Vleeskeuringswet omschreven "Bacteriologisch Onderzoek" (BO) bij slachtdieren. Doel was na te gaan of er verschillen zouden zijn in de aantallen positieve resultaten van het BO tussen de diensten

  5. Kalibemesting van zetmeelaardappelen

    NARCIS (Netherlands)

    Wijnholds, K.H.

    2003-01-01

    Het is bekend dat kali een grote invloed kan hebben op het OWG en het uitbetalingsgewicht. Bij een stikstofgift die op het ras is afgestemd, is het effect van een hogere kaligift op het uitbetalingsgewicht bij de oogst echter vrij gering. Na bewaring is er een lichte trend aanwezig dat een hogere

  6. De invloed van periodieke keuringen op de veiligheid en betrouwbaarheid van voertuigen. Lezing KIVI-PAI Symposium "Naar meer storingsvrije- en veilige autokilometers", Amsterdam, 9 februari 1983.

    NARCIS (Netherlands)

    Paar, H.G. & Tromp, J.P.M.

    1983-01-01

    The Dutch Institute For Road Safety Research SWOV is engaged in research to find a method and a procedure for periodical inspection of cars in the Netherlands, according to EEC specifications. In 1974 a literature review was made on the subject when the law was drafted. 6% of the accidents seem

  7. Domotica Smart Living. Special issue; Domotica Slim Wonden. Themanummer

    Energy Technology Data Exchange (ETDEWEB)

    Lepelaars, L. [Stichting Smart Homes, eersel (Netherlands); Hamers, E. [Van Dorp Installaties, Zoetermeer (Netherlands); Van Mil, R.

    2011-10-15

    In a few articles (introduction, interview and 3 articles) attention is paid to domotica applications and smart living. The interview is with a professor 'ambient robotics' at the University of Amsterdam. The articles are about (1) the activities of the Smart Homes Foundation, (2) the use of domotica in the health and homecare sector, and (3) the use of domotica to improve comfort, safety and efficiency. [Dutch] In een paar artikelen (voorwoord, interview en 3 artikelen) wordt aandacht besteed aan domotica toepassingen en slim wonen. Het interview betreft een bijzonder hoogleraar 'ambient robotics aan de Universiteit van Amsterdam. De artikelen gaan over de activiteiten van de Stichting Smart Homes, (2) de toepassingen van domotica in de thuiszorg, en (3) het gebruik van domotica om het comfort, de veiligheid en energie efficiency te verbeteren.

  8. Beoordeling van het gedrag van bestrijdingsmiddelen in de verzadigde zone van de bodem

    NARCIS (Netherlands)

    Linden, van der A.M.A.; Beek, van C.G.E.M.; Boesten, J.J.T.I.; Leistra, M.; Meinardi, C.R.; Puijker, L.M.

    1999-01-01

    In het MeerJarenPlan-Gewasbescherming van 1991 is de mogelijkheid gegeven om door middel van onderzoek in de verzadigde fase van de bodem aan te tonen dat bestrijdingsmiddelen, die kunnen uitspoelen naar de verzadigde zone, alsnog voor toelating in aanmerking kunnen komen als de omzettingssnelheid

  9. Beoordeling van het gedrag van bestrijdingsmiddelen in de verzadigde zone van de bodem

    NARCIS (Netherlands)

    Linden AMA van der; Beek CGEM van; Boesten JJTI; Leistra M; Meinardi CR; Puijker LM; LBG

    1994-01-01

    In het MeerJarenPlan-Gewasbescherming van 1991 is de mogelijkheid gegeven om door middel van onderzoek in de verzadigde fase van de bodem aan te tonen dat bestrijdingsmiddelen, die kunnen uitspoelen naar de verzadigde zone, alsnog voor toelating in aanmerking kunnen komen als de

  10. Databank van de lithografische opbouw en morfologische ontwikkeling van de uiterwaarden van de Midden-Waal

    NARCIS (Netherlands)

    Hebinck, K.A.

    2008-01-01

    In de uiterwaarden zijn de komende decennia veel ingrepen gepland. Een goede kennis van de sedimentatiedynamiek en morfologische ontwikkeling van de uiterwaarden is daarbij een vereiste. Daartoe is een digitale databank (op CD bij dit rapport) opgesteld van de opbouw en geomorfologische ontwikkeling

  11. Fluorescentievingerafdruk van Aardappel, Melganzenvoet en Mais : Eerste resultaten van plantonderscheid met behulp van fluorescentie

    NARCIS (Netherlands)

    Groot, T.T.; Nieuwenhuizen, A.T.

    2012-01-01

    Als het spectrum van één “soort” (gewas) vergeleken wordt met de rest (onkruid) neemt het onderscheid van het “gewas” af tot 70%. Het lijkt dus nodig ook de spectra van alle soorten onkruid in het veld te kennen om een goed onderscheid mogelijk te maken. De doelstelling voor deze metingen is een

  12. Die nabyheid van die Koninkryk

    Directory of Open Access Journals (Sweden)

    W.J. Snyman

    1963-03-01

    Full Text Available Vanweë die belangrikheid daarvan volg hier ’n breër bespreking van die proefskrif van dr. Tjaart van der Walt oor die nabyheid van die Koninkryk as wat in ’n gewone resensie kan geskied. Die vraagstuk wat onder oë gesien word is so oud as die kerk en die teologie, soms minder en soms meer op die voorgrond. Tans kan gesê word, staan dit in die middelpunt. Daarby is dit nie maar ’n akademiese vraagstuk nie, maar ’n vraagstuk waarvoor elke nadenkende leser van die Skrif te staan kom.

  13. Afbouw van het Wsw-bestand: actualisatie op basis van Wsw-gegevens ultimo 2013

    NARCIS (Netherlands)

    Berden, C.; Tempelman, C.

    2014-01-01

    In opdracht van het ministerie van Sociale Zaken en Werkgelegenheid heeft SEO Economisch Onderzoek onderzoek gedaan naar de verdeling van het Participatiebudget over gemeenten. Een onderdeel van dit onderzoek vormde het voorspellen van de afbouw van het huidige zittend bestand in de Wsw op basis van

  14. Invloed van minerale olie op de bestrijding van Phytophthora infestans in pootaardappelen

    NARCIS (Netherlands)

    Spits, H.G.; Bus, C.B.

    2003-01-01

    De invloed van toevoeging van olie aan een fungicide op de werking van het fungicide is afhankelijk van het gebruikte fungicide. Gezamenlijk spuiten van olie en Aviso DF, Curzate M en mogelijk ook Acrobat, verhoogt de curatieve werking van deze fungiciden. Gezamenlijk spuiten van olie en Aviso DF,

  15. Rembrandt in 2006: splendeur et misère van een herdenkingsjaar

    Directory of Open Access Journals (Sweden)

    E. O. G. Haitsma Mulier

    2008-01-01

    Full Text Available M. Alexander-Knotter, e.a., De 'joodse' Rembrandt. De mythe ontrafeld; S.A.C. Dudok van Heel, De jonge Rembrandt onder tijdgenoten. Godsdienst en schilderkunst in Leiden en Amsterdam; M. Roscam Abbing, Rembrandt 2006. Essays; Rembrandt 2006. New Rembrandt documents; R. van Straten, Rembrandts Leidse tijd 1606-1632; Chr. Tümpel, Rembrandt en de bijbel. Alle etsen; Ch. Vogelaar, e.a., Rembrandts landschappen; M. de. Winkel, Fashion and fancy. Dress and meaning in Rembrandt's paintings; E. Runia, e.a., Rembrandt in het Mauritshuis; G. Hoekveld-Meijer, De God van Rembrandt. Rembrandt als commentator van de godsdienst van zijn tijd; Ch. Vogelaar, e.a., Rembrandts moeder. Mythe en werkelijkheid; E. van de Wetering, e.a., Rembrandt. Zoektocht van een genie; M. Roscam Abbing, Rembrandt. Leven en werk van de grootste schilder aller tijden; A. K. Wheelock jr., e.a., Rembrandts late religieuze portretten; D. Bull, e.a., Rembrandt. Caravaggio; H. Beliën, e.a., Langs Rembrandts roem. De reputatie van een meester; F. Lammertse, e.a., Uylenburgh en zoon. Kunst en commercie van Rembrandt tot De Lairesse 1625-1675; G. Schwartz, De grote Rembrandt; A. McNeil Kettering, Rembrandts groepsportretten; M. Schapelhouman, Rembrandt en de kunst van het tekenen; B. Broos, Het Rembrandt boekRembrandt in 2006: splendeur et misère of a Year of RemembranceThe 400th anniversary of Rembrandt’s birth was celebrated with exhibitions and other activities. Compared to the previous celebration, the commercial aspects were strikingly evident. Various interpretations of Rembrandt’s work were presented; here they are considered from a historian’s point of view. To what extent did art historians incorporate historical aspects of Rembrandt’s life into their opinions? Many a book published on the occasion of an exhibition contained articles about art history but rarely a catalogue of the works on display. A few authors ventured to present historical interpretations, most of

  16. Optimality aspects with assigning of Magistrates to Sessions and Teams of the Amsterdam Criminal Court

    NARCIS (Netherlands)

    Schreuder, J.A.M.; Burke, E.K.; Rudova, H.

    2006-01-01

    In the criminal court (Arrondissements rechtbank, sector strafrecht) of Amsterdam the assignment of magistrates (judges, officers, etc) to sessions needed to handle the cases presented, has become a problem last years mainly caused by the increase of so called mega-sessions. One complicating factor

  17. The organisational legitimacy of immigrant groups: Turks and Moroccans in Amsterdam

    NARCIS (Netherlands)

    Vermeulen, F.; Brünger, M.

    2014-01-01

    This article analyses the organising process of Turkish and Moroccan immigrant groups in Amsterdam over a long-term period. In it, we argue that organisational legitimacy is the driving factor of an organisational process. We understand legitimacy as a generalised belief that an organisation's

  18. The ''Amsterdam Castle'': A case study of wiggle matching and the proper calibration curve

    NARCIS (Netherlands)

    van der Plicht, J; Jansma, E|info:eu-repo/dai/nl/074965255; Kars, H

    1995-01-01

    We have performed a high-precision 14C wiggle-matching study on two oak beams from the "Castle of Amsterdam". These beams are also dated by dendrochronology. Our two dating methods can only be made consistent using the recommended calibration curve (1986) instead of the revised one (1993).

  19. Increasing awareness and prompting HIV testing: Contributions of Amsterdam HIV Testing Week 2016.

    NARCIS (Netherlands)

    den Daas, C; Meddens, E M; van Bergen, Jeam; de Bree, G J; Hogewoning, A A; Brinkman, K; de Wit, Jbf

    2018-01-01

    We evaluated Amsterdam HIV Testing Week (HTW) 2016 regarding its primary goals of raising awareness and prompting HIV testing. Participating services offered free, anonymous HIV testing, with a focus on reaching men who have sex with men (MSM) and people with a non-western migration background.

  20. Ecstacy and cocaine : Patterns of use among prime age individuals in Amsterdam

    NARCIS (Netherlands)

    van Ours, J.C.

    2005-01-01

    This paper uses information about prime age individuals living in Amsterdam to study the patterns of use of ecstasy and cocaine.The information was collected in surveys in 1994, 1997 and 2001.The analysis shows that the use of ecstasy and cocaine is mainly influenced by calendar year, family

  1. Sustainable entrepreneurship ecosystem emergence and development : a case study of Amsterdam Denim City

    NARCIS (Netherlands)

    DiVito, Lori; Ingen-Housz, Zita

    2017-01-01

    Our paper investigates the interaction of mechanisms that drive the emergence and development of a sustainable entrepreneurship ecosystem (SEE). We study a specific geographic context, the Amsterdam metropolitan area, and a specific industrial context, the denim industry. We conducted a qualitative,

  2. Location-based technology and game-based learning in secondary education: learning about medieval Amsterdam

    NARCIS (Netherlands)

    Admiraal, W.; Akkerman, S.; Huizenga, J.; van Zeijts, H.

    2009-01-01

    Mobile games in education are excellent ways to combine situated, active and constructive learning with fun. In the mobile city game Frequency 1550 teams -of four students each- step into the game's world. With help of the Internet, smart phones and GPS technology, Amsterdam changes into a medieval

  3. Intraday Analysis of Market Integration: Dutch Blue Chips traded in Amsterdam and New York

    NARCIS (Netherlands)

    A.J. Menkveld (Bert)

    2000-01-01

    textabstractMarket integration is studied for Dutch stocks cross-listed at the NYSE. Trading starts in Amsterdam and ends in New York with a one-hour overlap. Both markets are not perfectly integrated in that they can be viewed as one market with the well-documented U-shape in volatility, volume and

  4. Placing prostitution: the spatial-sexual order of Amsterdam and its growth coalition

    NARCIS (Netherlands)

    Aalbers, M.B.; Deinema, M.

