WorldWideScience

Sample records for universiteit amsterdam department

  1. Die Departement Godsdiens- en Sendingwetenskap (Afd A, Universiteit van Pretoria, 1917-1978

    Directory of Open Access Journals (Sweden)

    P. J. van der Merwe

    1992-01-01

    Full Text Available The Department of Science of Religion and Missiology (Sec A, University of Pretoria, 1917-1978 The Transvaal University College began its Faculty of Theology in 1917 in co-operation with the Presbyterian Church and the Nederduitsch Hervormde Kerk. A Presbyterian minister, Prof E MacMillan, lectured from 1917 till 1934. This marked the end of Presbyterian participation. In the next period, 1935-1937, the Department suffered from a controversy between the Nederduitsch Hervormde Kerk and its new partner, the Nederduitsch Hervormde of Gereformeerde Kerk. The issue was solved when the Faculty divided into two sections, Section A for the Nederduitsch Hervormde Kerk and Section B for the Nederduitsch Hervormde of G ereformeerde Kerk. Prof H P Wolmarans was appointed to the chair of Science of Religion (Sec A in 1938 and served as head of the Department till 1959. He was succeeded by Prof F J van Zyl in 1960, who served till 1978.

  2. Jaarverslag 2003: Erasmus Universiteit Rotterdam

    NARCIS (Netherlands)

    2004-01-01

    textabstractDe Erasmus Universiteit Rotterdam heeft in 2003 resultaten ge- boekt waar zij voor staat, zowel op het gebied van wetenschap- pelijk onderwijs, wetenschappelijk onderzoek als in de sfeer van maatschappelijke dienstverlening. Daarvan kunt u in dit verslag kennisnemen. Veel aandacht is

  3. Jaarverslag 2001: Erasmus Universiteit Rotterdam

    NARCIS (Netherlands)

    2002-01-01

    textabstractDe Erasmus Universiteit Rotterdam heeft in 2001 resultaten geboekt waar zij voor staat, zowel op het gebied van wetenschappelijk onderwijs, wetenschappelijk onderzoek als in de sfeer van maatschappelijke dienstverlening. Met genoegen presenteren we u daarom dit verslag. Daarin laten we

  4. The Chemistry Departement of the Institute for Nuclear Physics Research, Amsterdam, The Netherlands

    International Nuclear Information System (INIS)

    Lindner, L.

    1977-01-01

    In 1946, the Institute for Nuclear Physics Research (IKO) in Amsterdam was founded as a typical post World War II effort to cope with the surge in scientific research, primarily in the USA. At present, the Institute encompasses almost 250 workers - including a Philips research group - out of which nearly 30 are members of the Chemistry Department. In the beginning, the investigations dealt with more or less conventional tracerwork using long-lived radionuclides produced in nuclear reactors. This changed rapidly with the synchrocyclotron coming into operation in 1947. The present can be best characterized as a sort of a transition state. Emphasis has been laid upon more typical chemical aspects of the research program: a shift from ''nuclear'' chemistry to ''radio'' chemistry. The future is determined by the 500 MeV linear electron accelerator, dubbed MEA (Medium Energy Accelerator) already under construction. (T.G.)

  5. Die opleiding van bedryfsielkundiges aan die universiteit van Fort Hare

    Directory of Open Access Journals (Sweden)

    W. Botha

    1977-11-01

    Full Text Available Die Departement Bedryfsielkunde aan die Universiteit van Fort Hare is 'n relatiewe jong departement en het eers in 1965 tot stand gekom. Voor hierdie datum is Bedryfsielkunde as 'n kort kursus deur die departement van suiwer Sielkunde aangebied en een van die destydse dosente, Dr. W. Backer, het die inisiatief geneem om 'n selfstandige departement van Bedryfsielkunde in die Fakulteit van Ekonomiese Wetenskappe op die been te bring.

  6. De Amsterdam a Figueroles : Experiencias UNIGIS

    NARCIS (Netherlands)

    Koomen, E.

    2006-01-01

    Eric Koomen es un investigador en SlG del Departamento de Economía Espacial de Ia Vrije Universiteit de Amsterdam. Su principal ámbito de investigacíon es el modelado del cambio del uso del suelo y su tesis doctoral se centra en Ia applicacíon de indicadores de modelos de cambios de usos del suelo.

  7. Bioprospektering, wetgewing en navorsing by universiteite in Suid-Afrika

    Directory of Open Access Journals (Sweden)

    J.L. Du Plessis

    2006-09-01

    Full Text Available Suid-Afrika is besonder ryk aan biodiversiteit. Dié biodiversiteit kan benut word en het kommersiële potensiaal. Bioprospektering is die sistematiese evaluering van biodiversiteit deur gebruik te maak van gevorderde tegnologie in die soeke na en ontwikkeling van kommersieel waardevolle nuwe produkte. Die internasionale Konvensie vir Biodiversiteit en die nasionale Biodiversiteitwet beklemtoon die volhoubare benutting en bewaring van biodiversiteit en stel sekere vereistes aan bioprospektering en die navorsing daarby betrokke. Navorsing op inheemse biologiese hulpbronne word ook deur die wetgewing geraak. Feitlik elke universiteit in Suid-Afrika is betrokke by bioprospekteringsprojekte en/of navorsing op inheemse biologiese hulpbronne. ’n Kort oorsig oor die ontstaan van die Biodiversiteitwet word gegee. Navorsingsbestuur en navorsers word hiermee meegedeel wat die huidige wetlike implikasies van die Biodiversiteitwet op navorsing by universiteite in Suid-Afrika is.

  8. Results of the implementation of a new screening protocol for child maltreatment at the Emergency Department of the Academic Medical Center in Amsterdam.

    Science.gov (United States)

    Teeuw, Arianne H; Sieswerda-Hoogendoorn, Tessa; Sangers, Esmée J; Heymans, Hugo S A; van Rijn, Rick R

    2016-01-01

    This study examines the results of the implementation of a new screening protocol for child maltreatment (CM) at the Emergency Department (ED) of the Academic Medical Center in Amsterdam, The Netherlands. This protocol consists of adding a so called 'top-toe' inspection (TTI), an inspection of the fully undressed child, to the screening checklist for child maltreatment, the SPUTOVAMO. We collected data from all patients 0-18 years old directly after introduction (February 2010) and 9 months later. Outcome measures were: completion of the screening and reasons for non-adherence. Data were collected on age, gender, reason for visiting the ED (defined by International Classification of Disease, ICD), presence of a chronic illness, type of professional performing the TTI and admission during week or weekend days. In February 560 and in November 529 paediatric patients were admitted. In February the complete screening protocol was performed in 42% of all children, in November in 17%. A correlation between completion of the SPUTOVAMO and having a TTI performed was found. Older age and presence of a chronic illness influenced the chance of having both SPUTOVAMO and TTI performed negatively. The completion rate of SPUTOVAMO was influenced by ICD code. Completion of TTI was influenced by type of investigator. The best performing professional was the ED physician followed by the paediatrician followed by the ED nurse. The reasons for not performing a TTI were not documented. Refusal of the TTI by a patient or parent was reported three times. Implementation of this new screening protocol for CM was only mildly successful and declined in time. A negative correlation between older child age and having a chronic illness and completion of the screening was found. A practical recommendation resulting from this study could be that, if CM screening protocols prove to be effective in detecting CM, regular training sessions have to be held. Filling out the checklist is something that

  9. Grote Hotels in Amsterdam

    NARCIS (Netherlands)

    Vermeer, G.

    2014-01-01

    De reiziger die Amsterdam binnenkomt via het Centraal Station ziet rechts van het Damrak meteen een beknopte geschiedenis van de hotelbouw in Amsterdam. Op de hoek, om twee kleinere huisjes heen, staat het oudste deel van het Victoriahotel (nu Victoria Plaza Hotel), dat in 1890 zijn deuren opende.

  10. 14 November 2014 - F. van der Duyn Schouten Rector Magnificus Vrije Universiteit University Amsterdam Kingdom of the Netherlands

    CERN Multimedia

    Guillaume, Jeanneret

    2014-01-01

    signing the Guest Book with ATLAS Collaboration, Dutch senior physicist H. ten Kate and visiting the ATLAS cavern with ATLAS Collaboration Deputy Spokesperson T. Wengler; ATLAS Collaboration, Director of Nikhef as of December 1, 2014 S. Bentvelsen and ATLAS Collaboration, Nikhef P. de Jong.

  11. The Amsterdam proton microbeam

    International Nuclear Information System (INIS)

    Bos, A.J.J.

    1984-01-01

    The aim of the work presented in this thesis is to develop a microbeam setup such that small beam spot sizes can be produced routinely, and to investigate the capabilities of the setup for micro-PIXE analysis. The development and performance of the Amsterdam proton microbeam setup are described. The capabilities of the setup for micro-PIXE are shown with an investigation into the presence of trace elements in human hair. (Auth.)

  12. Clinical highlights from Amsterdam

    Directory of Open Access Journals (Sweden)

    Jouke T. Annema

    2016-07-01

    Full Text Available This article contains highlights and a selection of the scientific advances from the Clinical Assembly that were presented at the 2015 European Respiratory Society International Congress in Amsterdam, the Netherlands. The most relevant topics for clinicians will be discussed, covering a wide range of areas including interventional pulmonology, rehabilitation and chronic care, thoracic imaging, diffuse and parenchymal lung diseases, and general practice and primary care. In this comprehensive review, exciting novel data will be discussed and put into perspective.

  13. Quickscan QTI addendum #1 - Usability study of QTI for De Digitale Universiteit

    NARCIS (Netherlands)

    dr. Pierre Gorissen

    2003-01-01

    De Digitale Universiteit (DU) performed a quickscan to determine the usability of the IMS Question and TestInteroperability (QTI) specification as a format to store questions and tests developed for and by the consortium. The original report is available in Dutch from the website of De Digitale

  14. Diverse artikelen in Gay Amsterdam News

    NARCIS (Netherlands)

    Hekma, G.

    2002-01-01

    Vernedering, in: Gay Amsterdam News 125 (jan 2002), pp. 20-21; Webseks, zaad, zweetseks, in: Gay Amsterdam News 126 (feb 2002), pp. 30-31; Wurgseks, in: Gay Amsterdam News 127 (mrt 2002), pp. 30-31; Wijnandus Johannes Sengers (1927-2002), in: Gay Amsterdam News 133 (sept 2002), pp. 49.

  15. Digital Amsterdam : Digital Art and Public Space in Amsterdam

    NARCIS (Netherlands)

    Cnossen, Boukje; Franssen, Thomas; De Wilde, Mandy

    2015-01-01

    In this report we explore digital art interventions in public space in Amsterdam as part of the ‘participatory public space’ project lead by the University of Melbourne. We focus specifically on artistic interventions in public space, rather than on the more general ways in which public space is

  16. Milieukwaliteitsplan Regionaal Orgaan Amsterdam; hoofdlijnenrapport

    NARCIS (Netherlands)

    Borch, ter M.; Coenen, E.; Frederiks, N.; Haas, de W.; Harmsen, T.; Jonker, G.; Kersten, G.; Klundert, van de B.; Loeven, L.; Steinhaus, R.; Timmermans, W.; Tjallingii, S.; Veer, van 't K.; Vink, S.; Wiersinga, W.; Witte, T.

    1995-01-01

    Het Milieukwaliteitsplan van het Regionaal Orgaan Amsterdam (ROA) speelt in op de nieuwe bestuurlijke verhoudingen in het ROA-gebied. Het geeft geen vaste doelstellingen waaraan iedere gemeente moet voldoen, maar is een instrumenteel en faciliërend kader voor uitwisseling van kennis en ervaringen,

  17. Values of Development and Educational Goals. Verhandelingen no. 8, tevens publikatie no. 21 van het Sociografisch Instituut der Universiteit van Amsterdam.

    Science.gov (United States)

    Fortuijn, A. B. Droogleever; Oud, P. J.

    This paper examines the concept of national development in terms of the realization of values; it is intended to serve as the basis for a research project focused on the formulation of a development strategy for developing countries, with special attention to the role of education in the development process. Chapter 1 briefly summarizes the…

  18. Environmental space management in the harbor of Amsterdam, Netherlands; Milieuruimtemanagement haven Amsterdam

    Energy Technology Data Exchange (ETDEWEB)

    Klok, L.; Hulskotte, J. [TNO Built Environment and Geosciences, Den Haag (Netherlands); Van Breemen, T. [Haven Amsterdam, Amsterdam (Netherlands)

    2012-02-15

    A new calculation tool will quickly offer the Harbor of Amsterdam insight in the effect of activities in the harbor on the air quality and hence the available environmental space. [Dutch] Een nieuw rekeninstrument geeft Haven Amsterdam snel inzicht in het effect van alle activiteiten in de haven op de luchtkwaliteit en daarmee in de beschikbare milieuruimte.

  19. Fietsongevallen in Amsterdam : een analyse ten behoeve van de gemeente Amsterdam (Rapport + bijlage).

    NARCIS (Netherlands)

    Polak, P.H.

    1983-01-01

    By order of the municipality of Amsterdam a study has been made into the development of traffic hazards for cyclists in Amsterdam during the period 1977-1980, and into the distribution of this insecurity within the city, and on the type of road in relationship with traffic counts. It is shown that

  20. Department

    African Journals Online (AJOL)

    USER

    2016-09-20

    Sep 20, 2016 ... Department of Biological and Environmental Sciences, Kibabii University. Abstract. This study ... Key Words: Climate Change, Regional Circulation Model, PRECIS, Bungoma County ... by different computer models is much.

  1. Amsterdam wrist rules: A clinical decision aid

    Directory of Open Access Journals (Sweden)

    Bentohami Abdelali

    2011-10-01

    Full Text Available Abstract Background Acute trauma of the wrist is one of the most frequent reasons for visiting the Emergency Department. These patients are routinely referred for radiological examination. Most X-rays however, do not reveal any fractures. A clinical decision rule determining the need for X-rays in patients with acute wrist trauma may help to percolate and select patients with fractures. Methods/Design This study will be a multi-center observational diagnostic study in which the data will be collected cross-sectionally. The study population will consist of all consecutive adult patients (≥18 years presenting with acute wrist trauma at the Emergency Department in the participating hospitals. This research comprises two components: one study will be conducted to determine which clinical parameters are predictive for the presence of a distal radius fracture in adult patients presenting to the Emergency Department following acute wrist trauma. These clinical parameters are defined by trauma-mechanism, physical examination, and functional testing. This data will be collected in two of the three participating hospitals and will be assessed by using logistic regression modelling to estimate the regression coefficients after which a reduced model will be created by means of a log likelihood ratio test. The accuracy of the model will be estimated by a goodness of fit test and an ROC curve. The final model will be validated internally through bootstrapping and by shrinking it, an adjusted model will be generated. In the second component of this study, the developed prediction model will be validated in a new dataset consisting of a population of patients from the third hospital. If necessary, the model will be calibrated using the data from the validation study. Discussion Wrist trauma is frequently encountered at the Emergency Department. However, to this date, no decision rule regarding this type of trauma has been created. Ideally, radiographs are

  2. Congenital anomalies in the teratological collection of Museum Vrolik in Amsterdam, The Netherlands. II: Skeletal dysplasias

    NARCIS (Netherlands)

    Oostra, R. J.; Baljet, B.; Dijkstra, P. F.; Hennekam, R. C.

    1998-01-01

    The Museum Vrolik collection of the Department of Anatomy and Embryology of the University of Amsterdam, founded by Gerardus Vrolik (1775-1859) and his son Willem Vrolik (1801-1863), consists of more than five thousand specimens of human and animal anatomy, embryology, pathology, and congenital

  3. Board and Deans of Amsterdam University, Netherlands

    CERN Document Server

    Patrice Loïez

    2001-01-01

    L. to r.: Dr Thomas Taylor, CERN IT Deputy Division Leader; Prof. Dymph C. van den Boom, Dean Faculty of Social and Behavioural Sciences, Professor in Empirical Thoretical Pedagogy; Prof. Jos Engelen, NIKHEF/University of Amsterdam, Dutch Delegate to the Scientific Policy Committee and Chairman of the LHC Committee; Prof. Jacob van der Gaag, Dean Faculty of Economic Science and Econometry, Professor in Developmenteconomy;Mr Jan van der Boon, CERN Director of Admnistration; Prof. Jan Robert Bausch, Dean Faculty of Dental Medicine, Professor in general Dentistry; Dr Sijbolt J. Noorda, President of the Board of the University of Amsterdam.

  4. The Vision on Wind. Space for Wind Turbines in Amsterdam, Netherlands; De Windvisie. Ruimte voor windmolens in Amsterdam

    Energy Technology Data Exchange (ETDEWEB)

    Godschalk, M.; Jacobs, S.; Van der Linden, K.; Plomp, M.; Rijntjes, R.; Ruiter, R.; Ydema, G.; Zonderland, H.

    2012-07-15

    With drafting the 'Wind Vision' the city of Amsterdam takes the initiative to realize more windmills in Amsterdam. Amsterdam aims for an efficient, sustainable energy, which will also benefit the Amsterdam population economically. The 'Wind Vision' shows that there are enough opportunities to supply one third of the households in Amsterdam with renewable electricity [Dutch] Met de Windvisie neemt Amsterdam het initiatief om meer windmolens in Amsterdam te realiseren. Amsterdam streeft naar een efficiente, duurzame energieopwekking, waar Amsterdammers ook economisch van kunnen profiteren. De Windvisie laat zien dat er op dit moment in de stad kansen zijn om genoeg windmolens te realiseren om een derde van de Amsterdamse huishoudens van duurzaam opgewekte elektriciteit te voorzien.

  5. Coordination Approaches for Complex Software Systems

    NARCIS (Netherlands)

    Bosse, T.; Hoogendoorn, M.; Treur, J.

    2006-01-01

    This document presents the results of a collaboration between the Vrije Universiteit Amsterdam, Department of Artificial Intelligence and Force Vision to investigate coordination approaches for complex software systems. The project was funded by Force Vision.

  6. Conservering bij zoutschade; De Waag in Amsterdam

    NARCIS (Netherlands)

    Lubelli, B.A.; Hees, R.P.J. van

    2007-01-01

    In de Waag in Amsterdam bevinden zich enkele waardevolle meesterproeven van metselwerk. Deze hebben zwaar te lijden onder aantasting van zouten. Aan de auteurs werd gevraagd om de oorzaken van de scahde te onderzoeken en advies uit te brengen over mogelijke interventie om het verval aan te pakken.

  7. Organising smart city projects : lessons from Amsterdam

    NARCIS (Netherlands)

    van Winden, Willem; Oskam, Inge; van den Buuse, Daniel; Schrama, Wieke; van Dijck, Egbert-Jan

    2016-01-01

    We studied 12 smart city projects in Amsterdam, and –among other things- analysed their upscaling potential and dynamics. Here are some of our findings: First, upscaling comes in various forms: rollout, expansion and replication. In roll-out, a technology or solution that was successfully tested and

  8. 'Flying markets': activating public spaces in Amsterdam

    NARCIS (Netherlands)

    Janssens, F.; Sezer, C.

    2013-01-01

    Marketplaces can be used by city planners as urban development strategies because they have the potential to turn open spaces in the city into public space, thereby improving both the social and the spatial qualities of those spaces. In Amsterdam, however, marketplaces currently fail to activate

  9. Drug use trends in Amsterdam nightlife, 2013

    NARCIS (Netherlands)

    Wouters, M.; Nabben, T.; Benschop, A.; Korf, D.J.

    2014-01-01

    The established club scene in Amsterdam is being challenged. Bright young entrepreneurs are organising parties at alternative venues outside the city centre. In 2013, the key word is ‘rave’. The mounting numbers of students in the city are also affecting Amsterdam’s nightlife. Antenna monitors these

  10. 2. The Amsterdam Declaration on fungal nomenclature

    DEFF Research Database (Denmark)

    Hawksworth, David L.; Crous, Pedro W.; Redhead, Scott A.

    2011-01-01

    The Amsterdam Declaration on Fungal Nomenclature was agreed at an international symposium convened in Amsterdam on 19-20 April 2011 under the auspices of the International Commission on the Taxonomy of Fungi (ICTF). The purpose of the symposium was to address the issue of whether or how the current...... to advise on the problem. The Declaration recognizes the need for an orderly transition to a single-name nomenclatural system for all fungi, and to provide mechanisms to protect names that otherwise then become endangered. That is, meaning that priority should be given to the first described name, except...... where there is a younger name in general use when the first author to select a name of a pleomorphic monophyletic genus is to be followed, and suggests controversial cases are referred to a body, such as the ICTF, which will report to the Committee for Fungi. If appropriate, the ICTF could be mandated...

  11. Congenitale afwijkingen in Amsterdam: resultaten 'Amsterdam born children and their development'-studie

    NARCIS (Netherlands)

    Sikkens, J.J.; Eijsden, van M.; Bezemer, P.D.; Bakker, M.K.; Bonsel, G.J.; Wal, van der M.F.; Cornel, M.C.

    2009-01-01

    OBJECTIVE: To describe the prevalence of congenital anomalies in children born in Amsterdam and to analyse potential differences between groups based on risk factors such as ethnicity and maternal age. DESIGN: Secondary analysis of a prospective cohort study. METHODS: Between 2003 and 2004, mothers

  12. The fast Amsterdam multiprocessor (FAMP) operation system

    International Nuclear Information System (INIS)

    Gosman, D.; Hertzberger, L.O.; Holthuizen, D.J.; Por, G.J.A.; Schoorel, M.

    1981-01-01

    The Fast Amsterdam Multi Processor system (FAMP system) is developed for on-line filtering and second stage triggering. The system is based on the MC 68000 microprocessor from MOTOROLA. In this report we will describe: The FAMP operating system software, the features of the slaves and supervisor in the FAMP operating system, the communication between supervisor and slaves using the dual port memories, the communication between user programs and the operating system. The hardware as well as the application of the system will be described elsewhere. (orig.)

  13. Effectiveness of clean taxi priority incentive at Amsterdam Central Station

    NARCIS (Netherlands)

    van der Flier, A.S.; Dam, J.; van den Hoed, R.

    2017-01-01

    The municipality of Amsterdam wants to have an emission free taxi sector by 2025. In order to reach that goal, the city has taken a number of measures which favour clean taxis above conventional taxis. One of these measures is an innovative priority privilege scheme at the Amsterdam Central Station

  14. Medical anthropology: essays and reflections from an Amsterdam graduate programme

    NARCIS (Netherlands)

    van der Geest, S.; Gerrits, T.; Challinor, J.

    2014-01-01

    This volume is a collection of twenty articles by graduates of the Amsterdam Master’s in Medical Anthropology (AMMA) at the University of Amsterdam. The university is known for outstanding and innovative work in the field of medical anthropology and teaching combines a strong ethnographic basis with

  15. TCS Amsterdam Marathon 2014 : economische impact, tevredenheid, gezondheidseffecten

    NARCIS (Netherlands)

    Baart de la Faille-Deutekom, Marije; Verhoogt, Pieter

    Op zondag 19 oktober 2014 vond de 39ste editie plaats van de TCS Amsterdam Marathon. Met 44.100 deelnemers is het evenement uitgegroeid tot één van de grootste participatiesportevenementen van ons land. Dankzij het stadsparcours is de TCS Amsterdam Marathon voor zowel de deelnemers als de inwoners

  16. Transnational class formation and concepts of control: notes towards a genealogy of the Amsterdam Project in International Political Economy

    NARCIS (Netherlands)

    Overbeek, H.W.

    2004-01-01

    International political economy (IPE) has been enriched, since the late 1970s, by flourishing numbers of critical approaches. The contributions during the 1980s and 1990s to this literature by some members of the Department of International Relations at the University of Amsterdam occupy a distinct

  17. Congenital anomalies in the teratological collection of Museum Vrolik in Amsterdam, The Netherlands. IV: closure defects of the neural tube

    NARCIS (Netherlands)

    Oostra, R. J.; Baljet, B.; Hennekam, R. C.

    1998-01-01

    The Museum Vrolik collection of the Department of Anatomy and Embryology of the University of Amsterdam, founded by Gerardus Vrolik (1775-1859) and his son Willem Vrolik (1801-1863), consists of more than 5,000 specimens of human and animal anatomy, embryology, pathology, and congenital anomalies.

  18. Congenital anomalies in the teratological collection of Museum Vrolik in Amsterdam, The Netherlands. V: conjoined and acardiac twins

    NARCIS (Netherlands)

    Oostra, R. J.; Baljet, B.; Verbeeten, B. W.; Hennekam, R. C.

    1998-01-01

    The Museum Vrolik collection of the Department of Anatomy and Embryology of the Academic Medical Center, University of Amsterdam, founded by Gerardus Vrolik (1775-1859) and his son Willem Vrolik (1801-1863), consists of more than 5,000 specimens of human and animal anatomy, embryology, pathology,

  19. Work in Amsterdam on local intelligence

    International Nuclear Information System (INIS)

    Dorenbosch, J.; Gosman, D.; Holthuizen, D.J.; Vermeulen, J.C.; Hertzberger, L.O.; Tuynman, F.

    1984-07-01

    Work on local intelligence at NIKHEF-H was started in 1979 with a proposal to design a multi microprocessor system for real-time event selection in high-energy physics experiments. The outcome of this is the Fast Amsterdam Multi Processor (FAMP) system which has the following properties: a high degree of modularity, facilitating easy system expansion; the possibility to realize hierarchical structures of processing elements; use of commercially available microprocessors. The system consists of modules that mechanically fit into a CAMAC crate. From the CAMAC standard only the CAMAC power supply lines are used. The FAMP system is described as it is used in the NA11/NA32 and UA1 experiments at CERN SPS (inclusive phi-meson production; proton-antiproton collisions.) Moreover, the FAMP distributed operating system (FADOS) is discussed in its present-day and future developments. (Auth.)

  20. Goede resultaten van de behandeling van patiënten met buikklachten op de afdeling Spoedeisende Hulp van het Onze Lieve Vrouwe Gasthuis te Amsterdam

    NARCIS (Netherlands)

    van Geloven, A. A.; Luitse, J. S.; Hoitsma, H. F.

    1998-01-01

    Evaluation of the treatment of patients with abdominal complaints at the first aid department of a city hospital, where patients were treated by emergency doctors (EMD) in combination with specialists. Retrospective, descriptive. Onze Lieve Vrouwe Gasthuis, first aid department, Amsterdam, the

  1. Struggles for success : Youth work rituals in Amsterdam and Beirut

    NARCIS (Netherlands)

    Abdallah, S.E.

    2017-01-01

    In Amsterdam and Beirut, Abdallah has ethnographically researched interactional dynamics between disadvantaged young people, regarding experiences of success, in settings of education, work, sports, and music. He analyzed how focus, mood, and bodily deployment produced shared symbols, emotional

  2. Amsterdam and London as financial centers in the eighteenth century

    OpenAIRE

    Ann M. Carlos; Larry Neal

    2011-01-01

    In the seventeenth century, Amsterdam and London developed distinctive innovations in finance through both banks and markets that facilitated the growth of trade in each city. In the eighteenth century, a symbiotic relation developed that led to bank-oriented finance in Amsterdam cooperating with market-oriented finance in London. The relationship that emerged allowed each to rise to unprecedented dominance in Europe, while the respective financial innovations in each city provided the means ...

  3. El Plan General de Amsterdam. A.U.P (II

    Directory of Open Access Journals (Sweden)

    Helma Hellinga

    1998-07-01

    Full Text Available El presente texto corresponde a la segunda parte del artículo "Het Algemeen Uitbreidingsplan van Amsterdam"publicado originalmente en el volumen Het Nieuwe Bouwen, Amsterdam 1920-1960, y cuya parte correspondiente a lo relativo a acontecimientos anteriores a la Segunda Guerra Mundial se presentó traducida en Cuaderno de Notas 5. Por consiguiente, en esta segunda entrega se recogen los desarrollos de los nuevos barrios o partir del final de la guerra hasta aproximadamente 1960

  4. Agrocentre Amsterdam. Design for agroparks in harbor areas; Agrocentrum Amsterdam. Ontwerpen voor agroparken in havengebieden

    Energy Technology Data Exchange (ETDEWEB)

    Broeze, J. [Agrotechnology en Food Innovations, Wageningen UR, Wageningen (Netherlands); Van Steekelenburg, M.G.N.; Smeets, P.J.A.M. [Alterra, Wageningen UR, Wageningen (Netherlands)

    2006-05-15

    A number of concepts for an Agropark in the Port of Amsterdam is discussed. Several variants are developed that differ in scale and functional combinations. The core of the agrocenter is to set up an energy chain with pig farming, horticulture, animal feed production, manure processing and biogas production. Mushroom cultivation and fisheries are also options [Dutch] Een aantal ontwerpen voor een Agropark in de Amsterdamse Haven wordt besproken. Verschillende varianten worden uitgewerkt die verschillen in schaalgrootte en functiecombinaties. Kern van het agrocentrum is het opzetten van een energieketen met varkenshouderij, glastuinbouw, veevoerproductie, mestverwerking en biogasproductie. Ook champignonteelt en viskweek zijn opties.

  5. Solar vision Amsterdam. Citizens and businesses go for the sun; Zonvisie Amsterdam. Burgers en bedrijven gaan voor de zon

    Energy Technology Data Exchange (ETDEWEB)

    Stam, T.; Diependaal, F.; Van ' t Hull, C.

    2013-06-15

    In the Solar Vision it is explained how the Amsterdam municipality plans to enable its citizens and businesses to realize their own solar energy project. The Solar Vision is prepared based on input from residents, businesses and institutions [Dutch] In de zonvisie staat hoe de gemeente Amsterdam haar burgers en bedrijven in staat wil stellen om hun eigen zonne-energieproject te realiseren. De zonvisie is mede opgesteld op basis van input van bewoners, bedrijven en instellingen.

  6. Biology, Management and Utilization of Common Reed Pharagnites australis.

    Science.gov (United States)

    1987-02-01

    Vrije Universiteit Waterways Experiment Staticn Department of Ecology and Ecotoxicology Environmental Laboratory P.O. Box 7161 P.O. Box 631 1007 MC...Madelijn van der Werff Vrije Universiteit Department of Ecology and Ecotoxicology Amsterdam and John W. Simmers and Stratford H. Kay Waterways...lowing and cutting 67 5.2.4. Active regulation of the water table 68 5.5. Nature conservation 68 5.4. Reed cultivation 69 Z.4. 1. Reed harvest 69 6

  7. Measured and calculated NO2 concentrations in Amsterdam in 2008

    International Nuclear Information System (INIS)

    Wesseling, J.P.; Nguyen, P.L.; Van der Zee, S.

    2010-08-01

    Calculations using the Dutch standard calculation method for air quality in urban streets performed for 38 streets in Amsterdam in 2008 yield, on average, lower Nitrogen dioxide concentrations than measurements at those locations. This follows from research by the RIVM and the Public Health Service of Amsterdam (GGD Amsterdam). The average difference between measured and calculated concentrations is 11 %. At measuring locations of the National Air Quality Measuring Network in the Netherlands no significant underestimation of concentrations by the model is observed. The research was performed by the Dutch ministry of Housing, Spatial Planning en the Environment (VROM). The air quality in the streets that were investigated is mainly determined by emissions from local traffic. The measurements have been performed during thirteen periods of four weeks each, using so called 'Palmes' diffusion tubes. These measurements have been calibrated using the European reference method that is operational in the permanent measuring stations of the GGD Amsterdam. The calculations were performed using the geometry of the roads and information of the traffic at the measuring locations. Part of the differences can be explained, as some locations are not within the scope of the model. In these situations the model is known to perform slightly less. Apart from local traffic, other sources, like shipping, also contribute to the NO2 background concentrations in streets in Amsterdam. Sources that have only globally been included in the calculation of this background concentration may influence concentrations at specific locations. Further studies on this subject will be conducted in 2010. [nl

  8. Congenital anomalies in the teratological collection of Museum Vrolik in Amsterdam, The Netherlands. III: primary field defects, sequences, and other complex anomalies

    NARCIS (Netherlands)

    Oostra, R. J.; Baljet, B.; Verbeeten, B. W.; Hennekam, R. C.

    1998-01-01

    The Museum Vrolik collection of the Department of Anatomy and Embryology of the Academic Medical Center, University of Amsterdam, founded by Gerardus Vrolik (1775-1859) and his son Willem Vrolik (1801-1863), consists of more than 5,000 specimens of human and animal anatomy, embryology, pathology,

  9. Experimental light scattering by small particles in Amsterdam and Granada

    Directory of Open Access Journals (Sweden)

    Volten H.

    2010-06-01

    Full Text Available We report on two light scattering instruments located in Amsterdam and Granada, respectively. These instruments enable measuring scattering matrices as functions of the scattering angle of collections of randomly orieneted irregular particles. In the past decades, the experimental setup located in Amsterdam, The Netherlands, has produced a significant amount of experimental data. Unfortunately, this setup was officially closed a couple of years ago. We also present a modernized descendant of the Dutch experimental setup recently constructed at the Instituto de Astrofísica de Andalucía (IAA in Granada, Spain. We give a brief description of the instruments, and present some representative results.

  10. The Willingness-to-Pay for Facilities at the Amsterdam Zuidas

    NARCIS (Netherlands)

    de Graaff, T.; de Groot, H.L.F.; Rodenburg, C.A.; Verhoef, E.T.

    2007-01-01

    This paper reports the results of a stated preference study investigating the willingness-to-pay (WTP) of employees at the Amsterdam Zuidas for the presence of nonshopping and shopping facilities. The Amsterdam Zuidas area, surrounding the current train-metro-tram station Amsterdam Zuid

  11. Hotels 'on hold' : Economische effecten van nieuw hotelbeleid in de gemeente Amsterdam

    NARCIS (Netherlands)

    Tieben, B.; Buunk, E.

    Amsterdam will tighten its licensing policy for new hotels. Under the new policy, the principle of “no, unless” will apply to the entire city. The development of new hotels in Amsterdam will only be possible in exceptional circumstances. SEO Amsterdam Economics has been commissioned by the

  12. An excellence initiative in liberal arts and science education: the case of Amsterdam University College

    NARCIS (Netherlands)

    van der Wende, Marijk; Wang, Q; Cheng, Y.

    2013-01-01

    Amsterdam University College (AUC) was established in 2009 as an excellence initiative jointly undertaken by the University of Amsterdam (UvA) and VU University Amsterdam (VU). AUC is a selective and residential honours college that offers an international liberal arts and sciences bachelor

  13. Lessons Learned from Field Operational Test of Integrated Network Management in Amsterdam

    NARCIS (Netherlands)

    Hoogendoorn, S.P.; van Kooten, J; Adams, R

    2016-01-01

    The Amsterdam Practical Trial (APT) is a multiyear program initiated by the Dutch Ministry of Transport and the Environment and is carried out in close cooperation by Rijkswaterstaat, the City of Amsterdam, the Province of North Holland, and the Amsterdam Metropolitan Region. The APT aims to

  14. CO2 footprint 2008 District Oud-Zuid, Amsterdam, Netherlands; CO2-voetafdruk 2008 Stadsdeel Oud-Zuid [Amsterdam

    Energy Technology Data Exchange (ETDEWEB)

    Hanekamp, E; Van Merksteijn, C [Partners for Innovation, Amsterdam (Netherlands)

    2009-06-15

    The district 'Oud-Zuid' in Amsterdam, Netherlands, plans to become CO2 neutral in 2015. For this purpose, the CO2 footprint of the district is determined and a plan of action developed. By means of scenarios, the district council can make choices for climate investments [Dutch] Stadsdeel Oud-Zuid van de gemeente Amsterdam wil CO2-neutraal zijn in 2015. Daartoe is de CO2-voetafdruk van Oud-Zuid bepaald en een plan van aanpak uitgewerkt. Met behulp van scenario's zal de stadsdeelraad keuzes kunnen maken over haar klimaatinvesteringen.

  15. Superincentive public transport contracting in the greater Amsterdam area

    NARCIS (Netherlands)

    Bakker, B.; Van de Velde, D.M.

    2009-01-01

    All suburban/regional bus services around Amsterdam City have been submitted to competitive tendering. This is done under a very innovative form of revenue-based contract that can be classified as a ‘super incentive’ contract. Payments to operators (‘subsidies’) are based on realised passenger

  16. AMSTERDAM-NIJMEGEN EVERYDAY LANGUAGE TEST - CONSTRUCTION, RELIABILITY AND VALIDITY

    NARCIS (Netherlands)

    BLOMERT, L; KEAN, ML; KOSTER, C; SCHOKKER, J

    1994-01-01

    The Amsterdam-Nijmegen Everyday Language Test (ANELT) is designed to measure, first, the level of verbal communicative abilities of aphasic patients and, second, changes in these abilities over time. The level of communicative effectiveness is determined by the adequacy of bringing a message across.

  17. Data on healthy food accessibility in Amsterdam, the Netherlands

    NARCIS (Netherlands)

    Helbich, M; Hagenauer, J

    2017-01-01

    This data descriptor introduces data on healthy food supplied by supermarkets in the city of Amsterdam, The Netherlands. In addition to two neighborhood variables (i.e., share of autochthons and average housing values), the data comprises three street network-based accessibility measures derived

  18. Fifteen years medical information sciences: the Amsterdam curriculum

    NARCIS (Netherlands)

    Jaspers, Monique W.; Fockens, Paul; Ravesloot, Jan H.; Limburg, Martien; Abu-Hanna, Ameen

    2004-01-01

    Objectives: To inform the medical informatics community on the rational, goals, evolution and present contents of the Medical Information Sciences program of the University of Amsterdam and our achievements. Methods: We elaborate on the history of our program, the philosophy, contents and

  19. Polychaeten aus den Zoologischen Museen von Leiden und Amsterdam I

    NARCIS (Netherlands)

    Augener, H.

    1933-01-01

    In der vorliegenden Arbeit ist die Untersuchung eines sehr umfangreichen Polychaeten-Materials niedergelegt, das mir von Herrn Prof. Dr. E. D. van Oort in Leiden und Herrn Prof. Dr. L. F. de Beaufort in Amsterdam zur Bearbeitung übergeben wurde. Von diesem Material ist der dem Museum in Leiden

  20. The anatomy lessons of the Amsterdam Guild of Surgeons

    NARCIS (Netherlands)

    IJpma, F.F.A.

    2014-01-01

    Mandatory lessons in anatomy, taught by the praelector anatomiae (lecturer in anatomy) of the Amsterdam Guild of Surgeons, were an important part of the surgical training starting in the 16th century. We describe how surgeons were trained approximately 350 years ago at the Surgeons’ Guild. The role

  1. Kinderen in Amsterdam : waar en hoe zij verongelukken.

    NARCIS (Netherlands)

    Wegman, F.C.M.

    1975-01-01

    The report contains a part of the study to the traffic unsafety of children in Amsterdam. Difference is made between the incidental and structural approach. In the last one is thought of intervening changes in the traffic circulation, measures in the field of planning etc. Starting point is the

  2. The acoustics of the Amsterdam Opera House 'Het Muziektheater'

    NARCIS (Netherlands)

    Lange, P.A. de; Luxemburg, L.C.J. van; Muchall, R.C.

    1996-01-01

    The first opera house ever to be built in the Netherlands opened its doors on 26 Septem-ber 1986. Erected in the heart of old Am-sterdam, the building houses the Dutch Op-era Company, the National Ballet and the Ballet Orchestra. The design and planning of the building has an interesting history.

  3. Legionella-uitbraak in Amsterdam: koeltoren als bron

    NARCIS (Netherlands)

    Hoek, J A R van den; IJzerman, E P F; Coutinho, Roel A

    2006-01-01

    During the period 6-28 July 2006, 30 confirmed cases of Legionella infection were identified in Amsterdam, 2 of which were fatal. All had a positive urinary antigen test, by which Legionella pneumophila serogroup I could be demonstrated. Consultations between the parties involved in the control of

  4. The dynamic spatial impact of Amsterdam Airport Schiphol

    NARCIS (Netherlands)

    Warffemius, P.; van der Hoorn, T.; Klaassen, H.

    2008-01-01

    This paper is about the agglomeration effect of Amsterdam Airport Schiphol and its implications for location policy regarding the airport region. We focus on a specific case, namely the important concentration of European Distribution Centers (EDCs) around the airport. The traditional answer to the

  5. Researchcode in het Academisch Medisch Centrum te Amsterdam: nuttig

    NARCIS (Netherlands)

    Vermeulen, M.

    2002-01-01

    At the Academic Medical Centre (AMC) of the University of Amsterdam, the Netherlands, it was decided to set up a research code committee. The first thing that was done was to define what were considered the most relevant types of scientific misconduct: falsification, plagiarism and invasion of

  6. Cyber Resilience in de Bestuurskamer : The Grand Conference in Amsterdam

    NARCIS (Netherlands)

    Klaver, M.H.A.

    2013-01-01

    Op 16 oktober 2012 vond in Amsterdam The Grand Conference plaats. Deze conferentie werd georganiseerd door het Centre for the Protection of National lnfrastructure (CPNI.NL) in nauwe samenwerking met de Europese Commissie, de Europese Networkand Information Security Agency (ENISA), het Amerikaanse

  7. Gentrification in Amsterdam: assessing the importance of context

    NARCIS (Netherlands)

    Hochstenbach, C.; Musterd, S.; Teernstra, A.

    2015-01-01

    This paper investigates the income levels and income developments of in-migrating, out-migrating, and sitting households in gentrifying neighbourhoods in Amsterdam over a 10-year period (1999-2008). First, to analyse these data, this paper discusses the impact of institutional and housing market

  8. HIV testing behaviour among heterosexual migrants in Amsterdam

    NARCIS (Netherlands)

    Stolte, I. G.; Gras, M.; van Benthem, B. H.; Coutinho, R. A.; van den Hoek, J. A. R.

    2003-01-01

    This cross-sectional study among heterosexual migrant groups in south-eastern Amsterdam, the city area where the largest migrant groups live, provides an insight into HIV testing behaviour in this particular group. Participants were recruited at street locations (May 1997-July 1998) and interviewed

  9. Case note: Rb Amsterdam (Vzr.) (internet, onrechtmatige publicatie, portretrecht, privacy)

    NARCIS (Netherlands)

    Alberdingk Thijm, C.A.

    2008-01-01

    De Voorzieningenrechter te Amsterdam verbiedt vereniging van pedofielen Martijn foto's van kinderen van leden van de koninklijke familie te publiceren. Door het publiceren van die foto's wordt inbreuk gemaakt op het portretrecht van die kinderen en op de persoonlijke levenssfeer van die leden van de

  10. Capturing the imaginary: Students and other tribes in Amsterdam

    NARCIS (Netherlands)

    Arbonés Aran, N.

    2015-01-01

    This thesis wants to contribute to operationalize insights into student identities, urban images and city/educational marketing and management communication. Instead of harping on the discourse of managing and increasing the positive image of Amsterdam, this thesis aims to give insight into a more

  11. Mass casualty triage after an airplane crash near Amsterdam

    NARCIS (Netherlands)

    Postma, Ingri L. E.; Weel, Hanneke; Heetveld, Martin J.; van der Zande, Ineke; Bijlsma, Taco S.; Bloemers, Frank W.; Goslings, J. Carel

    2013-01-01

    Triage is an important aspect of the management of mass casualty incidents. This study describes the triage after the Turkish Airlines Crash near Amsterdam in 2009. The results of the triage and the injuries of P3 casualties were evaluated. In addition, the role of the trauma mechanism and its

  12. De Hollandsche Schouwburg : lieu de mémoire [Amsterdam

    NARCIS (Netherlands)

    van Montfrans, M.; Mesnard, P.; Jurgenson, L.

    2016-01-01

    The Hollandsche Schouwburg, a memorial Site Until 1940, The Hollandsche Schouwburg, located just outside the Jewish quarter of Amsterdam, was a popular theatre, putting on many well-known Dutch plays. In 1941 the Nazi occupiers changed the theatre's name into Joodsche Schouwburg (Jewish Theatre).

  13. Supporting electric vehicles in freight transport in Amsterdam

    NARCIS (Netherlands)

    Trip, J.J.; Konings, J.W.

    2014-01-01

    Report written within the framework of Activity 7.4 of the Interreg IVB project E-Mobility NSR, file nr. 35-2-6-11. During the last decade the Municipality of Amsterdam has initiated quite elaborate policies to improve the air quality within the city, both for reasons of public health and spatial

  14. El Plan General de Amsterdam. A.U.P (I

    Directory of Open Access Journals (Sweden)

    Helma Hellinga

    1997-07-01

    Full Text Available El siguiente texto fue publicado en el volumen Het Nieuwe Bouwen, Amsterdam 1920-1960, Stedelijk Museum-Delft University Press, 1983, pp. 52-111 con el título original "Het Algemeen Uitbreidinsplan van Amsterdam" y es una exposición ampliamente documentada de los antecedentes inmediatos y el desarrollo del Plan General de 1935. La traducción que aquí se ofrece de este largo artículo es solamente parcial, incluyendo exclusivamente lo que corresponde hasta la Segunda Guerra Mundial. Por consiguiente, no se recoge su parte final relativa a la realización efectiva del Plan en los años de posguerra y en las décadas siguientes. Aparte de esta exclusión principal, se han eliminado algunos pasajes intermedios de cierta redundancia a fin de adaptarlo a un formato más reducido.

  15. Amsterdam's Airport Library Serves Passengers in 30 Languages

    Science.gov (United States)

    Dempsey, Kathy

    2011-01-01

    In the summer of 2010, Schiphol Airport in Amsterdam started offering the world's first library in an airport. This article describes Airport Library which is no ordinary library. It holds more than 1,200 items, but it lends nothing. It operates 24/7, yet it's only staffed by volunteers for 2 or 3 hours a day. It offers just nine public-access…

  16. Capita Selecta Early Music Amsterdam : Kas eestlastele ainus koht varajase muusika õpinguteks? / Taavi-Mats Utt

    Index Scriptorium Estoniae

    Utt, Taavi-Mats

    2000-01-01

    SICi (Stichting Internationale Concerten en Werkgroepen) korraldatavast varajase muusika koolitusest, seminaride sarjast "Capita Selecta Early Music Amsterdam", SICi plaanist laiendada tegevust Kiievi ja Peterburi konservatooriumidesse

  17. Falende Universiteit: Voer voor Methodologen.

    NARCIS (Netherlands)

    Verschuren, P.J.M.