    2012-01-01

    Amsterdam's red-light district is the paradigmatic case of window prostitution, but it is not a stable case: both the regulatory context of prostitution in the Netherlands and the socio-spatial dynamics of the district have changed throughout the years. This paper advances our understanding of

  5. The Lost Art of Regulated tolerance? Fifteen Years of Regulating Vices in Amsterdam

    NARCIS (Netherlands)

    Huisman, W.; Nelen, J.M.

    2014-01-01

    Fifteen years ago, Brants explored the idiosyncrasies of Dutch policy with regard to prostitution, focusing on the situation in the Dutch capital. Amsterdam was on the brink of the enactment of new policies and legislation regarding the legalization of prostitution and the crackdown on organized

  6. Die Lehre aus Amsterdam: Neue Urbanität in der alten Stadt

    NARCIS (Netherlands)

    Kloosterman, R.C.

    2010-01-01

    Cultural industries as an instrument seem to offer a way to revitalize derelict areas in and around the urban core that have been blighted by deindustrialization in the 1970 and 1980s. In this article, we explore how cultural industries have affected two such areas close to the Amsterdam central

  7. Children of immigrants in schools in New York and amsterdam : The factors shaping attainment

    NARCIS (Netherlands)

    Crul, Maurice; Holdaway, Jennifer

    Background/Context: This article considers the ways in which school systems in New York City and Amsterdam have shaped the educational trajectories of two groups of relatively disadvantaged immigrant youth: the children of Dominican immigrants in New York and the children of Moroccan immigrants in

  8. Risk behavior and social-cognitive determinants of condom use among ethnic minority communities in Amsterdam

    NARCIS (Netherlands)

    Wiggers, Louise C. W.; de Wit, John B. F.; Gras, Mitzi J.; Coutinho, Roel A.; van den Hoek, Anneke

    2003-01-01

    This study assessed sexual risk behavior and determinants of condom use among migrants in Amsterdam, the Netherlands. We tested the predictive utility of constructs derived from the health belief model and the theory of planned behavior. Data were collected by means of a cross-sectional study in a

  9. Winkelen als bevrijding? Vrouwen en stedelijke ruimte in Amsterdam, 1863-1913

    NARCIS (Netherlands)

    Furnée, W.J.H.

    2015-01-01

    Shopping as Liberation?: Women and Urban Space in Amsterdam, 1863-1913 In recent decades several historians have argued that the emergence of shopping as a leisure activity in the second half of the nineteenth century substantially enhanced women’s freedom of movement in public spaces and promoted

  10. Congenital anomalies in the teratological collection of Museum Vrolik in Amsterdam, The Netherlands. II: Skeletal dysplasias

    NARCIS (Netherlands)

    Oostra, R. J.; Baljet, B.; Dijkstra, P. F.; Hennekam, R. C.

    1998-01-01

    The Museum Vrolik collection of the Department of Anatomy and Embryology of the University of Amsterdam, founded by Gerardus Vrolik (1775-1859) and his son Willem Vrolik (1801-1863), consists of more than five thousand specimens of human and animal anatomy, embryology, pathology, and congenital

  11. Prevalence of Chlamydophila psittaci in fecal droppings from feral pigeons in Amsterdam, The Netherlands

    NARCIS (Netherlands)

    Heddema, Edou R.; ter Sluis, Sietske; Buys, Jan A.; Vandenbroucke-Grauls, Christina M. J. E.; van Wijnen, Joop H.; Visser, Caroline E.

    2006-01-01

    In many cities, the feral rock dove is an abundant bird species that can harbor Chlamydophila psittaci. We determined the prevalence and genotype of C. psittaci in fresh fecal samples from feral pigeons in Amsterdam, The Netherlands. The prevalence was 7.9% overall (26/331; 95% confidence interval,

  12. Let's do Diversity : report of the University of Amsterdam Diversity Commission

    NARCIS (Netherlands)

    G. Wekker (Gloria); M.W. Slootman (Marieke W.); R.A. Icaza Garza (Rosalba); H. Jansen (Hans); R. Vázquez (Rolando)

    2016-01-01

    markdownabstractBetween March and September 2016, the Diversity Commission studied diversity at the University of Amsterdam. Recognizing that the challenge to enhance social justice at the University requires active engagement with diversity, the Commission approached the topic along two lines:

  13. The association between ethnicity and vaginal microbiota composition in Amsterdam, the Netherlands

    NARCIS (Netherlands)

    Borgdorff, Hanneke; van der Veer, Charlotte; van Houdt, Robin; Alberts, Catharina J.; de Vries, Henry J.; Bruisten, Sylvia M.; Snijder, Marieke B.; Prins, Maria; Geerlings, Suzanne E.; Schim van der Loeff, Maarten F.; van de Wijgert, Janneke H. H. M.

    2017-01-01

    To evaluate whether ethnicity is independently associated with vaginal microbiota (VMB) composition in women living in Amsterdam, the Netherlands, as has been shown for American women. Women (18-34 years, non-pregnant, N = 610) representing the six largest ethnic groups (Dutch, African Surinamese,

  14. The Micropolitics of Criminalisation: Power, Resistance and the Amsterdam Squatting Movement

    NARCIS (Netherlands)

    Dadusc, D.

    2017-01-01

    This research analyses how the criminalisation of the Amsterdam squatting movement works. The key research question addresses how criminalisation operates as a technology of government, what kind of relations of power are constituted through this processes, and how these are experienced and

  15. Desalination of historical brick masonry. The case of the Waag building in Amsterdam

    NARCIS (Netherlands)

    Lubelli, B.A.; Hees, R.P.J. van

    2013-01-01

    The Waag building in Amsterdam (148g) (Figure 1) is a remnant of the former city walls (14g 1_ 1492); originally it was one of the city gates (St Anthoniespoort), When in the late six_ teenth century the city expanded, the walls were demolished and the building ceased to function as a gate, The

  16. Tattooing, permanent makeup and piercing in Amsterdam; guidelines, legislation and monitoring

    NARCIS (Netherlands)

    Worp, J.; Boonstra, A.; Coutinho, R. A.; van den Hoek, J. A. R.

    2006-01-01

    Tattooing, body piercing and permanent makeup are increasing in popularity. Here, we describe the procedures involved in these practices, their risks, the content of guidelines developed by the Municipal Health Service in Amsterdam (the Netherlands) to reduce infection risks, the legislation in the

  17. House Price Risk and Sub-District House Price Dynamics : The Case of Amsterdam

    NARCIS (Netherlands)

    Teye, A.L.; de Haan, J.; Elsinga, M.G.

    2016-01-01

    The recent Global Financial Crisis has lent even greater urgency to the need for households to understand the risks and dynamics of the residential property market better. This paper uses a rich dataset on individual residential property transactions between 1995 and 2014 in Amsterdam to study the

  18. Renewable energy technology feasibility study for a new hotel building in Amsterdam

    NARCIS (Netherlands)

    Bischoff, J.M.A.; Hensen, J.L.M.; Hassan Mohamed, Mohamed; Philips, C.

    2016-01-01

    This article discusses the economic and environmental feasibility of applying renewable energy technology (RET) to a new hotel building in Amsterdam using the simulation software HOMER. The study shows that applying PV including a surface up to 750m² can be both economical and environmentally

  19. The fight against human trafficking in the Amsterdam Red Light District

    NARCIS (Netherlands)

    Spapens, A.C.M.; Rijken, C.R.J.J.

    The Amsterdam Red Light District is famous for its sex-oriented businesses. Although prostitution was legalized in 2000, this did not end some of its criminal side effects, particularly the trafficking in women. In an effort to combat human trafficking in the district, the local authorities launched

  20. Veilig op de fiets in Amsterdam : de campagne 'Veilig op de fiets' : effecten, process en motivatie.

    NARCIS (Netherlands)

    Twisk, D.A.M.

    1994-01-01

    A campaign was organised to increase cycling safety in the Dutch municipality of Amsterdam. The campaign was based on marketing principles, and centred on cyclists' needs in safety and comfort. The emphasis in the 'Safe Cycling' campaign was on infrastructure improvements and police enforcement.

  1. Children's social capital in the segregated context of Amsterdam: an historical-geographical approach

    NARCIS (Netherlands)

    Karsten, L.

    2011-01-01

    This paper addresses children’s social capital across space and over time. Empirical evidence comes from an in-depth study of changes in children’s daily lives in Amsterdam over the past 50 years. Different dimensions of religious and ethnic segregation at school and in the neighbourhood have

  2. Romance Languages and Linguistic Theory 2013: Selected Papers from 'Going Romance' Amsterdam 2013

    NARCIS (Netherlands)

    Aboh, E.O.; Schaeffer, J.C.; Sleeman, P.

    2015-01-01

    The Going Romance conferences are a major European annual discussion forum for theoretically relevant research on Romance languages. This volume assembles a selection of the papers that were presented at the 27th edition of Going Romance, which was organized by the University of Amsterdam in

  3. Shelter-based convalescence for homeless adults in Amsterdam: a descriptive study

    NARCIS (Netherlands)

    van Laere, Igor; de Wit, Matty; Klazinga, Niek

    2009-01-01

    ABSTRACT: BACKGROUND: Adequate support for homeless populations includes shelter and care to recuperate from illness and/or injury. This is a descriptive analysis of diagnoses and use of shelter-based convalescence in a cohort of homeless adults in Amsterdam. METHODS: Demographics of ill homeless

  4. Amsterdam Short-Term Memory test: a new procedure for the detection of feigned memory deficits

    NARCIS (Netherlands)

    Schagen, S.; Schmand, B.; de Sterke, S.; Lindeboom, J.

    1997-01-01

    The validity of two malingering tests, the newly developed Amsterdam Short-Term Memory (ASTM) test and the Distraction test (Baker, Hanley, Jackson, Kimmance, & Slade, 1993) was examined in a group of patients with closed-head injury (CHI), a normal control group, and a control group with

  5. Data-driven Travel Demand Modelling and Agent-based Traffic Simulation in Amsterdam Urban Area

    NARCIS (Netherlands)

    Melnikov, V.R.; Krzhizhanovskaya, V.V.; Lees, M.H.; Boukhanovsky, A.V.

    2016-01-01

    The goal of this project is the development of a large-scale agent-based traffic simulation system for Amsterdam urban area, validated on sensor data and adjusted for decision support in critical situations and for policy making in sustainable city development, emission control and electric car

  6. Salt damage and RH changes: The case of the Waag Building in Amsterdam

    NARCIS (Netherlands)

    Hees, R.P.J. van; Lubelli, B.A.

    2007-01-01

    Changes in the air MM can cause damage to building materials contaminated with hygroscopic saus, even in the absence of any other moishwe source. This phenomenon has been observed in the case of the iflag build ing in Amsterdam, affècted by severe salt decay. The investigation, canied out by means

  7. Interobserver reliability of the Amsterdam Severity Scale in Stenosing Tenosynovitis (ASSiST)

    NARCIS (Netherlands)

    Peter, W.F.; Steultjens, M.P.M.; Mesman, T.; Dekker, J.; Hoeksma, A.F.

    2009-01-01

    STUDY DESIGN: Interobserver reliability study. INTRODUCTION: A scale was developed to measure the severity of stenosing tenosynovitis: the Amsterdam Severity Scale in Stenosing Tenosynovitis (ASSiST). PURPOSE OF THE STUDY: To study the interobserver reliability of the ASSiST. METHODS: Patients

  8. Microscopical examination of the effectiveness of conservation-treatment methods of the National Monument in Amsterdam

    NARCIS (Netherlands)

    Larbi, J.A.; Hees, R.P.J. van

    1999-01-01

    The Dutch National Monument in Amsterdam, a World War-II memorial structure, was built with an outer face consisting of slabs of travertine. In 1995, the masonry structure forming the core of the monument showed severe deterioration. In order to determine the actual cause of deterioration and to

  9. Occupational exposure to bloodborne viruses in the Amsterdam police force, 2000-2003

    NARCIS (Netherlands)

    Sonder, Gerard J. B.; Bovée, Lian P. M. J.; Coutinho, Roel A.; Baayen, Dorothé; Spaargaren, Joke; van den Hoek, Anneke

    2005-01-01

    Objectives: To assess and evaluate the rate and outcome of occupational exposure to hepatitis B virus (HBV), hepatitis C virus (HCV), and human immunodeficiency virus (HIV) in the Amsterdam police force. Methods: Retrospectively, all accidents with risk for viral transmission reported to the

  10. Patterns of retail location and urban form in Amsterdam in the mid-eighteenth century

    NARCIS (Netherlands)

    Lesger, C.