    2002-01-01

    Universities do not come up to a growing demand for practice oriented research and for students trained in this type of activity. Existing methodology mainly is theory oriented. We in large part miss methodology for producing prescriptive knowledge, for a holistic approach and for design oriented

  18. Book received: Paul van den Akker, Looking for Lines: Theories of the Essence of Art and the Problem of Mannerism, Amsterdam: Amsterdam University Press 2010 including preface, contents and introduction.

    Directory of Open Access Journals (Sweden)

    Paul van den Akker

    2010-12-01

    Full Text Available Paul van den Akker, Looking for Lines: Theories of the Essence of Art and the Problem of Mannerism, Amsterdam: Amsterdam University Press 2010 including preface, contents and introduction.

  19. Hinke Piersma en Jeroen Kemperman, Openstaande rekeningen. De gemeente Amsterdam en de gevolgen van roof en rechtsherstel, 1940-1950.

    Directory of Open Access Journals (Sweden)

    Regina Grüter

    2017-05-01

    Full Text Available Hinke Piersma en Jeroen Kemperman, Openstaande rekeningen. De gemeente Amsterdam en de gevolgen van roof en rechtsherstel, 1940-1950 (Amsterdam: Boom, 2015, 256 pp., isbn 978 908 953 661 7.

  20. Impact of AIDS on premature mortality in Amsterdam, 1982-1992

    NARCIS (Netherlands)

    Bindels, P. J.; Reijneveld, S. A.; Mulder-Folkerts, D. K.; Coutinho, R. A.; van den Hoek, A. A.

    1994-01-01

    OBJECTIVE: To study the impact of AIDS on premature mortality in the city of Amsterdam (1982-1992). METHODS: We combined aggregated data from the Netherlands Central Bureau for Statistics with data from the municipal death and population registry and data from the Amsterdam AIDS surveillance system

  1. Religious and territorial identities in a cosmopolitan and secular city: youth in Amsterdam

    NARCIS (Netherlands)

    Mamadouh, V.; van der Welle, I.; Brunn, S.D.

    2015-01-01

    Religion is a much contested issue in Dutch politics and more specifically in Amsterdam. We investigate whether and how religion works as an obstacle or a vehicle for integration for youth in the secular and cosmopolitan Amsterdam. First, we describe the role religion played in the process of nation

  2. Quiet Areas and the Need for Quietness in Amsterdam

    Directory of Open Access Journals (Sweden)

    Hester Booi

    2012-03-01

    Full Text Available This paper describes the Quiet Places Project in Amsterdam. The purpose of the study was to find out: (1 which public quiet places there are according to Amsterdam residents; (2 what characterizes a quiet place; (3 to what extent do residents want peace and quiet; (4 how do residents realize these needs. The factors determining the need for quietness are presented in a model showing the influence of demographic and socio-economic issues, health status, sensitiveness to noise, daily activities and the noisiness in and around home. Most important of these factors is sensitivity to noise. Elderly and less healthy people are more often sensitive to noise. People who are annoyed by sound from traffic, airplanes and the like show a higher need for quietness. People with a lively household or neighbourhood report lower needs for quietness. Visiting a quiet place and going outside to walk or bike can have a compensating effect on the need for quietness. This suggests that creating quiet places and enhancing possibilities for quiet recreation in urban environments can have a positive effect on the quality of life in the city. Objective noise levels at the quiet places were taken from environmental noise maps. This shows that there may be a preference for low transportation noise levels, but levels up to 60 dB Lday are acceptable. Apparently this depends on a relative quietness or on non-acoustic characteristics of an area: the presence of vegetation and other pleasant stimuli.

  3. Continuïteit en verandering in de handelsgeschiedenis van Amsterdam

    Directory of Open Access Journals (Sweden)

    O. Gelderblom

    2003-01-01

    Full Text Available Continuity and change in the trading history of Amsterdam,Oscar GelderblomThis article argues that Clé Lesger's Handel in Amsterdam (2001 overestimates the impact of the Dutch Revolt on the emergence of the Amsterdam market as the centre for international trade. The immigration of merchants from Brabant and Flanders at the end of the sixteenth century was a direct outcome of the increased economic interaction between Antwerp andAmsterdam after 1540. It was indeed after they had settled in the Dutch port that these newcomers accumulated most of their considerable wealth. Finally, Amsterdam's faceless markets for foodstuffs, raw materials, industrial products, and transportation services played just as important a role in the efficient exchange of information as the international networks of the Antwerp merchants.

  4. Jan Lever: Challenging the Role of Typological Thinking in Reformational Views of Biology

    NARCIS (Netherlands)

    Cook, Harry; Flipse, A.C.

    2017-01-01

    This essay analyzes the view of evolution of Jan Lever (1922–2010), founder of the biology department at the Vrije Universiteit Amsterdam, and compares his view with those of J.H. Diemer and H. Dooyeweerd. Together with Dooyeweerd, Lever wrote a series of chapters on the species concept in

  5. Civil society in beweging: Vier moskeeorganisaties in Amsterdam Slotervaart

    Directory of Open Access Journals (Sweden)

    Inge de Jong

    2007-03-01

    Full Text Available In this article, a picture is drawn of four mosques and affiliated foundations in the civil society of the Amsterdam city district Slotervaart. The focus in this article is concerned with civil society and religion. We took a closer look at what activities were being organised, what developments were underway, and what view the boards of the foundations and mosque councils held with respect to citizenship and the function of places of worship in Dutch society. The results of the study show that members of the board and volunteers try to build a bridge to Dutch society by appealing to the community from the perspective of theirn bonding function. The organisations find themselves in a field of force with internal and external developments in which they must function and within which they try to give their social responsibility shape.

  6. Exploring public databases to characterize urban flood risks in Amsterdam

    Science.gov (United States)

    Gaitan, Santiago; ten Veldhuis, Marie-claire; van de Giesen, Nick

    2015-04-01

    Cities worldwide are challenged by increasing urban flood risks. Precise and realistic measures are required to decide upon investment to reduce their impacts. Obvious flooding factors affecting flood risk include sewer systems performance and urban topography. However, currently implemented sewer and topographic models do not provide realistic predictions of local flooding occurrence during heavy rain events. Assessing other factors such as spatially distributed rainfall and socioeconomic characteristics may help to explain probability and impacts of urban flooding. Several public databases were analyzed: complaints about flooding made by citizens, rainfall depths (15 min and 100 Ha spatio-temporal resolution), grids describing number of inhabitants, income, and housing price (1Ha and 25Ha resolution); and buildings age. Data analysis was done using Python and GIS programming, and included spatial indexing of data, cluster analysis, and multivariate regression on the complaints. Complaints were used as a proxy to characterize flooding impacts. The cluster analysis, run for all the variables except the complaints, grouped part of the grid-cells of central Amsterdam into a highly differentiated group, covering 10% of the analyzed area, and accounting for 25% of registered complaints. The configuration of the analyzed variables in central Amsterdam coincides with a high complaint count. Remaining complaints were evenly dispersed along other groups. An adjusted R2 of 0.38 in the multivariate regression suggests that explaining power can improve if additional variables are considered. While rainfall intensity explained 4% of the incidence of complaints, population density and building age significantly explained around 20% each. Data mining of public databases proved to be a valuable tool to identify factors explaining variability in occurrence of urban pluvial flooding, though additional variables must be considered to fully explain flood risk variability.

  7. Distinct Neisseria gonorrhoeae Transmission Networks Among Men Who Have Sex With Men in Amsterdam, the Netherlands

    NARCIS (Netherlands)

    Heymans, Raymond; A Matser, Amy; Bruisten, Sylvia M.; Heijman, Titia; Geskus, Ronald B.; Speksnijder, Adrianus G. C. L.; Davidovich, Udi; de Vries, Henry J. C.; Coutinho, Roel A.; Schim van der Loeff, Maarten F.

    2012-01-01

    Background. Molecular typing was used to elucidate Neisseria gonorrhoeae transmission networks among men who have sex with men (MSM) in Amsterdam, the Netherlands. We determined whether clusters of patients infected with specific N. gonorrhoeae genotypes were related to various epidemiological

  8. Assembly of an endcap of the ATLAS silicon strip detector at NIKHEF, Amsterdam.

    CERN Multimedia

    Ginter, P

    2005-01-01

    Assembly of an endcap of the ATLAS silicon strip detector (SCT) at NIKHEF, Amsterdam. Technicians are mounting the power distribution cables on the cylinder that houses nine disks with silicon sensors.

  9. Housing liberalisation and gentrification: the social effects of tenure conversions in Amsterdam

    NARCIS (Netherlands)

    Boterman, W.R.; van Gent, W.P.C.

    2014-01-01

    Privatisation and liberalisation of the housing market are often used as governmental strategies for engineering the social composition of urban neighbourhoods. Drawing on longitudinal register data, this study reports findings from the highly-regulated housing context of Amsterdam. Through

  10. Do Neighborhood Characteristics in Amsterdam Influence Adiposity at Preschool Age?

    Directory of Open Access Journals (Sweden)

    E. Jessica Hrudey

    2015-05-01

    Full Text Available Background: Neighborhood characteristics may contribute to adiposity in young children, but results in the current literature are inconsistent. This study aimed to investigate whether objective (socioeconomic status (SES and subjective (perceived safety, satisfaction with green spaces and perceived physical disorder neighborhood characteristics directly influence child adiposity (as measured by BMI, percent body fat (%BF and waist-to-height ratio (WHtR. Methods: Data on child BMI, %BF and WHtR were obtained from the Amsterdam Born Children and their Development cohort at 5–6 years of age. Three thousand four hundred and sixty nine (3469 children were included in the analyses. Mixed models, using random intercepts for postal code area to account for neighborhood clustering effects, were used to analyze the relationships of interest. Results: Associations were observed for both perceived safety and neighborhood SES with %BF after adjustment for maternal education and ethnicity. All relationships were eliminated with the inclusion of individual covariates and parental BMI into the models. Conclusions: In general, child adiposity at age 5–6 years was not independently associated with neighborhood characteristics, although a small relationship between child %BF and both neighborhood SES and perceived safety cannot be ruled out. At this young age, familial and individual factors probably play a more important role in influencing child adiposity than neighborhood characteristics.

  11. Italian validation of the Amsterdam Preoperative Anxiety and Information Scale.

    Science.gov (United States)

    Buonanno, Pasquale; Laiola, Anna; Palumbo, Chiara; Spinelli, Gianmario; Terminiello, Virginia; Servillo, Giuseppe

    2017-07-01

    Preoperative anxiety is usually experienced by patients awaiting surgical procedures and it can negatively impact patient's outcome. The Amsterdam Preoperative Anxiety and Information Scale (APAIS) is a questionnaire created to identify anxious patients and their need for information: it has been translated and validated in many languages because of its reliability and ease of completion. To date, no Italian version of the APAIS has been produced; our aim was to translate and validate the APAIS in Italian. We produced an Italian version of the APAIS and we administered it to 110 patients undergoing elective surgery; we explored its structure by factor analysis and its reliability by Cronbach's alpha. We analyzed its external validity by confronting it to the Spielberg's State-Trait Anxiety Inventory (STAI). Sensitivity, specificity, and positive and negative predictive values of the Italian version of the APAIS were determined. The Italian version of the APAIS confirmed the original structure of the questionnaire and its internal consistency; it well correlated with the STAI-Y1, the subscale of the STAI which explore the anxiety "state." An APAIS score of 14 was found as best cutoff to distinguish anxious and non-anxious patients. The Italian translation of the APAIS showed psychometric properties similar to the original version. Its reliability and its efficiency make it a powerful tool even in Italian population to detect anxiety and need for information.

  12. Soil Investigation Aspects of a Complex Metro Project in Amsterdam

    Science.gov (United States)

    Herbschleb, Jurgen

    The municipality of Amsterdam wishes to reduce the level of car traffic within the City Centre. As a consequence the public transport is to be extended by a new (bored) North/South Metro line. The excavation depths for the stations will exceed 30 m and will be constructed in difficult soft soil conditions. A further significant aspect is that the building pits are very near (3 to 5 m) to buildings of historical importance. The design philosophy of the station boxes was to determine an acceptable balance between the safety requirements and construction costs. The guidelines for the design, both for the building pits and the bored tunnel, are the predicted deformations of the adjacent building foundations. One of the more important geotechnical risks for this project is incorrect determination of the deformations arising from the building processes alongside the route of the metro. As such it should be realised that advanced finite element programs with second order material models require different geotechnical parameters than analytical models. The careful selection of calculation (soil) models, the level of safety (risk analysis), and site investigation is the start of the determination of the geotechnical parameters. This paper will focus on the interpretation of the site investigation for this complex project and will concentrate on the process followed, the problems encountered with the interpretation, the obtained results, and the used tools for geotechnical risk management.

  13. The Amsterdam model for control of tattoo parlours and businesses.

    Science.gov (United States)

    Veenstra, Thijs

    2015-01-01

    In the early 1980s, an outbreak of hepatitis B in Amsterdam stood at the start of the development of the first hygiene guidelines for tattooists in The Netherlands. Ever since, infection control in tattoo practice has continued to prove its importance as tattoo-related outbreaks of infectious diseases have continued to be reported in Europe. Furthermore, the act of tattooing includes breaking the skin barrier but is performed by professionals who are not medically trained. The Ministry of Health has now implemented uniform regulations that apply to professionals who perform tattooing and apply permanent make-up. These regulations include hygiene guidelines that were developed by the National Institute for Public Health and the Environment in cooperation with representatives of the tattooing associations. The guidelines contain a list of requirements, including for the studio interior, the cleanness of the studio, the safe use of permitted equipment and products, sterilization methods, and the information provided to the customer. A permit may be granted after an inspection by the local health service, during which the act of tattooing has to be performed. It is now estimated that over 95% of all tattoos in The Netherlands were obtained at one of the almost 900 licensed studios. Reports of complications are generally low in number. We suggest that uniform European hygiene guidelines would further contribute to the safety of tattooing. © 2015 S. Karger AG, Basel.

  14. Inguinal hernia repair in the Amsterdam region 1994-1996.

    Science.gov (United States)

    Schoots, I G; van Dijkman, B; Butzelaar, R M; van Geldere, D; Simons, M P

    2001-03-01

    In the Netherlands, approximately 30,000 inguinal hernia repairs are performed yearly. At least 15% are for recurrence. New procedures are being introduced creating discussion on which technique is the best. Currently it is not possible to choose on evidence alone because of the long follow-up that is needed. In 1996 an inventory was taken of all inguinal hernia repairs that were performed in the Amsterdam region (9 hospitals). These results were compared with the results from a similar study performed in 1994. Major changes in treatment strategy were noted. The Bassini repair was replaced by Shouldice and Lichtenstein techniques. There was a significant increase in the use of prostheses for both primary and recurrent inguinal hernias. There was no significant decrease in the percentage of operations performed for recurrent hernia from 19.5% to 16.8%. However, there was a significant decrease in operations performed for early recurrences (5.1%-3.4%) (p = 0.05). These results suggest that the Shouldice and Lichtenstein repairs may be superior to the Bassini repair in terms of early hernia recurrence.

  15. HIV testing behaviour among heterosexual migrants in Amsterdam.

    Science.gov (United States)

    Stolte, I G; Gras, M; Van Benthem, B H; Coutinho, R A; van den Hoek, J A

    2003-08-01

    This cross-sectional study among heterosexual migrant groups in south-eastern Amsterdam, the city area where the largest migrant groups live, provides an insight into HIV testing behaviour in this particular group. Participants were recruited at street locations (May 1997-July 1998) and interviewed using structured questionnaires. They also donated saliva for HIV testing. In total, 705 males and 769 females were included in this study (Afro-Surinamese (45%), Dutch-Antilleans (15%) and West Africans (40%)). Prior HIV testing was reported by 38% of all migrants (556/1479), of which only a minority (28%) had actively requested HIV testing. Multivariate logistic regression showed that not actively requesting HIV testing was more likely among younger (migrants, especially women (ORwomen: 4.79, p risk should be facilitated by promoting HIV testing and by improving accurate self-assessment of risk for HIV infection, especially among the groups that do not actively request HIV testing. This would increase HIV awareness and provide the opportunity of better medical care earlier in HIV infection.

  16. Municipal climate change policies. A case study for Amsterdam

    International Nuclear Information System (INIS)

    Schol, E.; Van den Bosch, A.; Ligthart, F.A.T.M.; Roemer, J.C.; Ruijg, G.J.; Schaeffer, G.J.; Dinkelman, G.H.; Kok, I.C.; De Paauw, K.F.B.

    1999-01-01

    Insight in the local policy options with respect to climate change is provided, in this case within the sphere of influence of Amsterdam local authorities. A list of new policy options for CO 2 reduction has been made with the assistance of local policy makers and representatives of interest groups. These policy options have been divided into three qualitative scenarios: Institutional Cultural Change, Technological Innovation and Least-Regrets. The environmental, economic and other effects have been described for each policy option. The three most interesting policy options have been selected by local policymakers and representatives of interest groups during a workshop. Implementation strategies have been developed for the options selected. These strategies have been discussed during a second workshop. The reduction target, stabilisation of CO 2 emissions in 2015 compared to 1993, can be reached by a combination of all the new policy options. The three selected policy options count for 40% of this total CO 2 emission reduction. Finally, a general outline on the methodology can also be applied to other cities and municipalities. For example, this methodology can be used by participants of Cities for Climate Protection, an initiative of the International Council for Local Environmental Initiatives, or the Netherlands Climate Association. 136 refs

  17. Energy in the fast lane. Energy consumption of datahotels and ICT in Amsterdam, Netherlands; Energie snel weg. Bitspakhuizen in Amsterdam vreten ruimte en vermogen

    Energy Technology Data Exchange (ETDEWEB)

    Schrauwers, A. [ed.

    2000-11-29

    The rise of Information and Communication Technology (ICT) businesses (also known as datahotels) in the region of Amsterdam, Netherlands, causes electric power capacity problems. A brief overview is given of the required capacity of the ICT-sector in the Netherlands and the energy balance of a datahotel.

  18. Smart Policies and Metropolitan Vision: the Spatial Dimension in the Experience of Amsterdam Smart City Platform

    Directory of Open Access Journals (Sweden)

    Giulia Fini

    2014-11-01

    Full Text Available The paper aims at presenting the main projects and policies recently developed by the Municipality of Amsterdam in the field of energy policies, with particular reference to the projects promoted in the context of the ASC - Amsterdam Smart City Platform. The analyzed projects and policies seem to be relevant for at least three aspects and for the matters raised by them:I. for the aim to connect policies and projects of the Amsterdam Smart City with the definition of a territorial vision for the Amsterdam metropolitan area;II. for the strong connection characterizing this experience between energy-management policies on the territory and the management’s choices related to urban planning and urban design;III. finally, the experience is relevant in relation with the consolidation of the ACS’s platform as a place where several individuals are directly involved in the management of public good and where all requests and peculiarities contribute to defining a common planning process on the energy and environmental subjects in the urban and metropolitan area.  Based on the latest, most significant information of the activities performed by Amsterdam Smart City Platform, the paper focuses on the results after four years since the projects and tests have been carried out, on the basis of a network structuring, predetermined energy-saving targets and of some space-related choices regarding the whole territory as well as ASC’s policies.

  19. Additional value of typing Noroviruses in gastroenteritis outbreaks in Amsterdam, The Netherlands.

    Science.gov (United States)

    Koek, A G; Bovée, L P M J; van den Hoek, J A R; Bos, A J; Bruisten, S M

    2006-02-01

    In Amsterdam, 17 of the 55 gastroenteritis (GI) outbreaks reported from January 2002 to May 2003 were confirmed to be caused by noroviruses (NV). In this study, we describe the molecular epidemiology of a group of nine outbreaks associated with a catering firm and two outbreaks, 5 months apart, in an Amsterdam hospital. All outbreaks were typed to confirm their linkage, and the hospital-related cases were studied to see if the two outbreaks were caused by one persisting NV strain or by a reintroduction after 5 months. For the outbreaks associated with the catering firm one NV genogroup I strain was found which was identical in sequence among customers and employees of the caterer. This was not the strain that predominantly circulated in 2002/2003 in and around Amsterdam, which was the NV genogroup II4 "new variant" (GgII4nv) strain. In the Amsterdam hospital, the two outbreaks were caused by this predominant GgII4nv type, and we argue that NV was most likely reintroduced in the second outbreak from the Amsterdam community.

  20. De AERA. Gedroomde machines en de praktijk van het rekenwerk aan het Mathematisch Centrum te Amsterdam

    Directory of Open Access Journals (Sweden)

    Gerard Alberts

    2008-06-01

    Full Text Available AERA. Dream machines and computing practices at the Mathematical Center  Dream machines may be just as effective as the ones materialised. Their symbolic thrust can be quite powerful. The Amsterdam ‘Mathematisch Centrum’ (Mathematical Center, founded February 11, 1946, created a Computing Department in an effort to realise its goal of serving society. When Aad van Wijngaarden was appointed as head of the Computing Department, however, he claimed space for scientific research and computer construction, next to computing as a service. Still, the computing service following the five stage style of Hartree’s numerical analysis remained a dominant chara c ter istic of the work of the Computing Department.The high level of ambition held by Aad van Wijngaarden lead to ever renewed projections of big automatic computers, symbolised by the never-built AERA. Even a machine that was actually constructed, the ARRA which followed A.D. Booth’s design of the ARC, never made it into real operation. It did serve Van Wijngaarden to bluff his way into the computer age by midsummer 1952. Not until January 1954 did the computing department have a working stored program computer, which for reasons of policy went under the same name: ARRA. After just one other machine, the ARMAC, had been produced, a separate company, Electrologica, was set up for the manufacture of computers, which produced the rather successful X1 computer.The combination of ambition and absence of a working machine lead to a high level of work on programming, way beyond the usual ideas of libraries of subroutines. Edsger W. Dijkstra in particular led the way to an emphasis on the duties of the programmer within the pattern of numerical analysis. Programs generating programs, known elsewhere as autocoding systems, were at the ‘Mathematisch Centrum’ called ‘superprograms’. Practical examples were usually called a ‘complex’, in Dutch, where in English one might say

  1. The Compilation of Multilingual Concept Literacy Glossaries at the University of Cape Town: A Lexicographical Function Theoretical Approach Die samestelling van veeltaligekonsep-geletterheidswoordelyste by die Universiteit van Kaapstad: 'n Leksikografiesefunksieteoretiese benadering.

    Directory of Open Access Journals (Sweden)

    Dion Nkomo

    2012-01-01

    Full Text Available

    This article proposes a lexicographical approach to the compilation of multilingual concept literacy glossaries which may play a very important role in supporting students at institutions of higher education. In order to support concept literacy, especially for students for whom English is not the native language, a number of universities in South Africa are compiling multilingual glossaries through which the use of languages other than English may be employed as auxiliary media. Terminologies in languages other than English are developed by translating English terms or coining new terms in these languages to exploit the native language competence of most students. The glossary project at the University of Cape Town (UCT which was conceived under the auspices of the Multilingualism Education Project (MEP is discussed. It is shown that the UCT glossaries are compiled using methods consistent with those employed in modern lexicography or proffered in lexicographical theory. The lexicographical function theory is specifically used to account for the glossaries and their production. It is suggested that modern lexicography can provide useful guidance for the production of glossaries, given that the earliest glossaries constitute the humble beginnings of lexicography.

    Hierdie artikel stel 'n leksikografiese benadering tot die samestelling van meertaligekonsep-geletterheidswoordelyste voor wat 'n baie belangrike rol kan speel by die ondersteuning van studente by instellings vir hoër onderwys. Om konsepgeletterdheid te ondersteun, veral vir studente vir wie Engels nie die moedertaal is nie, stel 'n aantal universiteite in Suid-Afrika meertalige woordelyste saam waardeur die gebruik van ander tale as Engels as hulpmedia aangewend kan word. Terminologieë in ander tale as Engels word ontwikkel deur Engelse terme te vertaal of nuwe terme in hierdie tale te skep om die moedertaalvaardigheid van die meeste

  2. Ordinary People in the New World: The City of Amsterdam, Colonial Policy, and Initiatives from Below, 1656-1664

    NARCIS (Netherlands)

    Blom, F.; Looijesteijn, H.; Jacob, M.C.; Secretan, C.

    2013-01-01

    Between 1656 and 1664 the City of Amsterdam, uniquely, possessed a "City Colony" in the Dutch colony of New Netherland. Called New Amstel, this fledgling colony on the South River—the current Delaware—for a brief time cemented the commitment of Amsterdam to the preservation of the Dutch colony in

  3. Urinary uranium and kidney function parameters in professional assistance workers in the Epidemiological Study Air Disaster in Amsterdam (ESADA)

    NARCIS (Netherlands)

    J.A. Bijlsma (Joost); P. Slottje (Pauline); A.C. Huizink (Anja); J.W.R. Twisk (Jos); G.B. van der Voet (Gijsbert); F.A. de Wolff (Frederik); F. Vanhaecke (Frank); L. Moens (Luc); T. Smid (Tjabe)

    2008-01-01

    textabstractBackground. The Epidemiological Study Air Disaster in Amsterdam (ESADA) aimed to assess long-term health effects in professional assistance workers involved in the 1992 air disaster in Amsterdam. As part of ESADA indications of nephrotoxicity due to exposure to uranium from the balance

  4. Urinary uranium and kidney function parameters in professional assistance workers in the Epidemiological Study Air Disaster in Amsterdam (ESADA)

    NARCIS (Netherlands)

    Bijlsma, Joost A.; Slottje, Pauline; Huizink, Anja C.; Twisk, Jos W. R.; van der Voet, Gijsbert B.; de Wolff, Frederik A.; Vanhaecke, Frank; Moens, Luc; Smid, Tjabe

    2008-01-01

    The Epidemiological Study Air Disaster in Amsterdam (ESADA) aimed to assess long-term health effects in professional assistance workers involved in the 1992 air disaster in Amsterdam. As part of ESADA indications of nephrotoxicity due to exposure to uranium from the balance weights of the crashed

  5. The creation of play spaces in twentieth-century Amsterdam: from an intervention of civil actors to a public policy

    NARCIS (Netherlands)

    Verstrate, L.; Karsten, L.

    2011-01-01

    This case study uncovers a turning point in the production of play space in Amsterdam. Whereas over the first half of the twentieth century the creation of play spaces used to be the primary responsibility of the Amsterdam civil society, this situation started to change after the Second World War.

  6. Speaking of Belonging: Learning to Be "Good Citizens" in the Context of Voluntary Language Coaching Projects in Amsterdam, the Netherlands

    Science.gov (United States)

    Mosher, Rhiannon

    2015-01-01

    This article explores citizenship education for adult immigrants through informal language education in Amsterdam, the Netherlands. Based on data collected over thirteen months of ethnographic research among volunteer Dutch language coaches in Amsterdam, the primary methods used in this study were in-depth semi-structured interviews and…

  7. The air quality impact of the port of Amsterdam on its environment: Development of an air quality tool

    NARCIS (Netherlands)

    Klok, L.; Breemen, T. van; Hulskotte, J.

    2011-01-01

    Due to the expansion of the Port of Amsterdam, Urban development and the construction of new highways, air pollution levels are about to exceed European guidelines in and around the port region of Amsterdam. To assess the air quality in this region and the impact of theport emissions on its

  8. Career choices of migrant artists between Amsterdam and Antwerp. The Van Nieulandt brothers

    Directory of Open Access Journals (Sweden)

    Eric Jan Sluijter

    2015-12-01

    Full Text Available This essay examines the career choices of the brothers Guilliam II and Adriaen II van Nieulandt. Both were born in Antwerp but moved with their parents to Amsterdam at a young age. Guilliam returned to Antwerp to make his career, while Adriaen became embedded in Amsterdam’s artistic community. All members of their family – in Antwerp, Amsterdam and Rome – remained in close contact with each other, though changes in the religious and political culture left their mark on their professional decisions. Their choices did not yield artistic innovations but conservative styles and subjects based on shared Netherlandish traditions with a strong international flavour.

  9. Travelling Concepts : Text, Subjectivity, Hybridity : Amsterdam, 11, 12 y 13 de enero de 2000

    OpenAIRE

    Barros, Claudia; Zusman, Perla Brígida

    2000-01-01

    La Amsterdam School for Cultural Analysis, Theory and Intepretation (ASCA) ha organizado, los días 11, 12 y 13 de enero del 2000, el evento: Travelling Concepts: Text, Subjectivity, Hybridity. A la luz del «giro cultural» que la geografía ha realizado a partir de la década de 1990, la participación en encuentros de esta índole resultan de interés para incentivar los intercambios entre el campo de la geografía y el de los estudios culturales. L'Amsterdam School for Cultural Analysis, Theory...

  10. Designing Public Space for Mobility: Contestation, Negotiation and Experiment at Amsterdam Airport Schiphol

    DEFF Research Database (Denmark)

    Nikolaeva, Anna

    2012-01-01

    The paper investigates airport design, using the example of Amsterdam Airport Schiphol, from the point of view of managers, architects and designers. It is argued that existing accounts of the airport as a space of transit as well as a place for shopping and entertainment have underrated the comp......The paper investigates airport design, using the example of Amsterdam Airport Schiphol, from the point of view of managers, architects and designers. It is argued that existing accounts of the airport as a space of transit as well as a place for shopping and entertainment have underrated...

  11. Optimality aspects with assigning of Magistrates to Sessions and Teams of the Amsterdam Criminal Court

    NARCIS (Netherlands)

    Schreuder, J.A.M.; Burke, E.K.; Rudova, H.

    2006-01-01

    In the criminal court (Arrondissements rechtbank, sector strafrecht) of Amsterdam the assignment of magistrates (judges, officers, etc) to sessions needed to handle the cases presented, has become a problem last years mainly caused by the increase of so called mega-sessions. One complicating factor

  12. The organisational legitimacy of immigrant groups: Turks and Moroccans in Amsterdam

    NARCIS (Netherlands)

    Vermeulen, F.; Brünger, M.

    2014-01-01

    This article analyses the organising process of Turkish and Moroccan immigrant groups in Amsterdam over a long-term period. In it, we argue that organisational legitimacy is the driving factor of an organisational process. We understand legitimacy as a generalised belief that an organisation's

  13. The ''Amsterdam Castle'': A case study of wiggle matching and the proper calibration curve

    NARCIS (Netherlands)

    van der Plicht, J; Jansma, E|info:eu-repo/dai/nl/074965255; Kars, H

    1995-01-01

    We have performed a high-precision 14C wiggle-matching study on two oak beams from the "Castle of Amsterdam". These beams are also dated by dendrochronology. Our two dating methods can only be made consistent using the recommended calibration curve (1986) instead of the revised one (1993).

  14. Increasing awareness and prompting HIV testing: Contributions of Amsterdam HIV Testing Week 2016.

    NARCIS (Netherlands)

    den Daas, C; Meddens, E M; van Bergen, Jeam; de Bree, G J; Hogewoning, A A; Brinkman, K; de Wit, Jbf

    2018-01-01

    We evaluated Amsterdam HIV Testing Week (HTW) 2016 regarding its primary goals of raising awareness and prompting HIV testing. Participating services offered free, anonymous HIV testing, with a focus on reaching men who have sex with men (MSM) and people with a non-western migration background.

  15. Ecstacy and cocaine : Patterns of use among prime age individuals in Amsterdam

    NARCIS (Netherlands)

    van Ours, J.C.

    2005-01-01

    This paper uses information about prime age individuals living in Amsterdam to study the patterns of use of ecstasy and cocaine.The information was collected in surveys in 1994, 1997 and 2001.The analysis shows that the use of ecstasy and cocaine is mainly influenced by calendar year, family

  16. Sustainable entrepreneurship ecosystem emergence and development : a case study of Amsterdam Denim City

    NARCIS (Netherlands)

    DiVito, Lori; Ingen-Housz, Zita

    2017-01-01

    Our paper investigates the interaction of mechanisms that drive the emergence and development of a sustainable entrepreneurship ecosystem (SEE). We study a specific geographic context, the Amsterdam metropolitan area, and a specific industrial context, the denim industry. We conducted a qualitative,

  17. Location-based technology and game-based learning in secondary education: learning about medieval Amsterdam

    NARCIS (Netherlands)

    Admiraal, W.; Akkerman, S.; Huizenga, J.; van Zeijts, H.

    2009-01-01

    Mobile games in education are excellent ways to combine situated, active and constructive learning with fun. In the mobile city game Frequency 1550 teams -of four students each- step into the game's world. With help of the Internet, smart phones and GPS technology, Amsterdam changes into a medieval

  18. Intraday Analysis of Market Integration: Dutch Blue Chips traded in Amsterdam and New York

    NARCIS (Netherlands)

    A.J. Menkveld (Bert)

    2000-01-01

    textabstractMarket integration is studied for Dutch stocks cross-listed at the NYSE. Trading starts in Amsterdam and ends in New York with a one-hour overlap. Both markets are not perfectly integrated in that they can be viewed as one market with the well-documented U-shape in volatility, volume and

  19. Placing prostitution: the spatial-sexual order of Amsterdam and its growth coalition

    NARCIS (Netherlands)

    Aalbers, M.B.; Deinema, M.

    2012-01-01

    Amsterdam's red-light district is the paradigmatic case of window prostitution, but it is not a stable case: both the regulatory context of prostitution in the Netherlands and the socio-spatial dynamics of the district have changed throughout the years. This paper advances our understanding of

  20. The Lost Art of Regulated tolerance? Fifteen Years of Regulating Vices in Amsterdam

    NARCIS (Netherlands)

    Huisman, W.; Nelen, J.M.

    2014-01-01

    Fifteen years ago, Brants explored the idiosyncrasies of Dutch policy with regard to prostitution, focusing on the situation in the Dutch capital. Amsterdam was on the brink of the enactment of new policies and legislation regarding the legalization of prostitution and the crackdown on organized

  1. Die Lehre aus Amsterdam: Neue Urbanität in der alten Stadt

    NARCIS (Netherlands)

    Kloosterman, R.C.

    2010-01-01

    Cultural industries as an instrument seem to offer a way to revitalize derelict areas in and around the urban core that have been blighted by deindustrialization in the 1970 and 1980s. In this article, we explore how cultural industries have affected two such areas close to the Amsterdam central

  2. Children of immigrants in schools in New York and amsterdam : The factors shaping attainment

    NARCIS (Netherlands)

    Crul, Maurice; Holdaway, Jennifer

    Background/Context: This article considers the ways in which school systems in New York City and Amsterdam have shaped the educational trajectories of two groups of relatively disadvantaged immigrant youth: the children of Dominican immigrants in New York and the children of Moroccan immigrants in

  3. Risk behavior and social-cognitive determinants of condom use among ethnic minority communities in Amsterdam

    NARCIS (Netherlands)

    Wiggers, Louise C. W.; de Wit, John B. F.; Gras, Mitzi J.; Coutinho, Roel A.; van den Hoek, Anneke

    2003-01-01

    This study assessed sexual risk behavior and determinants of condom use among migrants in Amsterdam, the Netherlands. We tested the predictive utility of constructs derived from the health belief model and the theory of planned behavior. Data were collected by means of a cross-sectional study in a

  4. Winkelen als bevrijding? Vrouwen en stedelijke ruimte in Amsterdam, 1863-1913

    NARCIS (Netherlands)

    Furnée, W.J.H.

    2015-01-01

    Shopping as Liberation?: Women and Urban Space in Amsterdam, 1863-1913 In recent decades several historians have argued that the emergence of shopping as a leisure activity in the second half of the nineteenth century substantially enhanced women’s freedom of movement in public spaces and promoted

  5. Prevalence of Chlamydophila psittaci in fecal droppings from feral pigeons in Amsterdam, The Netherlands

    NARCIS (Netherlands)

    Heddema, Edou R.; ter Sluis, Sietske; Buys, Jan A.; Vandenbroucke-Grauls, Christina M. J. E.; van Wijnen, Joop H.; Visser, Caroline E.

    2006-01-01

    In many cities, the feral rock dove is an abundant bird species that can harbor Chlamydophila psittaci. We determined the prevalence and genotype of C. psittaci in fresh fecal samples from feral pigeons in Amsterdam, The Netherlands. The prevalence was 7.9% overall (26/331; 95% confidence interval,

  6. Let's do Diversity : report of the University of Amsterdam Diversity Commission

    NARCIS (Netherlands)

    G. Wekker (Gloria); M.W. Slootman (Marieke W.); R.A. Icaza Garza (Rosalba); H. Jansen (Hans); R. Vázquez (Rolando)

    2016-01-01

    markdownabstractBetween March and September 2016, the Diversity Commission studied diversity at the University of Amsterdam. Recognizing that the challenge to enhance social justice at the University requires active engagement with diversity, the Commission approached the topic along two lines:

  7. The association between ethnicity and vaginal microbiota composition in Amsterdam, the Netherlands

    NARCIS (Netherlands)

    Borgdorff, Hanneke; van der Veer, Charlotte; van Houdt, Robin; Alberts, Catharina J.; de Vries, Henry J.; Bruisten, Sylvia M.; Snijder, Marieke B.; Prins, Maria; Geerlings, Suzanne E.; Schim van der Loeff, Maarten F.; van de Wijgert, Janneke H. H. M.

    2017-01-01

    To evaluate whether ethnicity is independently associated with vaginal microbiota (VMB) composition in women living in Amsterdam, the Netherlands, as has been shown for American women. Women (18-34 years, non-pregnant, N = 610) representing the six largest ethnic groups (Dutch, African Surinamese,

  8. The Micropolitics of Criminalisation: Power, Resistance and the Amsterdam Squatting Movement

    NARCIS (Netherlands)

    Dadusc, D.

    2017-01-01

    This research analyses how the criminalisation of the Amsterdam squatting movement works. The key research question addresses how criminalisation operates as a technology of government, what kind of relations of power are constituted through this processes, and how these are experienced and

  9. Desalination of historical brick masonry. The case of the Waag building in Amsterdam

    NARCIS (Netherlands)

    Lubelli, B.A.; Hees, R.P.J. van

    2013-01-01

    The Waag building in Amsterdam (148g) (Figure 1) is a remnant of the former city walls (14g 1_ 1492); originally it was one of the city gates (St Anthoniespoort), When in the late six_ teenth century the city expanded, the walls were demolished and the building ceased to function as a gate, The

  10. HIV-surveys bij hoog-risicogroepen in Amsterdam 2003-2004

    NARCIS (Netherlands)

    van Veen MG; Wagemans MAJ; Op de Coul ELM; Fennema JSA; van der Helm TCM; Walter J; Prins M; van de Laar MJW; CIE

    2006-01-01

    Hoog-risicogroepen kunnen een brugfunctie vervullen voor de verspreiding van HIV en SOA naar de rest van de bevolking in Nederland. Dit blijkt uit de HIV-survey onder migranten en prostituees en hun klanten die is uitgevoerd in Amsterdam. Hierbij is gevonden dat de HIV-prevalentie onder

  11. Tattooing, permanent makeup and piercing in Amsterdam; guidelines, legislation and monitoring

    NARCIS (Netherlands)

    Worp, J.; Boonstra, A.; Coutinho, R. A.; van den Hoek, J. A. R.

    2006-01-01

    Tattooing, body piercing and permanent makeup are increasing in popularity. Here, we describe the procedures involved in these practices, their risks, the content of guidelines developed by the Municipal Health Service in Amsterdam (the Netherlands) to reduce infection risks, the legislation in the

  12. House Price Risk and Sub-District House Price Dynamics : The Case of Amsterdam

    NARCIS (Netherlands)

    Teye, A.L.; de Haan, J.; Elsinga, M.G.

    2016-01-01

    The recent Global Financial Crisis has lent even greater urgency to the need for households to understand the risks and dynamics of the residential property market better. This paper uses a rich dataset on individual residential property transactions between 1995 and 2014 in Amsterdam to study the

  13. Renewable energy technology feasibility study for a new hotel building in Amsterdam

    NARCIS (Netherlands)

    Bischoff, J.M.A.; Hensen, J.L.M.; Hassan Mohamed, Mohamed; Philips, C.

    2016-01-01

    This article discusses the economic and environmental feasibility of applying renewable energy technology (RET) to a new hotel building in Amsterdam using the simulation software HOMER. The study shows that applying PV including a surface up to 750m² can be both economical and environmentally

  14. The fight against human trafficking in the Amsterdam Red Light District

    NARCIS (Netherlands)

    Spapens, A.C.M.; Rijken, C.R.J.J.

    The Amsterdam Red Light District is famous for its sex-oriented businesses. Although prostitution was legalized in 2000, this did not end some of its criminal side effects, particularly the trafficking in women. In an effort to combat human trafficking in the district, the local authorities launched

  15. Veilig op de fiets in Amsterdam : de campagne 'Veilig op de fiets' : effecten, process en motivatie.

    NARCIS (Netherlands)

    Twisk, D.A.M.

    1994-01-01

    A campaign was organised to increase cycling safety in the Dutch municipality of Amsterdam. The campaign was based on marketing principles, and centred on cyclists' needs in safety and comfort. The emphasis in the 'Safe Cycling' campaign was on infrastructure improvements and police enforcement.

  16. Children's social capital in the segregated context of Amsterdam: an historical-geographical approach

    NARCIS (Netherlands)

    Karsten, L.

    2011-01-01

    This paper addresses children’s social capital across space and over time. Empirical evidence comes from an in-depth study of changes in children’s daily lives in Amsterdam over the past 50 years. Different dimensions of religious and ethnic segregation at school and in the neighbourhood have

  17. Romance Languages and Linguistic Theory 2013: Selected Papers from 'Going Romance' Amsterdam 2013

    NARCIS (Netherlands)

    Aboh, E.O.; Schaeffer, J.C.; Sleeman, P.

    2015-01-01

    The Going Romance conferences are a major European annual discussion forum for theoretically relevant research on Romance languages. This volume assembles a selection of the papers that were presented at the 27th edition of Going Romance, which was organized by the University of Amsterdam in

  18. Shelter-based convalescence for homeless adults in Amsterdam: a descriptive study

    NARCIS (Netherlands)

    van Laere, Igor; de Wit, Matty; Klazinga, Niek

    2009-01-01

    ABSTRACT: BACKGROUND: Adequate support for homeless populations includes shelter and care to recuperate from illness and/or injury. This is a descriptive analysis of diagnoses and use of shelter-based convalescence in a cohort of homeless adults in Amsterdam. METHODS: Demographics of ill homeless

  19. Amsterdam Short-Term Memory test: a new procedure for the detection of feigned memory deficits

    NARCIS (Netherlands)

    Schagen, S.; Schmand, B.; de Sterke, S.; Lindeboom, J.

    1997-01-01

    The validity of two malingering tests, the newly developed Amsterdam Short-Term Memory (ASTM) test and the Distraction test (Baker, Hanley, Jackson, Kimmance, & Slade, 1993) was examined in a group of patients with closed-head injury (CHI), a normal control group, and a control group with

  20. Data-driven Travel Demand Modelling and Agent-based Traffic Simulation in Amsterdam Urban Area

    NARCIS (Netherlands)

    Melnikov, V.R.; Krzhizhanovskaya, V.V.; Lees, M.H.; Boukhanovsky, A.V.

    2016-01-01

    The goal of this project is the development of a large-scale agent-based traffic simulation system for Amsterdam urban area, validated on sensor data and adjusted for decision support in critical situations and for policy making in sustainable city development, emission control and electric car

  1. Salt damage and RH changes: The case of the Waag Building in Amsterdam

    NARCIS (Netherlands)

    Hees, R.P.J. van; Lubelli, B.A.

    2007-01-01

    Changes in the air MM can cause damage to building materials contaminated with hygroscopic saus, even in the absence of any other moishwe source. This phenomenon has been observed in the case of the iflag build ing in Amsterdam, affècted by severe salt decay. The investigation, canied out by means

  2. Interobserver reliability of the Amsterdam Severity Scale in Stenosing Tenosynovitis (ASSiST)

    NARCIS (Netherlands)

    Peter, W.F.; Steultjens, M.P.M.; Mesman, T.; Dekker, J.; Hoeksma, A.F.

    2009-01-01

    STUDY DESIGN: Interobserver reliability study. INTRODUCTION: A scale was developed to measure the severity of stenosing tenosynovitis: the Amsterdam Severity Scale in Stenosing Tenosynovitis (ASSiST). PURPOSE OF THE STUDY: To study the interobserver reliability of the ASSiST. METHODS: Patients

  3. Microscopical examination of the effectiveness of conservation-treatment methods of the National Monument in Amsterdam

    NARCIS (Netherlands)

    Larbi, J.A.; Hees, R.P.J. van

    1999-01-01

    The Dutch National Monument in Amsterdam, a World War-II memorial structure, was built with an outer face consisting of slabs of travertine. In 1995, the masonry structure forming the core of the monument showed severe deterioration. In order to determine the actual cause of deterioration and to

  4. Amsterdam Book Design: Irma Boom, Hansje van Halem, Lesley Moore = Amsterdamskij knižnyj dizajn

    NARCIS (Netherlands)

    Lommen, M.

    2012-01-01

    Published on the occasion of the exhibition 'Amsterdam Book Design : Irma Boom, Hansje van Halem, Lesley Moore', from May 26th until June 17th 2012 in the creative platform Taiga Space, Saint Petersburg. In cooperation with Netherlands Institute Saint-Petersburg.

  5. Occupational exposure to bloodborne viruses in the Amsterdam police force, 2000-2003

    NARCIS (Netherlands)

    Sonder, Gerard J. B.; Bovée, Lian P. M. J.; Coutinho, Roel A.; Baayen, Dorothé; Spaargaren, Joke; van den Hoek, Anneke

    2005-01-01

    Objectives: To assess and evaluate the rate and outcome of occupational exposure to hepatitis B virus (HBV), hepatitis C virus (HCV), and human immunodeficiency virus (HIV) in the Amsterdam police force. Methods: Retrospectively, all accidents with risk for viral transmission reported to the

  6. Patterns of retail location and urban form in Amsterdam in the mid-eighteenth century

    NARCIS (Netherlands)

    Lesger, C.

    2011-01-01

    In this article location theory is used to map and analyse the patterns of retail location in Amsterdam in the eighteenth century. In the city centre as well as along the main axes to markets and the city gates the retailing of shopping goods (textiles, consumer durables) was much more prominent

  7. The Central Institute forBrain Research in Amsterdam and its directors

    NARCIS (Netherlands)

    Eling, Paul; Hofman, Michel A

    2014-01-01

    The Central Institute for Brain Research was founded in Amsterdam in 1908 as part of an international effort to study the nervous system with multiple institutions and various disciplines. The development of research in the past hundred years at the Brain Institute has hardly been documented. We

  8. The importance of agglomeration effects for distribution centres around Amsterdam Airport Schiphol

    NARCIS (Netherlands)

    Warffemius, P.; van der Hoorn, T.; Klaassen, H.