    2011-01-01

    In this article location theory is used to map and analyse the patterns of retail location in Amsterdam in the eighteenth century. In the city centre as well as along the main axes to markets and the city gates the retailing of shopping goods (textiles, consumer durables) was much more prominent

  11. The Central Institute forBrain Research in Amsterdam and its directors

    NARCIS (Netherlands)

    Eling, Paul; Hofman, Michel A

    2014-01-01

    The Central Institute for Brain Research was founded in Amsterdam in 1908 as part of an international effort to study the nervous system with multiple institutions and various disciplines. The development of research in the past hundred years at the Brain Institute has hardly been documented. We

  12. The importance of agglomeration effects for distribution centres around Amsterdam Airport Schiphol

    NARCIS (Netherlands)

    Warffemius, P.; van der Hoorn, T.; Klaassen, H.

    2010-01-01

    Amsterdam Airport Schiphol is a main European airport and represents an important concentration of European distribution centres (EDCs). It is commonly assumed that distribution centres are attracted to the airport region because of its air transport services. However, if one considers economies of

  13. Moving faces, looking places: validation of the Amsterdam Dynamic Facial Expression Set (ADFES)

    NARCIS (Netherlands)

    van der Schalk, J.; Hawk, S.T.; Fischer, A.H.; Doosje, B.

    2011-01-01

    We report two studies validating a new standardized set of filmed emotion expressions, the Amsterdam Dynamic Facial Expression Set (ADFES). The ADFES is distinct from existing datasets in that it includes a face-forward version and two different head-turning versions (faces turning toward and away

  14. Technical feasibility study for a solar energy system at Amsterdam Airport Schiphol (AAS)

    NARCIS (Netherlands)

    Janssen, P.N.J.W.; Myrzik, J.M.A.; Kling, W.L.; Reinders, L.

    2010-01-01

    This work arises within the framework of the introduction of renewable energies at Amsterdam Airport Schiphol (AAS) and the focus is on the technical feasibility of a solar energy system (SES) on ground level. The flight safety must always be guaranteed if solar panels are implemented on AAS. The

  15. Risks and interrelationships of subdistrict house prices : the case of Amsterdam

    NARCIS (Netherlands)

    Teye, A.L.; de Haan, J.G.; Elsinga, M.G.

    2017-01-01

    This paper uses individual house transaction data from 1995 to 2014 in Amsterdam to explore the risks and interrelationships of the subdistrict house prices. Simple indicators suggest that house prices grow faster and are more risky in the central business district and its immediate surrounding

  16. Reevaluation of the Amsterdam Inventory for Auditory Disability and Handicap Using Item Response Theory

    Science.gov (United States)

    Hospers, J. Mirjam Boeschen; Smits, Niels; Smits, Cas; Stam, Mariska; Terwee, Caroline B.; Kramer, Sophia E.

    2016-01-01

    Purpose: We reevaluated the psychometric properties of the Amsterdam Inventory for Auditory Disability and Handicap (AIADH; Kramer, Kapteyn, Festen, & Tobi, 1995) using item response theory. Item response theory describes item functioning along an ability continuum. Method: Cross-sectional data from 2,352 adults with and without hearing…

  17. Hypertension control in a large multi-ethnic cohort in Amsterdam, The Netherlands: the HELIUS study

    NARCIS (Netherlands)

    Agyemang, Charles; Kieft, Suzanne; Snijder, Marieke B.; Beune, Erik J.; van den Born, Bert-Jan; Brewster, Lizzy M.; Ujcic-Voortman, Joanne J.; Bindraban, Navin; van Montfrans, Gert; Peters, Ron J.; Stronks, Karien

    2015-01-01

    Hypertension is a major problem among European ethnic minority groups. We assessed the current situation of hypertension prevalence and its management among a multi-ethnic population in Amsterdam, The Netherlands. Data from the HELIUS study were used including 12,974 participants (1871 Ghanaian,

  18. Additional value of typing Noroviruses in gastroenteritis outbreaks in Amsterdam, The Netherlands

    NARCIS (Netherlands)

    Koek, A. G.; Bovée, L. P. M. J.; van den Hoek, J. A. R.; Bos, A. J.; Bruisten, S. M.

    2006-01-01

    In Amsterdam, 17 of the 55 gastroenteritis (GI) outbreaks reported from January 2002 to May 2003 were confirmed to be caused by noroviruses (NV). In this study, we describe the molecular epidemiology of a group of nine outbreaks associated with a catering firm and two outbreaks, 5 months apart, in

  19. When the spell is broken: gentrification, urban tourism and privileged discontent in the Amsterdam canal district

    NARCIS (Netherlands)

    Pinkster, F.M.; Boterman, W.R.

    2017-01-01

    Expansion of urban tourism in historic districts in European cities is putting increasing pressure on these areas as places to live. In Amsterdam, an ever-growing number of tourists visit the famous canal district, which also forms the home of a group of long-term, upper-middle-class residents.

  20. Advertising Amsterdam: the rise and growth of an international advertising industry

    NARCIS (Netherlands)

    Röling, R.

    2011-01-01

    Cultural industries have experienced dynamic growth in the Netherlands since the 1990s. Amsterdam is the indisputable cultural and creative capital of the country and one of the city’s most prominent cultural industries is the advertising industry. This study has explored processes of globalisation

  1. The HIV prevalence among pregnant women in the Amsterdam region (1988-1991)

    NARCIS (Netherlands)

    Bindels, P. J.; Mulder-Folkerts, D. K.; Boer, K.; Schutte, M. F.; van der Velde, W. j; Wong, F. J.; van den Hoek, A. J.; van Doornum, G. J.; Coutinho, R. A.

    1994-01-01

    The objective of the study was to monitor the HIV prevalence in the years 1988-1991 among pregnant women in the Amsterdam region, visitors to an abortion clinic and 3 outpatient infertility clinics. All women attending these clinics were asked to participate in the study on a voluntary basis and

  2. Building damage related to Amsterdam subway : Comparison of traditional monitoring with satellite monitoring results

    NARCIS (Netherlands)

    Korff, M.; Maccabiani, J

    2017-01-01

    This paper describes the evaluation of the monitoring data obtained from the construction of the North/South Line, a new subway line crossing the historic center of Amsterdam. During construction of the line (2003-2014), building deformations were monitored with Robotic Total Stations and with

  3. Hodorkovski advokaat : Venemaa ei ole õigusriik / Robert R. Amsterdam ; interv. Aleksei Günter

    Index Scriptorium Estoniae

    Amsterdam, Robert R.

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 24. juuli lk. 10. Naftamagnaadi Mihhail Hodorkovski advokaat vastab küsimustele, mis puudutavad ärimehe olukorda ja elamistingimusi vanglas ning tema võimalust ennetähtaegselt vabaneda. Lisa: Robert R. Amsterdam

  4. Astronomia instaurata? The third edition of Copernicus's De Revolutionibus (Amsterdam, 1617)

    NARCIS (Netherlands)

    van Netten, D.

    2012-01-01

    The article discusses the 1617 third edition of the book "De revolutionibus orbium coelestium" by Nicolaus Copernicus, published under the title "Astronomia instaurata (Restored astronomy)" in Amsterdam, the Netherlands, edited by Nicolaus Mulerius, and produced by Willem Janszoon. It considers why

  5. 20 Jahre Vertrag von Amsterdam: Reelle Vision oder reale Desillusion Europäischer Gleichstellungspolitik?

    NARCIS (Netherlands)

    Ahrens, P.; Scheele, A.; Vleuten, J.M. van der

    2016-01-01

    In 1997 the principles of gender mainstreaming and anti-discrimination based on sex, racial or ethnic origin, religion or belief, disability, age or sexual orientation were enshrined in the Treaty of Amsterdam. The introduction to this special issue takes stock of the results twenty years after and

  6. Towards sustainable urban distribution using city canals: the case of amsterdam

    NARCIS (Netherlands)

    van Duin, Ron; Kortmann, L.J.; van de Kamp, Maarten

    2017-01-01

    This study investigates whether a system of hub locations distributing goods across the water to the city of Amsterdam can be a potential future solution to guarantee same-day delivery to shopkeepers. A simulation model was developed to analyse the logistics performances and to optimise the number

  7. Towards sustainable urban distribution using city canals; the case of Amsterdam

    NARCIS (Netherlands)

    Dr. L.J. Kortmann; Dr. L.M. van de Kamp; dr. J.H.R. van Duin

    2017-01-01

    This study investigates whether a system of hub locations distributing goods across the water to the city of Amsterdam can be a potential future solution to guarantee same-day delivery to shopkeepers. A simulation model was developed to analyse the logistics performances and to optimise the number

  8. Estimating the size of the HIV epidemic among injecting drug users in Amsterdam

    NARCIS (Netherlands)

    van Haastrecht, H. J.; Bindels, P. J.; van den Hoek, A. A.; Coutinho, R. A.

    1997-01-01

    Aim of this study was to assess the cumulative incidence of HIV-infection, AIDS and pre-AIDS death in the population of injecting drug users (IDU) in Amsterdam. By assuming equivalence, between a cohort of IDU and the IDU population, of the ratios of incidences of AIDS and pre-AIDS death to the

  9. HIV prevalence, sexual risk behaviour and sexual mixing patterns among migrants in Amsterdam, The Netherlands

    NARCIS (Netherlands)

    Gras, M. J.; Weide, J. F.; Langendam, M. W.; Coutinho, R. A.; van den Hoek, A.

    1999-01-01

    To study (1) HIV prevalence; (2) sexual risk behaviour; (3) sexual mixing patterns; (4) determinants of disassortative (between-group) mixing among migrant groups in Amsterdam, the Netherlands and to gain insight into the potential for heterosexual spread of HIV/sexually transmitted diseases.

  10. Population-based study on the seroprevalence of parvovirus B19 in Amsterdam

    NARCIS (Netherlands)

    van Rijckevorsel, G. G. C.; Sonder, G. J. B.; Schim van der Loeff, M. F.; van den Hoek, J. A. R.

    2009-01-01

    A study was undertaken to estimate the seroprevalence of parvovirus B19 infection in the general adult population of Amsterdam, The Netherlands. To our knowledge this is the first study testing parvovirus B19 in a random sample of the Dutch adult population. The study was a cross-sectional survey,

  11. Greening the EU: National positions in the run‐up to the Amsterdam treaty

    DEFF Research Database (Denmark)

    Andersen, Mikael Skou; Liefferink, Duncan

    1998-01-01

    for an investigation into the 'self-perception' of the 'green' member states and for a detailed assessment of the national positions of the six countries with regard to environmental issues in the preparatory phase of the Amsterdam Treaty. Although the six 'forerunners' are often grouped together, differences among...

  12. The Amsterdam Hypermedia Model: Adding Time and Context to the Dexter Model

    NARCIS (Netherlands)

    L. Hardman (Lynda); D.C.A. Bulterman (Dick); G. van Rossum (Guido)

    1994-01-01

    textabstractFrom Computing Reviews, by Jeanine Meyer The purpose of this paper is to convince the reader of the need for a general model for hypermedia and present the Amsterdam hypermedia model (AHM) as fulfilling that need. Hypertext, which is described by the authors as a 'relatively mature

  13. 'Three centuries of urban and provincial public debt: Amsterdam and Holland'

    NARCIS (Netherlands)

    Fritschy, W.; M.Boone en C.A. Davids,

    2003-01-01

    An analysis of the development of Amsterdam's and Holland's public debt between 1500 and 1800 led to the following conclusion. If public finance is the nerve of any state-system, it is quite adequate to describe the Dutch Republic as a league of seven 'province-republics', much less so, however, to

  14. Die gebruik van parallelplaatreologie vir die bepaling van die intrinsieke viskositeit van poli-etileentereftalaat

    Directory of Open Access Journals (Sweden)

    O. C. Vorster

    2005-09-01

    Full Text Available Die bepaling van die intrinsieke viskositeit van poli-etileentereftalaat word bemoeilik deur die feit dat daar tans slegs twee metodes in gebruik is. In die eerste metode word die bepaling deur middel van oplossingsviskometrie gedoen, maar die toksisiteit van die oplosmiddel, asook die tydperk wat dit neem om die bepaling te doen, is ’n probleem. Die tweede metode word beperk deur die kompleksiteit en beskikbaarheid van die apparatuur in Suid-Afrika. In hierdie studie word ’n alternatiewe metode, gebaseer op parallelplaatreologie, voorgestel wat albei hierdie probleme oorkom en die resultate sodoende verkry, word vergelyk met dié wat met bestaande metodes verkry is.

  15. Ellis-van Creveld

    Directory of Open Access Journals (Sweden)

    Dhandabani Jayaraj

    2012-01-01

    Full Text Available Ellis-van Creveld (EVC syndrome is an autosomal recessive disorder that is also known as chondro-ectodermal dysplasia. The common manifestations of this syndrome are short ribs, postaxial polydactyly, growth retardation, and ectodermal and cardiac defects. The present case report is about an 8-year-old boy who had the features of bilateral hexadactyly, knocked knees, cardiac problems, congenital absence of incisors, fused upper and lower labial frenulum, and mulberry molars.