    2010-01-01

    Amsterdam Airport Schiphol is a main European airport and represents an important concentration of European distribution centres (EDCs). It is commonly assumed that distribution centres are attracted to the airport region because of its air transport services. However, if one considers economies of

  9. Moving faces, looking places: validation of the Amsterdam Dynamic Facial Expression Set (ADFES)

    NARCIS (Netherlands)

    van der Schalk, J.; Hawk, S.T.; Fischer, A.H.; Doosje, B.

    2011-01-01

    We report two studies validating a new standardized set of filmed emotion expressions, the Amsterdam Dynamic Facial Expression Set (ADFES). The ADFES is distinct from existing datasets in that it includes a face-forward version and two different head-turning versions (faces turning toward and away

  10. Technical feasibility study for a solar energy system at Amsterdam Airport Schiphol (AAS)

    NARCIS (Netherlands)

    Janssen, P.N.J.W.; Myrzik, J.M.A.; Kling, W.L.; Reinders, L.

    2010-01-01

    This work arises within the framework of the introduction of renewable energies at Amsterdam Airport Schiphol (AAS) and the focus is on the technical feasibility of a solar energy system (SES) on ground level. The flight safety must always be guaranteed if solar panels are implemented on AAS. The

  11. Risks and interrelationships of subdistrict house prices : the case of Amsterdam

    NARCIS (Netherlands)

    Teye, A.L.; de Haan, J.G.; Elsinga, M.G.

    2017-01-01

    This paper uses individual house transaction data from 1995 to 2014 in Amsterdam to explore the risks and interrelationships of the subdistrict house prices. Simple indicators suggest that house prices grow faster and are more risky in the central business district and its immediate surrounding

  12. Reevaluation of the Amsterdam Inventory for Auditory Disability and Handicap Using Item Response Theory

    Science.gov (United States)

    Hospers, J. Mirjam Boeschen; Smits, Niels; Smits, Cas; Stam, Mariska; Terwee, Caroline B.; Kramer, Sophia E.

    2016-01-01

    Purpose: We reevaluated the psychometric properties of the Amsterdam Inventory for Auditory Disability and Handicap (AIADH; Kramer, Kapteyn, Festen, & Tobi, 1995) using item response theory. Item response theory describes item functioning along an ability continuum. Method: Cross-sectional data from 2,352 adults with and without hearing…

  13. Hypertension control in a large multi-ethnic cohort in Amsterdam, The Netherlands: the HELIUS study

    NARCIS (Netherlands)

    Agyemang, Charles; Kieft, Suzanne; Snijder, Marieke B.; Beune, Erik J.; van den Born, Bert-Jan; Brewster, Lizzy M.; Ujcic-Voortman, Joanne J.; Bindraban, Navin; van Montfrans, Gert; Peters, Ron J.; Stronks, Karien

    2015-01-01

    Hypertension is a major problem among European ethnic minority groups. We assessed the current situation of hypertension prevalence and its management among a multi-ethnic population in Amsterdam, The Netherlands. Data from the HELIUS study were used including 12,974 participants (1871 Ghanaian,

  14. Additional value of typing Noroviruses in gastroenteritis outbreaks in Amsterdam, The Netherlands

    NARCIS (Netherlands)

    Koek, A. G.; Bovée, L. P. M. J.; van den Hoek, J. A. R.; Bos, A. J.; Bruisten, S. M.

    2006-01-01

    In Amsterdam, 17 of the 55 gastroenteritis (GI) outbreaks reported from January 2002 to May 2003 were confirmed to be caused by noroviruses (NV). In this study, we describe the molecular epidemiology of a group of nine outbreaks associated with a catering firm and two outbreaks, 5 months apart, in

  15. When the spell is broken: gentrification, urban tourism and privileged discontent in the Amsterdam canal district

    NARCIS (Netherlands)

    Pinkster, F.M.; Boterman, W.R.

    2017-01-01

    Expansion of urban tourism in historic districts in European cities is putting increasing pressure on these areas as places to live. In Amsterdam, an ever-growing number of tourists visit the famous canal district, which also forms the home of a group of long-term, upper-middle-class residents.

  16. Advertising Amsterdam: the rise and growth of an international advertising industry

    NARCIS (Netherlands)

    Röling, R.

    2011-01-01

    Cultural industries have experienced dynamic growth in the Netherlands since the 1990s. Amsterdam is the indisputable cultural and creative capital of the country and one of the city’s most prominent cultural industries is the advertising industry. This study has explored processes of globalisation

  17. The HIV prevalence among pregnant women in the Amsterdam region (1988-1991)

    NARCIS (Netherlands)

    Bindels, P. J.; Mulder-Folkerts, D. K.; Boer, K.; Schutte, M. F.; van der Velde, W. j; Wong, F. J.; van den Hoek, A. J.; van Doornum, G. J.; Coutinho, R. A.

    1994-01-01

    The objective of the study was to monitor the HIV prevalence in the years 1988-1991 among pregnant women in the Amsterdam region, visitors to an abortion clinic and 3 outpatient infertility clinics. All women attending these clinics were asked to participate in the study on a voluntary basis and

  18. Building damage related to Amsterdam subway : Comparison of traditional monitoring with satellite monitoring results

    NARCIS (Netherlands)

    Korff, M.; Maccabiani, J

    2017-01-01

    This paper describes the evaluation of the monitoring data obtained from the construction of the North/South Line, a new subway line crossing the historic center of Amsterdam. During construction of the line (2003-2014), building deformations were monitored with Robotic Total Stations and with

  19. Hodorkovski advokaat : Venemaa ei ole õigusriik / Robert R. Amsterdam ; interv. Aleksei Günter

    Index Scriptorium Estoniae

    Amsterdam, Robert R.

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 24. juuli lk. 10. Naftamagnaadi Mihhail Hodorkovski advokaat vastab küsimustele, mis puudutavad ärimehe olukorda ja elamistingimusi vanglas ning tema võimalust ennetähtaegselt vabaneda. Lisa: Robert R. Amsterdam

  20. Astronomia instaurata? The third edition of Copernicus's De Revolutionibus (Amsterdam, 1617)

    NARCIS (Netherlands)

    van Netten, D.

    2012-01-01

    The article discusses the 1617 third edition of the book "De revolutionibus orbium coelestium" by Nicolaus Copernicus, published under the title "Astronomia instaurata (Restored astronomy)" in Amsterdam, the Netherlands, edited by Nicolaus Mulerius, and produced by Willem Janszoon. It considers why

  1. Als ze maar van me afblijven : Een onderzoek naar antihomoseksueel geweld in Amsterdam

    NARCIS (Netherlands)

    Buijs, Laurens; Duyvendak, Jan Willem; Hekma, Gert

    2008-01-01

    Geweld tegen homo's is een veelvoorkomend en structureel verschijnsel in Nederlands gay capital. Ondanks de liberale reputatie van Amsterdam zijn vooroordelen over mannelijkheid en (homo)seksualiteit wijdverspreid. Dat leidt, voornamelijk bij jonge mannen, tot het plegen van geweld. Als ze maar van

  2. 20 Jahre Vertrag von Amsterdam: Reelle Vision oder reale Desillusion Europäischer Gleichstellungspolitik?

    NARCIS (Netherlands)

    Ahrens, P.; Scheele, A.; Vleuten, J.M. van der

    2016-01-01

    In 1997 the principles of gender mainstreaming and anti-discrimination based on sex, racial or ethnic origin, religion or belief, disability, age or sexual orientation were enshrined in the Treaty of Amsterdam. The introduction to this special issue takes stock of the results twenty years after and

  3. Towards sustainable urban distribution using city canals: the case of amsterdam

    NARCIS (Netherlands)

    van Duin, Ron; Kortmann, L.J.; van de Kamp, Maarten

    2017-01-01

    This study investigates whether a system of hub locations distributing goods across the water to the city of Amsterdam can be a potential future solution to guarantee same-day delivery to shopkeepers. A simulation model was developed to analyse the logistics performances and to optimise the number

  4. Towards sustainable urban distribution using city canals; the case of Amsterdam

    NARCIS (Netherlands)

    Dr. L.J. Kortmann; Dr. L.M. van de Kamp; dr. J.H.R. van Duin

    2017-01-01

    This study investigates whether a system of hub locations distributing goods across the water to the city of Amsterdam can be a potential future solution to guarantee same-day delivery to shopkeepers. A simulation model was developed to analyse the logistics performances and to optimise the number

  5. Estimating the size of the HIV epidemic among injecting drug users in Amsterdam

    NARCIS (Netherlands)

    van Haastrecht, H. J.; Bindels, P. J.; van den Hoek, A. A.; Coutinho, R. A.

    1997-01-01

    Aim of this study was to assess the cumulative incidence of HIV-infection, AIDS and pre-AIDS death in the population of injecting drug users (IDU) in Amsterdam. By assuming equivalence, between a cohort of IDU and the IDU population, of the ratios of incidences of AIDS and pre-AIDS death to the

  6. HIV prevalence, sexual risk behaviour and sexual mixing patterns among migrants in Amsterdam, The Netherlands

    NARCIS (Netherlands)

    Gras, M. J.; Weide, J. F.; Langendam, M. W.; Coutinho, R. A.; van den Hoek, A.

    1999-01-01

    To study (1) HIV prevalence; (2) sexual risk behaviour; (3) sexual mixing patterns; (4) determinants of disassortative (between-group) mixing among migrant groups in Amsterdam, the Netherlands and to gain insight into the potential for heterosexual spread of HIV/sexually transmitted diseases.

  7. Population-based study on the seroprevalence of parvovirus B19 in Amsterdam

    NARCIS (Netherlands)

    van Rijckevorsel, G. G. C.; Sonder, G. J. B.; Schim van der Loeff, M. F.; van den Hoek, J. A. R.

    2009-01-01

    A study was undertaken to estimate the seroprevalence of parvovirus B19 infection in the general adult population of Amsterdam, The Netherlands. To our knowledge this is the first study testing parvovirus B19 in a random sample of the Dutch adult population. The study was a cross-sectional survey,

  8. Greening the EU: National positions in the run‐up to the Amsterdam treaty

    DEFF Research Database (Denmark)

    Andersen, Mikael Skou; Liefferink, Duncan

    1998-01-01

    for an investigation into the 'self-perception' of the 'green' member states and for a detailed assessment of the national positions of the six countries with regard to environmental issues in the preparatory phase of the Amsterdam Treaty. Although the six 'forerunners' are often grouped together, differences among...

  9. The Amsterdam Hypermedia Model: Adding Time and Context to the Dexter Model

    NARCIS (Netherlands)

    L. Hardman (Lynda); D.C.A. Bulterman (Dick); G. van Rossum (Guido)

    1994-01-01

    textabstractFrom Computing Reviews, by Jeanine Meyer The purpose of this paper is to convince the reader of the need for a general model for hypermedia and present the Amsterdam hypermedia model (AHM) as fulfilling that need. Hypertext, which is described by the authors as a 'relatively mature

  10. 'Three centuries of urban and provincial public debt: Amsterdam and Holland'

    NARCIS (Netherlands)

    Fritschy, W.; M.Boone en C.A. Davids,

    2003-01-01

    An analysis of the development of Amsterdam's and Holland's public debt between 1500 and 1800 led to the following conclusion. If public finance is the nerve of any state-system, it is quite adequate to describe the Dutch Republic as a league of seven 'province-republics', much less so, however, to

  11. Local health systems in 21st century: who cares?-An exploratory study on health system governance in Amsterdam.

    Science.gov (United States)

    Plochg, T; Delnoij, D M J; Hogervorst, W V G; van Dijk, P; Belleman, S; Klazinga, N S

    2006-10-01

    There is a growing awareness that there should be a public health perspective to health system governance. Its intrinsic population health orientation provides the ultimate ground for determining the health needs and governing collaborative care arrangements within which these needs can be met. Notwithstanding differences across countries, population health concerns are not central to European health reforms. Governments currently withdraw leaving governance roles to care providers and/or financiers. Thereby, incentives that trigger the uptake of a public health perspective are often ignored. In this study we addressed this issue in the city of Amsterdam. Using a qualitative study design, we explored whether there is a public health perspective to the governance practices of the municipality and the major sickness fund in Amsterdam. And if so, what the scope of this perspective is. And if not, why not. Findings indicate that the municipality has a public health perspective to local health system governance, but its scope is limited. The municipality facilitates rather than governs health care provision in Amsterdam. Furthermore, the sickness fund runs major financial risks when adapting a public health perspective. It covers an insured population that partly overlaps the Amsterdam population. Returns on investments in population health are therefore uncertain, as competitors would also profit from the sickness fund's investments. The local health system in Amsterdam is not consistently aligned to the health needs of the Amsterdam population. The Amsterdam case is not unique and general consequences for local health system governance are discussed.

  12. Erwin van Loo, ‘Eenige wakkere jongens’. Nederlandse oorlogsvliegers in de Britse luchtstrijdkrachten, 1940-1945

    Directory of Open Access Journals (Sweden)

    Marc Dierikx

    2016-11-01

    Full Text Available Erwin van Loo, ‘Eenige wakkere jongens’. Nederlandse oorlogsvliegers in de Britse luchtstrijdkrachten, 1940-1945 (Proefschrift Universiteit van Amsterdam 2013; Amsterdam: Boom, 2013, 515 pp., isbn 978 94 6105 926 0.

  13. Status, near future and distant future of the Amsterdam electron scattering facility

    International Nuclear Information System (INIS)

    Vries, C. de.

    1982-01-01

    The experimental program with the electron Medium Energy Accelerator (MEA), located in Amsterdam, has been started. The general design features of the accelerator and electron scattering facilities are summarised in an Appendix. Some aspects of the Amsterdam instrumentation are discussed which have shown to be of importance from the point of view of flexibility, reproducibility, ease of tuning for high resolution and other time-saving elements. As such they are believed to be of importance for the design of future - especially third generation - facilities. Some of the on-going and near future experiments are presented, emphasizing those which have become within experimental reach due to the advanced level of instrumentation. Finally preliminary ideas are presented on how to increase the accelerator duty factor in the distant future by adding a pulse stretcher device, while maintaining all of the present buildings and 500 MeV equipment. (Auth.)

  14. [The zoological garden of Amsterdam Natura Artis Magistra during world War II].

    Science.gov (United States)

    Frankenhuis, Maarten Th

    2009-01-01

    Thanks to the wise management of its director, dr. Armand Sunier, and his team, 'Artis' survived the difficult war period without great losses of its animals and only material damage to some buildings. Artis has meant very much for the inhabitants of the city of Amsterdam during the war. In the first place for the employees and their families, that were kept for starvation and forced labour by extra rations of food and safe hiding places. But also for jewish persons in hiding, who could escape from a certain death by hiding in animal houses or other buildings in the garden. And also for hundreds of thousands people of Amsterdam who found in their zoological garden an oasis of relaxation in a town full of threat and violence.

  15. Measuring drifted dust near coal transhipment in the harbour of Amsterdam, Netherlands; Meten aan verwaaiend stof bij kolenoverslag in het Amsterdams havengebied

    Energy Technology Data Exchange (ETDEWEB)

    Weijers, E.P.; Rodink, R.; Hensen, A. [ECN Environment and Energy Engineering, Petten (Netherlands)

    2013-02-15

    For two months, particulate matter measurements were performed at the Rietlanden coal terminal in the Africa harbour in Amsterdam. At eight places around the coal terminal particulate matter concentrations were measured with relatively simple (and relatively inexpensive) optical sensors (which have been further developed by ECN). The primary purpose of the measurement campaign was to determine the performance and robustness of the sensors 'in the field'. After the satisfactory performance, the feasibility of a monitoring c.q. alarm system were studied and an estimate was made of particulate matter emissions from the terminal with a dispersion model during the measurement period [Dutch] Gedurende twee maanden zijn bij de Rietlanden kolenterminal in de Afrikahaven te Amsterdam fijnstofmetingen uitgevoerd. Op een achttal plaatsen rondom het bedrijf zijn fijnstofconcentraties gemeten met relatief eenvoudige (en relatief goedkope) optische sensoren (die door ECN verder zijn ontwikkeld). In de eerste plaats had de meetcampagne ten doel de prestatie en robuustheid van de sensoren 'in het veld' vast te stellen. Na gebleken geschiktheid is de haalbaarheid van een monitoring- c.q. alarmeringssysteem bestudeerd en is de fijnstofemissie afkomstig van de terminal geschat voor de periode van de metingen met een verspreidingsmodel.

  16. Human (InConsistencies in Ian McEwan’s Amsterdam

    Directory of Open Access Journals (Sweden)

    Anghel Florentina

    2016-12-01

    Full Text Available Ian McEwan’s Amsterdam has supplied its readers with psychological, moral and social topical issues presented in an easy flowing and exhilarating style. Starting from the assumption that life consists of a series of inconsistencies which are inherent and bring their contribution to the individual’s formation, the paper aims at demonstrating that the protagonists’ judgmental and moral inconsistencies, which are used as a plot generator and are environmentally determined, reveal features of their personality.

  17. Sur deux Cynoglossus de la collection ichthyologique du Zoölogisch Museum, Amsterdam

    NARCIS (Netherlands)

    Chabanaud, Paul

    1951-01-01

    Sous le nom de Cynoglossus xiphoideus Günther, la collection ichthyologique du Zoölogisch Museum, Amsterdam possède 2 spécimens dont l’un est originaire de Shanghaï et l’autre, de la mer de Timor. Le spécimen de Shanghaï a été cédé au Zoölogisch Museum (sans doute à titre d’échange) par le British

  18. Productivity and quality improvements. A report on cost management in gas distribution at the energy distribution company Amsterdam (Energie Noord West Amsterdam NV)

    International Nuclear Information System (INIS)

    Bosch, T.

    1997-01-01

    In a more competitive times traditional and technical industries like gas distribution have to change. They have to commercialize. A way to support this transition is to introduce an activity based cost control system (ABC) with proper delegation of financial responsibilities. This report is about the history of cost management in Amsterdam and the introduction of ABC in our distribution company. The message to other gas distributors is that introducing some form of ABC can be worth wile in the future and is probably inescapable because of growing competition. In the end gas distribution will probably turn out to be one of the few places where money can be earned in the entire gas trade. Not by increasing distribution prices, but by decreasing distribution costs and strategic investments. (au)

  19. Annotated translation of "Nota in verband met de voorgenomen putboring nabij Amsterdam [Note concerning the intended well drilling near Amsterdam]" by J. Drabbe and W. Badon Ghijben (1889)

    Science.gov (United States)

    Post, Vincent E. A.

    2018-06-01

    The famous report by engineers Drabbe and Badon Ghijben (1889), on an intended well drilling near Amsterdam (the Netherlands), was one of the key documents that contributed to the Ghijben-Herzberg formula, which links water-table elevation to the depth of the freshwater-saltwater interface in coastal aquifers. The report has been often cited but no English translation has appeared in the literature to date. The aim of this annotated translation of the report is to provide the international scientific community with easier access than was hitherto the case, plus electronic access to the original in Dutch. A brief introduction to the report is provided, followed by a translation that follows the original text as closely as possible.

  20. [Veterinary issues in the proceedings of the Amsterdam Agricultural Society, 1776-1832].

    Science.gov (United States)

    Mathijsen, A H H M

    2006-01-01

    The Amsterdam Agricultural Society, founded in 1776, was created by six wealthy gentlemen, well known for the important positions in society held by them. They invested the money earned through trade among others in the acquisition of land, partially newly reclaimed in the surroundings of Amsterdam. As a consequence of the expansion of the population the profitability of agriculture had increased. The merchants and regents knew how to combine business with pleasure. In the second half of the 17th and the first half of the 18th century, they have built about 500 country estates in the surroundings of Amsterdam. Besides the pleasures of country-life, the owners gained a practical interest in agriculture and animal husbandry. Missing practical knowledge in these fields themselves, they felt the moral obligation to contribute to the general welfare of the society by the promotion of new ideas or experiences gained by others. In the first volume of the Proceedings is stated: 'It is beyond question that chemistry, botany, meteorology and the Ars veterinaria are to be considered as the true fundaments of agricultural knowledge'. Inspired by the ideas of the Enlightenment and, quite in conformity with the spirit of the time, the establishment of a society was thought to be the answer in order to bring agricultural and thus economical reform. The method used was copied from the learned societies. The members proposed subjects for prize competitions and judged the answers sent in. The crowned answers were the main, but not the only, contents of the Society's Proceedings. The paper analyses the membership (the number of ordinary members decreased from 70 at the start to 56; that of honorary members was stable at about 20; further there were a few orrespondents), and quantifies the distribution of articles in the Proceedings, devoted respectively to agricultural, veterinary and zootechnical subjects. In addition, a detailed list with commentary, of the veterinary and

  1. Smart Grids for Aquifer Thermal Energy Storage (ATES): a case study for the Amsterdam Zuidas district

    Science.gov (United States)

    Jaxa-Rozen, Marc; Bloemendal, Martin; Rostampour, Vahab

    2017-04-01

    In the context of increasingly strict requirements for building energy efficiency, Aquifer Thermal Energy Storage (ATES) systems have emerged as an effective means to reduce energy demand for space heating and cooling in larger buildings. In the Netherlands, over 2000 systems are currently active, which has already raised issues with spatial planning in some areas; current planning schemes may lack the flexibility to properly address variations in ATES operation, which are driven by uncertainties across a broad range of time scales - from daily changes in building energy demand, to decadal trends for climate or groundwater conditions. This work is therefore part of a broader research effort on ATES Smart Grids (ATES-SG), which has focused on more adaptive methods for ATES management and control. In particular, improved control schemes which allow for coordination between neighboring ATES systems may offer more robust performance under uncertainty (Rostampour & Keviczky, 2016). The case studies for the ATES-SG project have so far focused on idealized cases, and on a historical simulation of ATES development in the city center of Utrecht. This poster will present an additional case study for the city center of Amsterdam, which poses several geohydrological challenges for ATES: for instance, variable density flow due to salinity gradients in the local aquifer, and varying depths for ATES systems due to the thickness of the aquifer. To study the effect of these conditions, this case uses an existing 15-layer geohydrological model of the Amsterdam region, cropped to an area of 4500m x 2500m around the Amsterdam Zuidas district. This rapidly developing business district is one of the densest areas of ATES use in Amsterdam, with 32 well doublets and 53 monowells currently registered. The geohydrological model is integrated with GIS data to accurately represent ATES spatial planning; simulated well flows are provided by a model predictive control component. This model is

  2. Risks and interrelationships of subdistrict house prices: the case of Amsterdam.

    Science.gov (United States)

    Teye, Alfred Larm; de Haan, Jan; Elsinga, Marja G

    2018-01-01

    This paper uses individual house transaction data from 1995 to 2014 in Amsterdam to explore the risks and interrelationships of the subdistrict house prices. Simple indicators suggest that house prices grow faster and are more risky in the central business district and its immediate surrounding areas than in the peripherals. Furthermore, we observe an over time decreasing intervariations between the subdistrict house price growth rates, whereas we find a lead-lag and house price causal flow from the more central to the peripheral subdistricts.

  3. Educated Guess van gevolgen voor verkeersslachtoffers door maatregel Snorfiets op de rijbaan (SOR) in Amsterdam : een eerste inschatting van effecten gerelateerd aan verkeersveiligheid.

    NARCIS (Netherlands)

    Wijlhuizen, G.J. Dijkstra, A. Bos, N.M. Goldenbeld, C. & Stipdonk, H.L.

    2013-01-01

    Educated Guess about the consequences for casualties as a result of introduction of the measure Light moped in the carriageway (SOR) in Amsterdam : a first estimate of the effects related to road safety. The Board of Mayor and Eldermen of the City of Amsterdam considers moving light mopeds in 50km/h

  4. Retrofit and commissioning of a 600 MW combined-cycle power plant in Amsterdam

    Energy Technology Data Exchange (ETDEWEB)

    Dijkman, B. (NV UNA, Amsterdam (Netherlands)); Keppel, W. (ABB Mannheim (Germany, F.R.))

    1991-01-01

    In 1982, NV UNA (formerly Energiebedrijf Amsterdam) had already begun to consider measures, from an economic point of view, which could be taken for the optimum technical conversion of the existing conventional 511 MW unit (oil and natural gas firing) at the Hemweg Power Plant in Amsterdam. At that point in time, there was no reason to erect new conventional units because of economic stagnation in the European economy and existing over-capacity in the energy sector. The very high fuel prices resulted in requirements for high thermal efficiency, meaning better use of fuel. For these reasons, work was carried out on modern, technically and economically attractive alternatives for the conversion of existing plants. The extension of the steam power plant by adding an upstream gas turbine equipped with a low-polluting combustion system made it possible to improve the efficiency of the operation and to reduce the emissions at the same time. It was ensured that natural gas would be available continously as the fuel for the gas turbine. 13 figs., 4 refs.

  5. Metallurgy Department

    DEFF Research Database (Denmark)

    Risø National Laboratory, Roskilde

    The activities of the Metallurgy Department at Risø during 1981 are described. The work is presented in three chapters: General Materials Research, Technology and Materials Development, Fuel Elements. Furthermore, a survey is given of the department's participation in international collaboration...

  6. Winkelen als bevrijding? Vrouwen en stedelijke ruimte in Amsterdam, 1863-1913

    Directory of Open Access Journals (Sweden)

    Jan Hein Furnée

    2015-06-01

    Full Text Available Shopping as Liberation?: Women and Urban Space in Amsterdam, 1863-1913In recent decades several historians have argued that the emergence of shopping as a leisure activity in the second half of the nineteenth century substantially enhanced women’s freedom of movement in public spaces and promoted female emancipation in general. Based on urban descriptions and digitised newspaper articles on nineteenth-century Amsterdam – on its main shopping street, the Kalverstraat, in particular – this article takes a more nuanced stance. Shopping as a leisure activity was older in origin than is often assumed and to some extent was a male activity as well. While shopping, ladies encountered numerous factors thathampered their spatial mobility, from road debris, pawing, mugging, the presence of prostitutes to ‘moral harassment’ over exploited shop girls. Indeed, a single feminist framed the right to shop and to visit restaurants in an explicit discourse of ‘liberation’. However, to argue that shopping promoted female emancipation in general would suggest a too linear and monolithic approach. In de afgelopen decennia hebben diverse historici betoogd dat de opkomst van het winkelen als vrijetijdsbesteding in de tweede helft van de negentiende eeuw de uithuizige bewegingsvrijheid van vrouwen uit de gegoede standen aanzienlijk heeft vergroot en hun emancipatie zo belangrijk heeft bevorderd. Op basis van stadsbeschrijvingen en gedigitaliseerde krantenartikelen over winkelen in Amsterdam – in de Kalverstraat in het bijzonder – neemt dit artikel enig gas terug. Het winkelen als vrijetijdsbesteding had een oudere oorsprong dan vaakis verondersteld en was tot op zekere hoogte ook een mannenzaak. Winkelende dames werden op verschillende manieren in hun ruimtelijke bewegingsvrijheid belemmerd: door straatvuil, handtastelijkheden, straatroof, de aanwezigheid van prostituees of ‘morele kwellingen’ over uitgebuite winkelmeisjes. Zeker, een enkele

  7. Restoration of the former site of the institute for nuclear physics research in Amsterdam

    International Nuclear Information System (INIS)

    Louwrier, Pieter W.F.; Bakker, C.N.M.; Peperkamp, J.A.M.

    2000-01-01

    In 1946 the Institute for Nuclear Physics Research (IKO) started operations on the site of an old gas factory made available by the City of Amsterdam. In 1997 IKO became part of the National Institute for Nuclear Physics and High-Energy Physics (NIKHEF). In 1996 NIKHEF left the laboratory site after 50 years of occupation. The City of Amsterdam, being the owner of the area, decided that in view of the plants for development of the area, the buildings should be demolished and the area made suitable for public use. The site was used as a nuclear research laboratory since 1946, housing a synchrocyclotron from 1947 to 1977 and a linear electron accelerator from 1968 to 1977. Several nuclear chemistry laboratories were in operation from 1946 to 1984. During the 50-year period the original buildings were modified and enlarged, and new buildings were added. Before the responsibility for the area could be transferred to the City and the operating licence could be adjusted to the new situation the Dutch authorities required that a site restoration project be executed. The site restoration project was planned in stages, each of which was supervised and evaluated by the Dutch Ministry of Housing, Spatial Planning and the Environment, and the Ministry of Social Affairs and Employment. Special interest groups such as Greenpeace, LAKA Foundation (a non-profit organisation acting as a consultant for the neighbouring population), the City of Amsterdam and the local City-Boards were following the process closely. The project encompassed the following stages: Set-up of a plan for the clearance of the building structures, including the criteria for release, in consultation with the ministries involved. Radiation protection was an integral part of the plan. Investigation of possible radioactive contamination of the evacuated buildings. Six undocumented contaminations and one documented contamination were identified. Supervised removal of contaminated building structures by a

  8. Development of a Healthy Urban Route Planner for cyclists and pedestrians in Amsterdam

    Science.gov (United States)

    van der Molen, Michiel; Ligtenberg, Arend; Vreugdenhil, Corne; Steeneveld, Gert-Jan

    2017-04-01

    Cities are hotspots of air pollution and heat stress, the exposure to which results in nuisance, health risks, cost of medication, reduced labour productivity and sick leave for citizens. Yet the air pollution and heat stress are spatially and temporally unevenly distributed over the city, depending on pollutant emissions, street design and atmospheric turbulent mixing and radiation. This spatiotemporal variation allows pedestrians and bikers to choose alternative routes to minimize their exposure, if the distribution is known. In this project, we develop a route planner for bicyclists and pedestrians for Amsterdam (NL), that proposes routes and departure times based on model simulations of weather and air quality. We use the WRF-Chem atmosphere and air quality model at unprecedented grid spacing of 100-m (Ronda et al, 2015, Super et al, 2016), with an underlying urban canopy model and NOx and PM10 emissions. The emissions by traffic are calculated based on observed traffic intensities and emission factors. An urban land use map will characterize urban density and street configuration to estimate urban heat storage (Attema et al, 2015). WRF-Chem runs will be issued daily for a lead time of 48 hours, resulting in forecast maps of temperature and pollutant concentrations that will be uniquely expressed in a metric that combines both threats. The hourly fields of this metric are provided to the route planner based on the open source routing library pgRouting to identify the more healthy routes on the route network of Amsterdam. The objectives of the healthy urban route planner are to raise awareness of heat and air quality issues in Amsterdam, to provide an innovative adaptation tool for citizens and tourists, to locate the most important bottlenecks in (the exposure to) air pollution and heat stress, and ultimately to test the readiness of the travellers to use the information and adapt the route. We expect to particularly target a group of lung- and cardiovascular

  9. Between Care and Order: Street-Level Workers’ Discretion and Drug Policies in Amsterdam (the Netherlands) and Porto Alegre (Brazil)

    NARCIS (Netherlands)

    R. Quadros Rigoni (Rafaela)

    2015-01-01

    markdownabstract__Abstract__ This comparative study analyses the implementation of policies on so-called ‘problem drugs’ (crack cocaine and heroin) for the cities of Amsterdam (in the Netherlands) and Porto Alegre (in Brazil). Using a variant on the street level bureaucracy approach, the study

  10. Hydrogeochemical transport modeling of 24 years of Rhine water infiltration in the dunes of the Amsterdam Water Supply.

    NARCIS (Netherlands)

    van Breukelen, B.M.; Appelo, C.A.J.; Olsthoorn, T.N.

    1998-01-01

    Water quality changes were modelled along a flowpath in a plume of artificially recharged, pretreated Rhine water in the dunes of the Amsterdam Water Supply, after 24 years of infiltration. The hydrogeochemical transport model PHREEQC was extended with dispersion/diffusion and kinetics for selected

  11. Jet grout strut for deep station boxes of the north/south metro line Amsterdam : Design and back analysis

    NARCIS (Netherlands)

    Delfgaauw, S.; Buykx, S.M.; Bosch, J.W.

    2009-01-01

    The new North/South metro line in Amsterdam contains several stations, some of which with an excavation depth of 30 m below surface. The design of these station boxes is very much determined by the adjacent historic buildings, high water table and the relatively soft soil. A lot of effort is put

  12. Pharmaco-economic evaluation of targeted hepatitis A vaccination for children of ethnic minorities in Amsterdam (The Netherlands)

    NARCIS (Netherlands)

    Postma, M.J.; Beutels, Ph; Schilthuis, H.; Bos, J.M.; van den Hoek, J.A.R.

    2004-01-01

    Objective: Estimate cost-effectiveness of vaccination against hepatitis A virus (HAV) for children of ethnic minorities in Amsterdam. Background: Pharmaco-economic analysis is relevant for motivating reimbursement of vaccination costs in the framework of a programmatic approach to vaccination of

  13. Understanding urban practitioners' perspectives on social-mix policies in Amsterdam: the importance of design and social space

    NARCIS (Netherlands)

    Lawton, P.

    2013-01-01

    Throughout recent decades, socially-mixed neighbourhoods have become a key element of urban policy and debate. This paper argues, with Amsterdam as an empirical case, that the design, layout and everyday use of social space—including public and private space—is of key importance in understanding the

  14. Intelligent Virtual Agents : 9th International Conference, IVA 2009 Amsterdam, The Netherlands, September 14-16, 2009 Proceedings

    NARCIS (Netherlands)

    Ruttkay, Z.M.; Kipp, M.; Nijholt, Antinus; Vilhjalmsson, H.H.

    2009-01-01

    Welcome to the Proceedings of the 9th International Conference on Intelligent Virtual Agents, held 14-16 September, 2009 in Amsterdam, The Netherlands. Intelligent Virtual Agents (IVAs) are interactive characters that exhibit humanlike qualities and communicate with humans or with each other using

  15. 97 Medical Apparatuses tested at the Academic Medical Center (AMC) Amsterdam for interference by WLAN/WiFi signals

    NARCIS (Netherlands)

    Hensbroek, R.

    2009-01-01

    This research describes the influence of WLAN 1 signals on medical apparatuses in the Academic Medical Center (AMC) Amsterdam. The results in this report were obtained by testing medical equipment with WLAN signals. A comparable research was reported earlier. See TNO report KvL/P&Z 2007.117 dated

  16. Risk indicators and potential risk factors for caries in 5-year-olds of different ethnic groups in Amsterdam.

    NARCIS (Netherlands)

    Verrips, G.H.; Frencken, J.E.; Kalsbeek, H.; Horst, G. ter; Filedt Kok-Weimar, T.L.

    1992-01-01

    The aim of this study was threefold: first, to assess the oral health of Turkish, Moroccan, Surinamese, Dutch and "other" 5-yr-old children living in Amsterdam; second, to identify risk indicators for caries, in addition to ethnicity; and third, to identify potential risk factors related to

  17. Culture, product differentiation and market segmentation: a structural analysis of the motivation and satisfaction of tourists in Amsterdam

    NARCIS (Netherlands)

    Romao, J.; Neuts, B.; Nijkamp, P.; van Leeuwen, E.S.

    2015-01-01

    The varied supply of tourism services - with particular emphasis on tangible and intangible cultural aspects - corresponds ideally to visitors' characteristics and wishes. This paper considers a major tourist destination, such as Amsterdam, as an export-oriented multi-product company, characterized

  18. Preventing evictions as a potential public health intervention: Characteristics and social medical risk factors of households at risk in Amsterdam

    NARCIS (Netherlands)

    van Laere, Igor; de Wit, Matty; Klazinga, Niek S.

    2009-01-01

    Aims: The public health problems precipitating evictions are understudied and no systemic data have been collected. We aim to identify the magnitude of evictions and the characteristics and social medical risk factors of households at risk in Amsterdam. This will help inform policies designed to

  19. Motives for and against injecting drug use among young adults in Amsterdam: qualitative findings and considerations for disease prevention

    NARCIS (Netherlands)

    Witteveen, Ewald; van Ameijden, Erik J. C.; Schippers, Gerard M.

    2006-01-01

    To elucidate injection initiation and risky injection practices among young drug users (YDUs) in Amsterdam, this study identifies self-reported motives for injecting and not injecting to inform interventions to be targeted at issues personally relevant for this population. A qualitative study was

  20. Translational HIV-1 research: from routine diagnostics to new virology insights in Amsterdam, the Netherlands during 1983-2013

    NARCIS (Netherlands)

    van der Kuyl, Antoinette C.; Bakker, Margreet; Jurriaans, Suzanne; Back, Nicole K. T.; Pasternak, Alexander O.; Cornelissen, Marion; Berkhout, Ben

    2013-01-01

    An HIV-1 diagnostic laboratory was established in the Academic Medical Center (AMC) of the University of Amsterdam after the discovery of human immunodeficiency virus (HIV) as the cause of the acquired immunodeficiency syndrome (AIDS). The first AIDS patients were diagnosed here in 1981 and since

  1. The relation between calcium intake and body composition in a Dutch population: the Amsterdam Growth and Health Longitudinal Study

    NARCIS (Netherlands)

    Boon, N.; Koppes, L.L.J.; Saris, W.H.; van Mechelen, W.

    2005-01-01

    To investigate whether dietary calcium intake is related to body mass index and the sum of four skinfolds among subjects in the Amsterdam Growth and Health Longitudinal Study (the Netherlands), the authors followed a cohort of men and women from age 13 years in 1977 to age 36 years in 2000.

  2. Incorporating insights from Time Series Analysis in groundwater modelling for the urban area of the city of Amsterdam

    NARCIS (Netherlands)

    Graafstra, P.; Smits, F.J.C.; Janse, T.

    2017-01-01

    As the public water authority of the city of Amsterdam and surrounding areas, Waternet makes use of both steady-state and transient groundwater models for a variety of purposes involving urban groundwater management. For instance when determining the effect of planned measures on the occurrence of

  3. Increase in HCV incidence among men who have sex with men in Amsterdam most likely caused by sexual transmission

    NARCIS (Netherlands)

    van de Laar, T.J.W.; van der Bij, A.K.; Prins, M.; Bruisten, S.M.; Brinkman, K.; Ruys, T.A.; van der Meer, J.T.M.; de Vries, H.J.C.; Mulder, J.W.; van Agtmael, M.; Jurriaans, S.; Wolthers, K.C.; Coutinho, R.A.

    2007-01-01

    We retrospectively screened 1836 men who have sex with men (MSM) participating in the Amsterdam Cohort Studies (1984-2003) for hepatitis C virus (HCV) antibodies. HCV incidence was 0.18/100 person-years (PY) in human immunodeficiency virus (HIV)-positive MSM (8/4408 PY [95% confidence interval {CI},

  4. Dealing with diversity: middle-class family households and the issue of 'black' and 'white' schools in Amsterdam

    NARCIS (Netherlands)

    Boterman, W.R.

    2013-01-01

    The urban middle classes often celebrate the diversity of their neighbourhood. As soon as they have children, however, the desire to display symbolic capital may conflict with the need to reproduce cultural capital through the educational system. In the ethnically diverse Amsterdam schooling

  5. Estimating the number of opiate users in amsterdam by capture-recapture: the importance of case definition

    NARCIS (Netherlands)

    Buster, M. C.; van Brussel, G. H.; van den Brink, W.

    2001-01-01

    One of the objectives of Amsterdam's methadone maintenance treatment is maximising its coverage among problematic opiate users. In order to evaluate what proportion is reached, the capture-recapture method is conducted to estimate the prevalence of problematic opiate use. Samples of opiate users in

  6. Affective foodscapes in an economy of passion : repetition, opposition and adaptation in Mexican restaurants in Amsterdam, Madrid and San Francisco

    NARCIS (Netherlands)

    Matus Ruiz, M.

    2012-01-01

    The
 main
 goal
 of
 my
 research
 was
 to
 analyze
 how
 the
 desire
 to
 affect
 and
 be
 affected
 by
 foreign
 signs
relates
 to
 the
 commoditization
 of
 food
 products
 offered
 in
 Mexican
 restaurants
 in
 Amsterdam,
 Madrid
and
 San
 Francisco.
 I
 conceive
 restaurants
 as


  7. Reliability and validity of a self-administered tool for online neuropsychological testing : The Amsterdam Cognition Scan

    NARCIS (Netherlands)

    Feenstra, H.E.M.; Murre, J.M.J.; Vermeulen, I. E.; Kieffer, J.M.; Schagen, S.B.

    2018-01-01

    Introduction : To facilitate large-scale assessment of a variety of cognitive abilities in clinical studies, we developed a self-administered online neuropsychological test battery: the Amsterdam Cognition Scan (ACS). The current studies evaluate in a group of adult cancer patients: test–retest

  8. Reliability and validity of a self-administered tool for online neuropsychological testing : The Amsterdam Cognition Scan

    NARCIS (Netherlands)

    Feenstra, Heleen E.M.; Murre, Jaap M.J.; Vermeulen, Ivar E.; Kieffer, Jacobien M.; Schagen, Sanne B.

    2018-01-01

    Introduction: To facilitate large-scale assessment of a variety of cognitive abilities in clinical studies, we developed a self-administered online neuropsychological test battery: the Amsterdam Cognition Scan (ACS). The current studies evaluate in a group of adult cancer patients: test–retest

  9. Hepatitis B vaccination and changes in sexual risk behaviour among men who have sex with men in Amsterdam

    NARCIS (Netherlands)

    Xridou, M.; Wallinga, J.; Dukers-Muijers, N.; Coutinho, R.

    The impact of hepatitis B vaccination in men having sex with men in Amsterdam has been marginal until now, possibly because of increases in sexual risk behaviour counterbalancing the effect of vaccination. A mathematical model is used to describe the hepatitis B epidemic. The model shows that, with

  10. Hepatitis B vaccination and changes in sexual risk behaviour among men who have sex with men in Amsterdam

    NARCIS (Netherlands)

    Xridou, M.; Wallinga, J.; Dukers-Muijers, N.; Coutinho, R.

    2009-01-01

    The impact of hepatitis B vaccination in men having sex with men in Amsterdam has been marginal until now, possibly because of increases in sexual risk behaviour counterbalancing the effect of vaccination. A mathematical model is used to describe the hepatitis B epidemic. The model shows that, with

  11. Multivariate analysis of the risk of stomach cancer after ulcer surgery in an Amsterdam cohort of postgastrectomy patients

    NARCIS (Netherlands)

    Tersmette, A. C.; Goodman, S. N.; Offerhaus, G. J.; Tersmette, K. W.; Giardiello, F. M.; Vandenbroucke, J. P.; Tytgat, G. N.

    1991-01-01

    Although gastric cancer incidence is decreasing in the western world, it remains an important cause of death, and there has been debate about screening persons who have undergone gastrectomy for benign ulcers. The authors analyzed risk factors for stomach cancer mortality in an Amsterdam cohort of

  12. Psychological distress of rescue workers eight and one-half years after professional involvement in the Amsterdam air disaster

    NARCIS (Netherlands)

    Witteveen, Anke B.; Bramsen, Inge; Twisk, Jos W. R.; Huizink, Anja C.; Slottje, Pauline; Smid, Tjabe; van der Ploeg, Henk M.

    2007-01-01

    This study examined specific and general psychological distress 8.5 years following the 1992 cargo aircraft crash in Amsterdam. Participants included 334 occupationally exposed fire fighters and 834 occupationally exposed police officers compared with reference groups of 194 fire fighters and 634

  13. HIV and hepatitis C treatment uptake among people who use drugs participating in the Amsterdam Cohort Studies, 1985-2015

    NARCIS (Netherlands)

    van Santen, Daniëla K.; van der Helm, Jannie J.; Lindenburg, Karen; Schim van der Loeff, Maarten; Prins, Maria

    2017-01-01

    Background: HIV-positive people who use drugs (PWUD) start antiretroviral therapy (ART) later than other risk groups, and among HCV-positive PWUD, HCV treatment uptake is low. Nowadays, HCV direct acting antivirals (DAAs) are available and reimbursed in the Netherlands (since 2014). The Amsterdam

  14. Reading the Qur,ān in the 17th-Century Sephardi Community of Amsterdam

    Directory of Open Access Journals (Sweden)

    den Boer, Harm

    2014-12-01

    Full Text Available This article presents an unknown Spanish translation of the Qur’ān, extant at the Ets Haim/Livraria Montezinos Library of the Portuguese Jewish Community of Amsterdam. The manuscript dates from the seventeenth century and was the work of a Spanish or Portuguese Jew living in Amsterdam or another community of the Sephardi diaspora. In the present contribution, a detailed material description of the manuscript and its contents, as well as of its Italian and Spanish sources, is offered. While the translator claimed that the work was translated “word for word from Arabic,” he actually used the Italian version of the Qur’ān by Giovanni Battista Castrodardo, published by Andrea Arrivabene in Venice in 1547. The short appendix on the life of Muḥammad, on the other hand was based on a Spanish polemical work addressed to the minority of the moriscos: the Confutación del Al corán y secta mahometana by Lope de Obregón, published in Granada in 1555. This translation represents a unique case-study of the re-contextualization of the Qur’ān in early modern Europe and of the History of Reading across European and Mediterranean confessions.Este trabajo presenta una traducción del Corán al castellano, desconocida hasta ahora, conservada en la Ets Haim/Biblioteca Montezinos de la comunidad judío-portuguesa de Amsterdam. El manuscrito data del siglo XVII y fue la obra de un judío español o portugués que vivía en Amsterdam o en otra comunidad de la diaspora Sefardí. En este estudio se ofrece una descripción material detallada del manuscrito y de su contenido, así como un análisis de sus fuentes italianas y españolas. Aunque el traductor dice haber traducido la obra «palabra por palabra del árabe», en realidad, parece haber utilizado la versión italiana del Corán realizada por Giovanni Battista Castrodardo y publicada por Andrea Arrivabene en Venecia (1547. Un corto apéndice sobre la vida de Mahoma, por otro lado, se basa en una

  15. Toxic fear: the management of uncertainty in the wake of the Amsterdam air crash.

    Science.gov (United States)

    Boin, A; van Duin, M; Heyse, L

    2001-12-14

    This paper examines the management of uncertainty among emergency responders, the media, and the public following the crash of an Israeli cargo plane carrying apparently hazardous cargo in Amsterdam's Bijlmermeer area. While the authorities' management of the emergency created by the initial crash was effective, the long-term crisis management performance was considerably less effective. It is argued that, particularly in hazardous materials emergencies, considerable management attention is required in the long-term aftermath rather than seeking a quick declaration of "all clear" or determination that the crisis is over. This paper examines the roles of all actors in the crisis and addresses the nature of communications in the "disaster after the disaster". The evolution of a "toxic fear" among citizens is documented and the social psychology of crisis management in the aftermath is examined.

  16. When the spell is broken: gentrification, urban tourism and privileged discontent in the Amsterdam canal district

    Science.gov (United States)

    Pinkster, Fenne M; Boterman, Willem R

    2017-01-01

    Expansion of urban tourism in historic districts in European cities is putting increasing pressure on these areas as places to live. In Amsterdam, an ever-growing number of tourists visit the famous canal district, which also forms the home of a group of long-term, upper-middle-class residents. While such residents are generally depicted as instigators of urban transformation, in this case, they are on the receiving end. Bringing together the literature on the socio-spatial impact of tourism, belonging and the lived experience of place, this article explores the changing relationship between these established residents and their neighbourhood and provides insight into their growing sense of discontent and even powerlessness in the face of neighbourhood change. PMID:29278248

  17. When the spell is broken: gentrification, urban tourism and privileged discontent in the Amsterdam canal district.

    Science.gov (United States)

    Pinkster, Fenne M; Boterman, Willem R

    2017-07-01

    Expansion of urban tourism in historic districts in European cities is putting increasing pressure on these areas as places to live. In Amsterdam, an ever-growing number of tourists visit the famous canal district, which also forms the home of a group of long-term, upper-middle-class residents. While such residents are generally depicted as instigators of urban transformation, in this case, they are on the receiving end. Bringing together the literature on the socio-spatial impact of tourism, belonging and the lived experience of place, this article explores the changing relationship between these established residents and their neighbourhood and provides insight into their growing sense of discontent and even powerlessness in the face of neighbourhood change.

  18. The Central Institute for Brain Research in Amsterdam and its directors.

    Science.gov (United States)

    Eling, Paul; Hofman, Michel A

    2014-01-01

    The Central Institute for Brain Research was founded in Amsterdam in 1908 as part of an international effort to study the nervous system with multiple institutions and various disciplines. The development of research in the past hundred years at the Brain Institute has hardly been documented. We analyze the history of this institute by means of brief portraits of its directors and their main research topics. It appears that each director introduced his own branch of neuroscience into the institute. Initially, mainly comparative neuroanatomical data were collected. Following the Second World War, the multidisciplinary approach slowly developed with research programs on systems neuroscience, neuroendocrinology, and brain disorders. Every new director introduced new approaches to the study of the brain and thus played an important role in keeping brain research in the Netherlands at the international forefront where it has been ever since its foundation in 1908.

  19. Shelter-based convalescence for homeless adults in Amsterdam: a descriptive study

    Directory of Open Access Journals (Sweden)

    Klazinga Niek

    2009-11-01

    Full Text Available Abstract Background Adequate support for homeless populations includes shelter and care to recuperate from illness and/or injury. This is a descriptive analysis of diagnoses and use of shelter-based convalescence in a cohort of homeless adults in Amsterdam. Methods Demographics of ill homeless adults, diagnoses, referral pattern, length of stay, discharge locations, and mortality, were collected by treating physicians during outreach care provision in a shelter-based convalescence care facility in Amsterdam, from January 2001 through October 2007. Results 629 individuals accounted for 889 admissions to the convalescence care facility. 83% were male and 53% were born in the Netherlands. The mean age was 45 years (SD 10 years. The primary physical problems were skin disorders (37%, respiratory disorders (33%, digestive disorders (24% and musculoskeletal disorders (21%. Common chronic conditions included addictions 78%, mental health disorders 20%, HIV/AIDS 11% and liver cirrhosis 5%. Referral sources were self-referred (18%, general hospitals (21% and drug clinics (27%. The median length of stay was 20 days. After (selfdischarge, 63% went back to the previous circumstances, 10% obtained housing, and 23% went to a medical or nursing setting. By March 2008, one in seven users (n = 83; 13% were known to have died, the Standard Mortality Ratio was 7.5 (95% CI: 4.1-13.5. Over the years, fewer men were admitted, with significantly more self neglect, personality disorders and cocaine use. Lengths of stay increased significantly during the study period. Conclusion Over the last years, the shelter-based convalescence care facility users were mainly homeless single males, around 45 years of age, with chronic problems due to substance use, mental health disorders and a frail physical condition, many of whom died a premature death. The facility has been flexible and responsive to the needs of the users and services available.

  20. Department o

    African Journals Online (AJOL)

    USER

    2016-10-31

    Oct 31, 2016 ... Department of Urban and Regional Planning, University of Ibadan, Oyo State, Nigeria. 2 ... Geospatial techniques were used for this study; data from primary and secondary source ... development, for instance, Nigeria cities .... (road network, road medians and water ..... Countries: A Case Study of Nigeria.

  1. Electronics department

    International Nuclear Information System (INIS)

    1979-01-01

    This report summarizes the activities in 1978 of some of the groups within the Electronics Department. The work covered includes plant protection and operator studies, reliability techniques, application of nuclear techniques to mineral exploration, applied laser physics, computing and, lastly, research instrumentation. (author)

  2. Persistence after treatment of pharyngeal gonococcal infections in patients of the STI clinic, Amsterdam, the Netherlands, 2012-2015: a retrospective cohort study

    NARCIS (Netherlands)

    Hananta, I. Putu Yuda; de Vries, Henry John Christiaan; van Dam, Alje P.; van Rooijen, Martijn Sebastiaan; Soebono, Hardyanto; Schim van der Loeff, Maarten Franciscus

    2017-01-01

    Infection of Neisseria gonorrhoeae in the pharynx (pharyngeal Ng) is associated with gonococcal transmission and development of antimicrobial resistance. We assessed proportion of and determinants for persistence after treatment of pharyngeal Ng. At the STI clinic of Amsterdam, the Netherlands,

  3. Intrapartum and neonatal mortality in primary midwife-led and secondary obstetrician-led care in the Amsterdam region of the Netherlands: A retrospective cohort study

    NARCIS (Netherlands)

    Wiegerinck, M.M.J.; van der Goes, B.Y.; Ravelli, A.C.J.; van der Post, J.A.M.; Klinkert, J.; Brandenbarg, J.; Buist, F.C.D.; Wouters, M.G.A.J.; Tamminga, P.; de Jonge, A.; Mol, B.W.

    2015-01-01

    Objective: to compare intrapartum- and neonatal mortality and intervention rates in term women starting labour in primary midwife-led versus secondary obstetrician-led care. Design: retrospective cohort study. Setting: Amsterdam region of the Netherlands. Participants: women with singleton

  4. HIV incidence on the increase among homosexual men attending an Amsterdam sexually transmitted disease clinic: using a novel approach for detecting recent infections

    NARCIS (Netherlands)

    Dukers, Nicole H. T. M.; Spaargaren, Joke; Geskus, Ronald B.; Beijnen, Jos; Coutinho, Roel A.; Fennema, Han S. A.

    2002-01-01

    Objective: Dramatic increases have occurred in sexually transmitted diseases (STD) and in sexual risk behaviour among homosexual men in Amsterdam and internationally. We investigated whether these trends indicate a resurgence of the HIV epidemic. Methods: HIV incidence was determined among

  5. Digital Destinations in the Tourist Sector: A Path Model for the Impact of e-Services on Tourist Expenditures in Amsterdam

    NARCIS (Netherlands)

    Neuts, B.; Romao, J.; Nijkamp, P.; van Leeuwen, E.S.

    2013-01-01

    Innovations in information and communication technologies (ICT) in recent decades have had profound implications for tourism services, promotion, or distribution. We apply a Structural Equations Model (SEM) to analyse the relationships between the characteristics of tourists visiting Amsterdam, the

  6. Beyond a lesbian space? An investigation on the intergenerational discourse surrounding lesbian public social places in Amsterdam.

    Science.gov (United States)

    Fobear, Katherine

    2012-01-01

    This article investigates intergenerational discourse on public lesbian social spaces within Amsterdam, Netherlands. The author seeks to address how lesbian women from different generations talk about lesbian social spaces in Amsterdam through anthropological ethnographic research and semistructured interviews with 20 lesbian women who have or currently are attending these places. The author also addresses the gradual decline of lesbian specific spaces in the city and the current belief that lesbian women are beyond having a public social space that services only the lesbian community. The rise in popularity of mixed gay- and lesbian-friendly bars and girl circuit parties will be identified as a key area where generational tensions and discourse are being played out. Issues pertaining to generational disagreements over lesbian identity, visibility, and space will be addressed.

  7. The association between ethnicity and vaginal microbiota composition in Amsterdam, the Netherlands.

    Science.gov (United States)

    Borgdorff, Hanneke; van der Veer, Charlotte; van Houdt, Robin; Alberts, Catharina J; de Vries, Henry J; Bruisten, Sylvia M; Snijder, Marieke B; Prins, Maria; Geerlings, Suzanne E; Schim van der Loeff, Maarten F; van de Wijgert, Janneke H H M

    2017-01-01

    To evaluate whether ethnicity is independently associated with vaginal microbiota (VMB) composition in women living in Amsterdam, the Netherlands, as has been shown for American women. Women (18-34 years, non-pregnant, N = 610) representing the six largest ethnic groups (Dutch, African Surinamese, South-Asian Surinamese, Turkish, Moroccan, and Ghanaian) were sampled from the population-based HELIUS study. Sampling was performed irrespective of health status or healthcare seeking behavior. DNA was extracted from self-sampled vaginal swabs and sequenced by Illumina MiSeq (16S rRNA gene V3-V4 region). The overall prevalence of VMBs not dominated by lactobacilli was 38.5%: 32.2% had a VMB resembling bacterial vaginosis and another 6.2% had a VMB dominated by Bifidobacteriaceae (not including Gardnerella vaginalis), Corynebacterium, or pathobionts (streptococci, staphylococci, Proteus or Enterobacteriaceae). The most prevalent VMB in ethnically Dutch women was a Lactobacillus crispatus-dominated VMB, in African Surinamese and Ghanaian women a polybacterial G. vaginalis-containing VMB, and in the other ethnic groups a L. iners-dominated VMB. After adjustment for sociodemographic, behavioral and clinical factors, African Surinamese ethnicity (adjusted odds ratio (aOR) 5.1, 95% confidence interval (CI) 2.1-12.0) and Ghanaian ethnicity (aOR 4.8, 95% CI 1.8-12.6) were associated with having a polybacterial G. vaginalis-containing VMB, and African Surinamese ethnicity with a L. iners-dominated VMB (aOR 2.8, 95% CI 1.2-6.2). Shorter steady relationship duration, inconsistent condom use with casual partners, and not using hormonal contraception were also associated with having a polybacterial G. vaginalis-containing VMB, but human papillomavirus infection was not. Other sexually transmitted infections were uncommon. The overall prevalence of having a VMB not dominated by lactobacilli in this population-based cohort of women aged 18-34 years in Amsterdam was high (38.5%), and

  8. The association between ethnicity and vaginal microbiota composition in Amsterdam, the Netherlands.

    Directory of Open Access Journals (Sweden)

    Hanneke Borgdorff

    Full Text Available To evaluate whether ethnicity is independently associated with vaginal microbiota (VMB composition in women living in Amsterdam, the Netherlands, as has been shown for American women.Women (18-34 years, non-pregnant, N = 610 representing the six largest ethnic groups (Dutch, African Surinamese, South-Asian Surinamese, Turkish, Moroccan, and Ghanaian were sampled from the population-based HELIUS study. Sampling was performed irrespective of health status or healthcare seeking behavior. DNA was extracted from self-sampled vaginal swabs and sequenced by Illumina MiSeq (16S rRNA gene V3-V4 region.The overall prevalence of VMBs not dominated by lactobacilli was 38.5%: 32.2% had a VMB resembling bacterial vaginosis and another 6.2% had a VMB dominated by Bifidobacteriaceae (not including Gardnerella vaginalis, Corynebacterium, or pathobionts (streptococci, staphylococci, Proteus or Enterobacteriaceae. The most prevalent VMB in ethnically Dutch women was a Lactobacillus crispatus-dominated VMB, in African Surinamese and Ghanaian women a polybacterial G. vaginalis-containing VMB, and in the other ethnic groups a L. iners-dominated VMB. After adjustment for sociodemographic, behavioral and clinical factors, African Surinamese ethnicity (adjusted odds ratio (aOR 5.1, 95% confidence interval (CI 2.1-12.0 and Ghanaian ethnicity (aOR 4.8, 95% CI 1.8-12.6 were associated with having a polybacterial G. vaginalis-containing VMB, and African Surinamese ethnicity with a L. iners-dominated VMB (aOR 2.8, 95% CI 1.2-6.2. Shorter steady relationship duration, inconsistent condom use with casual partners, and not using hormonal contraception were also associated with having a polybacterial G. vaginalis-containing VMB, but human papillomavirus infection was not. Other sexually transmitted infections were uncommon.The overall prevalence of having a VMB not dominated by lactobacilli in this population-based cohort of women aged 18-34 years in Amsterdam was high (38

  9. The impact of regulatory approaches targeting collaborative economy in the tourism accommodation sector::Barcelona, Berlin, Amsterdam and Paris

    OpenAIRE

    Dredge, Dianne; Gyimóthy, Szilvia; Birkbak, Andreas; Jensen, Torben Elgaard; Madsen, Anders Koed

    2016-01-01

    This paper has been commissioned by the European Commission’s DG GROWTH to examine the impact of regulatory approaches targeting collaborative economy in the tourism accommodation sector in the cities of Barcelona, Berlin, Amsterdam and Paris. In relation to tourism, the growth of the collaborative economy peer-to-peer accommodation sector has significant impacts for traditional tourism industry structures and relationships. The growth of the collaborative economy peer-to-peer accommodation m...

  10. Validation of the Malay version of the Amsterdam Preoperative Anxiety and Information Scale (APAIS).

    Science.gov (United States)

    Mohd Fahmi, Z; Lai, L L; Loh, P S

    2015-08-01

    Preoperative anxiety is a significant problem worldwide that may affect patients' surgical outcome. By using a simple and reliable tool such as the Amsterdam Preoperative Anxiety and Information Scale (APAIS), anaesthesiologists would be able to assess preoperative anxiety adequately and accurately. The purpose of this study was to develop and validate the Malay version of APAIS (Malay-APAIS), and assess the factors associated with higher anxiety scores. The authors performed forward and backward translation of APAIS into Malay and then tested on 200 patients in the anaesthetic clinic of University Malaya Medical Centre. Psychometric analysis was performed with factor analysis, internal consistency and correlation with Spielberger's State-Trait Anxiety Inventory (STAI-state). A good correlation was shown with STAI-state (r = 0.59). Anxiety and need for information both emerged with high internal consistency (Cronbach's alpha 0.93 and 0.90 respectively). Female gender, surgery with a higher risk and need for information were found to be associated with higher anxiety scores. On the other hand, previous experience with surgery had lower need for information. The Malay-APAIS is a valid and reliable tool for the assessment of patients' preoperative anxiety and their need for information. By understanding and measuring patient's concerns objectively, the perioperative management will improve to a much higher standard of care.

  11. The spatiality of specialty coffee bars and the cognitive-cultural economy in Amsterdam

    Directory of Open Access Journals (Sweden)

    Reza Shaker Ardekani

    2016-12-01

    Full Text Available Economic restructuring has led to the emergence of new socio-economic arrangements in cities based on the cognitive-cultural economy. Furthermore, the arrival of new middle classes in inner-cities has contributed to a renaissance of interest in urban culture and new consumption spaces. Focusing on specialty coffee bars (SCBs, the study explores their spatial patterns and spatial distributions in Amsterdam in order to find the spatial correlations between new urban consumption spaces and their locational economic strategies in terms of the cognitive-cultural opportunities. By employing geographic information system (GIS, the findings suggest a positive spatial correlation between urban areas involved in the cognitive-cultural economy and the concentration of SCBs. Although the argued correlation does not imply causation, it provides distinct insights related to the interconnectedness of new urban consumption spaces and their contextual urban economy. The paper also slightly touches upon some of the capabilities of GIS in the field of urban studies and poses some questions for further investigations.

  12. Improving rational thermal comfort prediction by using subpopulation characteristics: A case study at Hermitage Amsterdam.

    Science.gov (United States)

    Kramer, Rick; Schellen, Lisje; Schellen, Henk; Kingma, Boris

    2017-01-01

    This study aims to improve the prediction accuracy of the rational standard thermal comfort model, known as the Predicted Mean Vote (PMV) model, by (1) calibrating one of its input variables "metabolic rate," and (2) extending it by explicitly incorporating the variable running mean outdoor temperature (RMOT) that relates to adaptive thermal comfort. The analysis was performed with survey data ( n = 1121) and climate measurements of the indoor and outdoor environment from a one year-long case study undertaken at Hermitage Amsterdam museum in the Netherlands. The PMVs were calculated for 35 survey days using (1) an a priori assumed metabolic rate, (2) a calibrated metabolic rate found by fitting the PMVs to the thermal sensation votes (TSVs) of each respondent using an optimization routine, and (3) extending the PMV model by including the RMOT. The results show that the calibrated metabolic rate is estimated to be 1.5 Met for this case study that was predominantly visited by elderly females. However, significant differences in metabolic rates have been revealed between adults and elderly showing the importance of differentiating between subpopulations. Hence, the standard tabular values, which only differentiate between various activities, may be oversimplified for many cases. Moreover, extending the PMV model with the RMOT substantially improves the thermal sensation prediction, but thermal sensation toward extreme cool and warm sensations remains partly underestimated.

  13. Honouring the Dual Commitment: Remittance Strategies of Ghanaian Migrants in Amsterdam

    Directory of Open Access Journals (Sweden)

    Ntokozo Nzama

    2014-08-01

    Full Text Available This paper seeks to understand the rationale behind the practice of remittances and to examine its impact on the living standards and conditions of Ghanaian remitters living in Amsterdam, the Netherlands. This study investigates how remitters are able to sustain their lifestyles in a foreign country, and the sacrifices and compromises made in terms of their dual commitment to support families in Ghana and in the Netherlands. A qualitative approach using in-depth interviews was adopted in order to give research participants an opportunity to talk broadly about their lived experiences as Ghanaians residing in a foreign country and the challenges associated with sending remittances. Push factors such as political unrest, poverty, low income, and unemployment influenced movement out of Ghana. A better quality of life (better paying jobs, improved qualifications was the major pull factor that attracted migrants to the Netherlands. Remittances from migrants in the Netherlands supported the welfare of many households in Ghana, especially in terms of improved standards of living and better access to health care and education. Sending remittances is not “a feel good gesture” only, but an obligation to the family members back in Ghana. This study shows that there were major compromises and trade-offs in terms of migrant lifestyles because of their dual commitments.

  14. 'De strijd om Amsterdam'. Een nieuwe benadering in het onderzoek naar de NSB

    Directory of Open Access Journals (Sweden)

    Josje Damsma

    2009-01-01

    Full Text Available ‘The Fight for Amsterdam’. A New Approach in Research into the NSBThe main characteristics of the members of the Dutch Nazi-movement (Nationaal- Socialistische Beweging, NSB are constructed by historians De Jong and De Jonge. Both labeled the members of the NSB as ‘opportunistic’ and ‘isolated’. Up until now, that image has remained unchallenged. Inspired by Aristotle Kallis, Roger Griffin and Robert Paxton, we analyzed the behavior and social position of members of the NSB in Amsterdam during the Second World War in a new way. By focusing on their actions instead of on ideology, their isolated position can be brought into doubt along with opportunism as the main motivational factor. It is more likely that a combination of idealism, opportunism and social networks led to membership of the NSB. The interaction pattern differed from person to person and per political, economic or social level of communication. The results of this research show that Dutch political history and identity is complex and a lot of research still has to be done in this field.

  15. [The Amsterdam Dementia Screening Test in cognitively healthy and clinical samples. An update of normative data].

    Science.gov (United States)

    van Toutert, Meta; Diesfeldt, Han; Hoek, Dirk

    2016-10-01

    The six tests in the Amsterdam Dementia Screening Test (ADST) examine the cognitive domains of episodic memory (delayed picture recognition, word learning), orientation, category fluency (animals and occupations), constructional ability (figure copying) and executive function (alternating sequences). New normative data were collected in a sample of 102 elderly volunteers (aged 65-94), including subjects with medical or other health conditions, except dementia or frank cognitive impairment (MMSE > 24). Included subjects were independent in complex instrumental activities of daily living.Fluency, not the other tests, needed adjustment for age and education. A deficit score (0-1) was computed for each test. Summation (range 0-6) proved useful in differentiating patients with dementia (N = 741) from normal elderly (N = 102).Positive and negative predictive power across a range of summed deficit scores and base rates are displayed in Bayesian probability tables.In the normal elderly, delayed recall for eight words was tested and adjusted for initial recall. A recognition test mixed the target words with eight distractors. Delayed recognition was adjusted for immediate and delayed recall.The ADST and the normative data in this paper help the clinical neuropsychologist to make decisions concerning the presence or absence of neurocognitive disorder in individual elderly examinees.

  16. Study on depleted uranium at the airplane accident in Bijlmermeer, Amsterdam, Netherlands

    International Nuclear Information System (INIS)

    Veltkamp, A.C.; Van Hienen, J.F.A.

    1998-09-01

    The El Al airplane, which crashed in the urban area Bijlmermeer in Amsterdam, Netherlands, October 4th, 1992, contained balance weights of depleted uranium. Part of the balance weights has not been found after the disaster and its not sure what happened with the lost part. One of the options is that the uranium atomized during or after the fire. To clarify this the Dutch Civil Aviation Authority (RLD) ordered the Netherlands Energy Research Foundation (ECN) to study the fore-mentioned option on the basis of the following questions: (1) at which temperature will depleted uranium atomize and thus be released into the air?; (2) at which temperature will depleted uranium burn?; and (3) what is the chance that depleted uranium will atomize under the conditions as they occurred during the aircraft accident in the Bijlmermeer? The overall impression is that during the fire little if any uranium oxide has been released into the air. Because of lack of knowledge about the actual conditions, partial or complete oxidation can not be excluded with cast-iron certainty. 16 refs

  17. Looking back on a successful project. The Restoration of the Royal Palace in Amsterdam

    Directory of Open Access Journals (Sweden)

    Bert van Bommel

    2013-06-01

    Full Text Available After 1968, few changes were made to the Royal Palace in Amsterdam and eventually the palace was no longer functionally and technically up-to-date. Initially, the most recent restoration was only aimed at remedying that situation. Also, the project was split up and priority was given to fixing up the interior. Gradually, the actual restoration gained prominence. In 2007 it was decided to also restore the 1808 furniture. Until 2006, the government architect had hardly been involved in the restoration of the interior. This architect, Krijn van den Ende, was advised by various committees. Prior restorations (1929-1939 and 1960-1968 had restored the palace to its 17th-century state as best as possible. The most recent restoration respected this, while at the same time it aimed at connecting the 17th century character of the building to the unique collection of Empire furniture. This furniture was restored, as were the chandeliers and candelabras. All the ceilings on the first floor were studied and treated and the paintings between the beams were meticulously restored. A very important aspect was the restoration of the so-called ‘Bataven’ series in the galleries. Much of the work concerned making the building conform to contemporary standards. Once again the palace is now a suitable venue for official occasions. The inevitable addition of a lift did however cause quite a stir. Accessibility was improved and more representative rooms are now open to the public than before. The government architect was involved already in the preparatory stages of the second part of the restoration, which concerned the façades and the roofs. In executing the actual work a support committee provided advice and direction on his behalf. Although the sandstone is generally of a high quality, before 1968 a limited number of deteriorating blocks had been replaced. This time too, a number of blocks needed attention. The heavy scaffolding that needed to be installed for

  18. Validation of the Spanish version of the Amsterdam Preoperative Anxiety and Information Scale (APAIS).

    Science.gov (United States)

    Vergara-Romero, Manuel; Morales-Asencio, José Miguel; Morales-Fernández, Angelines; Canca-Sanchez, Jose Carlos; Rivas-Ruiz, Francisco; Reinaldo-Lapuerta, Jose Antonio

    2017-06-07

    Preoperative anxiety is a frequent and challenging problem with deleterious effects on the development of surgical procedures and postoperative outcomes. To prevent and treat preoperative anxiety effectively, the level of anxiety of patients needs to be assessed through valid and reliable measuring instruments. One such measurement tool is the Amsterdam Preoperative Anxiety and Information Scale (APAIS), of which a Spanish version has not been validated yet. To perform a Spanish cultural adaptation and empirical validation of the APAIS for assessing preoperative anxiety in the Spanish population. A two-step forward/back translation of the APAIS scale was performed to ensure a reliable Spanish cultural adaptation. The final Spanish version of the APAIS questionnaire was administered to 529 patients between the ages of 18 to 70 undergoing elective surgery at hospitals of the Agencia Sanitaria Costa del Sol (Spain). Cronbach's alpha, homogeneity index, intra-class correlation coefficient, and confirmatory factor analysis were calculated to assess internal consistency and criteria and construct validity. Confirmatory factor analysis showed that a one-factor model was better fitted than a two-factor model, with good fitting patterns (root mean square error of approximation: 0.05, normed-fit index: 0.99, goodness-of-fit statistic: 0.99). The questionnaire showed high internal consistency (Cronbach's alpha: 0.84) and a good correlation with the Goldberg Anxiety Scale (CCI: 0.62 (95% CI: 0.55 to 0.68). The Spanish version of the APAIS is a valid and reliable preoperative anxiety measurement tool and shows psychometric properties similar to those obtained by similar previous studies.

  19. The Amsterdam Resting-State Questionnaire reveals multiple phenotypes of resting-state cognition

    Directory of Open Access Journals (Sweden)

    B. Alexander eDiaz

    2013-08-01

    Full Text Available Resting-state neuroimaging is a dominant paradigm for studying brain function in health and disease. It is attractive for clinical research because of its simplicity for patients, straightforward standardization, and sensitivity to brain disorders. Importantly, non-sensory experiences like mind wandering may arise from ongoing brain activity. However, little is known about the link between ongoing brain activity and cognition, as phenotypes of resting-state cognition—and tools to quantify them—have been lacking. To facilitate rapid and structured measurements of resting-state cognition we developed a 50-item self-report survey, the Amsterdam Resting-State Questionnaire (ARSQ. Based on ARSQ data from 813 participants assessed after five minutes eyes-closed rest in their home, we identified seven dimensions of resting-state cognition using factor analysis: Discontinuity of Mind, Theory of Mind, Self, Planning, Sleepiness, Comfort, and Somatic Awareness. Further, we showed that the structure of cognition was similar during resting-state fMRI and EEG, and that the test-retest correlations were remarkably high for all dimensions. To explore whether inter-individual variation of resting-state cognition is related to health status, we correlated ARSQ-derived factor scores with psychometric scales measuring depression, anxiety, and sleep quality. Mental health correlated positively with Comfort and negatively with Discontinuity of Mind. Finally, we show that sleepiness may partially explain a resting-state EEG profile previously associated with Alzheimer’s disease. These findings indicate that the ARSQ readily provides information about cognitive phenotypes and that it is a promising tool for research on the neural correlates of resting-state cognition in health and disease.

  20. Predicting Early Mortality After Hip Fracture Surgery: The Hip Fracture Estimator of Mortality Amsterdam.

    Science.gov (United States)

    Karres, Julian; Kieviet, Noera; Eerenberg, Jan-Peter; Vrouenraets, Bart C

    2018-01-01

    Early mortality after hip fracture surgery is high and preoperative risk assessment for the individual patient is challenging. A risk model could identify patients in need of more intensive perioperative care, provide insight in the prognosis, and allow for risk adjustment in audits. This study aimed to develop and validate a risk prediction model for 30-day mortality after hip fracture surgery: the Hip fracture Estimator of Mortality Amsterdam (HEMA). Data on 1050 consecutive patients undergoing hip fracture surgery between 2004 and 2010 were retrospectively collected and randomly split into a development cohort (746 patients) and validation cohort (304 patients). Logistic regression analysis was performed in the development cohort to determine risk factors for the HEMA. Discrimination and calibration were assessed in both cohorts using the area under the receiver operating characteristic curve (AUC), the Hosmer-Lemeshow goodness-of-fit test, and by stratification into low-, medium- and high-risk groups. Nine predictors for 30-day mortality were identified and used in the final model: age ≥85 years, in-hospital fracture, signs of malnutrition, myocardial infarction, congestive heart failure, current pneumonia, renal failure, malignancy, and serum urea >9 mmol/L. The HEMA showed good discrimination in the development cohort (AUC = 0.81) and the validation cohort (AUC = 0.79). The Hosmer-Lemeshow test indicated no lack of fit in either cohort (P > 0.05). The HEMA is based on preoperative variables and can be used to predict the risk of 30-day mortality after hip fracture surgery for the individual patient. Prognostic Level II. See Instructions for Authors for a complete description of levels of evidence.

  1. Multidisciplinary integrated Parent and Child Centres in Amsterdam: a qualitative study

    Directory of Open Access Journals (Sweden)

    Vincent Busch

    2013-04-01

    Full Text Available Background: In several countries centres for the integrated delivery of services to the parent and child have been established. In the Netherlands family health care service centres, called Parent and Child Centres (PCCs involve multidisciplinary teams. Here doctors, nurses, midwives, maternity help professionals and educationists are integrated into multidisciplinary teams in neighbourhood-based centres. To date there has been little research on the implementation of service delivery in these centres.Study Design: A SWOT analysis was performed by use of triangulation data; this took place by integrating all relevant published documents on the origin and organization of the PCCs and the results from interviews with PCC experts and with PCC professionals (N=91. Structured interviews were performed with PCC-professionals (health care professionals (N=67 and PCC managers N=12 and PCC-experts (N=12 in Amsterdam and qualitatively analysed thematically. The interview themes were based on a pre-set list of codes, derived from a prior documentation study and a focus group with PCC experts. Results: Perceived advantages of PCCs were more continuity of care, shorter communication lines, low-threshold contact between professionals and promising future perspectives. Perceived challenges included the absence of uniform multidisciplinary guidelines, delays in communication with hospitals and midwives, inappropriate accommodation for effective professional integration, differing expectations regarding the PCC-manager role among PCC-partners and the danger of professionals' needs dominating clients' needs.Conclusions: Professionals perceive PCCs as a promising development in the integration of services. Remaining challenges involved improvements at the managerial and organizational level. Quantitative research into the improvements in quality of care and child health is recommended.

  2. Multidisciplinary integrated Parent and Child Centres in Amsterdam: a qualitative study

    Directory of Open Access Journals (Sweden)

    Vincent Busch

    2013-04-01

    Full Text Available Background: In several countries centres for the integrated delivery of services to the parent and child have been established. In the Netherlands family health care service centres, called Parent and Child Centres (PCCs involve multidisciplinary teams. Here doctors, nurses, midwives, maternity help professionals and educationists are integrated into multidisciplinary teams in neighbourhood-based centres. To date there has been little research on the implementation of service delivery in these centres. Study Design: A SWOT analysis was performed by use of triangulation data; this took place by integrating all relevant published documents on the origin and organization of the PCCs and the results from interviews with PCC experts and with PCC professionals (N=91. Structured interviews were performed with PCC-professionals (health care professionals (N=67 and PCC managers N=12 and PCC-experts (N=12 in Amsterdam and qualitatively analysed thematically. The interview themes were based on a pre-set list of codes, derived from a prior documentation study and a focus group with PCC experts.  Results: Perceived advantages of PCCs were more continuity of care, shorter communication lines, low-threshold contact between professionals and promising future perspectives. Perceived challenges included the absence of uniform multidisciplinary guidelines, delays in communication with hospitals and midwives, inappropriate accommodation for effective professional integration, differing expectations regarding the PCC-manager role among PCC-partners and the danger of professionals' needs dominating clients' needs. Conclusions: Professionals perceive PCCs as a promising development in the integration of services. Remaining challenges involved improvements at the managerial and organizational level. Quantitative research into the improvements in quality of care and child health is recommended.

  3. Cannabis intoxication inhibits avoidance action tendencies: a field study in the Amsterdam coffee shops.

    Science.gov (United States)

    Cousijn, Janna; Snoek, Robin W M; Wiers, Reinout W

    2013-09-01

    Experimental laboratory studies suggest that the approach bias (relatively fast approach responses) toward substance-related materials plays an important role in problematic substance use. How this bias is moderated by intention to use versus recent use remains unknown. Moreover, the relationship between approach bias and other motivational processes (satiation and craving) and executive functioning remains unclear. The aim of this study was to investigate the cannabis approach bias before and after cannabis use in real-life setting (Amsterdam coffee shops) and to assess the relationship between approach bias, craving, satiation, cannabis use, and response inhibition. Cannabis, tobacco, and neutral approach and avoidance action tendencies were measured with the Approach Avoidance Task and compared between 42 heavy cannabis users with the intention to use and 45 heavy cannabis users shortly after cannabis use. The classical Stroop was used to measure response inhibition. Multiple regression analyses were conducted to investigate relationships between approach bias, satiation, craving, cannabis use, and response inhibition. In contrast to the hypotheses, heavy cannabis users with the intention to use did not show a cannabis approach bias, whereas intoxicated cannabis users did show an approach bias regardless of image category. This could be attributed to a general slowing of avoidance action tendencies. Moreover, craving was negatively associated with the approach bias, and no relationships were observed between the cannabis approach bias, satiation, prior cannabis use, and response inhibition. Cannabis intoxication in a real-life setting inhibited general avoidance. Expression of the cannabis approach bias appeared not to be modulated by satiation or response inhibition.

  4. Multilocus sequence typing of Trichomonas vaginalis clinical samples from Amsterdam, the Netherlands.

    Science.gov (United States)

    van der Veer, C; Himschoot, M; Bruisten, S M

    2016-10-13

    In this cross-sectional epidemiological study we aimed to identify molecular profiles for Trichomonas vaginalis and to determine how these molecular profiles were related to patient demographic and clinical characteristics. Molecular typing methods previously identified two genetically distinct subpopulations for T. vaginalis; however, few molecular epidemiological studies have been performed. We now increased the sensitivity of a previously described multilocus sequence typing (MLST) tool for T. vaginalis by using nested PCR. This enabled the typing of direct patient samples. From January to December 2014, we collected all T. vaginalis positive samples as detected by routine laboratory testing. Samples from patients either came from general practitioners offices or from the sexually transmitted infections (STI) clinic in Amsterdam. Epidemiological data for the STI clinic patients were retrieved from electronic patient files. The primary outcome was the success rate of genotyping direct T. vaginalis positive samples. The secondary outcome was the relation between T. vaginalis genotypes and risk factors for STI. All 7 MLST loci were successfully typed for 71/87 clinical samples. The 71 typed samples came from 69 patients, the majority of whom were women (n=62; 90%) and half (n=34; 49%) were STI clinic patients. Samples segregated into a two population structure for T. vaginalis representing genotypes I and II. Genotype I was most common (n=40; 59.7%). STI clinic patients infected with genotype II reported more sexual partners in the preceding 6 months than patients infected with genotype I (p=0.028). No other associations for gender, age, ethnicity, urogenital discharge or co-occurring STIs with T. vaginalis genotype were found. MLST with nested PCR is a sensitive typing method that allows typing of direct (uncultured) patient material. Genotype II is possibly more prevalent in high-risk sexual networks. Published by the BMJ Publishing Group Limited. For

  5. The Amsterdam Resting-State Questionnaire reveals multiple phenotypes of resting-state cognition

    Science.gov (United States)

    Diaz, B. Alexander; Van Der Sluis, Sophie; Moens, Sarah; Benjamins, Jeroen S.; Migliorati, Filippo; Stoffers, Diederick; Den Braber, Anouk; Poil, Simon-Shlomo; Hardstone, Richard; Van't Ent, Dennis; Boomsma, Dorret I.; De Geus, Eco; Mansvelder, Huibert D.; Van Someren, Eus J. W.; Linkenkaer-Hansen, Klaus

    2013-01-01

    Resting-state neuroimaging is a dominant paradigm for studying brain function in health and disease. It is attractive for clinical research because of its simplicity for patients, straightforward standardization, and sensitivity to brain disorders. Importantly, non-sensory experiences like mind wandering may arise from ongoing brain activity. However, little is known about the link between ongoing brain activity and cognition, as phenotypes of resting-state cognition—and tools to quantify them—have been lacking. To facilitate rapid and structured measurements of resting-state cognition we developed a 50-item self-report survey, the Amsterdam Resting-State Questionnaire (ARSQ). Based on ARSQ data from 813 participants assessed after 5 min eyes-closed rest in their home, we identified seven dimensions of resting-state cognition using factor analysis: Discontinuity of Mind, Theory of Mind, Self, Planning, Sleepiness, Comfort, and Somatic Awareness. Further, we showed that the structure of cognition was similar during resting-state fMRI and EEG, and that the test-retest correlations were remarkably high for all dimensions. To explore whether inter-individual variation of resting-state cognition is related to health status, we correlated ARSQ-derived factor scores with psychometric scales measuring depression, anxiety, and sleep quality. Mental health correlated positively with Comfort and negatively with Discontinuity of Mind. Finally, we show that sleepiness may partially explain a resting-state EEG profile previously associated with Alzheimer's disease. These findings indicate that the ARSQ readily provides information about cognitive phenotypes and that it is a promising tool for research on the neural correlates of resting-state cognition in health and disease. PMID:23964225

  6. Groundwater impacts on surface water quality and nutrient loads in lowland polder catchments: monitoring the greater Amsterdam area

    Science.gov (United States)

    Yu, Liang; Rozemeijer, Joachim; van Breukelen, Boris M.; Ouboter, Maarten; van der Vlugt, Corné; Broers, Hans Peter

    2018-01-01

    The Amsterdam area, a highly manipulated delta area formed by polders and reclaimed lakes, struggles with high nutrient levels in its surface water system. The polders receive spatially and temporally variable amounts of water and nutrients via surface runoff, groundwater seepage, sewer leakage, and via water inlets from upstream polders. Diffuse anthropogenic sources, such as manure and fertiliser use and atmospheric deposition, add to the water quality problems in the polders. The major nutrient sources and pathways have not yet been clarified due to the complex hydrological system in lowland catchments with both urban and agricultural areas. In this study, the spatial variability of the groundwater seepage impact was identified by exploiting the dense groundwater and surface water monitoring networks in Amsterdam and its surrounding polders. A total of 25 variables (concentrations of total nitrogen (TN), total phosphorus (TP), NH4, NO3, HCO3, SO4, Ca, and Cl in surface water and groundwater, N and P agricultural inputs, seepage rate, elevation, land-use, and soil type) for 144 polders were analysed statistically and interpreted in relation to sources, transport mechanisms, and pathways. The results imply that groundwater is a large source of nutrients in the greater Amsterdam mixed urban-agricultural catchments. The groundwater nutrient concentrations exceeded the surface water environmental quality standards (EQSs) in 93 % of the polders for TP and in 91 % for TN. Groundwater outflow into the polders thus adds to nutrient levels in the surface water. High correlations (R2 up to 0.88) between solutes in groundwater and surface water, together with the close similarities in their spatial patterns, confirmed the large impact of groundwater on surface water chemistry, especially in the polders that have high seepage rates. Our analysis indicates that the elevated nutrient and bicarbonate concentrations in the groundwater seepage originate from the decomposition of

  7. Groundwater impacts on surface water quality and nutrient loads in lowland polder catchments: monitoring the greater Amsterdam area

    Directory of Open Access Journals (Sweden)

    L. Yu

    2018-01-01

    Full Text Available The Amsterdam area, a highly manipulated delta area formed by polders and reclaimed lakes, struggles with high nutrient levels in its surface water system. The polders receive spatially and temporally variable amounts of water and nutrients via surface runoff, groundwater seepage, sewer leakage, and via water inlets from upstream polders. Diffuse anthropogenic sources, such as manure and fertiliser use and atmospheric deposition, add to the water quality problems in the polders. The major nutrient sources and pathways have not yet been clarified due to the complex hydrological system in lowland catchments with both urban and agricultural areas. In this study, the spatial variability of the groundwater seepage impact was identified by exploiting the dense groundwater and surface water monitoring networks in Amsterdam and its surrounding polders. A total of 25 variables (concentrations of total nitrogen (TN, total phosphorus (TP, NH4, NO3, HCO3, SO4, Ca, and Cl in surface water and groundwater, N and P agricultural inputs, seepage rate, elevation, land-use, and soil type for 144 polders were analysed statistically and interpreted in relation to sources, transport mechanisms, and pathways. The results imply that groundwater is a large source of nutrients in the greater Amsterdam mixed urban–agricultural catchments. The groundwater nutrient concentrations exceeded the surface water environmental quality standards (EQSs in 93 % of the polders for TP and in 91 % for TN. Groundwater outflow into the polders thus adds to nutrient levels in the surface water. High correlations (R2 up to 0.88 between solutes in groundwater and surface water, together with the close similarities in their spatial patterns, confirmed the large impact of groundwater on surface water chemistry, especially in the polders that have high seepage rates. Our analysis indicates that the elevated nutrient and bicarbonate concentrations in the groundwater seepage originate

  8. Status report 500 MeV, 10% d.f. linear accelerator (MEA) under construction at Amsterdam

    International Nuclear Information System (INIS)

    Bruinsma, P.J.T.; Vries, C. de.

    1979-03-01

    The design parameters and the general lay-out of buildings and of the main components of the accelerator are presented. Some of the accelerator technology features which are typical for the Amsterdam machine are then described. The performance obtained so far with the first part of the machine is indicated with some remarks on the planning for the next 2 years during which the facility ought to be fully operational. The type of experimental facilities under construction are described and the status and the planning schedule are indicated. (Auth.)

  9. Bloedzuigers in pluimveestallen

    NARCIS (Netherlands)

    Mul, M.F.; Mullens, B.A.; Koenraadt, C.J.M.

    2009-01-01

    Wageningen UR en Universiteit Amsterdam werken aan mogelijke maatregelen tegen de vogelmijt, Dermanyssus gallinae, in Nederlandse legpluimveestallen. Ook is uitbreiding van een ander vogelmijt-type gesignaleerd: de noordelijke vogelmijt, of Ornithonyssus sylviarum

  10. De kloof tussen wetenschap en praktijk dichten Carel hulshof

    NARCIS (Netherlands)

    Putten, D. van

    2011-01-01

    Carel Hulshof is per 1 mei 2011 benoemd tot bijzonder hoogleraar Arbeids- en Bedrijfsgeneeskunde aan de Universiteit van Amsterdam bij het Coronel Instituut voor Arbeid en Gezondheid van het Academisch Medisch Centrum.

  11. Adriaan van Veldhuizen, De partij. Over het politieke leven in de vroege S.D.A.P.

    Directory of Open Access Journals (Sweden)

    Dirk Jan Wolffram

    2016-11-01

    Full Text Available Adriaan van Veldhuizen, De partij. Over het politieke leven in de vroege S.D.A.P. (Dissertatie Universiteit Leiden 2015; Amsterdam: Prometheus/Bert Bakker, 2015, 375 pp., isbn 978 90 3513 857 5.

  12. Developing future precipitation events from historic events: An Amsterdam case study.

    Science.gov (United States)

    Manola, Iris; van den Hurk, Bart; de Moel, Hans; Aerts, Jeroen

    2016-04-01

    Due to climate change, the frequency and intensity of extreme precipitation events is expected to increase. It is therefore of high importance to develop climate change scenarios tailored towards the local and regional needs of policy makers in order to develop efficient adaptation strategies to reduce the risks from extreme weather events. Current approaches to tailor climate scenarios are often not well adopted in hazard management, since average changes in climate are not a main concern to policy makers, and tailoring climate scenarios to simulate future extremes can be complex. Therefore, a new concept has been introduced recently that uses known historic extreme events as a basis, and modifies the observed data for these events so that the outcome shows how the same event would occur in a warmer climate. This concept is introduced as 'Future Weather', and appeals to the experience of stakeholders and users. This research presents a novel method of projecting a future extreme precipitation event, based on a historic event. The selected precipitation event took place over the broader area of Amsterdam, the Netherlands in the summer of 2014, which resulted in blocked highways, disruption of air transportation, flooded buildings and public facilities. An analysis of rain monitoring stations showed that an event of such intensity has a 5 to 15 years return period. The method of projecting a future event follows a non-linear delta transformation that is applied directly on the observed event assuming a warmer climate to produce an "up-scaled" future precipitation event. The delta transformation is based on the observed behaviour of the precipitation intensity as a function of the dew point temperature during summers. The outcome is then compared to a benchmark method using the HARMONIE numerical weather prediction model, where the boundary conditions of the event from the Ensemble Prediction System of ECMWF (ENS) are perturbed to indicate a warmer climate. The two

  13. Hypertension control in a large multi-ethnic cohort in Amsterdam, The Netherlands: the HELIUS study.

    Science.gov (United States)

    Agyemang, Charles; Kieft, Suzanne; Snijder, Marieke B; Beune, Erik J; van den Born, Bert-Jan; Brewster, Lizzy M; Ujcic-Voortman, Joanne J; Bindraban, Navin; van Montfrans, Gert; Peters, Ron J; Stronks, Karien

    2015-03-15

    Hypertension is a major problem among European ethnic minority groups. We assessed the current situation of hypertension prevalence and its management among a multi-ethnic population in Amsterdam, The Netherlands. Data from the HELIUS study were used including 12,974 participants (1871 Ghanaian, 2184 African Surinamese, 2278 South-Asian Surinamese, 2277 Turkish, 2222 Moroccan and 2142 Dutch origin people), aged 18-70 years. Comparisons among groups were made using proportions and age-adjusted prevalence ratios (PRs). Hypertension prevalence ranged from 24% and 16% in Moroccan men and women to 52% and 62% in Ghanaian men and women. Except for Moroccan women, age-adjusted PR of hypertension was higher in all the ethnic minority groups than in Dutch. Among hypertensives, ethnic minority groups generally had higher levels of hypertension awareness and BP lowering treatment than Dutch. Moreover, prevalence rates for the prescription of more than one BP lowering drug were generally higher in African and South-Asian origin groups compared with Dutch origin people. By contrast, BP control levels were lower in all the ethnic groups than in Dutch, with control rates being significantly lower in Ghanaian men (26%, PR=0.49; 95% CI, 0.37-0.66) and women (45%, PR=0.64; 0.52-0.77), African-Surinamese men (30%, PR=0.61; 0.46-0.81) and women (45%, PR=0.72; 0.51-0.77), and South-Asian Surinamese men (43%, PR=0.77; 0.61-0.97) and women (47%, PR=0.76; 0.63-0.92) compared with Dutch men (53%) and women (61%). Our findings indicate poor BP control in ethnic minority groups despite the high treatment levels. More work is needed to unravel the potential factors contributing to the poor control in order to improve BP control in ethnic minority groups, particularly among African and South-Asian origin groups. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  14. Comparison of general health status, myocardial infarction, obesity, diabetes, and fruit and vegetable intake between immigrant Pakistani population in the Netherlands and the local Amsterdam population.