  16. Leren van ver weg

    NARCIS (Netherlands)

    Switzer, Andrew

    2016-01-01

    Van de week kreeg ik in mijn klushuis in de Bijlmer bezoek over de vloer: een onderzoekster uit het verre São Paulo die samen met collega’s aan een project over zel ouw werkt. Wie aan zel ouw in Brazilië denkt, komt al snel uit op de favela’s en het valt te betwijfelen of er vraag is naar dit soort

  17. Local health systems in 21st century: who cares?-An exploratory study on health system governance in Amsterdam.

    Science.gov (United States)

    Plochg, T; Delnoij, D M J; Hogervorst, W V G; van Dijk, P; Belleman, S; Klazinga, N S

    2006-10-01

    There is a growing awareness that there should be a public health perspective to health system governance. Its intrinsic population health orientation provides the ultimate ground for determining the health needs and governing collaborative care arrangements within which these needs can be met. Notwithstanding differences across countries, population health concerns are not central to European health reforms. Governments currently withdraw leaving governance roles to care providers and/or financiers. Thereby, incentives that trigger the uptake of a public health perspective are often ignored. In this study we addressed this issue in the city of Amsterdam. Using a qualitative study design, we explored whether there is a public health perspective to the governance practices of the municipality and the major sickness fund in Amsterdam. And if so, what the scope of this perspective is. And if not, why not. Findings indicate that the municipality has a public health perspective to local health system governance, but its scope is limited. The municipality facilitates rather than governs health care provision in Amsterdam. Furthermore, the sickness fund runs major financial risks when adapting a public health perspective. It covers an insured population that partly overlaps the Amsterdam population. Returns on investments in population health are therefore uncertain, as competitors would also profit from the sickness fund's investments. The local health system in Amsterdam is not consistently aligned to the health needs of the Amsterdam population. The Amsterdam case is not unique and general consequences for local health system governance are discussed.

  18. Onderzoek naar de effecten van snoezelen op het gedrag van demente verpleeghuisbewoners en de werkbeleving van verzorgenden.

    NARCIS (Netherlands)

    Weert, J. van; Peter, J.; Dulmen, S. van; Ribbe, M.; Bensing, J.

    2004-01-01

    Het effect van snoezelen in de 24-uurszorg op de stemming en het gedrag van demente ouderen is nooit eerder onderzocht. Ook is in geen van de eerdere studies het effect onderzocht van snoezelen op de werkbeleving van verzorgenden. Uit onderzoek is bekend dat in verpleeghuizen waar geen

  19. Rituele van plesier: Dolf van Coller se Die Bieliebalies

    Directory of Open Access Journals (Sweden)

    J. van Wyk

    1998-04-01

    Full Text Available Rituals of pleasure: Dolf van Coller’s Die Bieliebalies This article is an analysis of Dolf van Coller's Die Bieliebalies (1993, read as a hedonist text. It has many points of similarity with what Bakhtin (1984 called grotesque realism, and with Nietzsche’s views as expounded in The birth of tragedy (1956. By comparing Van Caller's text to that of Bakhtin and Nietzsche, a counter-discourse to contemporary moral discourses such as feminism is explored. Van Coller’s use of laughter as a relativising mechanism is very liberating in the context where petty morality intervenes dogmatically in the field of literature and other spheres of life.

  20. Toepassing van finite difference- en finite element methoden voor het oplossen van een aantal stationaire grondwaterstromingsproblemen

    NARCIS (Netherlands)

    Wesseling, J.G.

    1977-01-01

    In dit verslag worden de oplossingsmethoden met de bijbehorende zelfontwikkelde FORTRAN computerprogramma's van de volgende stationaire grondwaterstromingsgevallen gegeven: - Analyse van de grondwaterstroming in een horizontaal vlak over een gedeelte van de Astense Aa, waar van plaats tot plaats

  1. Advies voor de toepassing van ground-penetrating radar bij de inventarisatie van de grondwaterdynamiek

    NARCIS (Netherlands)

    Knotters, M.

    2001-01-01

    Ground-penetrating radar (GPR) biedt mogelijk een nauwkeurig alternatief voor arbeidsintensieve metingen van de grondwaterstand in boorgaten. De GPR-metingen kunnen als hulpinformatie dienen bij geostatistische interpolatie van grondwaterstanden. Op basis van literatuurstudie en verkenning van het

  2. Bepaling van enkele neurotransmitters, monoaminen, en metabolieten, met behulp van Continuous Flowapparatuur

    NARCIS (Netherlands)

    Eigeman L; Schonewille F; Borst M; van der Laan JW

    1986-01-01

    Bij het onderzoek in de psychofarmacologie kan kennis van de effecten van stoffen op de omzettingssnelheid van neurotransmitters een belangrijk aspect zijn. Met de huidige psychofarmaca lijken vooral de klassieke neurotransmitters zoals de monoaminen, noradrenaline, dopamine en serotonine van

  3. Kansen voor conflictbemiddeling : Verslag van een onderzoek naar de toepassingsmogelijkheden van conflictbemiddeling

    NARCIS (Netherlands)

    Geveke, Henk; Plant, Ernelies; Thieme, Marianneke; Verberk, Marielle

    1998-01-01

    In opdracht van het Platform ADR, een klankbordgroep en denktank op het gebied van alternatieve geschilbeslechting, is onderzoek verricht naar de toepasbaarheid van een specifieke vorm van Alternative Dispute Resolution (ADR): conflictbemiddeling (mediation). De onderzoeksopdracht was als volgt: het

  4. Chloroplast DNA haplotype samenstelling van eikenopstanden (categorie "van bekende origine") van de Rassenlijst van Bomen; een aanvullende methode voor identificatie van autochtoniteit

    NARCIS (Netherlands)

    Buiteveld, J.; Boerwinkel, M.C.; Bovenschen, J.; Kranenborg, K.G.; Vries, de S.M.G.

    2005-01-01

    Tegenwoordig kan autochtoon materiaal op de Rassenlijst van Bomen geplaatst worden in de categorie `van bekende origine¿ en heeft daardoor een `officiële¿ status. Identificatie van autochtone opstanden blijft echter nog een lastige zaak. Momenteel worden autochtone opstanden geïdentificeerd met de

  5. Een schrijfstertje van Vermeer: Jacob Oortman en de Dissius-veiling van 1696

    NARCIS (Netherlands)

    Grijzenhout, F.

    2010-01-01

    Until now, only five of the 21 paintings by Vermeer that were sold at the famous Dissius aucton on 16 May, 1696, in Amsterdam, could be traced during the first half of the 18th century. The 'Milkmaid' (Amsterdam), 'Woman holding a balance' (Washington), 'A maid asleep' (New York) and the 'Music

  6. Bepaling van 14C in afvalwater

    NARCIS (Netherlands)

    Hiemstra YS; Kwakman PJM; Nissan LN; Aldenkamp FJ; LSO

    1998-01-01

    In opdracht van de Hoofdinspectie Milieuhygiene van het ministerie van VROM heeft LSO een methode ontwikkeld om 14C in afvalwater van nucleaire installaties te bepalen. De methode meet organisch gebonden-14C en anorganisch-14C in de vorm van carbonaat (14CO32-) in afvalwater. Het rapport

  7. De syntaxis van de Italiaanse preposities

    NARCIS (Netherlands)

    Boer, M.G. de

    2010-01-01

    SAMENVATTING In dit hoofdstuk wordt een inventaris opgesteld van de Italiaanse preposities die voorkomen in een corpus bestaande uit de romans La Ciociara van Moravia en Il Gattopardo van Tomasi di Lampedusa. Achtergrond voor de herkenning van preposities is de Extended Standard Theory van de

  8. Hoge resolutie typering van Coxiella burnetii

    NARCIS (Netherlands)

    Janse, I.; Bossers, A.; Roest, H.I.J.; Rotterdam, van B.

    2011-01-01

    Dit rapport beschrijft het onderzoek wat uitgevoerd is in het kader van het project ‘Hoge Resolutie Typering Coxiella burnetii’’. Het doel van dit project was om de genoomsequenties van een aantal Nederlandse isolaten van de bacterie Coxiella burnetii, de veroorzaker van Q-koorts, in kaart te

  9. Studentopinie als onderdeel van Cursuskwaliteit : Quickscan

    NARCIS (Netherlands)

    Elzinga, Hanny; Groenewoud, Jan; Ike, Paul; Loth, Betram; Reitsma, Sieuwke; Schotanus, Janke; Schuurman, Mieke; Steur, Jessica

    2015-01-01

    In het kader van dit onderzoek is een quickscan (15 vragen) opgesteld met als doel die informatie te verzamelen die nodig is om een eerste indicatie te krijgen van de kwaliteit van een cursus (vak). De quickscan is gebaseerd op literatuuronderzoek en best practices van de faculteiten van de

  10. Effectiviteit van markting management support systemen

    OpenAIRE

    Bruggen, Gerrit; Smidts, Ale; Wierenga, Berend

    1994-01-01

    textabstractVerhoogt het gebruik van marketing management support systemen de kwaliteit van marketingbeslissingen? En zo ja, onder welke omstandigheden? Aan de hand van een experimenteel laboratoriumonderzoek met het simulatiespel MARKSTRATonder 80 marketing managers en 160 studenten, kan de eerste vraag positief worden beantwoord. Omstandigheden als tijdsdruk, ervaring in het nemen van marketingbeslissingen en de analytische capaciteiten van de gebruikers vormen een belangrijk aandachtspunt ...

  11. Barcode van DNA. Democratisering van de taxonomie door digitaal identificatiesysteem

    NARCIS (Netherlands)

    Bakker, F.T.

    2011-01-01

    Het herkennen van biologische soorten aan de hand van een gestandaardiseerde DNA-barcode heeft de laatste tijd een enorme vlucht genomen. Gedreven door aan de ene kant de biodiversiteitscrises en de mogelijke global change, en aan de andere kant zowel razendsnelle technologische vooruitgang als ook

  12. De invloed van bodemreiniging op de biologische beschikbaarheid van metalen

    NARCIS (Netherlands)

    Adema DMM*; Boer JLM de; Gestel CAM van; Jong P de*

    1987-01-01

    Er werd onderzoek uitgevoerd met als doel het uitlooggedrag en de biologische beschikbaarheid van metalen in verontreinigde gronden voor en na reiniging te bepalen. Dit (deel)rapport beschrijft de resultaten van het onderzoek naar de biologische beschikbaarheid. Op zes locaties in Nederland

  13. Dutch Water Mining: Potentie van een zuiverend landschap van overvloed

    NARCIS (Netherlands)

    Os, van E.; Kruijs, A.; Bomas, B.; Poelman, M.; Pater, de M.; Bokhoven, van D.

    2012-01-01

    De blauwalg in het Volkerak - Zoommeer zorgt jaarlijks voor veel overlast. In de zomerperiode zijn giftig water en stank een hinderlijk fenomeen voor iedereen. Met de techniek Dutch Water Mining verdwijnt de overlast van blauwalgen. Voor de omliggende landbouwbedrijven ontstaat de zekerheid van een

  14. Betekenis van Legionella-soorten voor preventiebeleid van leidingwaterinstallaties

    NARCIS (Netherlands)

    Versteegh JFM; Brandsema PS; Lodder WJ; de Roda Husman AM; Schalk JAC; van der Aa NGFM; IMG; LZO; EPI

    2009-01-01

    Het RIVM adviseert om de huidige normstelling voor het preventiebeleid van Legionella te handhaven en niet uitsluitend op Legionella pneumophila te richten. Als andere Legionella-soorten worden aangetroffen kan er ook groei van Legionella pneumophila optreden. Als er dan geen maatregelen worden

  15. Het dichtwerk van Jan van Foreest (1585-1651)

    NARCIS (Netherlands)

    Vries, M. de

    2007-01-01

    The dissertation consists of an edition of Jan van Foreest's Greek poems and the greater part of those written in Latin, provided with translations and a succinct commentary in Dutch. A number of the Latin poems appears in print for the first time ever. Jan van Foreest (1586-1651) studied arts at

  16. Prestatiemeting ten tijde van economische crisis: de aanpak van DSM

    NARCIS (Netherlands)

    van Rinsum, M.; den Dekker, R.; Maas, V.

    2011-01-01

    Deze studie besteedt aandacht aan de gevolgen van de financiële crisis voor het prestatiemeetsysteem van een onderneming. Vanwege de financiële crisis hebben veel ondernemingen naast langetermijndoelstellingen ook een aantal kortetermijndoelstellingen geformuleerd die betrekking hebben op hun

  17. Stabilisatie en samenstelling van het glycosidenmengsel van Folia digitalis

    NARCIS (Netherlands)

    Tattje, Derk Hendrik Evert

    1952-01-01

    Na een korte inleiding wordt een omschrijving van het begrip stabilisatie gegeven en besproken hoe deze stabilisatie, dit is het irreversibel inactiveren van de enzymen, in het algemeen tot stand kan worden gebracht. Tevens wordt nagegaan of ook door verschillende oplosmiddelen reeds bij gewone

  18. Verzuring van bodem en grondwater als gevolg van atmosferische depositie

    NARCIS (Netherlands)

    Hoeks, J.