    Science.gov (United States)

    Raza, Qaisar; Nicolaou, Mary; Dijkshoorn, Henriëtte; Seidell, Jacob C

    2017-12-01

    South Asians living in Western countries have shown higher prevalence of cardiovascular disease and related non-communicable diseases as compared to the local populations. The aim of this study was to compare the general health status and prevalence of myocardial infarction (MI), diabetes, high blood pressure, overweight, obesity, and fruit and vegetable intake between Pakistani immigrants in the Netherlands and local Amsterdam population. A health survey was conducted in 2012-2013 among Pakistanis in the Netherlands. Results were compared with a health survey conducted among inhabitants of Amsterdam in 2012. One hundred and fifty-four Pakistanis from four big cities of the Netherlands and 7218 inhabitants of Amsterdam participated. The data for Amsterdam population were weighed on the basis of age, gender, city district, marital status, ethnicity and income level while the data for Pakistanis were weighed on the basis of age and gender to make both data-sets representative of their general population. Pakistanis reported a high prevalence of MI (3.3%), diabetes (11.4%), high blood pressure (14.4%), overweight (35.5%) and obesity (18.5%) while Amsterdam population reported the prevalence as 2.5% for MI, 6.8% for diabetes, 15.3% for high blood pressure, 28.1% for overweight and 11.1% for obesity. Pakistanis had a significantly higher level of MI (OR = 2.71; 95% CI: 1.19-6.14), diabetes (OR = 4.41; 95% CI: 2.66-7.33) and obesity (OR = 2.51; 95% CI: 1.53-4.12) after controlling for age, sex and educational level with Amsterdam population as the reference group. Pakistanis showed a higher intake of fruit and fruit juice as compared to Amsterdam population though the latter showed a higher intake of cooked vegetables. Higher prevalence of MI, diabetes and obesity among Pakistanis than Amsterdam population indicates the need for health scientists and policy-makers to develop interventions for tackling non-communicable diseases and its determinants among

  15. Pathways into homelessness: recently homeless adults problems and service use before and after becoming homeless in Amsterdam

    Directory of Open Access Journals (Sweden)

    de Wit Matty A

    2009-01-01

    Full Text Available Abstract Background To improve homelessness prevention practice, we met with recently homeless adults, to explore their pathways into homelessness, problems and service use, before and after becoming homeless. Methods Recently homeless adults (last housing lost up to two years ago and legally staying in the Netherlands were sampled in the streets, day centres and overnight shelters in Amsterdam. In April and May 2004, students conducted interviews and collected data on demographics, self reported pathways into homelessness, social and medical problems, and service use, before and after becoming homeless. Results among 120 recently homeless adults, (male 88%, Dutch 50%, average age 38 years, mean duration of homelessness 23 weeks, the main reported pathways into homelessness were evictions 38%, relationship problems 35%, prison 6% and other reasons 22%. Compared to the relationship group, the eviction group was slightly older (average age 39.6 versus 35.5 years; p = 0.08, belonged more often to a migrant group (p = 0.025, and reported more living single (p Conclusion the recently homeless fit the overall profile of the homeless population in Amsterdam: single (Dutch men, around 40 years, with a mix of financial debts, addiction, mental and/or physical health problems. Contacts with services were fragmented and did not prevent homelessness. For homelessness prevention, systematic and outreach social medical care before and during homelessness should be provided.

  16. Population-based study on the seroprevalence of hepatitis A, B, and C virus infection in Amsterdam, 2004.

    Science.gov (United States)

    Baaten, G G G; Sonder, G J B; Dukers, N H T M; Coutinho, R A; Van den Hoek, J A R

    2007-12-01

    In order to enhance screening and preventive strategies, this study investigated the seroprevalence of hepatitis A, B, and C in the general adult urban population and in subgroups. In 2004, sera from 1,364 adult residents of Amsterdam were tested for viral markers. Sociodemographic characteristics were collected using a standardized questionnaire. For hepatitis A, 57.0% was immune. Of first-generation immigrants from Turkey and Morocco, 100% was immune. Of all Western persons and second-generation non-Western immigrants, approximately half was still susceptible. For hepatitis B, 9.9% had antibodies to hepatitis B core antigen (anti-HBc) and 0.4% had hepatitis B surface antigen. Anti-HBc seroprevalences were highest among first-generation immigrants from Surinam, Morocco, and Turkey, and correlated with age at the time of immigration, and among men with a sexual preference for men. Seroprevalence among second-generation immigrants was comparable to Western persons. The seroprevalence of hepatitis C virus antibodies was 0.6%. In conclusion, a country with overall low endemicity for viral hepatitis can show higher endemicity in urban regions, indicating the need for differentiated regional studies and prevention strategies. More prevention efforts in cities like Amsterdam are warranted, particularly for hepatitis A and B among second-generation immigrants, for hepatitis B among men with a sexual preference for men, and for hepatitis C. Active case finding strategies are needed for both hepatitis B and C. (c) Wiley-Liss, Inc.

  17. Energy supply for the Zuidas district [Amsterdam, Netherlands] 1995-2005, 2005-2020. Review, analysis and preview; Energievoorziening Zuidas 1995-2005, 2005-2020. Terugblik, analyse, vooruitblik

    Energy Technology Data Exchange (ETDEWEB)

    Frederiks, N.

    2005-07-15

    The project The Zuidas in Amsterdam, Netherlands, is the connection between the residential areas Amsterdam South and Buitenveldertbaan. It is a large spatial development that generates significant strategic and economic effects for both municipality, region and the Netherlands. Amsterdam plans to generate and use as much sustainable energy as possible in the most efficient way. This report describes how the Zuidas can become a sustainable and energy efficient project. The public version of the report is described in DMB magazine No. 1 [Dutch] Het projectgebied De Zuidas in Amsterdam vormt de verbinding tussen woonwijken (Zuid en Buitenveldert). Het is een groot ruimtelijk-ontwikkelingsproject dat belangrijke strategische en economische effecten genereert voor zowel gemeente, regio als Nederland. Amsterdam wil zoveel mogelijk duurzame energie efficiënt opwekken en gebruiken. In dit rapport wordt beschreven hoe de Zuidas een duurzaam en energiezuinig project moet worden. De publieksversie wordt beschreven in DMB magazine nr. 1.

  18. Public Health Departments

    Data.gov (United States)

    Department of Homeland Security — State and Local Public Health Departments in the United States Governmental public health departments are responsible for creating and maintaining conditions that...

  19. The role of the architect as a facilitator of a new “common” space : Transformation of the NDSM shipwharf, Amsterdam

    NARCIS (Netherlands)

    Havik, K.M.

    2016-01-01

    This paper discusses the collaborative process of the redevelopment of the Dutch state heritage shipwharf NDSM in Amsterdam into a cultural incubator: a creative hub with artist studios, theater spaces, a skatepark and other (sub) cultural facilities. This process of redevelopment, which started in

  20. Car2x with software defined networks, network functions virtualization and supercomputers technical and scientific preparations for the Amsterdam Arena telecoms fieldlab

    NARCIS (Netherlands)

    Meijer R.J.; Cushing R.; De Laat C.; Jackson P.; Klous S.; Koning R.; Makkes M.X.; Meerwijk A.

    2015-01-01

    In the invited talk 'Car2x with SDN, NFV and supercomputers' we report about how our past work with SDN [1, 2] allows the design of a smart mobility fieldlab in the huge parking lot the Amsterdam Arena. We explain how we can engineer and test software that handle the complex conditions of the Car2X

  1. List of the primary types of social wasps (Hymenoptera: Vespidae) deposited in the Nationaal Natuurhistorisch Museum, Leiden, and the Zoölogisch Museum, Amsterdam

    NARCIS (Netherlands)

    Kojima, J.; Achterberg, van C.

    1997-01-01

    The primary types of social wasp subfamilies Vespinae, Polistinae and Stenogastrinae housed in the Nationaal Natuurhistorisch Museum in Leiden and the Zoölogisch Museum in Amsterdam are listed. Their complete label data are given unless they are available elsewhere. Lectotypes of Polistes snelleni

  2. Strong association between failure of T cell homeostasis and the syncytium-inducing phenotype among HIV-1-infected men in the Amsterdam Cohort Study

    NARCIS (Netherlands)

    Maas, J. J.; Gange, S. J.; Schuitemaker, H.; Coutinho, R. A.; van Leeuwen, R.; Margolick, J. B.

    2000-01-01

    OBJECTIVE: To assess the association between T cell homeostasis and its failure and 1.) the occurrence of AIDS and 2.) the switch from the non-syncytium-inducing (NSI) to the syncytium-inducing (SI) HIV virus phenotype. METHODS: For each of 325 homosexual men in the Amsterdam Cohort Study, the slope

  3. De waarde van studentensport : onderzoek naar de relatie tussen USC lidmaatschap en studieprestaties van bachelorstudenten in Amsterdam, Utrecht, Wageningen en Nijmegen

    NARCIS (Netherlands)

    Dekkers, Vera; Deutekom, Marije

    Er bestaan significante verschillen tussen het aantal behaalde studiepunten van niet-leden en leden van een Universitair Sportcentrum (USC). Dat blijkt uit onderzoek van het lectoraat “Kracht van Sport” van de Hogeschool van Amsterdam (HvA) en Hogeschool Inholland. Het onderzoek laat zien dat leden

  4. The implementation of the neighbourhood unit concept in the Western Garden Cities in Amsterdam in the early post-war period

    NARCIS (Netherlands)

    Mens, E.H.M.; Hein, Carola

    2016-01-01

    This paper analyses the way the General Expansion Plan for Amsterdam was modified after 1945 to accommodate the principles of the neighborhood unit concept, using the Western Garden Cities as a case study. The purpose is to evaluate continuities and discontinuities between per-war and post-war

  5. Transitions in drug use in a new generation of problem drug users in Amsterdam: a 6-year follow-up study

    NARCIS (Netherlands)

    Buster, Marcel C. A.; Witteveen, Ewald; Prins, Maria; van Ameijden, Erik J. C.; Schippers, Gerard; Krol, Anneke

    2009-01-01

    This study describes the transitions in drug use in Amsterdam among young drug users (YDUs) who are inhaling or injecting cocaine or using illicitly obtained opiates. From 2000 until 2003, 187 YDUs (

  6. Low prevalence of human T-cell leukaemia virus-I and -II infection among drug users in Amsterdam, The Netherlands

    NARCIS (Netherlands)

    van den Hoek, J. A.; Al, E. J.; Huisman, J. G.; Goudsmit, J.; Coutinho, R. A.

    1991-01-01

    The prevalence of human T-cell leukaemia virus-I and -II infection was studied in a cohort of 346 intravenous and nonintravenous drug users in Amsterdam. Three participants (0.86%) had antibodies to HTLV-I by two commercially available HTLV-I enzyme immunoassays (EIA). Infection in these three

  7. Is the institutionalization of urban movements inevitable? : A comparison of the opportunities for sustained squatting in New York City and Amsterdam

    NARCIS (Netherlands)

    H.D. Pruijt (Hans)

    2003-01-01

    textabstractAbstract: In this article the opportunity structures of New York City and Amsterdam for organized squatting are compared. New York City knew two distinct squatting waves, with an intermission of several years. The literature on US urban movements predicts transformation through

  8. From Amsterdam to Auburn: an explanation for the rise of the prison in seventeenth-century Holland and nineteenth-century America

    NARCIS (Netherlands)

    P.C. Spierenburg (Pieter)

    1987-01-01

    textabstractThe article attempts to make the difference in timing between Europe and the United States with respect to the rise of imprisonment understandable. It starts with Europe, taking Amsterdam as its main example. As a punitive institution, the prison became well-established in various

  9. Intrapartum and neonatal mortality in primary midwife-led and secondary obstetrician-led care in the Amsterdam region of the Netherlands: A retrospective cohort study

    NARCIS (Netherlands)

    Wiegerinck, M. M. J.; van der Goes, B. Y.; Ravelli, A. C. J.; van der Post, J. A. M.; Klinkert, J.; Brandenbarg, J.; Buist, F. C. D.; Wouters, M. G. A. J.; Tamminga, P.; de jonge, A.; Mol, B. W.

    2015-01-01

    To compare intrapartum- and neonatal mortality and intervention rates in term women starting labour in primary midwife-led versus secondary obstetrician-led care. Retrospective cohort study. Amsterdam region of the Netherlands. Women with singleton pregnancies who gave birth beyond 37+0 weeks

  10. Decline in HIV incidence and injecting, but not in sexual risk behaviour, seen in drug users in Amsterdam: a 19-year prospective cohort study

    NARCIS (Netherlands)

    Lindenburg, Catharina E. A.; Krol, Anneke; Smit, Colette; Buster, Marcel C. A.; Coutinho, Roel A.; Prins, Maria

    2006-01-01

    OBJECTIVE: To study temporal changes in HIV incidence, HIV transmission routes, and both injecting and sexual risk behaviour in the open Amsterdam Cohort Study (ACS) among drug users. Initiated in 1985, the ACS enables us to study changes in trends since HAART became widespread in 1996. METHODS:

  11. On Governance Structures and Maritime Conflict Resolution in Early Modern Amsterdam: The Case of the Chamber of Insurance and Average (sixteenth to Eighteenth Centuries)

    NARCIS (Netherlands)

    Go, Sabine C.P.J.

    2017-01-01

    The resolution of commercial conflicts was an important issue for the municipality of Amsterdam. The city’s government realised that commerce and trade could be hampered if commercial disputes were not dealt with quickly and effectively. A special type of commercial disputes centred on marine

  12. Vaginal and anal human papillomavirus infection and seropositivity among female sex workers in amsterdam, the Netherlands: prevalence, concordance and risk factors

    NARCIS (Netherlands)

    Marra, E.; Kroone, N.; Freriks, E.; van Dam, C. L.; Alberts, C. J.; Hogewoning, A. A.; Bruisten, S.; van Dijk, A.; Kroone, M. M.; Waterboer, T.; Schim van der Loeff, M. F.

    2017-01-01

    We studied prevalence, risk factors and concordance of vaginal and anal HPV infection and L1 seropositivity among female sex workers (FSW) in Amsterdam. In 2016, FSW aged ≥18 years having a sexually transmitted infections (STI) consultation were invited to participate. Participation entailed taking

  13. Car2x with software defined networks, network functions virtualization and supercomputers : technical and scientific preparations for the Amsterdam Arena telecoms fieldlab

    NARCIS (Netherlands)

    Meijer, R.; Cushing, R.; de Laat, C.; Jackson, P.; Klous, S.; Koning, R.; Makkes, M.; Meerwijk, A.; Smari, W.W.

    2015-01-01

    In the invited talk “Car2x with SDN, NFV and supercomputers” we report about how our past work with SDN [1, 2] allows the design of a smart mobility fieldlab in the huge parking lot the Amsterdam Arena. We explain how we can engineer and test software that handle the complex conditions of the Car2X

  14. Implementation of a Prehospital Triage System for Patients With Chest Pain and Logistics for Primary Percutaneous Coronary Intervention in the Region of Amsterdam, The Netherlands

    NARCIS (Netherlands)

    Adams, Rob; Appelman, Yolande; Bronzwaer, Jean G.; Slagboom, Ton; Amoroso, Giovanni; van Exter, Pieternel; Tijssen, G. P. Jan; de Winter, Robbert J.

    2010-01-01

    We aimed to describe the logistics of a prehospital triage system for patients with acute chest pain in the region of Amsterdam, The Netherlands. Ambulance electrocardiograms (ECGs) were evaluated immediately in 1 of the percutaneous coronary intervention (PCI)-capable centers. Patients accepted for

  15. Liberal Arts and Sciences Education for the 21st Century Knowledge Economy : A Case Study of Amsterdam University College, The Netherlands

    NARCIS (Netherlands)

    van der Wende, M.C.

    2016-01-01

    This chapter describes how Amsterdam University College (AUC), a liberal arts and science honours college in The Netherlands, promotes internationalization and adopts a global approach in its curriculum and academic community. It shows how global learning outcomes and 21st century skills can be

  16. Liberal Arts and Sciences Education for the 21st Century Knowledge Economy: A Case Study of Amsterdam University College, The Netherlands

    NARCIS (Netherlands)

    Klein Bog, Deirdre; van der Wende, Marijk; Jung, Insung; Nishimura, Mikiko; Sasao, Toshiaki

    2016-01-01

    This chapter describes how Amsterdam University College (AUC), a liberal arts and science honours college in The Netherlands, promotes internationalization and adopts a global approach in its curriculum and academic community. It shows how global learning outcomes and 21st century skills can be

  17. Partitioning of perfluorooctanesulfonate and perfluorohexanesulfonate in the aquatic environment after an accidental release of aqueous film forming foam at Schiphol Amsterdam Airport

    NARCIS (Netherlands)

    Kwadijk, C.J.A.F.; Kotterman, M.J.J.; Koelmans, A.A.

    2014-01-01

    In the summer of 2008, an accidental release of Aqueous Film Forming Foam (AFFF) took place at Schiphol Amsterdam Airport (The Netherlands). After the release, water, fish and sediment samples were collected and analyzed for perfluoroalkyl sulfonates (PFSA). In situ perfluorooctane sulfonate (PFOS)

  18. Men who have sex with men more often chose daily than event-driven use of pre-exposure prophylaxis: baseline analysis of a demonstration study in Amsterdam.

    NARCIS (Netherlands)

    Hoornenborg, Elske; Achterbergh, Roel Ca; van der Loeff, Maarten F Schim; Davidovich, Udi; van der Helm, Jannie J; Hogewoning, Arjan; van Duijnhoven, Yvonne Thp; Sonder, Gerard Jb; de Vries, Henry Jc; Prins, Maria

    The Amsterdam PrEP project is a prospective, open-label demonstration study at a large sexually transmitted infection (STI) clinic. We examined the uptake of PrEP; the baseline characteristics of men who have sex with men (MSM) and transgender persons initiating PrEP; their choices of daily versus

  19. The Amsterdam region - A home for creative knowledge workers and graduates? Understanding the attractiveness of the metropolitan region for creative knowledge workers

    NARCIS (Netherlands)

    Bontje, M.A.; Pethe, H.A.A.; Rühmann, P.

    2008-01-01

    The report brings together the results of a survey of creative knowledge workers in the Amsterdam region. How do creative knowledge workers judge the living situation and what activities do they pursue in the different parts of the region? How satisfied are creative knowledge workers with their

  20. Amount of self-reported illicit drug use compared to quantitative hair test results in community-recruited young drug users in Amsterdam

    NARCIS (Netherlands)

    Welp, Esther A. E.; Bosman, Ingrid; Langendam, Miranda W.; Totté, Maja; Maes, Robert A. A.; van Ameijden, Erik J. C.

    2003-01-01

    To assess the dose-effect relationship between self-reported drug intake and the concentration of drugs and/or their metabolites in hair and to examine factors that may mediate this relationship. A cohort study among young drug users (YDU) in Amsterdam, the Netherlands, which began in July 2000. At

  1. What if every drop of rain that falls on the roofs of Amsterdam is used to make beer?

    Science.gov (United States)

    Hut, Rolf; Lugt, Dorien; Ceccarini, Iacopo; van der Horst, Teije; des Tombe, Bas; Schilperoort, Bart; Hoebe, Joris

    2017-04-01

    The city of Amsterdam, like many cities in the world, faces the problem that because of our changing climate, rainfall events become more intense. Sewers designed to only flood once every 10 years now flood multiple times a year. In an award winning idea, the aptly named brewery Heavenswater, in dutch: "Hemelswater" decided to raise awareness for the growing urban rainwater drainages problems by brewing a beer using rain collected from their roof in stead of from drinking water. In this "what if" research we study the implications of this idea on a large scale. We look into the consequences for the rainwater drainage, but also wastewater, city planning, health care and last but not least: novel economic opportunities.

  2. Associations between Safety from Crime, Cycling, and Obesity in a Dutch Elderly Population: Results from the Longitudinal Aging Study Amsterdam

    Directory of Open Access Journals (Sweden)

    Stef P. J. Kremers

    2012-01-01

    Full Text Available The objective of this cross-sectional study was to investigate differences in associations between crime rates, cycling, and weight status between people living in low and high socioeconomic status (SES neighbourhoods. In total, 470 participants in the Longitudinal Aging Study Amsterdam were included (age: 63–70 y. Body height and weight were measured using a stadiometer and calibrated weight scale, respectively. Cycling behaviour was assessed in a face-to-face interview, and neighbourhood crime rates were assessed using data from police reports. Men residing in high SES neighbourhoods cycled more than males residing in low SES neighbourhoods. Cycling was negatively related to crime rates among both men and women living in low SES neighbourhoods. Among men living in low SES neighbourhoods, more cycling was associated with lower BMI. Interventions aiming to prevent obesity in older people may consider aiming at increasing bicycle use in lower SES neighbourhoods, but neighbourhood safety issues should be considered.

  3. Buying a house with solar cells. Survey among subscribers and buyers of newly built houses in Amsterdam, Netherlands

    International Nuclear Information System (INIS)

    Van Mierlo, B.; Sprengers, M.

    1995-12-01

    In a new housing estate in Amsterdam in 1995 the regional energy utility (EBA) has integrated a photovoltaic (PV) system (250 kWp) into 63 houses out of 245 houses. The parts of these owner-occupied houses with PV panels are not owned by the occupants. In order to determine which are the motives to buy solar houses and in order to analyze changes in their attitudes questionnaires were sent to potential occupants twice. First to the people who registered for the new housing project (subscribers), and second to the people who bought one of the 245 houses either with or without PV (buyers). The overall conclusion is that PV does not play an important role in the decision making process when buying a new house. It is recommended to study differences in PV preferences and opinions a few years after the buyers have moved to their new houses. 10 figs., 17 tabs., 9 refs., 3 appendices

  4. The monitoring of atmospheric mercury species in the Southern Indian Ocean at Amsterdam Island (38°S

    Directory of Open Access Journals (Sweden)

    Barret M.

    2013-04-01

    Full Text Available The role of oceans in the global cycle of mercury is still poorly characterized, mainly because of a lack a long-term data on atmospheric mercury concentrations in the remote Southern Ocean. In the frame of GMOS (Global Mercury Observation System, we present here the first results from a new monitoring station at Amsterdam Island in the Southern Indian Ocean. For the period January to April 2012, we recorded mean concentration of gaseous elemental mercury (GEM, reactive gaseous mercury (RGM and particulate-bounded mercury (PHg of 1.03 ng m−3, 0.37 and 0.34 pg m−3 respectively. While GEM concentrations showed little variations, RGM and PHg exhibited fast variations with alternation of value below the instrumental detection limit and maximum values up to 4 pg m−3.

  5. Hepatitis B vaccination and changes in sexual risk behaviour among men who have sex with men in Amsterdam.

    Science.gov (United States)

    Xiridou, M; Wallinga, J; Dukers-Muijers, N; Coutinho, R

    2009-04-01

    The impact of hepatitis B vaccination in men having sex with men in Amsterdam has been marginal until now, possibly because of increases in sexual risk behaviour counterbalancing the effect of vaccination. A mathematical model is used to describe the hepatitis B epidemic. The model shows that, with the current vaccination coverage, the decrease in incidence is small in the beginning. However, the number of infections prevented per vaccine administered rises over time. Nevertheless, increased risk behaviour reduces the benefit of vaccination. Targeting high-risk men is more successful in reducing and containing the epidemic than targeting low-risk men. In conclusion, the vaccination campaign is effective and should be intensified. High-risk men should be targeted for vaccination and for risk reduction.

  6. The Island of Amsterdamøya: A key site for studying past climate in the Arctic Archipelago of Svalbard

    Science.gov (United States)

    Bakke, Jostein; Balascio, Nicholas; van der Bilt, Willem G. M.; Bradley, Raymond; D'Andrea, William J.; Gjerde, Marthe; Ólafsdóttir, Sædís; Røthe, Torgeir; De Wet, Greg

    2018-03-01

    This paper introduces a series of articles assembled in a special issue that explore Holocene climate evolution, as recorded in lakes on the Island of Amsterdamøya on the westernmost fringe of the Arctic Svalbard archipelago. Due to its location near the interface of oceanic and atmospheric systems sourced from Arctic and Atlantic regions, Amsterdamøya is a key site for recording the terrestrial response to marine and atmospheric changes. We employed multi-proxy approaches on lake sediments, integrating physical, biogeochemical, and isotopic analyses to infer past changes in temperature, precipitation, and glacier activity. The results comprise a series of quantitative Holocene-length paleoclimate reconstructions that reveal different aspects of past climate change. Each of the four papers addresses various facets of the Holocene climate history of north-western Svalbard, including a reconstruction of the Annabreen glacier based on the sedimentology of the distal glacier-fed lake Gjøavatnet, a reconstruction of changing hydrologic conditions based on sedimentology and stratigraphy in Lake Hakluytvatnet, reconstruction of summer temperature based on alkenone paleothermometry from lakes Hakluytvatnet and Hajeren, and a hydrogen isotope-based hydrological reconstruction from lake Hakluytvatnet. We also present high-resolution paleomagnetic secular variation data from the same lake, which document important regional magnetic field variations and demonstrate the potential for use in synchronizing Holocene sedimentary records in the Arctic. The paleoclimate picture that emerges is one of early Holocene warmth from ca. 10.5 ka BP interrupted by transient cooling ca. 10-8ka BP, and followed by cooling that mostly manifested as two stepwise events ca. 7 and 4 ka BP. The past 4ka were characterized by dynamic glaciers and summer temperature fluctuations decoupled from the declining summer insolation.

  7. Pathways into homelessness: recently homeless adults problems and service use before and after becoming homeless in Amsterdam.

    Science.gov (United States)

    van Laere, Igor R; de Wit, Matty A; Klazinga, Niek S

    2009-01-07

    To improve homelessness prevention practice, we met with recently homeless adults, to explore their pathways into homelessness, problems and service use, before and after becoming homeless. Recently homeless adults (last housing lost up to two years ago and legally staying in the Netherlands) were sampled in the streets, day centres and overnight shelters in Amsterdam. In April and May 2004, students conducted interviews and collected data on demographics, self reported pathways into homelessness, social and medical problems, and service use, before and after becoming homeless. among 120 recently homeless adults, (male 88%, Dutch 50%, average age 38 years, mean duration of homelessness 23 weeks), the main reported pathways into homelessness were evictions 38%, relationship problems 35%, prison 6% and other reasons 22%. Compared to the relationship group, the eviction group was slightly older (average age 39.6 versus 35.5 years; p = 0.08), belonged more often to a migrant group (p = 0.025), and reported more living single (p homelessness, in the total group, contacts with any social service were 38% and with any medical service 27%. Despite these contacts they did not keep their house. During homelessness only contacts with social work and benefit agencies increased, contacts with medical services remained low. the recently homeless fit the overall profile of the homeless population in Amsterdam: single (Dutch) men, around 40 years, with a mix of financial debts, addiction, mental and/or physical health problems. Contacts with services were fragmented and did not prevent homelessness. For homelessness prevention, systematic and outreach social medical care before and during homelessness should be provided.

  8. The role of Surinamese migrants in the transmission of Chlamydia trachomatis between Paramaribo, Suriname and Amsterdam, The Netherlands.

    Science.gov (United States)

    Bom, Reinier J M; van der Helm, Jannie J; Bruisten, Sylvia M; Grünberg, Antoon W; Sabajo, Leslie O A; Schim van der Loeff, Maarten F; de Vries, Henry J C

    2013-01-01

    The large Surinamese migrant population in the Netherlands is a major risk group for urogenital Chlamydia trachomatis infection. Suriname, a former Dutch colony, also has a high prevalence of C. trachomatis. Surinamese migrants travel extensively between the Netherlands and Suriname. Our objective was to assess whether the Surinamese migrants in the Netherlands form a bridge population facilitating transmission of C. trachomatis between Suriname and the Netherlands. If so, joint prevention campaigns involving both countries might be required. Between March 2008 and July 2010, participants were recruited at clinics in Paramaribo, Suriname and in Amsterdam, the Netherlands. Participants were grouped as native Surinamese, native Dutch, Surinamese migrant, Dutch migrant, or Other, based on country of residence and country of birth of the participant and of their parents. Risk behavior, such as sexual mixing between ethnic groups, was recorded and C. trachomatis positive samples were typed through multilocus sequence typing (MLST). A minimum spanning tree of samples from 426 participants showed four MLST clusters. The MLST strain distribution of Surinamese migrants differed significantly from both the native Surinamese and Dutch populations, but was not an intermediate state between these two populations. Sexual mixing between the Surinamese migrants and the Dutch and Surinamese natives occurred frequently. Yet, the MLST cluster distribution did not differ significantly between participants who mixed and those who did not. Sexual mixing occurred between Surinamese migrants in Amsterdam and the native populations of Suriname and the Netherlands. These migrants, however, did not seem to form an effective bridge population for C. trachomatis transmission between the native populations. Although our data do not seem to justify the need for joint campaigns to reduce the transmission of C. trachomatis strains between both countries, intensified preventive campaigns to

  9. Adherence to guidelines for the treatment of Behçet's syndrome in New York and Amsterdam.

    Science.gov (United States)

    Kerstens, Floor G; Turkstra, Franktien; Atalay, Selma; van Vugt, Richard M; Swearingen, Christopher J; Yazici, Yusuf

    2017-01-01

    To assess adherence to published guidelines for the treatment of Behçet's syndrome (BS) in two geographic areas. We extracted guideline statements from the 2008 EULAR recommendations. Adherence to these statements was evaluated retrospectively in both New York (USA) and Amsterdam (The Netherlands), by reviewing records from patients fulfilling the ISG criteria. We analysed data per statement and event, and divided data according to the year in which an event occurred. We compared events prior to 2009 to those after publication of the EULAR recommendations (2009 and later). 474 patients were evaluated, 24 of whom were from Amsterdam. Treatment adherence varied substantially across various Behçet's manifestations, ranging from 21% vs. 31% in posterior uveitis, 50% vs. 25% in arterial disease, 29% vs. 29% in arthritis and 38% vs. 55% in erythema nodosum to 65% vs. 67% in deep venous thrombosis (DVT), before and after publication of the guidelines respectively. Topical treatment of mucocutaneous disease was only 2% vs. 8%, whereas adherence in neuro-Behçet was ≥ 94% and 100% in gastrointestinal disease. Adherence to treatment guidelines varies substantially by Behçet's manifestation. Lack of adherence in manifestations such as eye disease and arthritis suggests that current recommendations are not sufficient or other concurrent manifestations require more aggressive treatment. The extensive use of anti-TNF agents might indicate a shift towards more aggressive treatment. Thus, our results suggest the 2008 guidelines were not in line with treatment in clinical practice over the past years and the recent revision of the recommendations was indeed needed.

  10. Speaking of Belonging: Learning to be “Good Citizens” in the Context of Voluntary Language Coaching Projects in Amsterdam, the Netherlands

    Directory of Open Access Journals (Sweden)

    Rhiannon Mosher

    2015-09-01

    Full Text Available This article explores citizenship education for adult immigrants through informal language education in Amsterdam, the Netherlands. Based on data collected over thirteen months of ethnographic research among volunteer Dutch language coaches in Amsterdam, the primary methods used in this study were in-depth semi-structured interviews and participant observation. While the primary focus of this article is on the ways in which informal educational settings contribute to processes of adult citizenship education, this paper also underscores some of the perceived barriers to integration faced by adult immigrants in the Netherlands. Adopting a Foucauldian theoretical approach to governmentality, this paper considers how volunteer Dutch language coaches both reproduce and challenge contemporary discourses around citizenship and belonging in Dutch society. Experiences and expressions of citizenship among volunteer Dutch language coaches reveal how entangled discourses of cultural difference and neoliberal “active” citizenship shape state and everyday notions of good citizenship practice and integration.

  11. The role of the architect as a facilitator of a new “common” space: Transformation of the NDSM shipwharf, Amsterdam

    OpenAIRE

    Havik, K.M.

    2016-01-01

    This paper discusses the collaborative process of the redevelopment of the Dutch state heritage shipwharf NDSM in Amsterdam into a cultural incubator: a creative hub with artist studios, theater spaces, a skatepark and other (sub) cultural facilities. This process of redevelopment, which started in the late nineteen nineties, differed in multiple ways from conventional heritage redevelopment practices. The NDSM wharf has become an emblematic case of transformation processes initiated from the...

  12. Findings on prenatal, lactational and later childhood exposure to dioxins and dioxin-like compounds: a review of the Amsterdam-Zaandam cohort 1987–2005

    Directory of Open Access Journals (Sweden)

    Gavin W. ten Tusscher

    2015-02-01

    Full Text Available The Amsterdam-Zaandam cohort has been studied intermittently since 1987. The cohort was selected for optimal pregnancy and birth, in whom prenatal, lactational and more recently current dioxin exposures were measured. In the perinatal period and during the years thereafter, effects on various organ systems have been documented: thyroid, metabolism, immunity, haematology, motor development, brain development, lung function and puberty. We present a review of the endpoints studied, from the perinatal period into adolescence.

  13. A newly designed 45 to 60 mer oligonucleotide Agilent platform microarray for global gene expression studies of Synechocystis PCC6803: example salt stress experiment

    NARCIS (Netherlands)

    Aguirre von Wobeser, E.; Huisman, J.; Ibelings, B.; Matthijs, H.C.P.; Matthijs, H.C.P.

    2005-01-01

    A newly designed 45 to 60 mer oligonucleotide Agilent platform microarray for global gene expression studies of Synechocystis PCC6803: example salt stress experiment Eneas Aguirre-von-Wobeser 1, Jef Huisman1, Bas Ibelings2 and Hans C.P. Matthijs1 1 Universiteit van Amsterdam, Amsterdam, The

  14. Increasing risk behaviour can outweigh the benefits of antiretroviral drug treatment on the HIV incidence among men-having-sex-with-men in Amsterdam

    Directory of Open Access Journals (Sweden)

    Zhu Yifan

    2011-05-01

    Full Text Available Abstract Background The transmission through contacts among MSM (men who have sex with men is one of the dominating contributors to HIV prevalence in industrialized countries. In Amsterdam, the capital of the Netherlands, the MSM risk group has been traced for decades. This has motivated studies which provide detailed information about MSM's risk behavior statistically, psychologically and sociologically. Despite the era of potent antiretroviral therapy, the incidence of HIV among MSM increases. In the long term the contradictory effects of risk behavior and effective therapy are still poorly understood. Methods Using a previously presented Complex Agent Network model, we describe steady and casual partnerships to predict the HIV spreading among MSM. Behavior-related parameters and values, inferred from studies on Amsterdam MSM, are fed into the model; we validate the model using historical yearly incidence data. Subsequently, we study scenarios to assess the contradictory effects of risk behavior and effective therapy, by varying corresponding values of parameters. Finally, we conduct quantitative analysis based on the resulting incidence data. Results The simulated incidence reproduces the ACS historical incidence well and helps to predict the HIV epidemic among MSM in Amsterdam. Our results show that in the long run the positive influence of effective therapy can be outweighed by an increase in risk behavior of at least 30% for MSM. Conclusion We recommend, based on the model predictions, that lowering risk behavior is the prominent control mechanism of HIV incidence even in the presence of effective therapy.

  15. Association between Self-Rated Health and the Ethnic Composition of the Residential Environment of Six Ethnic Groups in Amsterdam

    Science.gov (United States)

    Veldhuizen, Eleonore M.; Musterd, Sako; Dijkshoorn, Henriëtte; Kunst, Anton E.

    2015-01-01

    Background: Studies on the association between health and neighborhood ethnic composition yielded inconsistent results, possibly due to methodological limitations. We assessed these associations at different spatial scales and for different measures of ethnic composition. Methods: We obtained health survey data of 4673 respondents of Dutch, Surinamese, Moroccan, Turkish other non-Western and other Western origin. Neighborhood ethnic composition was measured for buffers varying from 50–1000 m. Associations with self-rated health were measured using logistic multilevel regression analysis, with control for socioeconomic position at the individual and area level. Results: Overall ethnic heterogeneity was not related to health for any ethnic group. The presence of other Surinamese was associated with poor self-rated health among Surinamese respondents. The presence of Moroccans or Turks was associated with poor health among some groups. The presence of Dutch was associated with better self-rated health among Surinamese and Turks. In most cases, these associations were stronger at lower spatial scales. We found no other associations. Conclusions: In Amsterdam, self-rated health was not associated with ethnic heterogeneity in general, but may be related to the presence of specific ethnic groups. Policies regarding social and ethnic mixing should pay special attention to the co-residence of groups with problematic interrelations. PMID:26569282

  16. Theory of Mind and the Whole Brain Functional Connectivity: Behavioral and Neural Evidences with the Amsterdam Resting State Questionnaire.

    Science.gov (United States)

    Marchetti, Antonella; Baglio, Francesca; Costantini, Isa; Dipasquale, Ottavia; Savazzi, Federica; Nemni, Raffaello; Sangiuliano Intra, Francesca; Tagliabue, Semira; Valle, Annalisa; Massaro, Davide; Castelli, Ilaria

    2015-01-01

    A topic of common interest to psychologists and philosophers is the spontaneous flow of thoughts when the individual is awake but not involved in cognitive demands. This argument, classically referred to as the "stream of consciousness" of James, is now known in the psychological literature as "Mind-Wandering." Although of great interest, this construct has been scarcely investigated so far. Diaz et al. (2013) created the Amsterdam Resting State Questionnaire (ARSQ), composed of 27 items, distributed in seven factors: discontinuity of mind, theory of mind (ToM), self, planning, sleepiness, comfort, and somatic awareness. The present study aims at: testing psychometric properties of the ARSQ in a sample of 670 Italian subjects; exploring the neural correlates of a subsample of participants (N = 28) divided into two groups on the basis of the scores obtained in the ToM factor. Results show a satisfactory reliability of the original factional structure in the Italian sample. In the subjects with a high mean in the ToM factor compared to low mean subjects, functional MRI revealed: a network (48 nodes) with higher functional connectivity (FC) with a dominance of the left hemisphere; an increased within-lobe FC in frontal and insular lobes. In both neural and behavioral terms, our results support the idea that the mind, which does not rest even when explicitly asked to do so, has various and interesting mentalistic-like contents.

  17. Longitudinal interrelationships between frequent geographic relocation and personality development: results from the Amsterdam Growth and Health Longitudinal Study.

    Science.gov (United States)

    Lin, Kuan-Chia; Twisk, Jos W R; Rong, Jiin-Ru

    2011-04-01

    This study is part of the Amsterdam Growth and Health Longitudinal Study, which was undertaken to assess the long-term interrelationships between cumulative frequency of geographic relocation (CFGR) and the development of personality characteristics (i.e., Inadequacy, Rigidity, Social Inadequacy, Dominance, Self-sufficiency, Self-esteem, and Hostility). We found that participants who had more mobility experiences had lower consistency in their personality characteristics (the exception being Rigidity). Residential mobility from different life stages was positively associated with the continuity and change of Inadequacy and Dominance. In addition, young adults with higher Rigidity personality experienced fewer geographic moves during the transition from young adulthood to mid-life. Our study provides evidence that CFGR in different life stages may be associated with the development of personality characteristics from young adulthood to mid-life in different ways. Increased awareness of the potential interrelationships between frequent geographic relocation and personality development may have positive consequences for adult psychological health. © 2011 American Orthopsychiatric Association.

  18. Climatic change and local policy, Amsterdam, Netherlands. Policy options and implementation strategies to reduce emission of CO2

    International Nuclear Information System (INIS)

    Schol, E.; Van den Bosch, A.; Ligthart, F.A.T.M.; Roemer, J.C.; Ruijg, G.J.; Schaeffer, G.J.; Dinkelman, D.H.; Kok, I.C.; De Paauw, K.F.B.

    1998-04-01

    Insight is given into the local policy options with respect to climate change, in this case within the sphere of influence of Amsterdam local authorities. A list of new policy options for CO2-reduction has been made with the assistance of local policy makers and representatives of interest groups. These policy options have been divided into three qualitative scenarios: Institutional Cultural Change, Technological Innovation and Least Regrets. The environmental, economic and other effects have been described for each policy option. The three most interesting policy options have been selected by local policy makers and representatives of interest groups during a workshop. Implementation strategies have been developed for the options selected. These strategies have been discussed during a second workshop. The reduction target, stabilization of CO2-emissions in 2015 compared to 1993, can be realized by a combination of all the new policy options. The three selected policy options count for 40% of this total CO2-emission reduction. Finally, a general outline on the methodology to construct local policies for climate protection has been described. This methodology can also be applied to other cities and municipal administrators, e.g. participants of Cities for Climate Protection, an initiative of the International Council for Local Environmental Initiatives, or the Netherlands Climate Association. 136 refs

  19. Systematic study on genetic and epimutational profile of a cohort of Amsterdam criteria-defined Lynch Syndrome in Singapore.

    Directory of Open Access Journals (Sweden)

    Yanqun Liu

    Full Text Available BACKGROUND: Germline defects of mismatch repair (MMR genes underlie Lynch Syndrome (LS. We aimed to gain comprehensive genetic and epigenetic profiles of LS families in Singapore, which will facilitate efficient molecular diagnosis of LS in Singapore and the region. METHODS: Fifty nine unrelated families were studied. Mutations in exons, splice-site junctions and promoters of five MMR genes were scanned by high resolution melting assay followed by DNA sequencing, large fragment deletions/duplications and promoter methylation in MLH1, MSH2, MSH6 and PMS2 were evaluated by multiplex ligation-dependent probe amplification. Tumor microsatellite instability (MSI was assessed with five mononucleotide markers and immunohistochemical staining (IHC was also performed. RESULTS: Pathogenic defects, all confined to MLH1 and MSH2, were identified in 17 out of 59 (28.8% families. The mutational spectrum was highly heterogeneous and 28 novel variants were identified. One recurrent mutation in MLH1 (c.793C>T was also observed. 92.9% sensitivity for indication of germline mutations conferred by IHC surpassed 64.3% sensitivity by MSI. Furthermore, 15.6% patients with MSS tumors harbored pathogenic mutations. CONCLUSIONS: Among major ethnic groups in Singapore, all pathogenic germline defects were confined to MLH1 and MSH2. Caution should be applied when the Amsterdam criteria and consensus microsatellite marker panel recommended in the revised Bethesda guidelines are applied to the local context. We recommend a screening strategy for the local LS by starting with tumor IHC and the hotspot mutation testing at MLH1 c.793C>T followed by comprehensive mutation scanning in MLH1 and MSH2 prior to proceeding to other MMR genes.

  20. Recent 210Pb, 137Cs and 241Am accumulation in an ombrotrophic peatland from Amsterdam Island (Southern Indian Ocean).

    Science.gov (United States)

    Li, Chuxian; Le Roux, Gaël; Sonke, Jeroen; van Beek, Pieter; Souhaut, Marc; Van der Putten, Nathalie; De Vleeschouwer, François

    2017-09-01

    Over the past 50 years, 210 Pb, 137 Cs and 241 Am have been abundantly used in reconstructing recent sediment and peat chronologies. The study of global aerosol-climate interaction is also partially depending on our understanding of 222 Rn- 210 Pb cycling, as radionuclides are useful aerosol tracers. However, in comparison with the Northern Hemisphere, few data are available for these radionuclides in the Southern Hemisphere, especially in the South Indian Ocean. A peat core was collected in an ombrotrophic peatland from the remote Amsterdam Island (AMS) and was analyzed for 210 Pb, 137 Cs and 241 Am radionuclides using an underground ultra-low background gamma spectrometer. The 210 Pb Constant Rate of Supply (CRS) model of peat accumulations is validated by peaks of artificial radionuclides ( 137 Cs and 241 Am) that are related to nuclear weapon tests. We compared the AMS 210 Pb data with an updated 210 Pb deposition database. The 210 Pb flux of 98 ± 6 Bq·m -2 ·y -1 derived from the AMS core agrees with data from Madagascar and South Africa. The elevated flux observed at such a remote location may result from the enhanced 222 Rn activity and frequent rainfall in AMS. This enhanced 222 Rn activity itself may be explained by continental air masses passing over southern Africa and/or Madagascar. The 210 Pb flux at AMS is higher than those derived from cores collected in coastal areas in Argentina and Chile, which are areas dominated by marine westerly winds with low 222 Rn activities. We report a 137 Cs inventory at AMS of 144 ± 13 Bq·m -2 (corrected to 1969). Our data thus contribute to the under-represented data coverage in the mid-latitudes of the Southern Hemisphere. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Holocene glacier activity reconstructed from proglacial lake Gjøavatnet on Amsterdamøya, NW Svalbard

    Science.gov (United States)

    de Wet, Gregory A.; Balascio, Nicholas L.; D'Andrea, William J.; Bakke, Jostein; Bradley, Raymond S.; Perren, Bianca

    2018-03-01

    Well-dated and highly resolved paleoclimate records from high latitudes allow for a better understanding of past climate change. Lake sediments are excellent archives of environmental change, and can record processes occurring within the catchment, such as the growth or demise of an upstream glacier. Here we present a Holocene-length, multi-proxy lake sediment record from proglacial lake Gjøavatnet on the island of Amsterdamøya, northwest Svalbard. Today, Gjøavatnet receives meltwater from the Annabreen glacier and contains a record of changes in glacier activity linked to regional climate conditions. We measured changes in organic matter content, dry bulk density, bulk carbon isotopes, elemental concentrations via Itrax core-scanning, and diatom community composition to reconstruct variability in glacier extent back through time. Our reconstruction indicates that glacially derived sedimentation in the lake decreased markedly at ∼11.1 cal kyr BP, although a glacier likely persisted in the catchment until ∼8.4 cal kyr BP. During the mid-Holocene (∼8.4-1.0 cal kyr BP) there was significantly limited glacial influence in the catchment and enhanced deposition of organic-rich sediment in the lake. The deposition of organic rich sediments during this time was interrupted by at least three multi-centennial intervals of reduced organic matter accumulation (∼5.9-5.0, 2.7-2.0, and 1.7-1.5 cal kyr BP). Considering our chronological information and a sedimentological comparison with intervals of enhanced glacier input, we interpret these intervals not as glacial advances, but rather as cold/dry episodes that inhibited organic matter production in the lake and surrounding catchment. At ∼1.0 cal kyr BP, input of glacially derived sediment to Gjøavatnet abruptly increased, representing the rapid expansion of the Annabreen glacier.