    1983-01-01

    In het kader van de Tweede-Kamer-rapportage over verzuring door atmosferische depositie heeft het ICW een bijdrage geleverd aan het deelrapport over effecten op bodem en grondwater. Deze ICW-notitie is hier nu nader uitgewerkt, waarbij vooral aandacht wordt besteed aan de methode om effecten van

  19. die rol van die unieverdedigingsmag in die onderdrukking van die

    African Journals Online (AJOL)

    agv regeringsoptrede nie.39. Siotsom. In die geskiedenis van die Unieverdedigings- mag word die gebeure random die 1914-staking oorskadu deur die Rebellie en Suid-Afrika se deelname aan die Eerste Wereldoorlog. Tog was dit 'n belangrike mylpaal in die geskiedenis van die organisasie, omdat dit sy eerste optrede ...

  20. Vergelyking van twee metodes vir die bepaling van vitamien A ...

    African Journals Online (AJOL)

    Vergelyking van twee metodes vir die bepaling van vitamien A. J.J. Erasmus. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's ...

  1. Invloed van waterconditioners en hulpstoffen op de effectiviteit van gewasbeschermingsmiddelen

    NARCIS (Netherlands)

    Zeeland, van M.G.

    2007-01-01

    In 2005 heeft de gebruikerscommissie naar aanleiding van de literatuurstudie over hulpstoffen drie aanbevelingen voor verder onderzoek geformuleerd. In 2006 zijn twee daarvan in onderzoek genomen, namelijk: wordt door toevoegen van waterconditioners (Easi-mix, Intake, X-change) aan hard water de

  2. Die konteks vir die keuse van geriefsvoedsel van bepaalde ...

    African Journals Online (AJOL)

    Seugnet

    70. Die konteks vir die keuse van geriefsvoedsel van bepaalde beroepsvroue *. Martha Kok en Priscilla Botha. ABSTRACT. The purpose of this research is to understand and describe the context in which career women choose, purchase and use convenience food (CF). A person is rarely isolated from or unaffected by.

  3. De beoordeling van arbeidsongeschiktheid in Engeland

    NARCIS (Netherlands)

    Zuidam, W.; Cremer, R.; Brenninkmeijer, V.; Boer, W. de

    2003-01-01

    In het kader van een studie naar verschillende vormen van claimbeoordeling in 14 landen bezochten Wendy Zuidam en Roel Cremer Engeland om daar de privaat uitgevoerde arbeidsongeschiktheidsbeoordeling in kaart te brengen. In dit artikel wordt verslag gedaan van hun bevindingen.

  4. Medische begeleiding produktiepersoneel uit oogpunt van produktbescherming

    NARCIS (Netherlands)

    Boot R; Bremer VHP; Hannik CA; Middelkoop-Selman YB; van Steenis G

    1986-01-01

    Dit rapport bevat globale richtlijnen betreffende gezondheidsaspecten van personeel, binnen het RIVM betrokken bij de bereiding van biologische prudkten voor humane toepassing, gericht op bescherming van deze produkten. In het rapport : a) wordt het betreffende produktiepersoneel (PP) nader

  5. Genetiese parameters van speenkafrf^ eienskappe by ...

    African Journals Online (AJOL)

    Genetiese en. Omgewingsparameters van 'n VIeisraskudde. Ph.D.-tesis,. Univ. van die Oranje-Vrystaat. VAN MARLE, J., 1964. Untersuchungen tiber Einfltisse von. Umwelt und Erbanlage auf die Gewichtsentwicklung von. Fleischrinden unter extensiven Weidebedingungen der. Versuchstation Armoedsvlakte in Stidafrika.

  6. 3D-computersimulatie van het verhardingsproces

    NARCIS (Netherlands)

    Eijk, van R.J.; Brouwers, H.J.H.

    2000-01-01

    De ontwikkeling van geavanceerde meettechnieken heeft het mogelijk gemaakt de structuur van cement en zijn hydratatieproducten te volgen en zo meer inzicht te krijgen in het ingewikkelde hydratatieproces. De beschikbaarheid van rekenkracht en vernieuwde kennis over de hydratatieproducten en

  7. Effectiviteit van markting management support systemen

    NARCIS (Netherlands)

    G.H. van Bruggen (Gerrit); A. Smidts (Ale); B. Wierenga (Berend)

    1994-01-01

    textabstractVerhoogt het gebruik van marketing management support systemen de kwaliteit van marketingbeslissingen? En zo ja, onder welke omstandigheden? Aan de hand van een experimenteel laboratoriumonderzoek met het simulatiespel MARKSTRATonder 80 marketing managers en 160 studenten, kan de eerste

  8. Status, near future and distant future of the Amsterdam electron scattering facility

    International Nuclear Information System (INIS)

    Vries, C. de.

    1982-01-01

    The experimental program with the electron Medium Energy Accelerator (MEA), located in Amsterdam, has been started. The general design features of the accelerator and electron scattering facilities are summarised in an Appendix. Some aspects of the Amsterdam instrumentation are discussed which have shown to be of importance from the point of view of flexibility, reproducibility, ease of tuning for high resolution and other time-saving elements. As such they are believed to be of importance for the design of future - especially third generation - facilities. Some of the on-going and near future experiments are presented, emphasizing those which have become within experimental reach due to the advanced level of instrumentation. Finally preliminary ideas are presented on how to increase the accelerator duty factor in the distant future by adding a pulse stretcher device, while maintaining all of the present buildings and 500 MeV equipment. (Auth.)

  9. [The zoological garden of Amsterdam Natura Artis Magistra during world War II].

    Science.gov (United States)

    Frankenhuis, Maarten Th

    2009-01-01

    Thanks to the wise management of its director, dr. Armand Sunier, and his team, 'Artis' survived the difficult war period without great losses of its animals and only material damage to some buildings. Artis has meant very much for the inhabitants of the city of Amsterdam during the war. In the first place for the employees and their families, that were kept for starvation and forced labour by extra rations of food and safe hiding places. But also for jewish persons in hiding, who could escape from a certain death by hiding in animal houses or other buildings in the garden. And also for hundreds of thousands people of Amsterdam who found in their zoological garden an oasis of relaxation in a town full of threat and violence.

  10. De metafoor van het washandje. Column

    Directory of Open Access Journals (Sweden)

    Yolan Koster-Dreese

    2007-03-01

    Full Text Available In hun artikel ‘Kwaliteit en Zorg’ van ruim tien jaar geleden stellen Van Houten en Prins (1995 dat de thans vigerende zorgtaal in meer algemene zin kan worden aangeduid als ‘zorg-Taylorisme’: een scientific management-benadering van zorg. Met de introductie van de ‘zorgmarkt’ is een benadering ontstaan die grote overeenkomsten vertoont met die scientific management-benadering uit het begin van de vorige eeuw, zo menen Van Houten en Prins.

  11. Overleving van pathogenen bij mestverwerking

    NARCIS (Netherlands)

    Hoeksma, P.; Rutjes, S.; Aarnink, A.J.A.; Blaak, H.; Buisonjé, de F.E.

    2016-01-01

    In de producten van verschillende mestverwerkingsprocessen zijn de concentraties gemeten van een aantal pathogenen. De resultaten laten zien dat mechanische scheiding vrijwel geen effect heeft op het aantal pathogenen. Vergisting heeft weinig effect op virussen en grampositieve bacteriën, maar

  12. Die binding van die konfessie

    Directory of Open Access Journals (Sweden)

    P. J. Coetzee

    1970-05-01

    Full Text Available Ons moet waak teen twee uiterstes. Aan die een kant het die dogma as onversoenlike vyand die dogmatisme en aan die ander kant die antidogmatisme — dit hou enersyds die gevaar in van verabsolutering (oorskatting, en ander- syds die gevaar van relativisme (onderskatting.

  13. Fractioneren van gras en luzerne

    NARCIS (Netherlands)

    Kasper, G.J.

    1998-01-01

    Gewasfractionering is de mechanische scheiding van gewassen in een aantal fracties voor een betere benutting van het oorspronkelijke materiaal. Het is een proces waarbij de bladrijke plant sterk gekneusd en samengeperst wordt. Hierdoor ontstaat een relatief eiwitrijke en een vezelarme sapfractie en

  14. DIE GESKIEDENIS VAN AFDELING LOGISTIEK

    African Journals Online (AJOL)

    1 Aug 1978 ... dan ook aangebied, Agv die probleem wat ont- staan het met die gebrek aan goedgekeurde poste vir die Afdeling en as gevolg van die ver- wagte vertraging met die ondersoek van die. DOS-span, het die Afdeling Logistiek en Afde- ling Personeel oorleg gepleeg en laasgenoemde het ingestem dat die ...

  15. prosesseringsmetodes op die voedingswaarde van

    African Journals Online (AJOL)

    gebring is, kon geen betekenisvolle verskille tussen die drie monsters gevind word nie. Volgens Opstvedt (1976) kan ME waardes ook dien as 'n kriteria van proteien- kwaliteit, hoofsaaklik a.g.v. die verhoogde stikstofuit- skeiding in die urine wat sal plaasvind a.g.v. beskadiging van aminosure. De Groote (1968) het gevind ...

  16. De stijl van gewoon proza

    NARCIS (Netherlands)

    Fagel-de Werd, Suzanne

    2015-01-01

    Ook gewóón proza heeft stijl. Dat is de argumentatieve stelling die in de titel van dit proefschrift verborgen zit. Vaak wordt stijl gelijkgesteld met het gebruik van stijlfiguren en wordt daarnaast aangenomen dat er dus ook zoiets bestaat als proza zonder stijl. Dat ook ‘gewoon’ proza stijl heeft

  17. Integrale diergezondheid : beheersing van leverbot

    NARCIS (Netherlands)

    Neijenhuis, F.; Verkaik, J.C.; Verwer, C.M.; Smolders, E.A.A.; Wagenaar, J.P.

    2014-01-01

    Leverbotinfecties zijn in toenemende mate een knelpunt in de diergezondheid van melkvee en andere herkauwers. Bestrijding en/of behandeling van leverbot kent de volgende beperkingen: de besmettingscyclus is complex, beschikbare geneesmiddelen zijn in Nederland nagenoeg niet inzetbaar bij dieren die

  18. De materiaaleigenschappen van houtachtige materialen

    NARCIS (Netherlands)

    Kuilen, J.W.G. van de

    2000-01-01

    Naast gezaagd hout en gelamineerd hout is een uitgebreid palet aan houtachtige (plaat)materialen ontwikkeld, waarvan triplex en Oriented Strand Board tot de meest gebruikte behoren. Een van de eerste typen plaatmateriaal ontwikkeld op basis van hout is triplex. Daarna zijn vele typen platen

  19. De prijsgevoeligheid van huishoudelijk watergebruik.

    NARCIS (Netherlands)

    Kooreman, P.

    1993-01-01

    Het kabinet wil het mogelijk maken dat huishoudens een rekening krijgen voor waterverbruik, rioolrechten en zuiveringsheffing. De hoogte van die rekening moet geheel afhankelijk zijn van de hoeveelheid water die het huishouden verbruikt. De achterliggende gedachte hierbij is dat dit mensen ertoe zal

  20. Aernout van Buchel in Napels

    NARCIS (Netherlands)

    de Jong, Jan; Kemper, J.A.R.

    2012-01-01

    Aernout van Buchel a Napoli Il 18 ottobre 1587, dopo un viaggio in Germania, il giovane studioso olandese Aernout van Buchel (Buchellio/Arnoldus Buchellius) da Utrecht arrivò in Italia. Il suo scopo fu visitare Roma ed esaminare, con i propri occhi, i monumenti e le iscrizioni dell’Antichità. Fin da

  1. Huisverkoop van biologisch vlees : handboek

    NARCIS (Netherlands)

    Heijden, van der C.H.T.M.

    2005-01-01

    Voor biologische boeren die willen beginnen met de verkoop van biologisch vlees aan huis, is het 'Handboek Huisverkoop Biologisch Vlees' samengesteld. Het handboek bevat o.a. marketingtips en een overzicht van de wet- en regelgeving. Het is opgesteld door Wageningen UR in samenwerking met Biologica

  2. Management control van ondersteunende diensten

    NARCIS (Netherlands)

    Vosselman, E.G.J.

    1996-01-01

    In dit artikel worden alternatieve inrichtingstypen van ‘management control’-systemen voor ondersteunende (facilitaire) diensten algeleid. Daaraan voorafgaand wordt de ‘management control’-functie in algemene zin beschreven. Het oorspronkelijke ‘management control’ raamwerk van Anthony (1988) wordt

  3. Meningen van kinderen over natuurverlies

    NARCIS (Netherlands)

    Mabelis, A.A.

    1999-01-01

    Ongeveer 400 leerlingen van basisonderwijs en middelbaar onderwijs (MAVO en MAVO/VBO) in de regio Amerongen-Veenendaal werden geenqueteerd over hun gevoelens m.b.t. natuurverlies (uitsterven van soorten; bossterfte) en milieuverontreiniging (water-, bodem- en luchtverontreiniging; kernramp). Verder

  4. Human (InConsistencies in Ian McEwan’s Amsterdam

    Directory of Open Access Journals (Sweden)

    Anghel Florentina

    2016-12-01

    Full Text Available Ian McEwan’s Amsterdam has supplied its readers with psychological, moral and social topical issues presented in an easy flowing and exhilarating style. Starting from the assumption that life consists of a series of inconsistencies which are inherent and bring their contribution to the individual’s formation, the paper aims at demonstrating that the protagonists’ judgmental and moral inconsistencies, which are used as a plot generator and are environmentally determined, reveal features of their personality.

  5. Sur deux Cynoglossus de la collection ichthyologique du Zoölogisch Museum, Amsterdam

    NARCIS (Netherlands)

    Chabanaud, Paul

    1951-01-01

    Sous le nom de Cynoglossus xiphoideus Günther, la collection ichthyologique du Zoölogisch Museum, Amsterdam possède 2 spécimens dont l’un est originaire de Shanghaï et l’autre, de la mer de Timor. Le spécimen de Shanghaï a été cédé au Zoölogisch Museum (sans doute à titre d’échange) par le British

  6. Broeigedrag en -sukses van tuinduiwe

    Directory of Open Access Journals (Sweden)

    Pieter le Roux

    2013-02-01

    Full Text Available Broei-aktiwiteite van tuinduiwe (Columba livia in die Bloemfonteinse stadsgebied vind dwarsdeur die jaar plaas met ’n afname gedurende die laat somermaande wanneer seisoenale reënval in die streek ’n hoogtepunt bereik. Nesstrukture is relatief primitief en word gekenmerk deur ’n losse samestelling van nesmateriaal op opgehoopte, droë voëlmis. Broeisels van twee eiers is die mees algemene grootte en die eiers word gewoonlik binne twee dae ná mekaar gelê. Beide ouers is by die broeiproses van meer as twee weke betrokke, waartydens die eiers ’n progressiewe afname in massa ondergaan. Pas uitgebroeide neskuikens is met geel dons bedek en is grootliks hulpeloos. Egte vere begin eers ná die eerste week te voorskyn kom, en vanaf die derde week kan individue wankelrig rondbeweeg. Afgesien van die eerste paar dae na uitbroei, handhaaf neskuikens van seldsame enkeleier-broeisels deurgaans ’n laer liggaammassa as dié van normale broeisels. Die broeisukses van 247 broeipare vir hierdie studie is 34%. Eierverlies is hoër as die mortaliteitsyfer van neskuikens, en word veral deur klimaatsfaktore soos reënval geaffekteer. Predasie blyk die belangrikste faktor te wees wat die mortaliteitsyfer van neskuikens beïnvloed. Antagonistiese interaksie tussen krans- en tuinduiwe, asook moontlike intraspesie-aggressie, speel egter ook ’n beduidende rol.

  7. Filosofiese tendense in die wordinggeskiedenis van ons verstaan van die fisiese natuur

    Directory of Open Access Journals (Sweden)

    D. F. M. Strauss

    2006-09-01

    Full Text Available Die ontstaan van ’n lang tradisie van natuurwetenskaplike denke is in antieke Griekeland te vind – die bakermat van die Westerse beskawing en die bron van geartikuleerde rasionele besinning. Die vroegste fases van die Griekse kultuur het reeds geboorte geskenk aan ’n teoretiese nadenke oor die heelal. Die Pythagoreërs is veral bekend vir hul klem op die verklaringskrag van getalsverhoudinge. In hul tese dat “alles getal is” het hulle egter slegs rasionale getalle (breuke erken en gevolglik uiteindelik vasgeloop in die ontdekking van irrasionale getalle wat tot die geometrisering van die Griekse wiskunde gelei het en tegelyk die bedding gevorm het van waaruit ’n magtige tradisie van ruimte-metafisika gegroei het wat die hele middeleeuse tydperk omspan het. Die vermeende statiese syn is in die mees ekstreme geval – die skool van Parmenides en die argumente van Zeno teen veelheid en beweging – tot in die uiteindelike antinomiese konsekwensies daarvan deurdink. Dit was egter eers die vroeg-moderne tyd – die voorgangers en nakomelinge van Galilei – wat naas getal en ruimte ’n waardering ontwikkel het vir die verklaringskrag van beweging (vergelyk die klassieke meganistiese wêreldbeeld van die heelal as ’n meganisme van stofdeeltjies in beweging. Maar ook hierdie meganistiese reduksie (waardeur alle fisiese verskynsels herlei is tot die beweging van al of niegelade massapunte sou uiteindelik misluk omdat dit nie van die onomkeerbaarheid van fisiese prosesse rekenskap kon gee nie. Gevolglik beliggaam eers die fisika van die 20ste eeu ’n erkenning van die deurslaggewend-stempelende rol van energie-werking (dus van die fisiese aspek in die aard van stoflike dinge en prosesse. Die artikel word afgesluit met ’n vlugtige verduideliking van die implikasies van die voorafgaande argumentasie vir ’n benadering van die misterie van die bestaan van materie.

  8. Beoordeling van de gevoeligheid van soorten en habitattypes van Europees belang bij verstoringingrepen

    OpenAIRE

    Wouters, Jan

    2011-01-01

    Om ecologische schade te vermijden, moeten activiteiten of plannen met mogelijk schadelijke effecten doorgelicht worden. Het instrument ‘effectenindicator’ licht activiteiten in algemene termen door op mogelijke natuureffecten. De in dit advies weergegeven gevoeligheidstabellen geven de gevoeligheid op van soorten en biotopen voor effecten ten gevolge van menselijke activiteiten. De tabellen bevatten deze gegevens voor de soorten waarvoor gewestelijke instandhoudingsdoelstellingen zijn opgest...

  9. Overzicht van de onderzoekresultaten van kroketten, bitterballen en frikandellen van 1986

    NARCIS (Netherlands)

    Cazemier, G.; Veen, van der N.G.

    1987-01-01

    In 1986 werden in opdracht van de AID 54 monsters frikandellen en 237 monsters kroketten en bitterballen door het RIKILT onderzocht op de eisen, zoals die zijn vastgelegd in de Kwaliteitsverordening Kroketten, Bitterballen en Frika(n)dellen. In dit verslag zijn de analyseresultaten van deze monsters

  10. Ontwikkeling van een protocol voor de transformatie van iris; introductie van resistentie tegen irismozaik viris (IMMV)

    NARCIS (Netherlands)

    Langeveld, S.A.; Klerk, de G.J.M.

    2004-01-01

    Twee iris cultivars, Blue Magic en Blue Sail, werden in weefselkweek gebracht en callus werd geïnduceerd. Dit callus werd genetisch gemodificeerd met virusresistentie via de particle gun procedure die eerder voor lelie was ontwikkeld. Van een van de cultivars, Blue Magic, werden getransformeerde

  11. Die hermeneutiek van gereformeerde kerkreg

    Directory of Open Access Journals (Sweden)

    Andries le Roux du Plooy

    2012-10-01

    Full Text Available Die artikel het op die belangrikheid en noodsaaklikheid van ‘n hermeneutiek vir die gereformeerde kerkreg gefokus. Die kerkregtelike dokument wat besonderlik ter sake was, is die kerkorde van die Gereformeerde kerke in Suid-Afrika, met sy besondere band met die Dordtse kerkorde van 1618 en 1619. Agtereenvolgens is aandag gegee aan die volgende aspekte soos (1 die eiesoortige aard van ‘n kerkorde as ‘n teologiese dokument en teks, in onderskeiding van regsdokumente; (2 die aard van die hermeneutiek van kerkreg; (3 enkele teorieë oor die interpretasie of uitleg van tekste, veral regstekste en (4 normatiewe vooronderstellings en reëls vir die interpretasie en verstaan van die teks en artikels van die kerkorde asook besluite van kerklike vergaderinge. Die gevolgtrekking was dat weinig indringende navorsing gedoen is oor die saak van hermeneutiek vir kerkreg, hoewel dit noodsaaklik is. Duidelike hermeneutiese reëls is gesuggereer en verduidelik, wat sou kon meehelp dat kerke en kerklike vergaderinge die artikels van die kerkorde asook besluite en reglemente wat daarop berus het, kan interpreteer en toepas. The hermeneutics of reformed church polity. The article focused on the importance and urgency of a design for reformed hermeneutics on church polity. The Church Order referred to in the article is the Church Order of the Reformed Churches in South Africa, which are closely related to the Church Order of Dordt of 1618 and 1619. The following aspects received attention namely (1  the unique character of a Church Order, in comparison to and distinguished from legal documents and statutes; (2 the character and nature of hermeneutics of church polity; (3 theories of interpretation in the common law tradition and their relevance to church polity and (4 normative presuppositions and marks for the interpretation and understanding of the text and articles of the Church Order, as well as the resolutions of church assemblies. It was found that

  12. Resultaten van het Rijkswaterstaat JAMP 2009 monitoringsprogramma van bot (Platichthys flesus L.). Biologische gegevens van bot en milieukritische stoffen in bot

    OpenAIRE

    Hoek-van Nieuwenhuizen, van, M.; Barneveld, van, E.

    2010-01-01

    De in dit rapport beschreven werkzaamheden zijn in 2009 door IMARES uitgevoerd op basis van een opdracht van Rijkswaterstaat in het kader van het Joint Assessment and Monitoring Program van de OSPARCOM. De opdracht hield in het verkrijgen van biologische gegevens van bot (visziekten). De benodigde monsters bot werden verzameld door IMARES. Tevens werd materiaal van bot verzameld voor chemisch onderzoek en geanalyseerd.

  13. Stroming en samenstelling van de sprengen en het grondwater van de Veluwe in 1996; een vergelijking met de toestand van 1986

    NARCIS (Netherlands)

    Meinardi CR; LBG

    1999-01-01

    Monsters water uit sprengen en grondwater van de Veluwe zijn onderzocht op concentraties van hoofdcomponenten en van microcomponenten (bepalingen door NITG). Onderzoek is gedaan ter bepaling van verblijftijden in de bodem van grondwater en van het water in sprengen. De intrekgebieden van de

  14. Omkering van de bewijslast: knelpunten in de regeling en bij de toepassing van de omkering van de sanctie (deel I)

    NARCIS (Netherlands)

    Okhuizen, E.C.G.

    2013-01-01

    De omkering van de bewijslast als processuele sanctie op het niet nakomen van de aangifteplicht en de daaraan verbonden bijkomende verplichtingen lijken niet weg te denken uit ons belastingrecht. De sanctie kwam al voor in de fiscale wetgeving die dateert van vóór de invoering van de Algemene wet

  15. Ontwateren van zeugenmest door middel van omgekeerde osmose

    NARCIS (Netherlands)

    Thelosen, J.; Gastel, van J.; Cuyck, van J.

    1992-01-01

    In periodiek nummer 1 (februari 1991) is het proces van omgekeerde osmose reeds beschreven. In het kort komt omgekeerde osmose op het volgende neer: de te ontwateren vloeistof wordt onder hoge druk (55 bar) door filterbuizen gepompt.

  16. Verteerbaarheid van katoensaadbevattende diete en die effek van ...

    African Journals Online (AJOL)

    , 15 and 20% whole cottonseed respectively, was determined in sheep at a feeding level of ... Die skynbare verteerbaarheid van droe materie (DM), organiese materie (OM), totale ruproteien (TRP), ruvesel (RV), neutraalbestande vesel (NBV), ...

  17. 'n Kwalitatiewe ondersoek na die invloed van aspekte van die ...

    African Journals Online (AJOL)

    S Blignaut

    ISSN 0378-5254 Journal of Family Ecology and Consumer Sciences, Vol 26: No1, 1998. 15 ...... van byvoorbeeld die televisie en gedrukte media 'n invloed op die .... fashion promotion and advertising. New York. ... Consumer behaviour to-.

  18. Het effect van het calciumgehalte van pootgoed op de ziektegevoeligheid

    NARCIS (Netherlands)

    Velema, R.; Griend, van de P.; Velvis, H.

    2001-01-01

    Het onderzoek dat in dit verslag is beschreven heeft betrekking op de relatie tussen het calciumgehalte in de knol en het optreden van de ziekten Fusarium spp, Helminthosporium solani, Phytophthora infestans en Erwinia spp.