  2. Fire Department Emergency Response

    International Nuclear Information System (INIS)

    Blanchard, A.; Bell, K.; Kelly, J.; Hudson, J.

    1997-09-01

    In 1995 the SRS Fire Department published the initial Operations Basis Document (OBD). This document was one of the first of its kind in the DOE complex and was widely distributed and reviewed. This plan described a multi-mission Fire Department which provided fire, emergency medical, hazardous material spill, and technical rescue services

  3. Salinization may attack you from behind: upconing and related long-term downstream salinization in the Amsterdam Water Supply Dunes (Invited)

    Science.gov (United States)

    Olsthoorn, T.

    2010-12-01

    Groundwater from the Amsterdam Water Supply Dunes (GE: 52.35°N 4.55°E) has been used for the drinking water supply of Amsterdam since 1853. During the first half of the 20th century, severe intrusion and upconing occurred, with many of the wells turning brackish or saline. Already in 1903, the hydrologist/director of the Amsterdam Water Supply, Pennink, predicted this, based on his unique sand-box modeling, which he published in 1915 in the form of a large-size hard-bound book in four languages showing detailed black and white photographs of his tests. This book is now on the web: http://www.citg.tudelft.nl/live/pagina.jsp?id=68e12562-a4d2-489a-b82e-deca5dd32c42&lang=en Pennink devoted much of his work on saltwater upconing below wells, which he so feared. He simulated simultaneous flow of fresh and salt water, using milk to represent the saltwater having about the same density. With our current modeling tools, we can simulate his experiments, allowing to better understand his setup and even to verify our code. Pennink took interest in the way these cones form and in the point at which the salt water enters the screen. Surprizing, at least to many, is that this entry point is not necessarily the screen bottom. Measurements of the salinity distribution in salinized wells in the Amsterdam Water Supply Dune area confirmed this thirty years later when salinzation was severely occurring. The curved cone shape under ambient flow conditions provides part of the explanation why a short-term shut down of a well almost immediately diminishes salt concentrations, but salinization downstream of the wells in case with substantial lateral groundwater flow is not affected. Downstream salinization due to extraction was clearly shown in Pennink's experiments. However, the phenomenon seems still largely unknown or ignored. Downstream salinization also affects downstream heads for years after extraction has stopped. The presentation demonstrates and explains these local and more

  4. Anal infections with concomitant Chlamydia trachomatis genotypes among men who have sex with men in Amsterdam, the Netherlands

    Directory of Open Access Journals (Sweden)

    van der Loeff Maarten

    2011-03-01

    Full Text Available Abstract Background Lymphogranuloma venereum (LGV proctitis is caused by Chlamydia trachomatis (Ct genotype L and is endemic among men who have sex with men (MSM in western society. Genotype L infections need to be distinguished from non-LGV (genotypes A-K Ct infections since they require prolonged antibiotic treatment. For this purpose, an in-house developed pmpH based LGV polymerase chain reaction (PCR test is used at the Amsterdam STI outpatient clinic. We investigated retrospectively the anal Ct genotype distribution, and the frequency of concomitant genotype infections in MSM infected with LGV and non-LGV Ct infections. To detect concomitant Ct genotype infections, the pmpH LGV PCR and genoTyping Reverse Hybridization Assay (Ct-DT RHA were used. Methods A total of 201 Ct positive rectal swabs from MSM were selected, which were previously diagnosed as either LGV (n = 99 or non-LGV Ct infection (n = 102 according to the algorithm of Ct detection by the commercially available Aptima Combo 2 assay followed by an in-house pmpH LGV PCR. The samples were retested with the commercially available Ct-DT RHA, which differentiates between 14 major genotypes and is able to detect concomitant Ct genotypes. Results Excellent genotyping agreement was observed between the Ct-DT RHA and the pmpH LGV PCR (Kappa = 0.900, 95%CI = 0.845-0.955, McNemar's p = 1.000. A concomitant non-LGV genotype was detected in 6/99 (6.1% LGV samples. No additional LGV infections were observed with the Ct-DT RHA among the non-LGV Ct group. In the non-LGV group genotype G/Ga (34.3% was seen most frequent, followed by genotype D/Da (22.5% and genotype J (13.7%. All LGV infections were caused by genotype L2. Conclusions Concomitant non-LGV genotypes do not lead to missed LGV proctitis diagnosis. The pmpH LGV PCR displayed excellent agreement with the commercially available Ct-DT genotyping RHA test. The genotypes G/Ga, D/Da and J were the most frequent non-LGV Ct strains in MSM.

  5. A post audit and inverse modeling in reactive transport: 50 years of artificial recharge in the Amsterdam Water Supply Dunes

    Science.gov (United States)

    Karlsen, R. H.; Smits, F. J. C.; Stuyfzand, P. J.; Olsthoorn, T. N.; van Breukelen, B. M.

    2012-08-01

    SummaryThis article describes the post audit and inverse modeling of a 1-D forward reactive transport model. The model simulates the changes in water quality following artificial recharge of pre-treated water from the river Rhine in the Amsterdam Water Supply Dunes using the PHREEQC-2 numerical code. One observation dataset is used for model calibration, and another dataset for validation of model predictions. The total simulation time of the model is 50 years, from 1957 to 2007, with recharge composition varying on a monthly basis and the post audit is performed 26 years after the former model simulation period. The post audit revealed that the original model could reasonably predict conservative transport and kinetic redox reactions (oxygen and nitrate reduction coupled to the oxidation of soil organic carbon), but showed discrepancies in the simulation of cation exchange. Conceptualizations of the former model were inadequate to accurately simulate water quality changes controlled by cation exchange, especially concerning the breakthrough of potassium and magnesium fronts. Changes in conceptualization and model design, including the addition of five flow paths, to a total of six, and the use of parameter estimation software (PEST), resulted in a better model to measurement fit and system representation. No unique parameter set could be found for the model, primarily due to high parameter correlations, and an assessment of the predictive error was made using a calibration constrained Monte-Carlo method, and evaluated against field observations. The predictive error was found to be low for Na+ and Ca2+, except for greater travel times, while the K+ and Mg2+ error was restricted to the exchange fronts at some of the flow paths. Optimized cation exchange coefficients were relatively high, especially for potassium, but still within the observed range in literature. The exchange coefficient for potassium agrees with strong fixation on illite, a main clay mineral in

  6. Department of Transportation

    Science.gov (United States)

    ... of Drone Integration Pilot Program MEET THE SECRETARY TRANSPORTATION TUESDAY FEATURED NEWS The Briefing Room Connect With ... Carriers - Get a DOT Number Find Your State Transportation Department 5 Star Automobile Crash Test Ratings Office ...

  7. Department of Business Administrati

    African Journals Online (AJOL)

    USER

    2015-08-20

    Aug 20, 2015 ... Department of Business Administration, Olabisi Onabanjo University, Ago-Iwoye, ... strategy and product performance with a special focus on the food and beverage industry in ... for the actions that the leaders will create in.

  8. Department of Education (DOE)

    Data.gov (United States)

    Social Security Administration — The purpose of this agreement is to assist the U.S. Department of Education in its obligation to ensure that applicants for student financial assistance under Title...

  9. Department of reactor technology

    International Nuclear Information System (INIS)

    1982-04-01

    The general development of the Department of Reacctor Technology at Risoe during 1981 is presented, ant the activities within the major subject fields are described in some detail. Lists of staff, publications, and computer programs are included. (author)

  10. Administering an Academic Department.

    Science.gov (United States)

    Hicks, Donald W.; Sperry, John B.

    1986-01-01

    Clarifies the possible forms of leadership taken by the administrator of an academic department. Discusses such elements as authoritarian leadership, faculty consensus, power and responsibility, input factors, types of decision making, faculty recruiting, and authoritarian versus democratic approach. (CT)

  11. Department of energy technology

    International Nuclear Information System (INIS)

    1983-04-01

    The general development of the Department of Energy Technology at Risoe during 1982 is presented, and the activities within the major subject fields are described in some detail. List of staff, publications and computer programs are included. (author)

  12. Department of Reactor Technology

    DEFF Research Database (Denmark)

    Risø National Laboratory, Roskilde

    The general development of the Department of Reactor Technology at Risø during 1981 is presented, and the activities within the major subject fields are described in some detail. Lists of staff, publications, and computer programs are included.......The general development of the Department of Reactor Technology at Risø during 1981 is presented, and the activities within the major subject fields are described in some detail. Lists of staff, publications, and computer programs are included....

  13. Southeast Indian Ridge Between the Rodriguez Triple Junction and the Amsterdam and Saint-Paul Islands: Detailed Kinematics for the Past 20 m.y.

    Science.gov (United States)

    Royer, Jean-Yves; Schlich, Roland

    1988-11-01

    The Southeast Indian Ridge has the fastest spreading rates of the three mid-oceanic ridge systems of the Indian Ocean and has recorded the movements of Antarctica relative to Australia and India since the Late Cretaceous. New bathymetric and magnetic data have been collected by the R/V Marion Dufresne (1983) and the R/V Jean Charcot (1984), on the western part of this ridge, between the Rodriguez Triple Junction (25.5°S, 70.0°E) and the Amsterdam and Saint-Paul islands (38°S, 78°E). These data bring additional information on the seafloor magnetic pattern produced by the Southeast Indian Ridge during the past 20 m.y. A new tectonic chart is proposed for the area around the Amsterdam and Saint-Paul islands. We have mapped 17 isochrons ranging from anomalies 6 to 1 (20.5-0.7 Ma) based on the compilation of all the data available in this area (25 cruises). Their distribution clearly shows asymmetric features. Reconstructions at short time intervals show that stage poles of rotation describe oscillatory movements along a direction parallel to the Southeast Indian Ridge axis. Observed changes in spreading rates and the stability of the spreading directions since the Miocene support this result.

  14. Holocene multi-proxy environmental reconstruction from lake Hakluytvatnet, Amsterdamøya Island, Svalbard (79.5°N)

    Science.gov (United States)

    Gjerde, Marthe; Bakke, Jostein; D'Andrea, William J.; Balascio, Nicholas L.; Bradley, Raymond S.; Vasskog, Kristian; Ólafsdóttir, Sædis; Røthe, Torgeir O.; Perren, Bianca B.; Hormes, Anne

    2018-03-01

    High resolution proxy records of past climate are sparse in the Arctic due to low organic production that restricts the use of radiocarbon dating and challenging logistics that make data collection difficult. Here, we present a new lake record from lake Hakluytvatnet at Amsterdamøya island (79.5°N), the northwesternmost island on Svalbard. Multi-proxy analyses of lake sediments in combination with geomorphological mapping reveal large environmental shifts that have taken place at Amsterdamøya during the Holocene. A robust chronology has been established for the lake sediment core through 28 AMS radiocarbon ages, and this gives an exceptionally well-constrained age control for a lake at this latitude. The Holocene was a period with large changes in the Hakluytvatnet catchment, and the onset of the Neoglacial (ca. 5 ka) marks the start of modern-day conditions in the catchment. The Neoglacial is characterized by fluctuations in the minerogenic input to the lake as well as internal productivity, and we suggest that these fluctuations are driven by atmospherically forced precipitation changes as well as sea ice extent modulating the amount of moisture that can reach Hakluytvatnet.

  15. Energy Flexibility from Large Prosumers to Support Distribution System Operation—A Technical and Legal Case Study on the Amsterdam ArenA Stadium

    Directory of Open Access Journals (Sweden)

    Dirk Kuiken

    2018-01-01

    Full Text Available To deal with the rising integration of stochastic renewables and energy intensive distributed energy resources (DER to the electricity network, alternatives to expensive network reinforcements are increasingly needed. An alternative solution often under consideration is integrating flexibility from the consumer side to system management. However, such a solution needs to be contemplated from different angles before it can be implemented in practice. To this end, this article considers a case study of the Amsterdam ArenA stadium and its surrounding network where flexibility is expected to be available to support the network in the future. The article studies the technical aspects of using this flexibility to determine to what extent, despite the different, orthogonal goals, the available flexibility can be used by various stakeholders in scenarios with a large load from electric vehicle charging points. Furthermore, a legal study is performed to determine the feasibility of the technical solutions proposed by analysing current European Union (EU and Dutch law and focusing on the current agreements existing between the parties involved. The article shows that flexibility in the network provided by Amsterdam ArenA is able to significantly increase the number of charging points the network can accommodate. Nonetheless, while several uses of flexibility are feasible under current law, the use of flexibility provided by electric vehicles specifically faces several legal challenges in current arrangements.

  16. Doctors of Amsterdam

    NARCIS (Netherlands)

    Mooij, Annet

    2001-01-01

    Holland 's Golden Age of the arts was also a bright era for medical science. Public dissections in the anatomy theatre were a popular attraction, and visitors came from far and wide to view the wonderful anatomy collections of Frederik Ruysch. In the intervening 350 years, every aspect of medicine

  17. Doctors of Amsterdam

    NARCIS (Netherlands)

    Mooij, Annet

    2001-01-01

    Holland 's Golden Age of the arts was also a bright era for medical science. Public dissections in the anatomy theatre were a popular attraction, and visitors came from far and wide to view the wonderful anatomy collections of Frederik Ruysch.In the intervening 350 years, every aspect of medicine

  18. Seroprevalence of hepatitis E virus differs in Dutch and first generation migrant populations in Amsterdam, the Netherlands: a cross-sectional study.

    Science.gov (United States)

    Sadik, S; van Rijckevorsel, G G C; van Rooijen, M S; Sonder, G J B; Bruisten, S M

    2016-11-08

    In the last decade hepatitis E virus (HEV) is increasingly recognized as a cause of acute viral hepatitis in developed countries. HEV is transmitted via the fecal-oral route. In countries like the Netherlands, HEV infection is suspected to be a zoonosis but HEV may also be introduced by migrants. We studied the seroprevalence of HEV among different migrants, mainly Moroccans and Turks, and compared this to that of the native Dutch population in Amsterdam, the Netherlands. Data were obtained from a cross-sectional survey of the adult Amsterdam population performed in 2004; the Amsterdam Health Monitor. A total of 1199 plasma samples were tested for IgG-and IgM antibodies to HEV using the Wantai kit according to instructions of the manufacturer. Basic demographic data (gender, age, country of birth, and age at immigration) were used in the analyses. Hepatitis A virus (HAV) serology data were available from a previous study. The total weighted anti-HEV IgG seroprevalence in the overall Amsterdam population was 26.7 %, based on 1199 samples. In the study population (not-weighted) this HEV seroprevalence was 157/426 (36.9 %) for the Dutch participants and it was 161/257 (62.6 %) for Moroccans, 99/296 (33.4 %) for Turks and 42/220 (19.1 %) for other ethnicities. HEV seroprevalence increased significantly with age. First-generation Moroccan migrants (44.0 %) had a significantly higher weighted HEV seroprevalence than the Dutch participants (29.7 %). In the first generation Turks (20.3 %) and first generation migrants from other countries (16.7 %) this weighted seroprevalence was lower, but this was only significant for the 'other ethnicities'. The median age of migration was significantly higher in the Moroccan and Turkish migrants who were HEV IgG positive versus HEV IgG negative. However, when stratifying for age at time of study, median migration age was only significantly different for HEV sero-status for younger Turks and younger 'other ethnicities'. HEV Ig

  19. Department of Defense perspective

    International Nuclear Information System (INIS)

    Devine, R.

    1985-01-01

    This paper examines radiation instrumentation from the Department of Defense perspective. Radiation survey instruments and calibration, or RADIAC, as it is called in the services, while administratively falling under the Assistant Secretary of Defense for Atomic Energy, has generally been managed at a lower level. The Naval Electronics Systems Command and Army Signal Corp are the two principles in the Department of Defense for RADIAC. The actions of the services are coordinated through the tri-service RADIAC working group, which meets about every year and a half. Several points from this organization are highlighted

  20. Agricultural research department

    International Nuclear Information System (INIS)

    1989-01-01

    The annual report gives a general review of the research work of the department. The acitivities of the year are described in 4 short project reports each followed by a list of publications, posters and lectures. Further, the report gives two review articles on selected subjects related to the work: ''Pea mutants'' and ''Linkage maps''. Included in the report are also a list of the staff members, guest scientists and students, lectures given at the department, and a list of travel- and other activities. (author)

  1. Strengthening Science Departments

    Science.gov (United States)

    Campbell, Todd; Melville, Wayne; Bartley, Anthony

    2012-01-01

    Teachers do not work in a vacuum. They are, in most cases, part of a science department in which teachers and the chairperson have important roles in science education reform. Current reform is shaped by national standards documents that emphasize the pedagogical and conceptual importance of best practices framed by constructivism and focused on…

  2. Department of reactor technology

    International Nuclear Information System (INIS)

    1980-01-01

    The activities of the Department of Reactor Technology at Risoe during 1979 are described. The work is presented in five chapters: Reactor Engineering, Reactor Physics and Dynamics, Heat Transfer and Hydraulics, The DR 1 Reactor, and Non-Nuclear Activities. A list of the staff and of publications is included. (author)

  3. Mining Department computer systems

    Energy Technology Data Exchange (ETDEWEB)

    1979-09-01

    Describes the main computer systems currently available, or being developed by the Mining Department of the UK National Coal Board. They are primarily for the use of mining and specialist engineers, but some of them have wider applications, particularly in the research and development and management statistics fields.

  4. Metallurgy Department publications 1988

    International Nuclear Information System (INIS)

    Schroeder Pedersen, A.; Bilde-Soerensen, J.B.

    1989-08-01

    A presentation (including abstracts) of scientific and technical publications and lectures by the staff of the Metallurgy Department during 1988 is given. The list comprises journal papers, conference papers, reports, lectures and poster presentations in the following catagories: Publications, Lectures and Poster Presentations. (author)

  5. Metallurgy Department publications 1989

    International Nuclear Information System (INIS)

    Horsewell, A.

    1990-08-01

    All publiclations by the staff of the Metallurgy Department during 1989 are listed. This list is divided into three sections as follows: Publications (journal and conference papers, reports); Lectures (public lecture presentations) and Posters (poster presentations at conferences and symposia). Abstracts are included. (author)

  6. The Amsterdam Studies of Acute Psychiatry I (ASAP-I; A prospective cohort study of determinants and outcome of coercive versus voluntary treatment interventions in a metropolitan area

    Directory of Open Access Journals (Sweden)

    Mulder Niels

    2008-05-01

    Full Text Available Abstract Background The overall number of involuntary admissions is increasing in many European countries. Patients with severe mental illnesses more often progress to stages in which acute, coercive treatment is warranted. The number of studies that have examined this development and possible consequences in terms of optimizing health care delivery in emergency psychiatry is small and have a number of methodological shortcomings. The current study seeks to examine factors associated with compulsory admissions in the Amsterdam region, taking into account a comprehensive model with four groups of predictors: patient vulnerability, social support, responsiveness of the health care system and treatment adherence. Methods/Design This paper describes the design of the Amsterdam Study of Acute Psychiatry-I (ASAP-I. The study is a prospective cohort study, with one and two-year follow-up, comparing patients with and without forced admission by means of a selected nested case-control design. An estimated total number of 4,600 patients, aged 18 years and over, consecutively coming into contact with the Psychiatric Emergency Service Amsterdam (PESA are included in the study. From this cohort, a randomly selected group of 125 involuntary admitted subjects and 125 subjects receiving non-coercive treatment are selected for further evaluation and comparison. First, socio-demographic, psychopathological and network characteristics, and prior use of health services will be described for all patients who come into contact with PESA. Second, the in-depth study of compulsory versus voluntary patients will examine which patient characteristics are associated with acute compulsory admission, also taking into account social network and healthcare variables. The third focus of the study is on the associations between patient vulnerability, social support, healthcare characteristics and treatment adherence in a two-year follow-up for patients with or without

  7. Building the image of modern art : the rhetoric of two museums and the representation and canonization of modern art (1935-1975) : the Stedelijk Museum in Amsterdam and the Museum of Modern Art in New York

    NARCIS (Netherlands)

    Leigh, Nana

    2008-01-01

    The Rhetoric of Two Museums and the Representation and Canonization of Modern Art (1935-1975): The Stedelijk Museum in Amsterdam and the Museum of Modern Art in New York Museums of modern art have determined the course of modern art history. Their contributions to the representation and

  8. REPAiR: REsource Management in Peri-urban AReas: Going Beyond Urban Metabolism : D3.3 Process model for the two pilot cases: Amsterdam, the Netherlands & Naples, Italy

    NARCIS (Netherlands)

    Geldermans, R.J.; Wandl, A.; Steenmeijer, M.A.; Furlan, C.; Streefland, Tamara; Formato, E.; Cerreta, Maria; Amenta, L.; Varju, Viktor; Inglese, Pasquale; Iodice, Silvia; Berruti, Gilda; Varju, Viktor; Grünhut, Z; Bodor, Akos; Lovász, Virág; Moticska, Zsombor; Tonini, Davide; Taelman, Sue Ellen

    2018-01-01

    Deliverable 3.3 of Work Package 3 concerns an integrated analysis of the two pilot case studies within the REPAiR project, Amsterdam and Naples, from the vantage point of waste production and processing, and the transition to circular societies. It comprises spatial, social and material flow

  9. Amplified Fragment Length Polymorphism Fingerprinting for Identification of a Core Group of Neisseria gonorrhoeae Transmitters in the Population Attending a Clinic for Treatment of Sexually Transmitted Diseases in Amsterdam, The Netherlands

    OpenAIRE

    Spaargaren, Joke; Stoof, Jeroen; Fennema, Han; Coutinho, Roel; Savelkoul, Paul

    2001-01-01

    Amplified fragment length polymorphism analysis seems well suited for studying the epidemiology of isolates of Neisseria gonorrhoeae obtained from patients attending the Sexually Transmitted Disease Outpatient Clinic in Amsterdam, The Netherlands. It shows potential to identify the core group of transmitters.

  10. Usage of purchased self-tests for HIV and sexually transmitted infections in Amsterdam, the Netherlands: results of population-based and serial cross-sectional studies among the general population and sexual risk groups

    NARCIS (Netherlands)

    Bil, Janneke P.; Prins, Maria; Stolte, Ineke G.; Dijkshoorn, Henriëtte; Heijman, Titia; Snijder, Marieke B.; Davidovich, Udi; Zuure, Freke R.

    2017-01-01

    Objectives There are limited data on the usage of commercially bought self-tests for HIV and other sexually transmitted infections (STIs). Therefore, we studied HIV/STI self-test usage and its determinants among the general population and sexual risk groups between 2007 and 2015 in Amsterdam, the

  11. RH Department Information Meeting

    CERN Multimedia

    HR Department

    2010-01-01

    Dear Colleagues, HR Department would like to invite you to an information meeting which will be held on Thursday 30 September 2010 at 9:30 am in the Main Auditorium (Building 500)* A welcome coffee will be available from 9:00 a.m. The presentation will cover the CERN Competency Model which consists of the technical and behavioral competencies that are intrinsic to our Organization and its application in the various HR processes. This presentation will be followed by a questions & answers session. We look forward to seeing you all on 30 September! Best regards, Anne-Sylvie Catherin Head, Human Resources Department *This meeting will be simultaneously retransmitted and thereafter available at the following address: http://webcast.cern.ch.

  12. The Corporate Marketing Department

    DEFF Research Database (Denmark)

    Ritter, Thomas; Eggert, Andreas; Münkhoff, Eva

    Corporate marketing has been downsized or eliminated in many firms. At the same time, firms that still own a corporate marketing department struggle with organizing and positioning their commercial front‐end. The question arises whether firms need a corporate marketing department, and if so, how...... it can best add value to the firm. Based on a qualitative study among B2B companies, we develop a conceptual framework highlighting the various parental roles through which corporate marketing can contribute to overall firm and business unit performance. In addition, we identify five gaps that restrain...... successful outcomes of corporate marketing activities. In sum, our framework provides important insights on how to successfully organize corporate marketing activities....

  13. A summary on the effectiveness of the Amsterdam memory and attention training for children (Amat-c) in children with brain injury.

    Science.gov (United States)

    Dvorak, Elizabeth; van Heugten, Caroline

    2018-01-01

    To summarise the current research on the effectiveness of the Amsterdam Memory and Attention Training for Children (Amat-c). A literature search was conducted to find articles published about the Amat-c, using PubMed, psychINFO, and PsychBITE databases. Relevant search terms included Amat-c, attention and memory, and childhood ABI. Our literature search identified 7 articles that described 5 separate studies including 61 children in total (mostly TBI). Only one study had a control group. All results indicated positive effects on memory and attention, although in three of the studies, these results were not statistically tested. Positive results were generally maintained six months follow up. This review showed that the Amat-c is effective for treating attention and memory disturbances in children with ABI. However, evidence is limited and training material is outdated. We suggest that the Amat-c should be digitised and implemented in a school setting and further evaluated.

  14. An "ethics of the self" in the novel-cronicle-journal-short story Ana de Amsterdam, by Ana Cássia Rebelo

    Directory of Open Access Journals (Sweden)

    Lilian Reichert Coelho

    2017-11-01

    Full Text Available We present a Reading of the relations between the plurality of Genres collected by Ana Cássia Rebelo, a writer with roots in Portugal, Goa and Moçambique at the same time, in the book Ana de Amsterdam, and the themes dealt. As theoretical bias, we approached to Agamben, Gumbrecht and Barthes. As method, we chose the inductive perspective. As main theoretical notions, we adopted “the ethics of the self”, the production of presence and biografeme. After the mentioned effort, we concluded that boredom insulated from anguish, produced in the core of the Contemporary world, affects the narrator in such a deep way that compels her to take a strong position and highlight her privacy in an obscene way. It allows her to frame her own “self” as a mosaic of Genres and Themes, arised from the relation between the body as materiality and the subjective experience of Reading and Writing.

  15. Anorectal and inguinal lymphogranuloma venereum among men who have sex with men in Amsterdam, The Netherlands: trends over time, symptomatology and concurrent infections.

    Science.gov (United States)

    de Vrieze, Nynke Hesselina Neeltje; van Rooijen, Martijn; Schim van der Loeff, Maarten Franciscus; de Vries, Henry John C

    2013-11-01

    To examine lymphogranuloma venereum (LGV) trends over time among men who have sex with men (MSM) visiting the Amsterdam sexually transmitted infection (STI) clinic; to investigate anal LGV symptomatology; and to examine the positivity and characteristics of anorectal and inguinal LGV. We included MSM consultations from whom a swab (from anorectum, bubo or an genital ulcer) was taken for Chlamydia trachomatis (Ct) screening. Anorectal swabs were taken from all MSM who reported receptive anorectal intercourse in the preceding 6 months. Ct positive samples were further tested with a pmpH PCR to identify L-genovars. Patient symptoms, clinical and anoscopic inflammatory signs, and STI co-infections were noted; Gram-stained anorectal mucosal smears were examined. Between January 2005 and June 2012, 48 570 consultations among MSM were conducted. In 3628/35 650 visits, anorectal Ct infections were diagnosed, including 411 anal LGV (1.2%). Moreover, 65/1649 genital ulcer swabs were Ct positive; 10 were inguinal LGV (0.6%) Since January 2011 a significant increase in the positivity of LGV occurred (p<0.0001). 89 (27.2%) anorectal LGV cases were asymptomatic. HIV prevalence among anorectal LGV cases was significantly higher (p=0.008) than among inguinal LGV cases. STI co-morbidity in anorectal LGV cases remained invariably high during the study period. Since January 2011, LGV positivity in MSM consultations in Amsterdam has risen significantly. The great majority comprise anal LGV; inguinal LGV is rare. Anal LGV is asymptomatic in a quarter of cases. In all MSM with anal Ct infections LGV should be excluded, irrespective of symptoms or inflammatory signs.

  16. Scientific Services Department

    International Nuclear Information System (INIS)

    SSD in the South Western Region employs more than 200 people, of which 90% are scientists or engineers. Their purpose is to understand and clarify the extensive technical issues which arise during the operation of many different types of plant spread over a wide area of Southern England and South Wales. Priority is given to work in terms of its potential value to the Board. This brochure illustrates some aspects of the work of SSD. Based at Regional Headquarters in Bristol, the Department undertakes 'on site' inspection followed by more thorough laboratory examinations for the diagnosis of faults, and carries out selected research activities. Most of this effort is directed towards the three nuclear sites and four large conventional power stations in the Region. (author)

  17. Department of Genetics

    International Nuclear Information System (INIS)

    2000-01-01

    Full text: There are five independent research groups in the Department conducting the following lines of investigations: 1. Regulation of sulfur amino acid metabolism in fungi, focusing on cloning and characterisation of structural and regulatory genes in Aspergillus nidulans. 2. Identification and characterization of S. cerevisiae genes involved in the regulation of tRNA biosynthesis and control of translation fidelity in cytosolic and mitochondrial systems. 3. Mechanism of DNA repair and mutagenesis by using mutations in DNA polymerases, mismatch repair and radiation sensitivity genes to study their influence on the generation of mutations in nondividing, resting cells (adaptive mutations) in S. cerevisiae. 4. Pleiotropic effects of the S. cerevisiae IRR1 gene, particularily on colony formation and sister chromatid cohesion. 5. Regulation of heme synthesis in S. cerevisiae: the analysis of structure-function relationship of ferrochelatase (the last enzyme of the pathway). 6. Role of RSP5 the ubiquitin-protein ligase of S. cerevisiae in protein import to mitochondria and endocytosis of plasma membrane proteins. 7. Molecular analysis of the glucose-6-phosphate dehydrogenase gene in Polish 6-GDP deficient subjects. 8. Genetic and phylogenic studies of the Polish Bison bonasus population with the use of nuclear and mitochondrial markers

  18. The 'Amstel Canal' in Amsterdam Canal construction as part of the medieval reclamation and drainage system of the Western Netherlands wilderness

    Science.gov (United States)

    Abrahamse, Jaap-Evert; Kosian, Menne; Weerts, Henk

    2013-04-01

    Usually, Amsterdam is presented as a river city, with the river Amstel as the trade route towards its hinterland, the IJ sea-branch as the portal to the world and its Dam as a focal point of transshipment and trade. Geomorphological, sedimentological, historical and historical-geographical evidence however, points towards the straight part of the Amstel, now located in Amsterdam, as a drainage canal that was dug in the aftermath of the 'Great Reclamation' of the 11th and 12th centuries. During this period, large parts of the wilderness in Utrecht and Holland were cultivated and put to agricultural use. Prior to the 'Great Reclamations', large oligotrophic (Sphagnum) peat bogs drained by small rivers were characteristic of the entire region. All along the straight Amstel canal, Sphagnum peat is found, which is indicative of the area's former peat bog conditions. The 'Amstel Canal' connected two natural meandering watercourses, one at the north and one at the south of the canal. The soil along both watercourses exists of eutrophic peat, which is indicative of repeated natural flooding. This is a strong indication of the anthropogenous origin of the straight part of the Amstel. The reason for digging the Amstel canal was not to create better trade links; it was a local component of a solution for major regional drainage problems in the provinces of Utrecht and Holland. These problems arose from the silting up of the Rhine rivermouth around 1100AD. Because of this, the precipitation surplus of the entire region could not be drained to the North Sea by this route anymore. This led to increased flooding and subsequently to conflicts between the rulers of Holland and Utrecht. In 1165AD, these conflicts reached a point where the Holy Roman Emperor intervened. The ruling of Barbarossa eventually led to a compromise: Utrecht and Holland redirected the entire drainage system of the region from the North Sea to the Zuiderzee in a concerted effort. This operation consisted of

  19. Comparing policies for children of parents attending hospital emergency departments after intimate partner violence, substance abuse or suicide attempt.

    Science.gov (United States)

    Hoytema van Konijnenburg, Eva M M; Diderich, Hester M; Teeuw, Arianne H; Klein Velderman, Mariska; Oudesluys-Murphy, Anne Marie; van der Lee, Johanna H

    2016-03-01

    To improve identification of child maltreatment, a new policy ('Hague protocol') was implemented in hospitals in The Netherlands, stating that adults attending the hospital emergency department after intimate partner violence, substance abuse or a suicide attempt should be asked whether they care for children. If so, these children are referred to the Reporting Center for Child Abuse and Neglect (RCCAN), for assessment and referrals to support services. An adapted, hospital-based version of this protocol ('Amsterdam protocol') was implemented in another region. Children are identified in the same manner, but, instead of a RCCAN referral, they are referred to the pediatric outpatient department for an assessment, including a physical examination, and referrals to services. We compared results of both protocols to assess how differences between the protocols affect the outcomes on implementation, detection of child maltreatment and referrals to services. Furthermore, we assessed social validity and results of a screening physical examination. We included 212 families from the Amsterdam protocol (cohort study with reports by pediatric staff and parents) and 565 families from the Hague protocol (study of RCCAN records and telephone interviews with parents). We found that the RCCAN identified more maltreatment than pediatric staff (98% versus at least 51%), but referrals to services were similar (82% versus 80% of the total sample) and parents were positive about both interventions. Physical examination revealed signs of maltreatment in 5%. We conclude that, despite the differences, both procedures can serve as suitable methods to identify and refer children at risk for maltreatment. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. BE Department Annual Report 2016

    CERN Document Server

    Collier, Paul; Billen, Ronny; Hatziangeli, Eugenia; Jensen, Erk; Jones, Rhodri; Lamont, Mike; Mackney, Anna; Sollander, Peter; Steerenberg, Rende

    2017-01-01

    The Beams Department hosts the Groups responsible for the beam generation, acceleration, diagnostics, controls and performance optimization for the whole CERN accelerator complex. This Report describes the 2016 highlights for the BE Department.

  1. Department of Molecular Biology

    International Nuclear Information System (INIS)

    2000-01-01

    Full text: The Department's continuing interest is centered on the mechanisms of mutagenesis and DNA repair. Part of the studies concerns the effects of the interdependence of mutator and antimutator genes on the response of E. coli cells to various mutagens. The phenomenon of mutation frequency decline (MFD) was studied and recently distinct response of this system to UV light and to alkylating agents was shown. Studies on the isfA gene, which is involved in the regulation of the SOS response, including its precise localization on the bacterial chromosome, were continued. Also, studies on the mechanism of DNA replication-independent mutagenesis in lambda phage were continued. Halogen light mutagenesis and the role of the hem gene in the near UV and UVA irradiation mutagenesis were investigated. New experimental approaches were adapted to study adaptive mutations. Another part of the studies was focused on the relation between the structure of DNA bases adducts and their coding and mutagenic properties, as well as their properties as substrates for DNA repair enzymes. These studies include instrumental methods, such as NMR, MS, HPLC and GC/MS, to investigate structure and the kinetics of formation and excision of adducts, and organic chemistry methods to synthesize adducts. The coding and mutagenic properties of several oxidized and alkylated bases (including imidazole-ring opened purines) were determined by employing in vitro enzymatic and phage/bacteria systems. The sites of reaction of chloroacetaldehyde, a metabolite of carcinogenic vinyl chloride, with a fragment of human p53 gene, were studied using the method of polymerase fingerprint analysis. Ethenoadducts, the products of the reaction of chloroacetaldehyde with adenine and cytosine, and also products of solvolytic degradation of ethenoadenine, were studied as substrates of various DNA glycosylases. Several purine and pyrimidine derivatives were synthesized and tested as inhibitors of DNA glycosylases

  2. Use of portable exposure meters for comparing mobile phone base station radiation in different types of areas in the cities of Basel and Amsterdam.

    Science.gov (United States)

    Urbinello, Damiano; Huss, Anke; Beekhuizen, Johan; Vermeulen, Roel; Röösli, Martin

    2014-01-15

    Radiofrequency electromagnetic fields (RF-EMF) are highly variable and differ considerably within as well as between areas. Exposure assessment studies characterizing spatial and temporal variation are limited so far. Our objective was to evaluate sources of data variability and the repeatability of daily measurements using portable exposure meters (PEMs). Data were collected at 12 days between November 2010 and January 2011 with PEMs in four different types of urban areas in the cities of Basel (BSL) and Amsterdam (AMS). Exposure from mobile phone base stations ranged from 0.30 to 0.53 V/m in downtown and business areas and in residential areas from 0.09 to 0.41 V/m. Analysis of variance (ANOVA) demonstrated that measurements from various days were highly reproducible (measurement duration of approximately 30 min) with only 0.6% of the variance of all measurements from mobile phone base station radiation being explained by the measurement day and only 0.2% by the measurement time (morning, noon, afternoon), whereas type of area (30%) and city (50%) explained most of the data variability. We conclude that mobile monitoring of exposure from mobile phone base station radiation with PEMs is useful due to the high repeatability of mobile phone base station exposure levels, despite the high spatial variation. © 2013.

  3. Genetic, clinical and pharmacological determinants of out-of-hospital cardiac arrest: rationale and outline of the AmsteRdam Resuscitation Studies (ARREST) registry

    Science.gov (United States)

    Blom, M T; van Hoeijen, D A; Bardai, A; Berdowski, J; Souverein, P C; De Bruin, M L; Koster, R W; de Boer, A; Tan, H L

    2014-01-01

    Introduction Out-of-hospital cardiac arrest (OHCA) is a major public health problem. Recognising the complexity of the underlying causes of OHCA in the community, we aimed to establish the clinical, pharmacological, environmental and genetic factors and their interactions that may cause OHCA. Methods and analysis We set up a large-scale prospective community-based registry (AmsteRdam Resuscitation Studies, ARREST) in which we prospectively include all resuscitation attempts from OHCA in a large study region in the Netherlands in collaboration with Emergency Medical Services. Of all OHCA victims since June 2005, we prospectively collect medical history (through hospital and general practitioner), and current and previous medication use (through community pharmacy). In addition, we include DNA samples from OHCA victims with documented ventricular tachycardia/fibrillation during the resuscitation attempt since July 2007. Various study designs are employed to analyse the data of the ARREST registry, including case–control, cohort, case only and case-cross over designs. Ethics and dissemination We describe the rationale, outline and potential results of the ARREST registry. The design allows for a stable and reliable collection of multiple determinants of OHCA, while assuring that the patient, lay-caregiver or medical professional is not hindered in any way. Such comprehensive data collection is required to unravel the complex basis of OHCA. Results will be published in peer-reviewed journals and presented at relevant scientific symposia. PMID:25332818

  4. Height system connection between island and mainland using a hydrodynamic model: a case study connecting the Dutch Wadden islands to the Amsterdam ordnance datum (NAP)

    Science.gov (United States)

    Slobbe, D. C.; Klees, R.; Verlaan, M.; Zijl, F.; Alberts, B.; Farahani, H. H.

    2018-03-01

    We present an efficient and flexible alternative method to connect islands and offshore tide gauges with the height system on land. The method uses a regional, high-resolution hydrodynamic model that provides total water levels. From the model, we obtain the differences in mean water level (MWL) between tide gauges at the mainland and at the islands or offshore platforms. Adding them to the MWL relative to the national height system at the mainland's tide gauges realizes a connection of the island and offshore platforms with the height system on the mainland. Numerical results are presented for the connection of the Dutch Wadden islands with the national height system (Normaal Amsterdams Peil, NAP). Several choices of the period over which the MWLs are computed are tested and validated. The best results were obtained when we computed the MWL only over the summer months of our 19-year simulation period. Based on this strategy, the percentage of connections for which the absolute differences between the observation- and model-derived MWL differences are ≤ 1 cm is about 34% (46 out of 135 possible leveling connections). In this case, for each Wadden island we can find several connections that allow the transfer of NAP with (sub-)centimeter accuracy.

  5. Department of Nuclear Energy

    International Nuclear Information System (INIS)

    2002-01-01

    Full text: The activities of Department was engaged in the selected topics in nuclear fission reactor science and engineering. Present and future industry competitiveness, economic prosperity and living standards within the world are strongly dependent on maintaining the availability of energy at reasonable prices and with security of supply. Also, protection of man and the environment from the harmful effects of all uses of energy is an important element of the quality of life especially in Europe. It is unrealistic to assume that the technology for renewable (hydro, wind, solar and biomass) available within a 20-30 year perspective could provide the production capacity to replace present use of nuclear power and at the same time substantially reduce the use of fossil fuels, especially when considering that energy demand in industrialized countries can be expected to continue to increase even within a framework of overall energy conservation and continued improvement of efficiency in energy usage. In the area of nuclear fission, we continue support to maintain and develop the competence needed to ensure the safety of existing and future reactors and other nuclear installations. In addition support is given to explore the potential for improving present fission technology from a sustainable development point of view. The focus on advanced modelling of improved reactor and fuel cycle concepts, including supporting experimental research, with a view to improving the utilisation of the inherent energy content of uranium and other nuclear fuels, whilst at the same time reducing the amount of long-lived radioactive waste produced. A common scientific understanding of the frequently used concept of ''reasonable assurance of safety'' for the long-term, post-closure phase of repositories for spent fuel and high-level waste developed in order to ensure reasonably equivalent legal interpretations in environmental impact assessment and licensing procedures. Also, research is

  6. Mechanical engineering department technical review

    International Nuclear Information System (INIS)

    Carr, R.B.; Denney, R.M.

    1981-01-01

    The Mechanical Engineering Department Technical Review is published to: (1) inform the readers of various technical activities within the department, (2) promote exchange of ideas, and (3) give credit to the personnel who are achieving the results. The report is formatted into two parts: technical acievements and publication abstracts. The first is divided into eight sections, one for each division in the department providing the reader with the names of the personnel and the division accomplishing the work

  7. Mechanical Engineering Department. Technical review

    Energy Technology Data Exchange (ETDEWEB)

    Simecka, W.B.; Condouris, R.A.; Talaber, C. (eds.)

    1980-01-01

    The Mechanical Engineering Department Technical Review is published to (1) inform the readers of various technical activities within the Department, (2) promote exchange of ideas, and (3) give credit to the personnel who are achieving the results. The report is formatted into two parts: technical achievements and publication abstracts. The first is divided into eight sections, one for each Division in the Department providing the reader with the names of the personnel and the Division accomplishing the work.

  8. Mechanical Engineering Department technical abstracts

    International Nuclear Information System (INIS)

    Denney, R.M.

    1982-01-01

    The Mechanical Engineering Department publishes listings of technical abstracts twice a year to inform readers of the broad range of technical activities in the Department, and to promote an exchange of ideas. Details of the work covered by an abstract may be obtained by contacting the author(s). Overall information about current activities of each of the Department's seven divisions precedes the technical abstracts

  9. Materials Department. Annual report 1990

    International Nuclear Information System (INIS)

    Horsewell, A.; Hansen, N.

    1991-07-01

    Selected activities of the Materials Department at Risoe National Laboratory during 1990 are described. The work is presented in three chapters: Materials Science, Materials Engineering and Materials Technology. A survey is given of the Department's participation in international collaboration and of its activities within education and training. Furthermore, the main figures outlining the funding and expenditure of the Department are given. Lists of staff members, visiting scientists, publications, lectures and poster presentations are included. (author) 91 refs., 46 ills

  10. Materials Department. Annual report 1991

    International Nuclear Information System (INIS)

    Horsewell, A.; Hansen, N.

    1992-03-01

    Selected activities of the Materials Department at Risoe National Laboratory during 1991 are described. The work is presented in three chapters: Materials Science, Materials Engineering and Materials Technology. A survey is given of the Department's participation in international collaboration and of its activities within education and training. Furthermore, the main figures outlining the funding and expenditure of the Department are given. Lists of staff members, visiting scientists, publications, lectures and poster presentations are included. (au)

  11. Mechanical Engineering Department. Technical review

    International Nuclear Information System (INIS)

    Simecka, W.B.; Condouris, R.A.; Talaber, C.

    1980-01-01

    The Mechanical Engineering Department Technical Review is published to (1) inform the readers of various technical activities within the Department, (2) promote exchange of ideas, and (3) give credit to the personnel who are achieving the results. The report is formatted into two parts: technical achievements and publication abstracts. The first is divided into eight sections, one for each Division in the Department providing the reader with the names of the personnel and the Division accomplishing the work

  12. Department of Theoretical Physics - Overview

    International Nuclear Information System (INIS)

    Kwiecinski, J.

    2000-01-01

    Full text: Research activity of the Department of Theoretical Physics concerns theoretical high-energy and elementary particle physics, intermediate energy particle physics, theoretical nuclear physics, theory of nuclear matter, theory of quark-gluon plasma and of relativistic heavy-ion collisions, theoretical astrophysics and general physics. There is some emphasis on the phenomenological applications of the theoretical research, yet the more formal problems are also considered. The detailed summary of the research projects and of the results obtained in various fields is given in the abstracts. Our Department actively collaborates with other Departments of the Institute as well as with several scientific institutions both in Poland and abroad. In particular members of our Department participate in the EC network which allows mobility of researchers. Several members of our Department have also participated in the research projects funded by the Polish Committee for Scientific Research (KBN). The complete list of grants is listed separately. Besides pure research, members of our Department are also involved in graduate and undergraduate teaching activity both at our Institute as well as at other academic institutions in Cracow. At present five students are working for their Ph.D. or MSc degrees under supervision of the senior members from the Department. We continue our participation at the EC SOCRATES-ERASMUS educational programme which allows exchange of graduate students between our Department and the Department of Physics of the University of Durham in the UK. (author)

  13. Nieuwe vormen, nieuwe inkomsten: over schrijvershonoraria

    NARCIS (Netherlands)

    Kuitert, L.

    2012-01-01

    De opkomst van het digitale boek werd al vanaf het begin argwanend bekeken. E-books zouden het papieren boek verdringen en daarmee ook de boekhandels. Lisa Kuitert, hoogleraar Boekwetenschap aan de Universiteit van Amsterdam, bespreekt niet de gevolgen voor de boekverkopers of uitgevers, maar voor

  14. Introduction: Towards a new architectonic critique

    NARCIS (Netherlands)

    Buijs, G.J.; Jongeneel, R.

    2013-01-01

    8-9 January 2013 at the Vrije Universiteit Amsterdam, a seminar took place bringing together people from various parts of the world, various disciplines, and various academic and non-academic professions — philosophers, economists, theologians, historians, social scientists as well as bankers,

  15. Esperanto: een taal van mij, een taal om van te houden = Esperanto: lingvo malfremda, lingvo amida

    NARCIS (Netherlands)

    Jansen, W.

    2010-01-01

    Onderstaande tekst vormt de artikelversie van mijn op 4 september 2009 gehouden oratie bij de aanvaarding van het bijzonder hoogleraarschap in de interlinguïstiek en het Esperanto aan de Universiteit van Amsterdam (Jansen, 2009). Ten opzichte van de oorspronkelijke oratie is de nu volgende tekst op

  16. SIC Industriemonitor najaar 2003

    NARCIS (Netherlands)

    Brouwer, N.; de Nooij, M.; Pomp, M.