  19. Achtergrondconcentraties van 17 sporenmetalen in het grondwater van Nederland

    NARCIS (Netherlands)

    Fraters B; Boumans LJM; Prins HP; LBG

    2002-01-01

    Er worden achtergrondconcentraties gegeven van 17 sporenmetalen in het grondwater in Nederland. De drie typen achtergrondconcentraties die onderscheiden worden, zijn: natuurlijk, semi-natuurlijk en regionaal. De natuurlijke achtergrondconcentratie is de concentratie zoals die gemeten zou worden op

  20. ABC transporters van Botrytis cinerea in biotische en abiotische interacties

    NARCIS (Netherlands)

    Schoonbeek, H.

    2005-01-01

    Op 29 november 2004 promoveerde Henk-jan Schoonbeek aan Wageningen Universiteit op het proefschrift getiteld 'ABC transporters from Botrytis cinerea in biotic and abiotic interactions'. Promotor was Prof. dr. ir. P.J.G.M. de Wit en co-promotor was dr.ir. M.A. de Waard, leerstoelgroep Fytopathologie,

  1. Fieldlab als aanjager van het innovatie ecosysteem

    NARCIS (Netherlands)

    Stolwijk, C.; Seiffert, L.

    2016-01-01

    Recente ontwikkelingen op het gebied van innovatiebeleid tonen een hernieuwde aandacht voor de rol van fieldlabs in het aanjagen van het omliggende innovatie ecosysteem1. Voorbeelden van deze trend zijn o.a. de Europese ’Innovation Hubs’, de Duitse ‘Mittelstand 4.0-Kompetenzzentren’, en de

  2. Effecten van wintergewassen op verliezen en benutting van stikstof bij de teelt van snijmaos; verslag van onderzoek op ROC Aver-Heino tussen voorjaar 1991 en najaar 1994

    NARCIS (Netherlands)

    Dijk, van W.; Schröder, J.J.; Holte, ten L.; Groot, de W.J.M.

    1995-01-01

    Tussen 1988 en 1994 is onderzoek verricht naar de effecten van wintergewassen (winterrogge en onderzaai van gras) op de verliezen en benutting van stikstof bij continuteelt van snijmaos op zandgrond. Gemiddeld over de gehele onderzoeksperiode nam zowel rogge als gras 30-40 kg/ha op in de

  3. Van Varroa jacobsoni naar Varroa destructor

    NARCIS (Netherlands)

    Calis, Johan

    2002-01-01

    Resultaten van onderzoek naar de verschillende voortplantingsstrategieën van Varroa jacobsoni en Varroa destructor in respectievelijk de Oosterse honigbij (Apis cerana) en de Westerse honingbij (Apis mellifera). Het hygiënisch gedrag van de Oosterse honingbij (leegruimen van aangetaste

  4. Consumentenonderzoek in het Restaurant van de Toekomst

    NARCIS (Netherlands)

    Wijk, de R.A.; Gorselink, M.; Steenbekkers, L.P.A.; Wabeke, M.; Thomasson, T.

    2010-01-01

    Miljoenen mensen lunchen dagelijks op hun werk. Over bijvoorbeeld motieven bij de keuze van maaltijdcomponenten, de invloed van de inrichting van het restaurant of variaties in het assortiment op dit keuzegedrag is weinig tot niets bekend. In het Restaurant van de Toekomst doet de Consumer Science

  5. Mechanische preventie van tarweopslag in graszaadteelt

    NARCIS (Netherlands)

    Wever, A.C.; Borm, G.E.L.

    2003-01-01

    Voor de chemische bestrijding van tarwe in veldbeemdgras is, na het vervallen van de toelating van diuron in juni '99, alleen chloorprofam nog toegelaten. Van beide middelen is een vrij grote kans op schade en is de effectiviteit tegen tarwe matig en zeer wisselend. Omdat de kans op nieuwe

  6. De kern van HRM. - 2e dr.

    NARCIS (Netherlands)

    Verburg, R.; den Hartog, D.

    2008-01-01

    In dit boek staat de kern van HRM centraal. Op basis van praktijkvoorbeelden, toonaangevende internationale publicaties en onderzoek in Nederland worden essentiële thema's van HRM belicht. Zo komen de volgende onderwerpen aan de orde: - De oorsprong van HRM - De veranderende relatie tussen werkgever

  7. Numerieke simulatie van de blastbelasting op vlucht MH17 van Malaysia Airlines als gevolg van de detonatie van een gevechtslading (U)

    NARCIS (Netherlands)

    2015-01-01

    De Onderzoeksraad voor Veiligheid (OVV) onderzoekt de crash van vlucht MH17 van Malaysia Airlines die plaatsvond op donderdag 17 juli 2014 in de regio Donetsk (Oekraïne). De OVV wil een duidelijk beeld geven van de oorzaak van de crash. Een mogelijke oorzaak is fatale schade aan het vliegtuig als

  8. Evaluatie van de Alcohol Verkeer Cursussen

    NARCIS (Netherlands)

    Leuw, Ed.; Brouwers, M.

    1992-01-01

    In dit rapport wordt een overzicht gegeven van de opzet, doelstellingen en uitkomsten van het evaluatie-onderzoek dat is verbonden aan de landelijke invoering van Alcohol Verkeer Cursussen (AVC's). Het verslag geeft een globaal en beschrijvend beeld van de belangrijkste kenmerken (deelname en

  9. Endopolygalacturonases van Botrytis cinerea: karakteristieken in vitro

    NARCIS (Netherlands)

    Krooshof, G.H.; Kester, H.C.M.; Burgers, K.; Benen, J.A.E.

    2003-01-01

    In dit artikel samenvattingen van lezingen van zeven presentaties van zestien onderzoekers van de KNPV-werkgroep Botrytis die op 18 september 2002 hun jaarlijkse bijeenkomst op het PPO Bomen in Boskoop hielden. De lezingen hadden de volgende onderwerpen: 1) Botrytis problems in hardy ornamentals; 2)

  10. Die teologiese arbeid van Antonius HJ Gunneweg

    African Journals Online (AJOL)

    En dis 'n klein treetjie van klagte na aanklag en na protes teen die gode, die heersers wat die mens vernietig deur hom oor sy ware lewe te bedrieg. Die ideologie eis dan ook dienooreenkomstig die bevryding en emansipasie van die mens van die gode en van God (1983: 118—119). Volgens die Jahwis is dit die slang wat, ...

  11. De polders van Nederland: een geologisch succesverhaal?

    NARCIS (Netherlands)

    Cohen, K.M.

    Overal in Nederland is de gesteldheid van de ondergrond het gevolg van landschapsvorming door de natuur, en van bedoelde en onbedoelde acties door de mens. Dat is nog eens extra waar in de poldergebieden van de kustvlakte en het rivierengebied. Al in de Romeinse tijd lagen daar lokaal de nodige

  12. De Balanced Scorecard, van theorie naar praktijk

    NARCIS (Netherlands)

    Schotanus, Fredo

    2004-01-01

    Meten is weten en wat men meet is wat men krijgt. Ofwel, wat gemeten wordt, is waar aandacht aan geschonken wordt. Dit zijn veelgehoorde statements en zij geven het belang aan van het meten van prestaties en van het meten van de juiste factoren. Hoe moet dit meten in de praktijk worden gebracht? Aan

  13. Over de zin en onzin van ecolabels

    NARCIS (Netherlands)

    Duim, van der V.R.

    2004-01-01

    In dit forum een discussie over de zin en onzin van ecolabels en keurmerken in toerisme. Voorstanders van eco-labeling plaatsen het debat in de context van een brede visie op milieuverandering. Labels zijn voor duurzame ontwikkeling een essentieel instrument om de belangen van burger-consumenten in

  14. Die Subjektiewe en Objektiewe doelwitte van Arbeid

    Directory of Open Access Journals (Sweden)

    T. H. Veldsman

    1982-11-01

    Die artikel gee aandag aan die subjektiewe en objektiewe doelwitte van arbeid. Hul plek en funksie binne 'n voorgestelde geïntegreerde motiveringsmodel word eerstens aangedui. Vervolgens word die verwantskap tussen die twee doelwitte uitgelig, gevolg deur 'n bespreking van die aard van die objektiewe doel. Laastens word die invloed van moderne arbeid op hierdie doelwitte uitgestippel.

  15. De fysiologische tremor van de hand

    NARCIS (Netherlands)

    Weerden, Tiemen Willem van

    1989-01-01

    Bij het innemen van een houding, zoals het willekeurig horizontaal gestrekt houden van de hand, vertoont het betrokken lichaamsdeel kleine fluctuaties in positie: de fysiologische tremor. Het doel van het proefschrift is, naast een beschrijving van het fenomeen, inzicht te geven in de oorzakelijke

  16. Stabiliteit van drijvende lichamen; anti-slingertanks

    NARCIS (Netherlands)

    Bourgingnon, G.P.

    1980-01-01

    Het dempen van de slingerbewegingen (roll) van een drijvend lichaam door middel van tanks met een vrije vloeistofoppervlakte. In de scheepsbouwkunde is vrij veel bekend over het toepassen van anti-slingertanks. De anti-slingertank, die ook dempt bij een stilliggend schip (in tegenstelling tot

  17. HISTORIESE OORSIG VAN DIE ONTSTAAN EN ONTWIKKELING ...

    African Journals Online (AJOL)

    In 1933 belas Rykskanselier. Hitler vir. Goering, Minister van Lugvaart, in die geheim met die skepping van die Luftwaffe. Die basis in Rusland is gesluit en toekomstige vlieeniers is nou in die geheim na Italie waar hulle elke aspek van moderne oorlog- voering oefen en die Blitzkrieg-gedagte, deur op ondersteuning van 'n.

  18. Biobrood van eigen bodem: een ketenproject

    NARCIS (Netherlands)

    Postma, R.; Bakker, den A.; Derksen, V.; Kruiger, K.; Maassen, J.; Osman, A.M.; Schepers, H.E.

    2008-01-01

    In 2007 is het ketenproject “Biobrood van eigen bodem” uitgevoerd in het kader van het coinnovatieprogramma biologische afzetketens. Het betrof een samenwerkingsproject van een aantal ketenpartijen uit de biologische broodketen en een aantal kennisinstellingen. Het doel van het project was gericht

  19. Het microscopisch onderzoek van amandelspijs en banketspijs

    NARCIS (Netherlands)

    Jong, de W.J.H.J.

    1982-01-01

    Nagaan of het door middel van microscopisch onderzoek mogelijk is om de identiteit vast te stellen van de gebruikte grondstoffen bij de bereiding van amandelspijs en banketspijs. Van een aantal monsters (22) gevulde speculaas werd de spijs geïsoleerd. Voor het microscopisch onderzoek werden een

  20. Productivity and quality improvements. A report on cost management in gas distribution at the energy distribution company Amsterdam (Energie Noord West Amsterdam NV)

    International Nuclear Information System (INIS)

    Bosch, T.

    1997-01-01

    In a more competitive times traditional and technical industries like gas distribution have to change. They have to commercialize. A way to support this transition is to introduce an activity based cost control system (ABC) with proper delegation of financial responsibilities. This report is about the history of cost management in Amsterdam and the introduction of ABC in our distribution company. The message to other gas distributors is that introducing some form of ABC can be worth wile in the future and is probably inescapable because of growing competition. In the end gas distribution will probably turn out to be one of the few places where money can be earned in the entire gas trade. Not by increasing distribution prices, but by decreasing distribution costs and strategic investments. (au)

  1. Annotated translation of "Nota in verband met de voorgenomen putboring nabij Amsterdam [Note concerning the intended well drilling near Amsterdam]" by J. Drabbe and W. Badon Ghijben (1889)

    Science.gov (United States)

    Post, Vincent E. A.

    2018-06-01

    The famous report by engineers Drabbe and Badon Ghijben (1889), on an intended well drilling near Amsterdam (the Netherlands), was one of the key documents that contributed to the Ghijben-Herzberg formula, which links water-table elevation to the depth of the freshwater-saltwater interface in coastal aquifers. The report has been often cited but no English translation has appeared in the literature to date. The aim of this annotated translation of the report is to provide the international scientific community with easier access than was hitherto the case, plus electronic access to the original in Dutch. A brief introduction to the report is provided, followed by a translation that follows the original text as closely as possible.

  2. Het effect van creatief schrijven op het lezen van korte verhalen

    NARCIS (Netherlands)

    Janssen, T.; van den Bergh, H.

    2010-01-01

    Schrijven en lezen zijn complementaire vaardigheden, niet alleen bij referentiële teksten, maar ook bij fictionele. Janssen en Van den Bergh doen verslag van een onderzoek naar de invloed van creatief schrijven op het lezen van verhalen. Als leerlingen, voorafgaand aan het lezen van een verhaal, een

  3. Tranen van bloed : Het beleg van 's-Hertogenbosch en de oorlog in de Nederlanden, 1629

    NARCIS (Netherlands)

    Cauwer, de Peter

    2008-01-01

    Het beleg van 's-Hertogenbosch en de veldtocht van 1629 staat in de Nederlandse geschiedschrijving te boek als een van de meest roemruchte gebeurtenissen van de Tachtigjarige Oorlog. Het beeld en de interpretaties van deze gebeurtenis zijn de afgelopen decennia nauwelijks veranderd. Toch bleven de

  4. Detectie van Meloidogyne spp. in grondmonsters - een vergelijking van twee technieken

    NARCIS (Netherlands)

    Veenhuizen, P.T.M.; Schoemakers, N.; Vos, J.; Versteegen, F.; Landeweert, R.; Karssen, G.

    2007-01-01

    Hier volgen de samenvattingen van de bijeenkomst van 20 maart 2007 van de KNPV-werkgroep Meloidogyne. 1) Kwantitatieve multiplexdetectie van aaltjes; 2). Meloidogyne chitwoodi en M. fallax: vergelijking visuele beoordeling en Taqman-PCR aan pootaardappelen; 3) Detectie van Meloidogyne spp. in

  5. Estimates of genetic parameters and genetic trend for fur traits in a ...

    African Journals Online (AJOL)

    Ph.D.-tesis, Universiteit van. Stellenbosch. VAN NlEKERK, AJ.A., 1972. 'n Studie van teeltprobleme by. Karakoelskape met spesiale verwysing na die Niemollerkudde. D.Sc.(Agric)-tesis, Universiteit van die 0. V.S., Bloemfontein. VAN NlEKERK, AJ.A., SCHOEMAN, SJ. & NEL, J.A., 1968. Oorerflikhede van en genetiese ...

  6. Politiekennis in gebruik. Een onderzoek naar het gebruik van het Politie Kennis Net

    NARCIS (Netherlands)

    Bakker, G.D.; Gellevij, M.R.M.; de Hoog, Robert; Kooken, J.P.; Krommendijk, M.

    2006-01-01

    I. Bakker, M. Gellevij, R. de Hoog, J. Kooken , M. Krommendijk (IPIT, Instituut voor Maatschappelijke Veiligheidsvraagstukken en vakgroep Instructietechnologie, faculteit Gedragswetenschappen, Universiteit Twente) P&W Verkenningen, Politie en Wetenschap, Apeldoorn ISBN: 90-78764-02-3 AbstractHet

  7. Kroniek van de intellectuele eigendom

    NARCIS (Netherlands)

    Visser, D.J.G.

    2015-01-01

    Het online doorverkopen en uitlenen van e-books is omstreden. De thuiskopieheffing blijft een kostbaar hoofdpijndossier. Een parodie vereist een humoristische bedoeling. Onpersoonlijke geschriften en verweesde werken zijn niet meer beschermd. Een stoel is geen merk, maar een winkelinrichting

  8. Voedingsgewoonten van overvloed en onbehagen.

    NARCIS (Netherlands)

    Hartog, den A.P.

    1996-01-01

    Vijf artikelen waarin de volgende aspecten zijn belicht: -) vijftig jaar eten in Nederland; -) sociale klasseverschillen in (op)voeding; -) voedingsaankopen in het gezin; -) invloed sociale omgeving; -) effectiviteit van vet- en suikervervangers

  9. Gezondheidsaspecten van Legionella in water

    NARCIS (Netherlands)

    Schets FM; de Roda Husman AM; MGB

    2004-01-01

    Legionella pneumophila is een veroorzaker van ernstige longontsteking bij mensen. Legionella bacterien blijken overal in waterige milieus aanwezig te zijn. Met name in kunstmatige waterige milieus kunnen mensen blootgesteld worden aan aerosolen waarin Legionella aanwezig is. Dit beknopte

  10. Tandem Van de Graaff facility

    Data.gov (United States)

    Federal Laboratory Consortium — Completed in 1970, the Tandem Van de Graaff facility was for many years the world's largest electrostatic accelerator facility. It can provide researchers with beams...

  11. Gentegreerde woordeboekgebruik van vakwoordeboeke vir ...

    African Journals Online (AJOL)

    Riette Ruthven

    word bespreek asook daardie vakwoordeboeke wat op aanleerders van sowel 'n taal as die vak gerig is. ... Abstract: Integrated Dictionary Use of Specialised Dictionaries for Learn- ers. ...... Applied Language Studies 25(3): 319-331. Gouws ...

  12. Evaluatie van relatievorming in de laagdrempelige verslavingszorg

    Directory of Open Access Journals (Sweden)

    Esther Kuis

    2010-12-01

    deze vergelijking de vragenlijst die de meeste aspecten van de kwaliteit van de relatie meet, en bewerkten deze. Daarna is dit instrument getoetst in een onderzoek onder 80 bezoekers van laagdrempelige verslavingscentra in vier verschillende steden. De auteurs concluderen dat de bewerkte vragenlijst onderscheidend vermogen bezit voor verschillende werkers en instellingen. De lijst is behulpzaam bij het meten van de kwaliteit van de relatie tussen cliënt en hulpverlener.

  13. Mediamonitering in die bestuur van korporatiewe beeld

    OpenAIRE

    2012-01-01

    M.Comm. Die waarde van hierdie ondersoek hou verband met die bemarking van 'n onderneming en die handhawing van 'n mededingende voordeel deur die projektering van 'n positiewe beeld (Anon., 1995a:92; Bateman & Zeithaml, 1993:75; Caminiti, 1992:50; Kotler & Armstrong, 1991:240). Hierdie aspek neem toe in belangrikheid soos wat die besigheidsmilieu in Suid-Afrika verander, veral wat betref die toetrede van buitelandse maatskappye tot die Suid-Afrikaanse mark.

  14. Van Hove singularities revisited

    International Nuclear Information System (INIS)

    Dzyaloshinskii, I.

    1987-07-01

    Beginning with the work of Hirsch and Scalapino the importance of ln 2 -Van Hove singularity in T c -enhancement in La 2 CuO 4 -based compounds was realized, which is nicely reviewed by Rice. However, the theoretical treatment carried out before is incomplete. Two things were apparently not paid due attention to: interplay of particle-particle and particle-hole channels and Umklapp processes. In what follows a two-dimensional weak coupling model of LaCuO 4 will be solved exactly in the ln 2 -approximation. The result in the Hubbard limit (one bare charge) is that the system is unstable at any sign of interaction. Symmetry breaking moreover is pretty peculiar. Of course, there are separate singlet superconducting pairings in the pp-channel (attraction) and SDW (repulsion) and CDW (attraction) in the ph-channel. It is natural that Umklapps produce an SDW + CDW mixture at either sign of the interaction. What is unusual is that both the pp-ph interplay and the Umklapps give rise to a monster-coherent SS + SDW + CDW mixture, again at either sign of the bare charge. In the general model where all 4 charges involved are substantially different, the system might remain metallic. A more realistic approach which takes into account dopping in La-M-Cu-O and interlayer interaction provides at least a qualitative understanding of the experimental picture. 10 refs, 5 figs

  15. SLAM in a van

    Science.gov (United States)

    Binns, Lewis A.; Valachis, Dimitris; Anderson, Sean; Gough, David W.; Nicholson, David; Greenway, Phil

    2002-07-01

    We have developed techniques for Simultaneous Localization and Map Building based on the augmented state Kalman filter, and demonstrated this in real time using laboratory robots. Here we report the results of experiments conducted out doors in an unstructured, unknown, representative environment, using a van equipped with a laser range finder for sensing the external environment, and GPS to provide an estimate of ground truth. The goal is simultaneously to build a map of an unknown environment and to use that map to navigate a vehicle that otherwise would have no way of knowing its location. In this paper we describe the system architecture, the nature of the experimental set up, and the results obtained. These are compared with the estimated ground truth. We show that SLAM is both feasible and useful in real environments. In particular, we explore its repeatability and accuracy, and discuss some practical implementation issues. Finally, we look at the way forward for a real implementation on ground and air vehicles operating in very demanding, harsh environments.

  16. [Veterinary issues in the proceedings of the Amsterdam Agricultural Society, 1776-1832].

    Science.gov (United States)

    Mathijsen, A H H M

    2006-01-01

    The Amsterdam Agricultural Society, founded in 1776, was created by six wealthy gentlemen, well known for the important positions in society held by them. They invested the money earned through trade among others in the acquisition of land, partially newly reclaimed in the surroundings of Amsterdam. As a consequence of the expansion of the population the profitability of agriculture had increased. The merchants and regents knew how to combine business with pleasure. In the second half of the 17th and the first half of the 18th century, they have built about 500 country estates in the surroundings of Amsterdam. Besides the pleasures of country-life, the owners gained a practical interest in agriculture and animal husbandry. Missing practical knowledge in these fields themselves, they felt the moral obligation to contribute to the general welfare of the society by the promotion of new ideas or experiences gained by others. In the first volume of the Proceedings is stated: 'It is beyond question that chemistry, botany, meteorology and the Ars veterinaria are to be considered as the true fundaments of agricultural knowledge'. Inspired by the ideas of the Enlightenment and, quite in conformity with the spirit of the time, the establishment of a society was thought to be the answer in order to bring agricultural and thus economical reform. The method used was copied from the learned societies. The members proposed subjects for prize competitions and judged the answers sent in. The crowned answers were the main, but not the only, contents of the Society's Proceedings. The paper analyses the membership (the number of ordinary members decreased from 70 at the start to 56; that of honorary members was stable at about 20; further there were a few orrespondents), and quantifies the distribution of articles in the Proceedings, devoted respectively to agricultural, veterinary and zootechnical subjects. In addition, a detailed list with commentary, of the veterinary and

  17. St. Teresa van Avila: sentrale figuur in die werk van Cussons en Van Wyk Louw

    Directory of Open Access Journals (Sweden)

    H. van Vuuren

    1989-05-01

    Full Text Available A central poem in Van Wyk Louw’s Tristia (1962, is “H. Teresa van Avila flap uit” (literally translated: “Saint Teresa of Avila talks too much/babbles uncontrollably”. This article illustrates how intertextual reading helped to clarify the poem. Teresa of Avila’s The way of perfection (a translation of the Spanish work El Camino de la Perfección, 1573 is the intertext of the Van Wyk Louw poem. In the last section of the article it is shown how the figure of St. Teresa of Avila is central not only to Van Wyk Louw’s Tristia (1962, but also to the oeuvre of Sheila Cussons, which underlines a strong intertextuality between these two Afrikaans oeuvres.

  18. ‘n Kritiese bespreking van roskam se seining van apartheid as grondslag van die Suid-afrikaanse samelewing

    Directory of Open Access Journals (Sweden)

    N. van Loggerenberg

    1963-03-01

    Full Text Available Segregasie is al deur vele ondersoekers histories tot ’n tradisie uit die stigtingsjaar 1652 met die aankoms van Jan van Riebeeck herlei. Roskam sion dit egter as 'n beleid wat veel later aanvaar is. Hy sien dit as beleid wat bepaalde groepe van die bevolking as 'n politieke eenheid, kragtens ’n sosiale hiërargie, van mekaar wil afskei, isoleer. Dit is vir  hom duidelik dat die politieke eenheid van Ordinansie 50 van 1828 nooit werklikheid geword het nie, en die tradisie van blanke heerskappy pas vir liom as heleid beter in die huidige situasic as segregasie. Roskam is dan van oordeel dat ..white supremacy” daarom die juiste en omskrywende betekenis van segregasie is.

  19. Gebruik van TaqMan PCR voor het kwantificeren van Fusarium spp. en Microdochium nivale in gewassen en gewasresten van tarwe.

    NARCIS (Netherlands)

    Köhl, J.; Haas, de B.H.; Kastelein, P.; Burgers, S.L.G.E.; Waalwijk, C.

    2005-01-01

    Infecties van tarwe door toxigene Fusarium spp. kunnen leiden tot contaminatie van graan met diverse mycotoxines. Voorkoming van mycotoxinebesmetting is uit oogpunt van voedselveiligheid, diergezondheid, maar ook bedrijfseconomisch, vereist. Voor vier Fusariumsoorten is een kwantitatieve detectie

  20. Inzicht in het presteren van de executieketen : Ontwikkeling van een monitor voor het meten van Kritieke Prestatie Indicatoren in de Executieketen

    NARCIS (Netherlands)

    Braak, S.W. van den; Netten, C.P.M.; Witzenburg, R. van

    2013-01-01

    Dit zijn de voorlopige resultaten van het ontwikkelprojcet Monitor Kritieke Prestatie Indicatoren Executieketen. Het structureel meten van de vastgestelde Kritieke Prestatie Indicatoren (KPI's) behelst het periodiek verzamelen, bewerken en presenteren van grote hoeveelheden data van verschillende