    2003-01-01

    In juni 2000 publiceerde de Stichting voor Economisch Onderzoek (SEO) van de Universiteit van Amsterdam in opdracht van Stichting voor Industriebeleid en Communicatie (SIC) een ontwerp voor een SIC industriemonitor met een voorstel voor de inhoud en de structuur van een dergelijke monitor. Op dat

  17. Indirect Taxes and Public Debt in the 'World of Islam' before 1800

    NARCIS (Netherlands)

    Fritschy, W.; S. Cavaciocchi,

    2008-01-01

    Indirect taxes and public debt in the ‘world of Islam’ before 1800. A comparison of Western and Islamic public finance. Wantje Fritschy – Vrije Universiteit Amsterdam – June 2007 The ‘world of islam’ and ‘the West’ before 1800 seem to have displayed different ‘fiscal values’: not only was it

  18. Waarom wij studenten niet vertellen dat de Griekse cultuur uit ‘Zwart Afrika’ komt

    NARCIS (Netherlands)

    Boter, G.J.; Flinterman, J.J.

    2016-01-01

    The present contribution is an offshoot of a public debate on Afrocentric criticisms of the teaching of Ancient History, held at the Vrije Universiteit Amsterdam in June 2015 (for a video recording of this event see https://www.youtube.com/watch?v=WMu5lncT8OU). We argue that the central tenets of

  19. Soil and worm: on eating as relating

    NARCIS (Netherlands)

    Bertoni, F.

    2013-01-01

    Earthworms and soil combine in an ecotoxicological experiment in the Vrije Universiteit in Amsterdam. To determine the effects of a toxic compound produced by genetically modified broccoli, ecotoxicologists use the earthworm in a standardized test to understand the conditions of the soil. In the

  20. Computer-Assisted Linguistic Analysis of the Peshitta

    NARCIS (Netherlands)

    Roorda, D.; Talstra, Eep; Dyk, Janet; van Keulen, Percy; Sikkel, Constantijn; Bosman, H.J.; Jenner, K.D.; Bakker, Dirk; Volkmer, J.A.; Gutman, Ariel; van Peursen, Wido Th.

    2014-01-01

    CALAP (Computer-Assisted Linguistic Analysis of the Peshitta), a joint research project of the Peshitta Institute Leiden and the Werkgroep Informatica at the Vrije Universiteit Amsterdam (1999-2005) CALAP concerned the computer-assisted analysis of the Peshitta to Kings (Janet Dyk and Percy van

  1. Institutionele repositories: UvA maakt onderzoek beter zichtbaar en toegankelijk

    NARCIS (Netherlands)

    Woutersen-Windhouwer, S.

    2009-01-01

    De UB Amsterdam (UvA) zet zich in om de onderzoeksresultaten van de universiteit toegankelijk te maken. Dat vergroot de impact van het onderzoek en de zichtbaarheid van de wetenschappers. Hiervoor heeft de UB een nieuwe werkwijze opgezet, waarbij ze de wetenschapppers actief benadert. En met succes:

  2. 10 Bel 03.pmd

    African Journals Online (AJOL)

    Owner

    2 maart 2009 ... Congo, de missie en de literatuur: Over David van Reybrouck,. J. G. Schoup en Amaat Vyncke. Jacqueline Bel. Jacqueline Bel is als universitair hoofddocent moderne Nederlandse letterkunde verbonden aan de Vrije. Universiteit in Amsterdam. Zij is onder meer gespecialiseerd in Nederlandse en Vlaamse.

  3. The effects of movement stimulation on activities of daily living performance and quality of life in nursing home residents with dementia: a randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Henskens M

    2018-04-01

    Full Text Available Marinda Henskens,1 Ilse M Nauta,2 Katja T Drost,3 Erik JA Scherder1 1Department of Clinical Neuropsychology, Vrije Universiteit Amsterdam, Amsterdam, the Netherlands; 2Department of Neurology, MS Center Amsterdam, Vrije Universiteit Medical Center, Amsterdam, the Netherlands; 3tanteLouise, Bergen op Zoom, the Netherlands Background: Nursing home (NH residents with dementia experience a reduced quality of life (QoL, in part, due to a dependence in performing activities of daily living (ADL. Stimulating movement is associated with improvements in ADL performance. Therefore, movement stimulating interventions, such as ADL training and exercise, focus on optimizing ADL performance to improve QoL. This study aimed to evaluate the effect of three movement stimulating interventions on QoL and ADL performance in NH residents with dementia. Methods: In this 6-month double parallel randomized controlled trial, the effects of ADL training, a multicomponent aerobic and strength exercise training, and a combined ADL and exercise training were analyzed in 87 NH residents with dementia. The Global Deterioration Scale was used to classify the severity of dementia. Participants were screened at baseline using the 6 minute walk test and Mini-Mental State Examination. The Qualidem, and the Care Dependency Scale and Erlangen ADL test were evaluated at baseline, and after 3 and 6 months to measure QoL and ADL, respectively. Multilevel analyses were adjusted for baseline performance, age, and gender. Results: A 6-month ADL training positively affected overall QoL (p = 0.004 and multiple aspects of QoL, including care relationship (p = 0.004, positive self-image (p = 0.002, and feeling at home (p = 0.001, compared to care-as-usual. No benefits were observed of exercise on QoL. No benefits were observed of a combined ADL and exercise intervention on QoL. No effects were found of the three movement interventions on ADL performance. Conclusion: The results indicate

  4. Emergency Department Management of Trauma

    DEFF Research Database (Denmark)

    MacKenzie, Colin; Lippert, Freddy

    1999-01-01

    Initial assessment and management of severely injured patients may occur in a specialized area of an emergency department or in a specialized area of a trauma center. The time from injury until definitive management is of essence for survival of life-threatening trauma. The initial care delivered...... injured patients after these patients reach a hospital emergency department or a trauma center....

  5. Consumers’ preferences regarding department stores

    NARCIS (Netherlands)

    van Laarhoven, W.; Borgers, A.W.J.; van den Berg, P.E.W.

    2017-01-01

    The main reason for this research was the bankruptcy of one the Dutch oldest and largest chain of department stores at the end of 2015. The main goal of this research is to find what, from a consumers’ perspective, a department store should look like. A four storey (1500 m2 each) building was

  6. Financing Academic Departments of Psychiatry

    Science.gov (United States)

    Liptzin, Benjamin; Meyer, Roger E.

    2011-01-01

    Objective: The authors describe the many financial challenges facing academic departments of psychiatry and the resulting opportunities that may arise. Method: The authors review the history of financial challenges, the current economic situation, and what may lie ahead for academic departments of psychiatry. Results: The current environment has…

  7. Validation of the Amsterdam Dynamic Facial Expression Set--Bath Intensity Variations (ADFES-BIV: A Set of Videos Expressing Low, Intermediate, and High Intensity Emotions.

    Directory of Open Access Journals (Sweden)

    Tanja S H Wingenbach

    Full Text Available Most of the existing sets of facial expressions of emotion contain static photographs. While increasing demand for stimuli with enhanced ecological validity in facial emotion recognition research has led to the development of video stimuli, these typically involve full-blown (apex expressions. However, variations of intensity in emotional facial expressions occur in real life social interactions, with low intensity expressions of emotions frequently occurring. The current study therefore developed and validated a set of video stimuli portraying three levels of intensity of emotional expressions, from low to high intensity. The videos were adapted from the Amsterdam Dynamic Facial Expression Set (ADFES and termed the Bath Intensity Variations (ADFES-BIV. A healthy sample of 92 people recruited from the University of Bath community (41 male, 51 female completed a facial emotion recognition task including expressions of 6 basic emotions (anger, happiness, disgust, fear, surprise, sadness and 3 complex emotions (contempt, embarrassment, pride that were expressed at three different intensities of expression and neutral. Accuracy scores (raw and unbiased (Hu hit rates were calculated, as well as response times. Accuracy rates above chance level of responding were found for all emotion categories, producing an overall raw hit rate of 69% for the ADFES-BIV. The three intensity levels were validated as distinct categories, with higher accuracies and faster responses to high intensity expressions than intermediate intensity expressions, which had higher accuracies and faster responses than low intensity expressions. To further validate the intensities, a second study with standardised display times was conducted replicating this pattern. The ADFES-BIV has greater ecological validity than many other emotion stimulus sets and allows for versatile applications in emotion research. It can be retrieved free of charge for research purposes from the

  8. A Study on Mediation by Offspring BMI in the Association between Maternal Obesity and Child Respiratory Outcomes in the Amsterdam Born and Their Development Study Cohort.

    Science.gov (United States)

    Harskamp-van Ginkel, Margreet W; London, Stephanie J; Magnus, Maria C; Gademan, Maaike G; Vrijkotte, Tanja G

    2015-01-01

    A causal relationship between maternal obesity and offspring asthma is hypothesized to begin during early development, but no underlying mechanism for the found association is identified. We quantitatively examined mediation by offspring body mass index (BMI) in the association of maternal pre-pregnancy BMI on risk of asthma and wheezing during the first 7-8 years of life in a large Amsterdam born birth cohort. For 3185 mother-child pairs, mothers reported maternal pre-pregnancy BMI and offspring outcomes "ever being diagnosed with asthma" and "wheezing in the past 12 months" on questionnaires. We measured offspring height and weight at age 5-6 years. We performed a multivariate log linear regression comparing outcomes in offspring of mothers with different BMI categories. For each category we quantified and tested mediation by offspring BMI and also investigated interaction by parental asthma. At the age of 7-8 years, 8% of the offspring ever had asthma and 7% had current wheezing. Maternal pre-pregnancy obesity was associated with higher risks of asthma (adjusted RR 2.32 (95% CI: 1.49-3.61) and wheezing (adjusted RR 2.16 (95% CI: 1.28-3.64). Offspring BMI was a mediator in the association between maternal BMI and offspring wheezing, but not for asthma. There was no interaction by parental asthma. Maternal pre-pregnancy obesity was associated with higher risks of offspring asthma and wheezing. The association between maternal obesity and offspring wheezing was both direct and indirect (mediated) through the child's own BMI.

  9. Predicting Overall Survival After Stereotactic Ablative Radiation Therapy in Early-Stage Lung Cancer: Development and External Validation of the Amsterdam Prognostic Model

    Energy Technology Data Exchange (ETDEWEB)

    Louie, Alexander V., E-mail: Dr.alexlouie@gmail.com [Department of Radiation Oncology, VU University Medical Center, Amsterdam (Netherlands); Department of Radiation Oncology, London Regional Cancer Program, University of Western Ontario, London, Ontario (Canada); Department of Epidemiology, Harvard School of Public Health, Harvard University, Boston, Massachusetts (United States); Haasbeek, Cornelis J.A. [Department of Radiation Oncology, VU University Medical Center, Amsterdam (Netherlands); Mokhles, Sahar [Department of Cardio-Thoracic Surgery, Erasmus University Medical Center, Rotterdam (Netherlands); Rodrigues, George B. [Department of Radiation Oncology, London Regional Cancer Program, University of Western Ontario, London, Ontario (Canada); Stephans, Kevin L. [Department of Radiation Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, Ohio (United States); Lagerwaard, Frank J. [Department of Radiation Oncology, VU University Medical Center, Amsterdam (Netherlands); Palma, David A. [Department of Radiation Oncology, London Regional Cancer Program, University of Western Ontario, London, Ontario (Canada); Videtic, Gregory M.M. [Department of Radiation Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, Ohio (United States); Warner, Andrew [Department of Radiation Oncology, London Regional Cancer Program, University of Western Ontario, London, Ontario (Canada); Takkenberg, Johanna J.M. [Department of Cardio-Thoracic Surgery, Erasmus University Medical Center, Rotterdam (Netherlands); Reddy, Chandana A. [Department of Radiation Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, Ohio (United States); Maat, Alex P.W.M. [Department of Cardio-Thoracic Surgery, Erasmus University Medical Center, Rotterdam (Netherlands); Woody, Neil M. [Department of Radiation Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, Ohio (United States); Slotman, Ben J.; Senan, Suresh [Department of Radiation Oncology, VU University Medical Center, Amsterdam (Netherlands)

    2015-09-01

    Purpose: A prognostic model for 5-year overall survival (OS), consisting of recursive partitioning analysis (RPA) and a nomogram, was developed for patients with early-stage non-small cell lung cancer (ES-NSCLC) treated with stereotactic ablative radiation therapy (SABR). Methods and Materials: A primary dataset of 703 ES-NSCLC SABR patients was randomly divided into a training (67%) and an internal validation (33%) dataset. In the former group, 21 unique parameters consisting of patient, treatment, and tumor factors were entered into an RPA model to predict OS. Univariate and multivariate models were constructed for RPA-selected factors to evaluate their relationship with OS. A nomogram for OS was constructed based on factors significant in multivariate modeling and validated with calibration plots. Both the RPA and the nomogram were externally validated in independent surgical (n=193) and SABR (n=543) datasets. Results: RPA identified 2 distinct risk classes based on tumor diameter, age, World Health Organization performance status (PS) and Charlson comorbidity index. This RPA had moderate discrimination in SABR datasets (c-index range: 0.52-0.60) but was of limited value in the surgical validation cohort. The nomogram predicting OS included smoking history in addition to RPA-identified factors. In contrast to RPA, validation of the nomogram performed well in internal validation (r{sup 2}=0.97) and external SABR (r{sup 2}=0.79) and surgical cohorts (r{sup 2}=0.91). Conclusions: The Amsterdam prognostic model is the first externally validated prognostication tool for OS in ES-NSCLC treated with SABR available to individualize patient decision making. The nomogram retained strong performance across surgical and SABR external validation datasets. RPA performance was poor in surgical patients, suggesting that 2 different distinct patient populations are being treated with these 2 effective modalities.

  10. Ethnicity and socioeconomic status are related to dietary patterns at age 5 in the Amsterdam born children and their development (ABCD) cohort.

    Science.gov (United States)

    Rashid, Viyan; Engberink, Marielle F; van Eijsden, Manon; Nicolaou, Mary; Dekker, Louise H; Verhoeff, Arnoud P; Weijs, Peter J M

    2018-01-08

    Health inequalities are already present at young age and tend to vary with ethnicity and socioeconomic status (SES). Diet is a major determinant of overweight, and studying dietary patterns as a whole in relation to overweight rather than single nutrients or foods has been suggested. We derived dietary patterns at age 5 and determined whether ethnicity and SES were both related to these dietary patterns. We analysed 2769 validated Food Frequency Questionnaires filled in by mothers of children (5.7 ± 0.5y) in the Amsterdam Born Children and their Development (ABCD) cohort. Food items were reduced to 41 food groups. Energy adjusted intake per food group (g/d) was used to derive dietary patterns using Principal Component Analysis and children were given a pattern score for each dietary pattern. We defined 5 ethnic groups (Dutch, Surinamese, Turkish, Moroccan, other ethnicities) and 3 SES groups (low, middle, high, based on maternal education). Multivariate ANOVA, with adjustment for age, gender and maternal age, was used to test potential associations between ethnicity or SES and dietary pattern scores. Post-hoc analyses with Bonferroni adjustment were used to examine differences between groups. Principal Component Analysis identified 4 dietary patterns: a snacking, full-fat, meat and healthy dietary pattern, explaining 21% of the variation in dietary intake. Ethnicity was related to the dietary pattern scores (p pattern, whereas Turkish children scored high on full-fat and Surinamese children on the meat pattern. SES was related to the snacking, full-fat and meat patterns (p pattern and low on the full-fat pattern. This study indicates that both ethnicity and SES are relevant for dietary patterns at age 5 and may enable more specific nutrition education to specific ethnic and low socioeconomic status target groups.

  11. Validation of the Amsterdam Dynamic Facial Expression Set--Bath Intensity Variations (ADFES-BIV): A Set of Videos Expressing Low, Intermediate, and High Intensity Emotions.

    Science.gov (United States)

    Wingenbach, Tanja S H; Ashwin, Chris; Brosnan, Mark

    2016-01-01

    Most of the existing sets of facial expressions of emotion contain static photographs. While increasing demand for stimuli with enhanced ecological validity in facial emotion recognition research has led to the development of video stimuli, these typically involve full-blown (apex) expressions. However, variations of intensity in emotional facial expressions occur in real life social interactions, with low intensity expressions of emotions frequently occurring. The current study therefore developed and validated a set of video stimuli portraying three levels of intensity of emotional expressions, from low to high intensity. The videos were adapted from the Amsterdam Dynamic Facial Expression Set (ADFES) and termed the Bath Intensity Variations (ADFES-BIV). A healthy sample of 92 people recruited from the University of Bath community (41 male, 51 female) completed a facial emotion recognition task including expressions of 6 basic emotions (anger, happiness, disgust, fear, surprise, sadness) and 3 complex emotions (contempt, embarrassment, pride) that were expressed at three different intensities of expression and neutral. Accuracy scores (raw and unbiased (Hu) hit rates) were calculated, as well as response times. Accuracy rates above chance level of responding were found for all emotion categories, producing an overall raw hit rate of 69% for the ADFES-BIV. The three intensity levels were validated as distinct categories, with higher accuracies and faster responses to high intensity expressions than intermediate intensity expressions, which had higher accuracies and faster responses than low intensity expressions. To further validate the intensities, a second study with standardised display times was conducted replicating this pattern. The ADFES-BIV has greater ecological validity than many other emotion stimulus sets and allows for versatile applications in emotion research. It can be retrieved free of charge for research purposes from the corresponding author.

  12. Vaginal high-risk human papillomavirus infection in a cross-sectional study among women of six different ethnicities in Amsterdam, the Netherlands: the HELIUS study.

    Science.gov (United States)

    Alberts, C J; Vos, R A; Borgdorff, H; Vermeulen, W; van Bergen, J; Bruisten, S M; Geerlings, S E; Snijder, M B; van Houdt, R; Morré, S A; de Vries, H J C; van de Wijgert, J H H M; Prins, M; Schim van der Loeff, M F

    2016-12-01

    In the Netherlands the incidence of cervical cancer is higher among ethnic minority populations compared with the general Dutch population. We investigated the prevalence of, and risk factors associated with, vaginal high-risk human papillomavirus (hrHPV) infection in women of six different ethnicities living in Amsterdam. For this cross-sectional study we selected women aged 18-34 years old of six ethnicities from the large-scale multiethnic HEalthy LIfe in an Urban Setting study. Self-collected vaginal swabs were tested for HPV DNA and genotyped using a highly sensitive PCR and reverse line blot assay (short PCR fragment (SPF)10-PCR DNA enzyme immunoassay/LiPA25-system version-1, delft diagnostic laboratory (DDL)). Participants completed a questionnaire regarding demographics and sexual behaviour. Logistic regression using generalised estimating equations was used to assess risk factors of hrHPV, and to investigate whether prevalence of hrHPV differed among ethnicities. The study population consisted of 592 women with a median age of 27 (IQR: 23-31) years. Dutch and African Surinamese women reported the highest sexual risk behaviour. HrHPV prevalence was highest in the Dutch (40%) followed by the African Surinamese (32%), Turkish (29%), Ghanaian (26%), Moroccan (26%) and South-Asian Surinamese (18%). When correcting for sexual risk behaviour, the odds to be hrHPV-positive were similar for all non-Dutch groups when compared with that of the Dutch group. We found an overall higher hrHPV prevalence and higher sexual risk behaviour in the native Dutch population. Further research is needed to unravel the complex problem concerning cervical cancer disparities, such as differences in participation in the cervical cancer screening programme, or differences in clearance and persistence of hrHPV. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  13. Microplastics en route: Field measurements in the Dutch river delta and Amsterdam canals, wastewater treatment plants, North Sea sediments and biota.

    Science.gov (United States)

    Leslie, H A; Brandsma, S H; van Velzen, M J M; Vethaak, A D

    2017-04-01

    Environmental contamination by plastic particles, also known as 'microplastics', brings synthetic materials that are non-degradable and biologically incompatible into contact with ecosystems. In this paper we present concentration data for this emerging contaminant in wastewater treatment plants (WWTPs) and freshwater and marine systems, reflecting the routes via which these particles can travel and the ecosystems they potentially impact along their path. Raw sewage influents, effluents and sewage sludge from seven municipal WWTPs in the Netherlands contained mean particle concentrations of 68-910L -1 , 51-81L -1 and 510-760kg -1 wet weight (ww), respectively (particle sizes between 10 and 5000μm). Even after treatment, wastewater constitutes a source of microplastic pollution of surface waters, and via biosolids applications in farming and forestry, plastic retained in sewage sludge can be transferred to terrestrial environments. The WWTPs investigated here had a mean microplastics retention efficiency of 72% (s.d. 61%) in the sewage sludge. In the receiving waters of treated and untreated wastewaters, we detected high microplastic levels in riverine suspended particulate matter (1400-4900kg -1 dry weight (dw)) from the Rhine and Meuse rivers. Amsterdam canal water sampled at different urban locations contained microplastic concentrations (48-187L -1 ), similar to those observed in wastewater that is emitted from sewage treatment facilities in the area. At least partial settling of the particles occurs in freshwater as well, as indicated by microplastics in urban canal sediments (species are heavily exposed to plastic particles. Body residues between 10 and 100particlesg -1 dw were measured in benthic macroinvertebrate species inhabiting the Dutch North Sea coast: filter-feeding mussels and oysters (species for human consumption) as well as other consumers in the marine food chain. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Persistence after treatment of pharyngeal gonococcal infections in patients of the STI clinic, Amsterdam, the Netherlands, 2012-2015: a retrospective cohort study.

    Science.gov (United States)

    Hananta, I Putu Yuda; De Vries, Henry John Christiaan; van Dam, Alje P; van Rooijen, Martijn Sebastiaan; Soebono, Hardyanto; Schim van der Loeff, Maarten Franciscus

    2017-11-01

    Infection of Neisseria gonorrhoeae in the pharynx (pharyngeal Ng) is associated with gonococcal transmission and development of antimicrobial resistance. We assessed proportion of and determinants for persistence after treatment of pharyngeal Ng. At the STI clinic of Amsterdam, the Netherlands, females-at-risk and men who have sex with men are routinely screened for pharyngeal Ng using an RNA-based nucleic acid amplification test (NAAT; Aptima Combo 2). Patients with pharyngeal Ng were invited for a test-of-cure (TOC) 7 days after treatment with a 500 mg ceftriaxone intramuscularly. We retrospectively examined medical records of patients with pharyngeal Ng (January 2012-August 2015) who returned for a TOC 7-28 days after treatment. Persistence was defined as a positive NAAT at TOC. Out of 2204 pharyngeal Ng cases recorded in the study period, 781 cases (median time between first treatment and TOC of 8 (IQR 7-12) days) were included in the analysis. Persistence after treatment was found in 36 (4.6%) and was less likely among patients who received ceftriaxone in combination with other antibiotics (vs monotherapy) (adjusted OR (aOR) 0.36, 95% CI 0.12 to 1.04) and with longer time from treatment to TOC (aOR 0.74, 95% CI 0.60 to 0.90, per extra day). In those with a TOC 15-28 days after treatment, Ng persisted in only 1.0% (1/105 cases). A small proportion of pharyngeal Ng persists despite appropriate treatment. Combining ceftriaxone with other antibiotics appears to lead to faster clearance. A TOC for pharyngeal Ng 7 days after treatment may be too soon. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  15. Persistence after treatment of pharyngeal gonococcal infections in patients of the STI clinic, Amsterdam, the Netherlands, 2012–2015: a retrospective cohort study

    Science.gov (United States)

    De Vries, Henry John Christiaan; van Dam, Alje P; van Rooijen, Martijn Sebastiaan; Soebono, Hardyanto; Schim van der Loeff, Maarten Franciscus

    2017-01-01

    Introduction Infection of Neisseria gonorrhoeae in the pharynx (pharyngeal Ng) is associated with gonococcal transmission and development of antimicrobial resistance. We assessed proportion of and determinants for persistence after treatment of pharyngeal Ng. Methods At the STI clinic of Amsterdam, the Netherlands, females-at-risk and men who have sex with men are routinely screened for pharyngeal Ng using an RNA-based nucleic acid amplification test (NAAT; Aptima Combo 2). Patients with pharyngeal Ng were invited for a test-of-cure (TOC) 7 days after treatment with a 500 mg ceftriaxone intramuscularly. We retrospectively examined medical records of patients with pharyngeal Ng (January 2012–August 2015) who returned for a TOC 7–28 days after treatment. Persistence was defined as a positive NAAT at TOC. Results Out of 2204 pharyngeal Ng cases recorded in the study period, 781 cases (median time between first treatment and TOC of 8 (IQR 7–12) days) were included in the analysis. Persistence after treatment was found in 36 (4.6%) and was less likely among patients who received ceftriaxone in combination with other antibiotics (vs monotherapy) (adjusted OR (aOR) 0.36, 95% CI 0.12 to 1.04) and with longer time from treatment to TOC (aOR 0.74, 95% CI 0.60 to 0.90, per extra day). In those with a TOC 15–28 days after treatment, Ng persisted in only 1.0% (1/105 cases). Conclusion A small proportion of pharyngeal Ng persists despite appropriate treatment. Combining ceftriaxone with other antibiotics appears to lead to faster clearance. A TOC for pharyngeal Ng 7 days after treatment may be too soon. PMID:28822976

  16. Validation of the Amsterdam Dynamic Facial Expression Set – Bath Intensity Variations (ADFES-BIV): A Set of Videos Expressing Low, Intermediate, and High Intensity Emotions

    Science.gov (United States)

    Wingenbach, Tanja S. H.

    2016-01-01

    Most of the existing sets of facial expressions of emotion contain static photographs. While increasing demand for stimuli with enhanced ecological validity in facial emotion recognition research has led to the development of video stimuli, these typically involve full-blown (apex) expressions. However, variations of intensity in emotional facial expressions occur in real life social interactions, with low intensity expressions of emotions frequently occurring. The current study therefore developed and validated a set of video stimuli portraying three levels of intensity of emotional expressions, from low to high intensity. The videos were adapted from the Amsterdam Dynamic Facial Expression Set (ADFES) and termed the Bath Intensity Variations (ADFES-BIV). A healthy sample of 92 people recruited from the University of Bath community (41 male, 51 female) completed a facial emotion recognition task including expressions of 6 basic emotions (anger, happiness, disgust, fear, surprise, sadness) and 3 complex emotions (contempt, embarrassment, pride) that were expressed at three different intensities of expression and neutral. Accuracy scores (raw and unbiased (Hu) hit rates) were calculated, as well as response times. Accuracy rates above chance level of responding were found for all emotion categories, producing an overall raw hit rate of 69% for the ADFES-BIV. The three intensity levels were validated as distinct categories, with higher accuracies and faster responses to high intensity expressions than intermediate intensity expressions, which had higher accuracies and faster responses than low intensity expressions. To further validate the intensities, a second study with standardised display times was conducted replicating this pattern. The ADFES-BIV has greater ecological validity than many other emotion stimulus sets and allows for versatile applications in emotion research. It can be retrieved free of charge for research purposes from the corresponding author

  17. Department

    African Journals Online (AJOL)

    USER

    2016-01-13

    Jan 13, 2016 ... component was developed as the backend with a front end developed using VB. ... The system proved that with user oriented GIS system it is possible to develop tools that can ..... as the graphical user interface (GUI) where.

  18. Department

    African Journals Online (AJOL)

    USER

    2017-05-25

    May 25, 2017 ... 15), frequent contact with extension agents (2.183) and access to training (2.083) had high propensity to .... Methodology. Sampling Technique .... Perception. Biosecurity Principles. Weighted score. Weighted. Mean. Remark.

  19. Depart

    African Journals Online (AJOL)

    USER

    2016-05-06

    May 6, 2016 ... examine the adaptation to water resource including water for domestic use, agricultural use, and ... the climate system (internal variability), or variations in ... as well as the duration and impact of such variability ... release of greenhouse gases are the major .... In areas of high altitudes (Jos plateau. (606m).

  20. Department

    African Journals Online (AJOL)

    USER

    2016-01-13

    Jan 13, 2016 ... The quality of planning and decision making in the ... Geographic Information Systems (GIS) tools and support systems should ... Techniques such as buffering were incorporated in the system to allow users to .... Water points.

  1. Depart

    African Journals Online (AJOL)

    USER

    2017-01-26

    Jan 26, 2017 ... Hence, informal automobile workshops can spring up beside, behind or within any ... The study therefore, recommends the establishment of mechanic complex, organization and .... roads to catch the next available customers ...

  2. Department

    African Journals Online (AJOL)

    USER

    2014-09-08

    Sep 8, 2014 ... Ethiopian Journal of Environmental Studies & Management 7(5): 572 – 580, 2014. ISSN:1998-0507 ... during the slack period of rain-fed agriculture. In spite of the ... be as a result of fact that operation of the irrigation farming ...

  3. Department of Theoretical Physics - Overview

    International Nuclear Information System (INIS)

    Kwiecinski, J.

    2002-01-01

    Full text: Research activity of the Department of Theoretical Physics concerns theoretical high energy and elementary particle physics, intermediate energy particle physics, theoretical nuclear physics, theory of nuclear matter, theory of quark-gluon plasma and of relativistic heavy ion collisions, theoretical astrophysics and general physics. There is some emphasis on the phenomenological applications of the theoretical research yet the more formal problems are also considered. The detailed summary of the research projects and of the results obtained in various fields is given in the abstracts. Our Department successfully collaborates with other Departments of the Institute as well as with several scientific institutions both in Poland and abroad. In particular, members of our Department participate in the EC network which allows for the mobility of researchers. Several members of our Department have also participated in the research projects funded by the State Committee for Scientific Research. Besides pure research, members of our Department are also involved in graduate and undergraduate teaching activity both at our Institute and at other academic institutions in Cracow. At present, eight students are working towards their Ph.D. degrees under the supervision of senior members of the Department. (author)

  4. Department of Theoretical Physics - Overview

    International Nuclear Information System (INIS)

    Kwiecinski, J.

    2001-01-01

    Full text: Research activity of the Department of Theoretical Physics concerns theoretical high-energy and elementary particle physics, intermediate energy particle physics, theoretical nuclear physics, theory of nuclear matter, theory of quark-gluon plasma and relativistic heavy-ion collisions, theoretical astrophysics and general physics. There is some emphasis on the phenomenological applications of the theoretical research yet more formal problems are also considered. A detailed summary of the research projects and of the results obtained in various field is given in the abstracts. Our Department actively collaborates with other Departments of the Institute as well as with several scientific institutions both in Poland and abroad. In particular, members of our Department participate in the EC network, which stimulates the mobility of researchers. Several members of our Department also participated in the research projects funded by the Polish Committee for Scientific Research (KBN). Besides pure research, members of our Department are also involved in graduate and up graduate teaching activity at our Institute as well as at other academic institution in Cracow. At present nine students are working on their Ph.D. degrees under the supervision of senior members of the Department. (author)

  5. Department of Theoretical Physics - Overview

    International Nuclear Information System (INIS)

    Kwiecinski, J.

    1999-01-01

    Full text: Research activity of the Department of Theoretical Physics concerns theoretical high-energy and elementary particle physics, intermediate energy particle physics, theoretical nuclear physics, theory of nuclear matter, theory of quark-gluon plasma and of relativistic heavy-ion collisions, theoretical astrophysics and general physics. There is some emphasis on the phenomenological applications of the theoretical research yet the more formal problems are also considered. The detailed summary of the research projects and of the results obtained in various fields is given in the abstracts. Our Department actively collaborates with other Departments of the Institute as well as with several scientific institutions both in Poland and abroad. In particular members of our Department participate in the EC network which allows mobility of researchers. Several members of our Department have also participated in the research projects funded by the Polish Committee for Scientific Research (KBN). The complete list of grants is listed separately. Besides pure research, members of our Department are also involved in graduate and undergraduate teaching activity both at our Institute as well as at other academic institutions in Cracow. At present five PhD students are working for their degree under supervision of the senior members from the Department. In the last year we have completed our active participation in the educational TEMPUS programme funded by the European Communities. This programme has in particular allowed exchange of students between our Department and the Department of Physics of the University of Durham in the United Kingdom. In 1998 we joined the SOCRATES - ERASMUS project which will make it possible to continue this exchange. (author)

  6. Annual report 1987 Materials Department

    International Nuclear Information System (INIS)

    1989-01-01

    Review of the activities performed by the Materials Department of the National Atomica Energy Commission of the Argentine Republic during the year 1987. The Department provides services and assistance in all matters related to metallography and special techniques, corrosion and materials' transport, transport phenomena, casting and solidification, damage by radiation, thermomechanical treatments, mechanical properties, fatigue and fracture, multinational project of research and development in materials, VII course on metallurgy and technology of materials. Likewise, information on the Materials Department's staff, its publications, projects and agreements, seminars, courses and conferences during 1987 is included [es

  7. Department of Geography and Environment

    African Journals Online (AJOL)

    USER

    2017-01-30

    Accepted: January 30, 2017. Department of ... and people living around the illegal dump-sites. Kubwa-Abu a area has three ... inherent water content of waste themselves which serves as an ..... Natural Radioactivity in Soil,. Vegetation, and ...

  8. Physics department annual progress report

    International Nuclear Information System (INIS)

    Moeller, H.B.; Lebech, B.

    1980-12-01

    Research in the Physics Department at Risoe covers three main fields: solid-state physics, plasma physics, and meteorology. The principal activities in these fields are presented for the period from 1 January to 31 December 1980. (Auth.)

  9. Department of Psychology, Obafemi Awolo

    African Journals Online (AJOL)

    USER

    2014-11-05

    Accepted: November 05, 2014. Department of Psychology, Obafemi Awolowo University, Ile-Ife, Nigeria ... place attachment, a strong internal locus of control and strong and accessible ..... Scale for Turkish University students. Journal of ...

  10. Mechanical Engineering Department technical abstracts

    International Nuclear Information System (INIS)

    1984-01-01

    The Mechanical Engineering Department publishes abstracts twice a year to inform readers of the broad range of technical activities in the Department, and to promote an exchange of ideas. Details of the work covered by an abstract may be obtained by contacting the author(s). General information about the current role and activities of each of the Department's seven divisions precedes the technical abstracts. Further information about a division's work may be obtained from the division leader, whose name is given at the end of each divisional summary. The Department's seven divisions are as follows: Nuclear Test Engineering Division, Nuclear Explosives Engineering Division, Weapons Engineering Division, Energy Systems Engineering Division, Engineering Sciences Division, Magnetic Fusion Engineering Division and Materials Fabrication Division

  11. Electronics Department. Progress Report 1984

    DEFF Research Database (Denmark)

    Risø National Laboratory, Roskilde

    This report summarizes the activities in the Electronics Department in 1984. These include work under the headings of informatics, applied laser physics, nuclear geophysics, instrumentation and measuring techniques, and instrumentation consulting, registration and maintenance for the Danish...

  12. Creating a Virtual Physics Department.

    Science.gov (United States)

    Suson, Daniel J.; Hewett, Lionel D.; McCoy, Jim; Nelson, Vaughn

    1999-01-01

    Describes a solution to alleviate the low numbers of students graduating from the majority of physics programs throughout the nation. Discusses the outcome of a virtual physics department. (Author/CCM)

  13. Usage of purchased self-tests for HIV and sexually transmitted infections in Amsterdam, the Netherlands: results of population-based and serial cross-sectional studies among the general population and sexual risk groups.

    Science.gov (United States)

    Bil, Janneke P; Prins, Maria; Stolte, Ineke G; Dijkshoorn, Henriëtte; Heijman, Titia; Snijder, Marieke B; Davidovich, Udi; Zuure, Freke R

    2017-09-21

    There are limited data on the usage of commercially bought self-tests for HIV and other sexually transmitted infections (STIs). Therefore, we studied HIV/STI self-test usage and its determinants among the general population and sexual risk groups between 2007 and 2015 in Amsterdam, the Netherlands. Data were collected in four different studies among the general population (S1 - 2) and sexual risk groups (S3 - 4). S1 - Amsterdam residents participating in representative population-based surveys (2008 and 2012; n=6044) drawn from the municipality register; S2 - Participants of a population-based study stratified by ethnicity drawn from the municipality register of Amsterdam (2011-2015; n=17 603); S3 - Men having sex with men (MSM) participating in an HIV observational cohort study (2008 and 2013; n=597) and S4 - STI clinic clients participating in a cross-sectional survey (2007-2012; n=5655). Prevalence of HIV/STI self-test usage and its determinants. The prevalence of HIV/STI self-test usage in the preceding 6-12 months varied between 1% and 2% across studies. Chlamydia self-tests were most commonly used, except among MSM in S3. Chlamydia and syphilis self-test usage increased over time among the representative sample of Amsterdam residents (S1) and chlamydia self-test usage increased over time among STI clinic clients (S4). Self-test usage was associated with African Surinamese or Ghanaian ethnic origin (S2), being woman or MSM (S1 and 4) and having had a higher number of sexual partners (S1-2). Among those in the general population who tested for HIV/STI in the preceding 12 months, 5-9% used a self-test. Despite low HIV/STI self-test usage, we observed increases over time in chlamydia and syphilis self-test usage. Furthermore, self-test usage was higher among high-risk individuals in the general population. It is important to continue monitoring self-test usage and informing the public about the unknown quality of available self-tests in the Netherlands and

  14. Mechanical Engineering Department Technical Review

    International Nuclear Information System (INIS)

    Carr, R.B.; Denney, R.M.

    1981-01-01

    The Mechanical Engineering Department Technical Review is published to inform readers of various technical activities within the Department, promote exchange of ideas, and give credit to personnel who are achieving the results. The report is presented in two parts: technical achievements and publication abstracts. The first is divided into seven sections, each of which reports on an engineering division and its specific activities related to nuclear tests, nuclear explosives, weapons, energy systems, engineering sciences, magnetic fusion, and materials fabrication

  15. [Outsourcing of clinical laboratory department].

    Science.gov (United States)

    Murai, T

    2000-03-01

    Recently, to improve financial difficulties at various hospitals, outsourcing of the laboratory department is be coming more wide spread. At the department of clinical pathology of St. Luke's International Hospital, the system, so called, "Branch labo" which is one of the outsourcing laboratory conditions, was adopted in March 1999. In this reports. We described the decision procedure for accepting the situation and the circumstances of operation.

  16. Departments as Agents of Change

    Science.gov (United States)

    Lagowski, J. J.

    1996-07-01

    Higher education is changing because it has no choice. And, for the most part, outside influences are dictating the processes of change. The more fortunate institutions have had a flat budget during this period, but most have been forced to deal with a declining revenue stream as well. Legislators seem bent on micromanaging state-supported institutions, even as they cut their support. Regulators demand greater institutional accountability. Students and their parents expect more service at lower prices and increased flexibility. Technological advances have dramatically affected the availability and accessibility of extant knowledge. It is no longer a question of whether institutions will change, but rather, who will control the change. Most institutions possess long-standing academic traditions, but these are placed at risk in an increasingly competitive market that holds little sympathy for such traditions and may even see them as obstacles or barriers. As a result, the change agents will undoubtedly have a profound effect on the very nature of academic institutions. From the academic point of view, it would seem prudent to attempt to manage the changes that will inevitably occur. A number of concerned observers, notably the Pew Higher Education Roundtable and the American Association for Higher Education, argue persuasively that the academic department is the logical focus for responding to the current winds of change. Using a marketing metaphor, the academic department has been likened to a "producers' cooperative" of services that consumers seek. Thus, the department should be held accountable for the quality of teaching delivered by its members, for the coherence of its major, for its contributions to the general education curriculum, and for supervising and rewarding its individual faculty members. If departments are to be held accountable, it is surely in their best interest to act in such a way that they are accountable. Expecting academic departments to be

  17. PREFACE: Proceedings of the 25th International Conference on Low Temperature Physics (LT25) (Amsterdam, The Netherlands, 6-13 August 2008) Proceedings of the 25th International Conference on Low Temperature Physics (LT25) (Amsterdam, The Netherlands, 6-13 August 2008)

    Science.gov (United States)

    Kes, Peter; Jochemsen, Reijer

    2009-04-01

    This issue forms part I of the Proceedings of the 25th International Conference on Low Temperature Physics (LT25) (Amsterdam, The Netherlands, 67-13 August 2008). The majority of the special invited lectures, such as the London prize lectures, the international union of pure and applied physics (IUPAP) young scientist award lectures, the plenary, half-plenary and public lectures, and the historical lectures presented at the LT25 conference, are included. The papers relating to the oral and poster presentations will appear in part II of the proceedings in a dedicated open access issue of Journal of Physics: Conference Series (2009 J. Phys.: Conf. Ser. 150). In addition to the organizer's report and a summary of the new developments in low temperature physics, which can also be found in this issue, part II provides useful information about LT25, such as an overview of committees, sponsors, exhibitors, and some conference statistics. To ensure the high publication standard mandated by Journal of Physics: Condensed Matter and Journal of Physics: Conference Series every paper was reviewed by at least one referee before it was accepted for publication. The editors are indebted to many colleagues for invaluable assistance in the preparation and review of 900 papers appearing in both parts I and II of these proceedings. In particular, we would like to thank Carlo Beenakker, Jeroen van den Brink, Hans Brom, Jos de Jongh, Horst Rogalla, Fons de Waele, and Jan Zaanen.

  18. Associations Between Statin Use and Physical Function in Older Adults from The Netherlands and Australia: Longitudinal Aging Study Amsterdam and Australian Longitudinal Study on Women's Health.

    Science.gov (United States)

    van Boheemen, Laurette; Tett, Susan E; Sohl, Evelien; Hugtenburg, Jacqueline G; van Schoor, Natasja M; Peeters, G M E E

    2016-06-01

    Statin therapy may cause myopathy, but long-term effects on physical function are unclear. We investigated whether statin use is associated with poorer physical function in two population-based cohorts of older adults. Data were from 691 men and women (aged 69-102 years in 2005/2006) in the LASA (Longitudinal Aging Study Amsterdam) and 5912 women (aged 79-84 years in 2005) in the ALSWH (Australian Longitudinal Study on Women's Health). Statin use and dose were sourced from containers (LASA) and administrative databases (ALSWH). Physical function was assessed using performance tests, questionnaires on functional limitations and the SF-12 (LASA) and SF-36 (ALSWH) questionnaires. Cross-sectional (both studies) and 3-year prospective associations (ALSWH) were analysed for different statin dosage using linear and logistic regression. In total, 25 % of participants in LASA and 61 % in ALSWH used statins. In the cross-sectional models in LASA, statin users were less likely to have functional limitations (percentage of subjects with at least 1 limitation 63.9 vs. 64.2; odds ratio [OR] 0.6; 95 % confidence interval [CI] 0.3-0.9) and had better SF-12 physical component scores (mean [adjusted] 47.3 vs. 44.5; beta [B] = 2.8; 95 % CI 1.1-4.5); in ALSWH, statin users had better SF-36 physical component scores (mean [adjusted] 37.4 vs. 36.5; B = 0.9; 95 % CI 0.3-1.5) and physical functioning subscale scores (mean [adjusted] 55.1 vs. 52.6; B = 2.4; 95 % CI 1.1-3.8) than non-users. Similar associations were found for low- and high-dose users and in the prospective models. In contrast, no significant associations were found with performance tests. Two databases from longitudinal population studies in older adults gave comparable results, even though different outcome measures were used. In these two large cohorts, statin use was associated with better self-perceived physical function.

  19. A longitudinal study on determinants of HPV vaccination uptake in parents/guardians from different ethnic backgrounds in Amsterdam, the Netherlands

    Directory of Open Access Journals (Sweden)

    Catharina J. Alberts

    2017-02-01

    Full Text Available Abstract Background Human papillomavirus (HPV vaccination coverage in the Netherlands is low (~60% compared to other childhood vaccinations (>90%, and even lower among ethnic minorities. The aim of this study was to explore the possible impact of ethnicity on the determinants of both HPV vaccination intention and HPV vaccination uptake among parents/guardians having a daughter that is invited for the HPV vaccination. Methods In February 2014, parents/guardians living in Amsterdam were invited to complete a questionnaire about social-psychological determinants of their decision making process regarding the HPV vaccination of their daughter and socio-demographic characteristics. This questionnaire was sent approximately one month before the daughter was scheduled to receive her first HPV vaccine dose. Their daughters’ HPV vaccination status was retrieved from the national vaccination database. We distinguished four ethnic groups: Dutch (NL, Surinamese, Netherlands Antillean, and Aruban (SNA, Middle-Eastern and North-African (MENA, and Other. To assess the impact of determinants on both intention and uptake, linear and logistic regression analyses were used respectively. Missing data were imputed using multiple imputation by chained equation. Results In total 1,309 parents/guardians participated (33% participation rate. In all groups we found the mothers’ intention to be the strongest predictor of their daughters’ HPV vaccination uptake. Explained variance of uptake was highest in the NL-group (pseudo-R2:0.56 and lower in the other ethnic groups (pseudo-R2 varied between 0.23 and 0.29. The lower explained variance can be attributed to the relative large proportion of participants with a positive intention that finally did not go for vaccination in the SNA-group (11% and MENA-group (30%. Explained variance (R2 of intention varied between 0.66 and 0.77 across ethnic groups, and was best explained by the proximal social

  20. Reactor Engineering Department annual report

    International Nuclear Information System (INIS)

    1993-09-01

    This report summarizes the research and development activities in the Department of Reactor Engineering during the fiscal year of 1992 (April 1, 1992-March 31, 1993). The major Department's programs promoted in the year are the assessment of the high conversion light water reactor, the design activities of advanced reactor system and development of a high energy proton linear accelerator for the engineering applications including TRU incineration. Other major tasks of the Department are various basic researches on the nuclear data and group constants, the developments of theoretical methods and codes, the reactor physics experiments and their analyses, fusion neutronics, radiation shielding, reactor instrumentation, reactor control/diagnosis, thermohydraulics and technology developments related to the reactor physics facilities. The cooperative works to JAERI's major projects such as the high temperature gas cooled reactor or the fusion reactor and to PNC's fast reactor project were also progressed. The activities of the Research Committee on Reactor Physics are also summarized. (author)

  1. Reactor engineering department annual report

    International Nuclear Information System (INIS)

    1990-09-01

    This report summarizes the research and development activities in the Department of Reactor Engineering during the fiscal year of 1989 (April 1, 1989 - March 31, 1990). One of major Department's programs is the assessment of the high conversion light water reactor and the design activities of advanced reactor system. Development of a high energy proton linear accelerator for the nuclear engineering including is also TRU incineration promoted. Other major tasks of the Department are various basic researches on nuclear data and group constants, theoretical methods and code development, on reactor physics experiments and analyses, fusion neutronics, radiation shielding, reactor instrumentation, reactor control/diagnosis, thermohydraulics, technology assessment of nuclear energy and technology developments related to the reactor physics facilities. The cooperative works to JAERI's major projects such as the high temperature gas cooled reactor or the fusion reactor and to PNC's fast reactor project also progressed. The activities of the Research Committee on Reactor Physics are also summarized. (author)

  2. Reactor Engineering Department annual report

    International Nuclear Information System (INIS)

    Matsuura, S.; Nakahara, Y.; Takano, H.

    1983-09-01

    Research and development activities in the Department of Reactor Engineering in fiscal 1982 are described. The work of the Department is closely related to development of multipurpose Very High Temperature Gas Cooled Reactor and Fusion Reactor, and development of Liquid Metal Fast Breeder Reactor carried out by Power Reactor and Nuclear Fuel Development Corporation. Since fiscal 1982, Systematic research and development work on safeguards technology has been added to the activities of the Department. Contents of the report are achievements in fields such as nuclear data and group constants, theoretical method and code development, integral experiment and analysis, fusion neutronics, shielding, reactor and nuclear instrumentation, reactor control and diagnosis, and safeguards technology, and activities of the Committee on Reactor Physics. (author)

  3. Reactor Engineering Department annual report

    International Nuclear Information System (INIS)

    1985-08-01

    Research and development activities in the Department of Reactor Engineering in fiscal 1984 are described. The work of the Department is closely related to development of multipurpose Very High Temperature Gas Cooled Reactor and Fusion Reactor, and development of Liquid Metal Fast Breeder Reactor carried out by Power Reactor and Nuclear Fuel Development Corporation. Contents of the report are achievements in fields such as nuclear data and group constants, theoretical method and code development, reactor physics experiment and analysis, fusion neutronics, shielding, reactor and nuclear instrumentation, reactor control and diagnosis, safeguards technology, and activities of the Committee on Reactor Physics. (author)

  4. Reactor Engineering Department annual report

    International Nuclear Information System (INIS)

    1984-08-01

    Research and development activities in the Department of Reactor Engineering in fiscal 1983 are described. The work of the Department is closely related to development of multipurpose Very High Temperature Gas Cooled Reactor and Fusion Reactor, and development of Liquid Metal Fast Breeder Reactor carried out by Power Reactor and Nuclear Fuel Development Corporation. Contents of the report are achievements in fields such as nuclear data and group constants, theoretical method and code development, integral experiment and analysis, fusion neutronics, shielding, reactor and nuclear instrumentation, reactor control and diagnosis, and safeguards technology, and activities of the Committee on Reactor Physics. (author)

  5. Emergency Department Management of Trauma

    DEFF Research Database (Denmark)

    MacKenzie, Colin; Lippert, Freddy

    1999-01-01

    services (EMS) response times and advanced prehospital care increase the number of critically injured patients surviving sufficiently long to reach a hospital “in extremis.” Both scenarios provide challenges in the management of traumatized patients. This article addresses the management of severely......Initial assessment and management of severely injured patients may occur in a specialized area of an emergency department or in a specialized area of a trauma center. The time from injury until definitive management is of essence for survival of life-threatening trauma. The initial care delivered...... injured patients after these patients reach a hospital emergency department or a trauma center....

  6. Budgeting in an imaging Department

    International Nuclear Information System (INIS)

    Nyalla, A. M.

    2006-01-01

    budgeting form an integral part of an imaging department. It is a plan to cope with necessary expenses in the future. It involves identifying the needs and income sources required to cover the needs.Covers specific items and time-usually a year and is expressed in monetary terms. The micro budget is put in the macro budget of the hospital. defines financial support for the department. Considers: a fiscal year, projection of patients, types of examinations, type of equipment, monetary exchange, and inflation rate

  7. Department of Chemistry, progress report

    International Nuclear Information System (INIS)

    1989-05-01

    The research activities in Department of Chemistry during the last 3 years from 1986 to 1988 were compiled. The researches and works of Department of Chemistry are mainly those concerned with important basic matters and items which are committed to the further development of the nuclear fuels and materials, to the establishment of the nuclear fuel cycle, and to the acquisition of data for the environmental safety studies. Intensive efforts were also made on chemical analysis service of various fuels and nuclear materials. (author)

  8. Annual Report 1984. Chemistry Department

    DEFF Research Database (Denmark)

    Funck, Jytte; Nielsen, Ole John

    This report contains a brief survey of the main activities in the Chemistry Department. All articles and reports published and lectures given in 1984 are presented. The facilities and equipment are mentioned briefly. The activities are divided into the following groups: radioisotope chemistry, an......, analytical- and organic chemistry, environmental chemistry, polymer chemistry, geochemistry and waste disposal, radical chemistry, positron annihilation, mineral processing, and general.......This report contains a brief survey of the main activities in the Chemistry Department. All articles and reports published and lectures given in 1984 are presented. The facilities and equipment are mentioned briefly. The activities are divided into the following groups: radioisotope chemistry...

  9. Department of Radiation Detectors: Overview

    International Nuclear Information System (INIS)

    Piekoszewski, J.

    1998-01-01

    (full text) Work carried out in 1997 in the Department of Radiation Detectors concentrated on three subjects: (i) Semiconductor Detectors (ii) X-ray Tube Generators (iii) Material Modification using Ion and Plasma Beams. Semiconductor detectors: Semiconductor detectors of ionizing radiation are among the basic tools utilized in such fields of research and industry as nuclear physics, high energy physics, medical (oncology) radiotherapy, radiological protection, environmental monitoring, energy dispersive X-ray fluorescence non-destructive analysis of chemical composition, nuclear power industry. The Department all objectives are: - search for new types of detectors, - adapting modern technologies (especially of industrial microelectronics) to detector manufacturing, - producing unique detectors tailored for physics experiments, - manufacturing standard detectors for radiation measuring instruments, - scientific development of the staff. These 1997 objectives were accomplished particularly by: - research on unique detectors for nuclear physics (e.g. transmission type Si(Li) detectors with extremely thin entrance and exit window), - development of technology of high-resistivity (HRSi) silicon detectors and thermoelectric cooling systems (KBN grant), - study of the applicability of industrial planar technology in producing detectors, - manufacturing detectors developed in previous years, re-generating and servicing customer detectors of various origin. In accomplishing of the above, the Department cooperated with interested groups of physicists from our Institute (P-I and P-II Departments), Warsaw University, Warsaw Heavy Ion Laboratory and with some technology Institutes based in Warsaw (ITME, ITE). Some detectors and services have been delivered to customers on a commercial basis. X-Rat tube generators: The Department conducts research on design and technology of producing X-ray generators based on X-ray tubes of special construction. In 1997, work on a special

  10. The upgraded Amsterdam nuclear microprobe

    International Nuclear Information System (INIS)

    Vis, R.D.; Kramer, J.L.A.M.; Tros, G.H.J.; Langevelde, F. van; Mars, L.

    1993-01-01

    The improvement of the facilities at our University consists of three phases. In phase 1, a 1.7 MV NEC tandem-Pelletron accelerator has been installed. The accelerator serves as injector for two beam lines, subsequently for macro- and micro-analysis. Moreover, an interconnection has been made with a beam line from our 400 kV high voltage Van de Graaff accelerator in order to enable injection of these very intense low energy beams in these two lines. Apart from new vacuum equipment and conventional beam steering and focussing elements, the experimental facilities are replaced from the cyclotron experimental hall to the newly organised experimental hall. In the phases 2 and 3, which are not yet completed, a second ion source for the Pelletron and a new or extended focussing unit for the microprobe will complete the overall operation. (orig.)

  11. Electronics Department progress report 1984

    International Nuclear Information System (INIS)

    1985-11-01

    This report summarizes the activities in the Electronics Department in 1984. These include work under the headings of informatics, applied laser physics, nuclear geophysics, instrumentation and measuring techniques, and instrumentation consulting, registration and maintenance for the Danish Research Council and Risoe National Laboratory. (author)

  12. Annual report 1985 Chemistry Department

    International Nuclear Information System (INIS)

    Funck, J.; Larsen, E.; Nielsen, O.J.

    1986-03-01

    This report contains a brief survey of the main activities in the Chemistry Department. All particles and reports published and lectures given in 1985 are presented. The facilities and equipment are mentioned briefly. The activities are divided into the following groups: radioisotope chemistry, analytical- and organic chemistry, environmental chemistry, polymer chemistry, geochemistry and waste disposal, radical chemistry, positron annihilation, mineral processing, and general. (author)

  13. Electronics Department progress report 1983

    International Nuclear Information System (INIS)

    1984-05-01

    this report summarizes the Electronics Department's activities in 1983. These include work under the headings of man-machine system and operator studies, reliability techniques, application of nuclear techniques to mineral exploration, applied laser physics, computing and, lastly, research instrumentation. (author)

  14. Annual report 1989 Chemistry Department

    International Nuclear Information System (INIS)

    Funck, J.; Neve Larsen, Aa.; Larsen, E.; Nielsen, O.J.

    1990-03-01

    This report contains a brief survey of the main activities in the Chemistry Department. The names and abstracts of all articles and reports published and lectures given in 1989 are presented. The facilities and equipment are mentioned briefly. The activities are divided into the following groups: radioisotope chemistry, analytical- and organic chemistry, environmental chemistry, polymer chemistry, chemical reactivity, mineral processing, and general. (author)

  15. Annual report 1988 Chemistry Department

    International Nuclear Information System (INIS)

    Funck, J.; Neve Larsen, Aa.; Larsen, E.; Nielsen, O.J.

    1989-05-01

    This report contains a brief survey of the main activities in the Chemistry Department. The names and abstracts of all articles and reports published and lectures given in 1988 are presented. The facilities and equipment are mentioned briefly. The activities are divided into the following groups: radioisotope chemistry, analytical- and organic chemistry, environmental chemistry, polymer chemistry, chemical reactivity, mineral processing, and general. (author)

  16. Annual report 1985 Chemistry Department

    International Nuclear Information System (INIS)

    1987-01-01

    This annual report describes the activities carried out in 1985 by the Chemistry Department in the following fields: Chemistry, Inorganic Chemistry, Physicochemistry (Interphases, Surfaces), General Chemical Analysis, Active Materials Analysis, X Ray Fluorescence Analysis, Mass Spectroscopy (Isotopic Analysis, Instrumentation) and Optical Spectroscopy. A list of publications is enclosed. (M.E.L.) [es

  17. Annual report 1984 Chemistry Department

    International Nuclear Information System (INIS)

    Funck, J.; Larsen, E.; Nielsen, O.J.

    1985-03-01

    This report contains a brief survey of the main activities in the Chemistry Department. All articles and reports published and lectures given in 1984 are presented. The facilities and equipment are mentioned briefly. The activities are divided into the following groups: radioisotope chemistry, analytical- and organic chemistry , environmental chemistry, polymer chemistry, geochemistry and waste disposal, radical chemistry, positron annihilation, mineral processing, and general. (author)

  18. Physics Department annual progress report

    International Nuclear Information System (INIS)

    Moeller, H.B.; Lebech, B.

    1981-12-01

    Research in the Physics Department at Risoe covers three main fields: solid-state physics; plasma physics; meteorology. The principal activities in these fields are presented in this report, which covers the period from 1 January to 31 December 1981. Introductions to the work in each of the main fields are given in the respective sections of the report. (Auth.)

  19. Annual report 1986 chemistry department

    International Nuclear Information System (INIS)

    Funck, J.; Larsen, E.; Nielsen, O.J.

    1987-03-01

    This report contains a brief survey of the main activities in the Chemistry Department. All articles and reports published and lectures given in 1986 are presented. The facilities and equipment are mentioned briefly. The activities are divided into the following groups: radioisotope chemistry, analytical- and organic chemistry, environmental chemistry, polymer chemistry, radical chemistral, mineral processing, and general. (author)

  20. Department of Material Studies - Overview

    International Nuclear Information System (INIS)

    Werner, Z.

    2007-01-01

    The technology of modifying surfaces of practical-use materials by means of continuous and pulsed energy and particle beams has been intensely studied for more than 20 years. In some fields it is presently utilized on a wide scale in industry. Continuous or pulsed ion and plasma beams play a significant role among various approaches used in this area. The research carried by Department P-IX is centered around the use of two own ion implantation machines (ion implanters) of different kind and several world-wide unique sources of high-intensity intense plasma pulses, utilized jointly with Department P-V. The Department cooperates closely with Forschungszentrum Rossendorf (FZR, Dresden, Germany) in the field of ion-beam-based analytical techniques and the use of unique ion implantation facilities. The main objectives of the Department are: search for new ways of modifying surface properties of solid materials by means of continuous or pulsed ion and plasma beams and implementation of ion implantation technique in national industries as a method of improving the lifetime of machine parts and tools utilized in industry. In 2006 these objectives were accomplished in many ways, particularly by research on: formation of superconducting MgB 2 phases, electrical conductivity in metallic nano-layers produced in oxide insulators (Al 2 O 3 ) by ion implantation, ion implantation as a method of improving mechanical properties of stainless steels without degrading their corrosion resistance, ion implantation/plasma treatment of ceramics aimed at improving their wettability in ceramic-metal joints, methods of controlling wear of ceramic-polymer pairs used in bio-medical applications. The research was conducted in cooperation with Department P-V of IPJ, Institute of Nuclear Chemistry and Technology (Warsaw), Warsaw University of Technology, Institute of Technology of Materials for Electronics (Warsaw), and Institute of Molecular Physics Polish Academy of Sciences (Poznan

  1. Department of Energy multiprogram laboratories

    International Nuclear Information System (INIS)

    1982-09-01

    The Panel recommends the following major roles and missions for the laboratories: perform the Department's national trust fundamental research missions in the physical sciences, including high energy and nuclear physics, and the radiobiological sciences including nuclear medicine; sustain scientific staff core capabilities and specialized research facilities for laboratory research purposes and for use by other Federal agencies and the private sector; perform independent scientific and technical assessment or verification studies required by the Department; and perform generic research and development where it is judged to be in the public interest or where for economic or technical reasons industry does not choose to support it. Organizational efficiencies if implemented by the Department could contribute toward optimal performance of the laboratories. The Panel recommends that a high level official, such as a Deputy Under Secretary, be appointed to serve as Chief Laboratory Executive with authority to help determine and defend the research and development budget, to allocate resources, to decide where work is to be done, and to assess periodically laboratory performance. Laboratory directors should be given substantially more flexibility to deploy resources and to initiate or adapt programs within broad guidelines provided by the Department. The panel recommends the following actions to increase the usefulness of the laboratories and to promote technology transfer to the private sector: establish user groups for all major mission programs and facilities to ensure greater relevance for Department and laboratory efforts; allow the laboratories to do more reimbursable work for others (other Federal agencies, state and local governments, and industry) by relaxing constraints on such work; implement vigorously the recently liberalized patent policy; permit and encourage joint ventures with industry

  2. Department of Material Studies - Overview

    International Nuclear Information System (INIS)

    Werner, Z.

    2009-01-01

    Full text: The technology of modifying surfaces of technological materials by means of continuous and pulsed energy and particle beams has been intensely studied for more than 20 years. In some fields, it is currently utilized on a wide scale in industry. Continuous or pulsed ion and plasma beams play a significant role among various approaches used in this area. The research carried by Department P-IX is centered on applications of our two ion implantation facilities (ion implanters) of different kinds and unique sources of high-intensity intense plasma pulses, operated by the Department of Plasma Physics. The Department cooperates closely with Forschungszentrum Rossendorf (FZR, Dresden, Germany) in the field of analytical ion beam techniques and the use of unique ion implantation facilities. The main objectives of the Department are: · the search for new ways of modifying the surface properties of solid materials by means of continuous or pulsed ion and plasma beams and · the implementation of ion implantation techniques in national industries as a method of improving the lifetime of machine parts and tools utilized in industry. In 2008, research was focused on: · ion implantation/plasma treatment of ceramics aimed at improving their wettability in ceramic-metal joints, · ion beam synthesis and plasma pulse activation of superconducting MgB 2 phases, · cobalt and zirconium inclusions in conducting layers produced in oxide insulators (Al 2 O 3 ) by ion implantation and thermal annealing. Research was conducted in cooperation with Department P-V of IPJ, Institute of Nuclear Chemistry and Technology (Warsaw), Warsaw University of Technology, Institute of Technology of Materials for Electronics (Warsaw), Institute of Molecular Physics, Polish Academy of Sciences (Poznan), Institute of Chemical Physics PAS and Forschungszentrum Rossendorf FZR (Dresden, Germany), as well as with some industrial companies. (author)

  3. Die Fakulteit Teologie (Afd A) aan die Universiteit van Pretoria; Vrae ...

    African Journals Online (AJOL)

    definition is called for and some relevant issues are indicated; an honest evaluation in respect of the political and social context which is reflected in positions adopted, a pastoral compassion which takes note of human misery, cognisance of the

  4. Verkeersveiligheidseffecten van het Haagse verkeerscirculatieplan. In opdracht van Universiteit Utrecht, Institute for Risk Assessment Sciences.

    NARCIS (Netherlands)

    Reurings, M.C.B.

    2010-01-01

    The Hague municipality's traffic circulation plan: its road safety effects. The purpose of the European 6th framework project INTARESE is to develop a methodology for assessing the health risks of policy options. One of the policy areas for which some case studies will be performed is traffic and

  5. MijnOU.nl (proef met een sociale netwerkdienst binnen de Open Universiteit)

    NARCIS (Netherlands)

    Eshuis, Jannes; Hermans, Henry

    2010-01-01

    Doel van het project Mijnou.nl Het ideaal van een volledig gepersonaliseerd startportaal, waarin studenten via een Single Sign On (SSO) toegang vinden tot al het leermateriaal waarop zij rechten hebben verworven, relevante informatie vinden over activiteiten op studiecentra, contacten kunnen

  6. Die verhouding tussen vertroue en diversiteitsklimaat by 'n Suid-Afrikaanse universiteit

    OpenAIRE

    McCallaghan, Sean; Heyns, Marita

    2016-01-01

    Hierdie studie stel ondersoek in na die verwantskap tussen vertroue en die diversiteitsklimaat binne 'n Suid-Afrikaanse tersiêre inrigting. 'n Kwantitatiewe benadering met behulp van 'n nie-waarskynlikheidsgerieflikheidsteekproef (N=350) is gevolg. Die vraelys wat in die studie gebruik is, maak gebruik van 'n kombinasie van drie vooraf-gevalideerde instrumente. Die resultate dui aan dat die werknemers saamstem dat die instelling bereid is tot diversiteitsbestuur en die uitskakeling van diskri...

  7. A safer road environment for cyclists. Proefschrift Technische Universiteit Delft TUD.

    NARCIS (Netherlands)

    Schepers, P.

    2013-01-01

    This thesis focuses on the question of how the road environment (road design and network characteristics) affects road safety for cyclists through effects on risk and exposure to risk. In this thesis, the term ‘road design’ is used to denote the location level (e.g. intersection design) while the

  8. Die sentrale openbaring in die Ou Testament en die Christelike grondslag van die Potchefstroomse Universiteit

    Directory of Open Access Journals (Sweden)

    F.N. Lion-Cachet

    1995-03-01

    Full Text Available The central revelation in the Old Testament and the Christian foundation of the Potchefstoom University. The PU for CHE acknowledges the revelation of God in creation and his Word as its foundation. The issue concerning the focus of the revelation in Scripture is answered in different ways. Looking at the Old Testament from a revelatory-cognitive approach, the LORD’S own disclosure as “I am who I am” (Exodus 3:14 may be a meaningful response. The concept “I am who I am” has a incomprehensible as well as a comprehensible meaning which reveals our knowledge of the LORD in a great diversity (He is God, the Creator, the Saviour, the Holy One, etc.. In addition, Christ proclaimed Himself in the New Testament as "I am ... ”. This central concept opens up the opportunity for a Christian university to do scientific work with the full reality of creation as its object.

  9. Enabling department-scale supercomputing

    Energy Technology Data Exchange (ETDEWEB)

    Greenberg, D.S.; Hart, W.E.; Phillips, C.A.

    1997-11-01

    The Department of Energy (DOE) national laboratories have one of the longest and most consistent histories of supercomputer use. The authors summarize the architecture of DOE`s new supercomputers that are being built for the Accelerated Strategic Computing Initiative (ASCI). The authors then argue that in the near future scaled-down versions of these supercomputers with petaflop-per-weekend capabilities could become widely available to hundreds of research and engineering departments. The availability of such computational resources will allow simulation of physical phenomena to become a full-fledged third branch of scientific exploration, along with theory and experimentation. They describe the ASCI and other supercomputer applications at Sandia National Laboratories, and discuss which lessons learned from Sandia`s long history of supercomputing can be applied in this new setting.

  10. Department of Radiation Detectors: Overview

    International Nuclear Information System (INIS)

    Piekoszewski, J.

    1999-01-01

    Full text: Work carried out in 1998 in the Department of Radiation Detectors concentrated on three subjects: (i) Semiconductor Detectors (ii) X-ray Tube Generators (iii) Material Modification Using Ion and Plasma Beams. SEMICONDUCTOR DETECTORS: Semiconductor detectors of ionizing radiation are among the basic tools utilized in such fields of research and industry as nuclear physics, high energy physics, medical (oncology) radiotherapy, radiological protection, environmental monitoring, energy dispersive X-ray fluorescence non-destructive analysis of chemical composition, nuclear power industry. The departmental objectives are: a search for new types of detectors; producing unique detectors tailored for physics experiments; manufacturing standard detectors for radiation measuring instruments; scientific development of the staff. These objectives were accomplished in 1998 particularly by: research on unique thin silicon detectors for identification of particles in E-ΔE telescopes, modernization of technology of manufacturing Ge(Li) detectors capable of detecting broader range of gamma energies, manufacturing detectors developed in previous years, re-generating and servicing customer detectors of various origin. In accomplishment of the above the Department co-operated with groups of physicists from IPJ, PAN Institute of Physics (Warsaw), and with some technology Institutes based in Warsaw (ITME, ITE). Some detectors and services have been delivered to customers on a commercial basis. X-Ray TUBE GENERATORS: The Department conducts research on design and technology of manufacturing X-ray generators as well as on imaging and dosimetry of X-ray beams. Various models of special construction X-ray tubes and their power supplies are under construction. In 1998 work concentrated on: completing laboratory equipment for manufacturing X-ray tubes and their components, developing technology of manufacturing X-ray tubes and their components, completing a laboratory set-up with

  11. Annual report 1987 Chemistry Department

    International Nuclear Information System (INIS)

    Funck, J.; Larsen, E.; Nielsen, O.J.

    1988-04-01

    This report contains a brief survey of the main activities in the Chemistry Department. The names and abstracts of all articles and reports published and lectures given in 1987 are presented. The facilities and equipment are mentioned briefly. The activities are divided into the following groups: radioisotope chemistry, analytical- and organic chemistry, environmental chemistry, polymer chemistry, radical chemistry, mineral processing, and general. 13 ills., (author)

  12. Advertising Emergency Department Wait Times

    OpenAIRE

    Weiner, Scott G

    2013-01-01

    Advertising emergency department (ED) wait times has become a common practice in the United States. Proponents of this practice state that it is a powerful marketing strategy that can help steer patients to the ED. Opponents worry about the risk to the public health that arises from a patient with an emergent condition self-triaging to a further hospital, problems with inaccuracy and lack of standard definition of the reported time, and directing lower acuity patients to the higher cost ED se...

  13. Annual report 1983 Chemistry Department

    International Nuclear Information System (INIS)

    Funck, J.; Larsen, E.; Nielsen, O.J.

    1984-05-01

    This report contains a brief survey of the main activities in the Chemistry Department. All articles and reports published and lectures given in 1983 are presented. The facilities and equipment are barely mentioned. The activities are divided into nine groups: 1. radioisotope chemistry 2. analytical- and organic chemistry 3. environmental chemistry 4. polymer chemistry 5. geochemistry and waste disposal 6. radical chemstry 7. positron annihilation 8. mineral processing 9. general. (author)

  14. Annual report 1982 chemistry department

    International Nuclear Information System (INIS)

    Larsen, E.; Nielsen, O.J.

    1983-04-01

    The work going on in the Risoe National Laboratory, Chemistry Department is briefly surveyed by a presentation of all articles and reports published in 1982. The facilities and equipment are barely mentioned. The papers are divided into eight activities: 1. neutron activation analysis 2. analytical- and organic chemistry 3. environmental chemistry 4. polymer chemistry 5. geochemistry 6. radical chemistry 7. poitron annihilation 8. uranium process chemistry. (author)

  15. Carel Breytspraak Sr., Purveyor to his Majesty King Louis Napoleon. Breytspraak furniture from the collection of the Royal Palace in Amsterdam

    Directory of Open Access Journals (Sweden)

    Paul van Duin

    2013-06-01

    Full Text Available In 1808, King Louis Napoleon had the town hall of Amsterdam converted to Royal Palace. Besides making the necessary architectural alterations, he ordered hundreds of pieces of furniture and other ornamental objects from local furniture makers, upholsterers, decorators and other suppliers. This collection of Empire furniture, which is still preserved in the palace, is today the largest of its kind outside France. Between 2005 and 2009, these pieces of furniture were restored as part of the wider restoration of the entire palace, a gigantic operation that involved hundreds of restoration experts. A furniture committee made sure that quality and looks remained uniform. During the process the restoration experts and researchers made a full study of the furniture, documenting finds and findings, supplemented with research into the origins, the makers, use, techniques and material. This is unique for the Netherlands. The data, recorded in documentation and restoration reports, offer fresh insights in especially the construction and manufacturing process of Dutch Empire furniture. The discoveries are illustrated by a number of purveyances by Carel Breytspraak Sr. (1769-1810, the best paid furniture maker of the king. The 100 chairs he made for the Grand dining room of the palace are an example of pre-modern serial production. This may be inferred from the varying quality of the wood that was used and from the varying thickness of the seat stretchers, among other things. Furthermore, it turned out that the chairs still had the original stuffing, which was reused after having been restored. One chair still had the original upholstery from the days of Louis Napoleon and this was used as the basis for the current upholstery. The chairs are typical examples of furniture made after French decoration prints, which were undoubtedly provided by the king’s architects. The roll-top desk that Breytspraak made for the king’s bedroom is one of the most unique

  16. Benchmarking in academic pharmacy departments.

    Science.gov (United States)

    Bosso, John A; Chisholm-Burns, Marie; Nappi, Jean; Gubbins, Paul O; Ross, Leigh Ann

    2010-10-11

    Benchmarking in academic pharmacy, and recommendations for the potential uses of benchmarking in academic pharmacy departments are discussed in this paper. Benchmarking is the process by which practices, procedures, and performance metrics are compared to an established standard or best practice. Many businesses and industries use benchmarking to compare processes and outcomes, and ultimately plan for improvement. Institutions of higher learning have embraced benchmarking practices to facilitate measuring the quality of their educational and research programs. Benchmarking is used internally as well to justify the allocation of institutional resources or to mediate among competing demands for additional program staff or space. Surveying all chairs of academic pharmacy departments to explore benchmarking issues such as department size and composition, as well as faculty teaching, scholarly, and service productivity, could provide valuable information. To date, attempts to gather this data have had limited success. We believe this information is potentially important, urge that efforts to gather it should be continued, and offer suggestions to achieve full participation.

  17. Department of Leptonic Interactions - Overview

    International Nuclear Information System (INIS)

    Rybicki, K.

    1999-01-01

    Full text: 1998 was the first full calendar year of the formal existence of our Department which evolved from the Laboratory of Electronic Particle Detectors (originally called Laboratory of Filmless Detectors) founded in 1972. The department is involved in two running experiments (DELPHI at CERN and H1 at DESY) and in one experiment (BELLE at KEK) which will start data taking in 1999. In addition, three department members work for the ATLAS collaboration at CERN. Since the DELPHI experiment will soon be terminated, we are considering future enterprises. One possibility is the TESLA project at DESY (our technicians have been working for several years on the construction and testing of superconducting cavities for the project). Another possibility is the LHC-b experiment at CERN. The main results of work done in 1998 are covered in reports on research. Here we mention only a few highlights. In the DELPHI experiment the cross section for the process e + e - → W + W - has been measured for several energies. Data registered so far allowed determination of the W mass with the accuracy comparable to the Tevatron results. An important role in these measurements has been played by the sophisticated silicon detector to which the Cracow group brought a substantial contribution. The analysis of more H1 data has weakened the indication for an excess of very high Q 2 events reported in 1997. Thus the paper on isolated leptons with very high transverse momenta was formulated even more carefully. In these and in several other studies the topological second level trigger designed, installed and improved by the Cracow-Orsay collaboration was very important. In the BELLE experiment the HALNY system has been designed and installed by our people. The system allows fast readout and filtering of signals from the Silicon Vertex Detector which is crucial for the experiment. One should also mention high-quality carbon-carbon composites produced in collaboration with the High Energy

  18. Department of Leptonic Interactions - Overview

    International Nuclear Information System (INIS)

    Rybicki, K.

    2000-01-01

    Full text: Our Department evolved from the Laboratory of Electronic Particle Detectors (originally called the Laboratory of Filmless Detectors) founded in 1972. The department is involved in three running experiments (DELPHI at CERN, H1 at DESY and BELLE at KEK). In 1999, we joined the LHC-b experiment at CERN. In addition, three department members work part-time for the ATLAS collaboration at CERN and our technicians have been working for several years on the construction and testing of superconducting cavities for the TESLA project. This arrangement provides a neat equilibrium between data producing experiments (2000 is the last year of the DELPHI running) and future projects. The main results of work done in 1999 are covered in reports on research. Here we mention only a few highlights. The first runs of the BELLE experiment have shown that the apparatus and the software can cope with the luminosity of 6 x 10 31 cm -2 s -1 presently available at KEK-B. The DELPHI experiment measured the parameters of the W boson with an accuracy comparable to that of the Tevatron. This allowed still more precise tests of the Standard Model. Some of them, like the determination of the cross sections for the production of Z 0 Z 0 and q(anti)q pairs, were actually done in Cracow. A novel study of p-p and Λ-Λ correlations performed in Cracow showed that the size of the particle emitting region decreases with particle mass. The H1 experiment published the first results on open beauty production at HERA. The cross section seems to be higher than the predictions of Quantum Chromodynamics in the Next-to-Leading Order. The work on a prototype detector for the LHC-b has just started in Cracow. One should also mention high-quality carbon-carbon composites designed and produced in collaboration with the High Energy Physics Detector Construction Group. For the first time, there were as many as 47 papers (fulfilling the highest KBN standard) published in a single year, the members of our

  19. Hazards Control Department 1995 annual report

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, G.W.

    1996-09-19

    This annual report of the Hazards Control Department activities in 1995 is part of the department`s efforts to foster a working environment at Lawrence Livermore National Laboratory (LLNL) where every person desire to work safely.

  20. Department of Hadron Structure - Overview

    International Nuclear Information System (INIS)

    Eskreys, A.

    2000-01-01

    Full Text: The XII Department of the Institute of Nuclear Physics has been involved in 1999 in the following experiments and projects: -ZEUS experiment at HERA (DESY), which covered the main activity of the department. The group from department participating in this experiment consisted of physicists: J. Chwastowski, A. Eskreys, J. Figiel, K. Klimek, K. Olkiewicz, M.B. Przybycien, P. Stopa, M. Zachara, and L. Zawiejski and engineers and technicians: J. Andruszkow, W. Daniluk, B. Dabrowski, P. Jurkiewicz, A. Kotarba, K. Oliwa, W. Wierba, and A. Wlodarczyk; -D0 experiment at TEVATRON (FNAL), USA - one physicist: B. Pawlik from the department was involved in this experiment; -TESLA project at DESY - two engineers: J. Andruszkow and P. Jurkiewicz were participating in this project; -ATLAS project at LHC (CERN) - one physicist: K. Piotrzkowski from the department was participating in this project. 11 physicists and 8 engineers and technicians have been involved in carrying above programs. ZEUS experiment is the continuation of the investigation of e ± p interactions at HERA collider which has started over 10 years ago and has a perspective of another 5 years of activity. The upgrade of HERA and the expected 5-7 fold increase of luminosity makes the physics program very attractive. Cracow group is responsible for upgrade of the luminosity monitor to meet the new working conditions after HERA upgrade. An extended proposal for luminosity measurement after HERA upgrade, including the measurements of the Bremsstrahlung events rates by additional detectors apart from the photon calorimeter (i.e. 6m and 40m electron taggers and luminosity spectrometer), has been prepared and was accepted for realization by the ZEUS collaboration and the DESY Physics Research Committee (PRC). D0 is the (anti)pp experiment carried out at FNAL (Batavia), USA, and is now designed to deliver 100 times higher luminosity than has been achieved so far. In ATLAS project the preparation of the physics

  1. Department of Radiation Detectors - Overview

    International Nuclear Information System (INIS)

    Piekoszewski, J.

    1997-01-01

    Work carried out in 1996 in the Department of Radiation Detectors concentrated on three subjects: (i) Semiconductor Detectors (ii) X-ray Tube Generators (iii) Material Modification Using Ion and Plasma Beams. The Departamental objectives are: a search for new types of detectors, adapting modern technologies (especially of industrial microelectronics) to detector manufacturing, producing unique detectors tailored for physics experiments, manufacturing standard detectors for radiation measuring instruments. These objectives were accomplished in 1996 by: research on unique detectors for nuclear physics (e.g. a spherical set of particle detectors silicon ball), detectors for particle identification), development of technology of high-resistivity silicon detectors HRSi (grant proposal), development of thermoelectric cooling systems (grant proposal), research on p-i-n photodiode-based personal dosimeters, study of applicability of industrial planar technology in producing detectors, manufacturing detectors developed in previous years, re-generating and servicing customer detectors of various origin. The Department conducts research on the design and technology involved in producing X-ray generators based on X-ray tubes of special construction. Various tube models and their power supplies were developed. Some work has also been devoted to the detection and dosimetry of X-rays. X-ray tube generators are applied to non-destructive testing and are components of analytical systems such as: X-ray fluorescence chemical composition analysis, gauges of layer thickness and composition stress measurements, on-line control of processes, others where an X-ray tube may replace a radio-isotope source. In 1996, the Department: reviewed the domestic demand for X-ray generators, developed an X-ray generator for diagnosis of ostheroporosis of human limbs, prepared a grant proposal for the development of a new instrument for radiotherapy, the so-called needle-like X-ray tube. (author)

  2. Department of Radiation Detectors - Overview

    Energy Technology Data Exchange (ETDEWEB)

    Piekoszewski, J. [Soltan Inst. for Nuclear Studies, Otwock-Swierk (Poland)

    1997-12-31

    Work carried out in 1996 in the Department of Radiation Detectors concentrated on three subjects: (i) Semiconductor Detectors (ii) X-ray Tube Generators (iii) Material Modification Using Ion and Plasma Beams. The Departamental objectives are: a search for new types of detectors, adapting modern technologies (especially of industrial microelectronics) to detector manufacturing, producing unique detectors tailored for physics experiments, manufacturing standard detectors for radiation measuring instruments. These objectives were accomplished in 1996 by: research on unique detectors for nuclear physics (e.g. a spherical set of particle detectors silicon ball), detectors for particle identification), development of technology of high-resistivity silicon detectors HRSi (grant proposal), development of thermoelectric cooling systems (grant proposal), research on p-i-n photodiode-based personal dosimeters, study of applicability of industrial planar technology in producing detectors, manufacturing detectors developed in previous years, re-generating and servicing customer detectors of various origin. The Department conducts research on the design and technology involved in producing X-ray generators based on X-ray tubes of special construction. Various tube models and their power supplies were developed. Some work has also been devoted to the detection and dosimetry of X-rays. X-ray tube generators are applied to non-destructive testing and are components of analytical systems such as: X-ray fluorescence chemical composition analysis, gauges of layer thickness and composition stress measurements, on-line control of processes, others where an X-ray tube may replace a radio-isotope source. In 1996, the Department: reviewed the domestic demand for X-ray generators, developed an X-ray generator for diagnosis of ostheroporosis of human limbs, prepared a grant proposal for the development of a new instrument for radiotherapy, the so-called needle-like X-ray tube. (author).

  3. Department of Structural Research - Overview

    International Nuclear Information System (INIS)

    Wasiutynski, T.

    1999-01-01

    Full text: Two main subjects dominated activity of Department of Structural Research this year: dynamics of molecules in condensed matter and magnetic properties of new materials. The former subject is to be understood in a very broad sense. It embraces fast quantum and classical reorientations of small molecules in disordered crystalline phases as well as rather slow motions of large molecules and molecular segments in liquid crystals and polymers. Glassy states occurring in such systems were of particular interest. The magnetic materials studied in our department fall into two categories: canonical substances such as rare earth orthoferrites and the recently discovered molecular magnets. A typical study of a substance in our group consists of a series of experiments involving various complementary methods followed by advanced theoretical and model analysis. The experimental work is performed on great instruments accessible for us owing to the well established network of international cooperations and in great number at our own premises. The main experimental tools of our department are: adiabatic and differential scanning calorimeters, Fourier transformed infrared absorption spectrometer, ac susceptibility/dc magnotemeter and Cahn balance. All of them operate in wide temperature range: 4 - 400 K. Magnetic measurements are carried out in dc field up 56 kOe. An important improvement of out equipment took place last year. New hardware and software were devised to control the calorimetric measurements. Consequently temperature flows as slow as 1 μK/min are now detectable, that makes the calorimeter a perfect tool for the studies of slow relaxational processes in condensed matter. A new option of data acquisition applied to the infrared spectrometer allows one to study the kinetics of phase transformations in real time. The time resolution is of order of few minutes. This is of special importance in the studies of glassy phases which evolve in the time scale of hours

  4. Department of Nuclear Spectroscopy - Overview

    International Nuclear Information System (INIS)

    Styczen, J.

    2002-01-01

    Full text: The Nuclear Spectroscopy Department is the largest department of the Institute. It merges a variety of research groups having been performing investigations with a rich diversity of methods: from pure studies of the structure of nucleus and of nuclear properties through applied nuclear spectroscopy in condensed matter research, to the complex biophysical investigations of biological tissues. The nuclear structure experiments were performed mainly in European Large Scale Facilities (ALPIINFN-Legnaro, VIVITRON-IReS-Strasbourg, JYFL-K100-Cyclotron) with the use of the GASP, EUROBALL IV, RITU systems and with application of ancillary detectors - HECTOR+HELENA, RFD. Some data were obtained with the GAMMASPHERE in USA. Other research has been based on our own instrumentation - VdG, AFM, Dual-Beam-Implanter, PAC, Moessbauer spectrometers etc., in a strong co-operation with Polish and European institutions, of course. The atomic studies were done on the ESR at GSI in Darmastadt. In several pages which follow, some important results of the investigations in the Department are presented. In 2001, Dr hab. Jerzy Dryzek and Dr hab. Adam Maj were granted the Associated Professor positions, and Miss Agnieszka Kulinska and Mrs Maria Kmiecik - the Ph.D. degrees. Dr Kmiecik was also awarded the Henryk Niewodniczanski prize for studies of 147 Eu compound nucleus shape evolution. Some of us became (continued to be) members of International Committees - the PHINUFY (R. Broda), the Steering Committee of RISING at GSI (J. Styczen), the PAC of the VIVITRON at Strasbourg (J. Styczen). We organized an International Conference on Condensed Matter Studies (100 participants), which belonged to the well known series of Zakopane School of Physics. It's Proceedings appeared as a volume of the Acta Physica Polonica A journal. (author)

  5. Violence in the Emergency Department.

    Science.gov (United States)

    Stowell, Keith R; Hughes, Nolan P; Rozel, John S

    2016-12-01

    Violence is common in the emergency department (ED). The ED setting has numerous environmental risk factors for violence, including poor staffing, lack of privacy, overcrowding, and ready availability of nonsecured equipment that can be used as weapons. Strategies can be taken to mitigate the risk of violence toward health care workers, including staff training, changes to the ED layout, appropriate use of security, and policy-level changes. Health care providers in the ED should be familiar with local case law and standards related to the duty to warn third parties when a violent threat is made by a patient. Copyright © 2016 Elsevier Inc. All rights reserved.

  6. Shock in the emergency department

    DEFF Research Database (Denmark)

    Holler, Jon Gitz; Henriksen, Daniel Pilsgaard; Mikkelsen, Søren

    2016-01-01

    BACKGROUND: The knowledge of the frequency and associated mortality of shock in the emergency department (ED) is limited. The aim of this study was to describe the incidence, all-cause mortality and factors associated with death among patients suffering shock in the ED. METHODS: Population...... failures. Outcomes were annual incidence per 100,000 person-years at risk (pyar), all-cause mortality at 0-7, and 8-90 days and risk factors associated with death. RESULTS: We identified 1646 of 438,191 (0.4 %) ED patients with shock at arrival. Incidence of shock increased from 53.8 to 80.6 cases per 100...

  7. Department of Material Studies: Overview

    International Nuclear Information System (INIS)

    Werner, Z.

    2003-01-01

    Full text: The technology of modifying surfaces of industrial-use materials by means of continuous and pulsed energy beams has been intensely studied for more than 20 years. In some fields it is presently utilized on a broad scale in industry. Continuous or pulsed ion and plasma beams play a significant role among various approaches used. Department P-IX (jointly with Department P-V) utilizes some globally unique sources of intense plasma pulses, and jointly with Forschungszentrum Rossendorf (FZR, Dresden, Germany) conducts research on the application of continuous ion beams using FZR and IPJ facilities. The main objectives of the Department are: - a search for new ways of modifying surface properties of solid materials by means of pulsed plasma beams; - the implementation of ion implantation technique in national industries as a method of improving the lifetime of machine parts and tools utilized in industry. In 2002 these objectives were accomplished in many ways, particularly by research on phase changes in steel irradiated with intense pulsed plasma beams, Si-implanted TiN coatings on steel, implantation of high doses of nitrogen into aluminum, and corrosion properties of Ti surfaces alloyed with Pd by implantation and/or plasma pulses. The research was aimed at practical objectives like finding novel hard coatings, improving resistance to high temperature oxidation, reducing friction between NC6 steel-made parts without using a lubricating agent etc. The research was conducted in cooperation with Department P-V of IPJ, Institute of Nuclear Chemistry and Technology (Warsaw), Warsaw University of Technology, Institute of Technology of Materials for Electronics (Warsaw), Forschungszentrum Rossendorf FZR (Dresden, Germany), as well as with some industrial companies. Some research in 2002 was aimed at improving of the rod plasma injector generator used in our lab (the mechanism of electrode erosion during the plasma discharge, ablation of substrate material induced

  8. Justice Department Airline Merger Policy

    Science.gov (United States)

    Farmer, D. A.

    1972-01-01

    Justice Department airline merger policy is developed within the context of the Federal Aviation Act, in which there is an unusually explicit reliance on competition as a means of fulfilling statutory goals. The economics of the airline industry appear to indicate that low concentration and vigorous competition are particularly viable and desirable. Several factors, including existing regulatory policy, create incentives for airlines to merge whether or not an individual merger promotes or conflicts with the public interest. Specific benefits to the public should be identified and shown to clearly outweight the detriments, including adverse competitive impact, in order for airline mergers to be approved.

  9. The Frederic Joliot hospital department

    International Nuclear Information System (INIS)

    1999-02-01

    The Service Hospitalier Frederic Joliot (SHFJ) of the CEA, has got a scientific and a medical mission: to develop techniques allowing the functional study of human organs. The paper presents the main activities of this department: the positron emission tomography to visualize in real time markers in the organism in neurology and cardiology, researches on epilepsy to localize the epileptic centre, the nuclear medicine in cardiology with the use of the gamma photon emission tomography and the radiopharmacology to visualize the drugs effects in the organism. (A.L.B.)

  10. Department of Nuclear Physical Chemistry

    International Nuclear Information System (INIS)

    Mikulski, J.

    1994-01-01

    The research program at the Department of Nuclear Physical Chemistry of the Niewodniczanski Institute of Nuclear Physics is described. The Department consist of three laboratories. First - Laboratory of Physical Chemistry of Separation Processes on which the activity is concentrated on production and separation of neutron deficient isotopes for medical diagnostic. Recently, the main interest was in 111 In which is a promising tracer for cancer diagnostic. To increase the effectiveness of production of indium 111 In the reaction with deuterons on the enriched cadmium target was carried out instead of the previously used one with alpha particles on natural silver. In the second one - Laboratory of Chemistry and Radiochemistry - the systematic studies of physicochemical properties of transition elements in solutions are carried out. The results of the performed experiments were used for the elaboration of new rapid and selective methods for various elements. Some of these results have been applied for separation of trans actinide elements at U-400 cyclotron of JINR Dubna. The third one laboratory -Environmental Radioactivity Laboratory - conducts continuous monitoring of radioactivity contamination of atmosphere. The investigation of different radionuclides concentration in natural environment, mainly in the forest had been carried out

  11. Next HR Department public meeting

    CERN Multimedia

    2016-01-01

    Dear Colleagues, I am pleased to invite you to the next public meeting organized by the HR Department, which will take place on Tuesday 28 June at 3 p.m. in the Council Chamber. A drink will be served after the meeting as of 16:30 This meeting will be the opportunity to revisit the specificities of the Career Structure measures and Benchmark Jobs, what they entail and how they will be implemented, and to answer your questions. This meeting is also important for me on a personal note, as I will bid you farewell, at least for a few years, taking special leave as of 1 August 2016 to take up the position of Director-General for Human Resources at the European Central Bank in Frankfurt.  Should you not be able to attend the meeting, it can also be followed via Webcast and the recording will be made available on Indico. I look forward to meeting you. Best regards, Anne-Sylvie Catherin Head of the Human Resources Department

  12. High Energy Physics Departments - Overview

    International Nuclear Information System (INIS)

    Bartke, J.

    1999-01-01

    Following the tradition, the activities of the seven new units created in 1997 on the basis of the former Department of High Energy Physics are presented under a common header, they are: Department of Particle Theory (Dept 5); Department of Leptonic Interactions (Dept 11); Department of Hadron Structure (Dept 12); Department of High Energy Nuclear Interactions (Dept 13); The ALICE Experiment Laboratory (NAL); The ATLAS Experiment Laboratory (NAT); High Energy Physics Detector Construction Group (PBD). The research covers a variety of problems of the experimental and theoretical high energy particle physics: the hadronic and leptonic interactions with nucleons and nuclei (characteristics of particle production, including heavy quark physics), e + e - interactions and tests of the Standard Model (also radiative corrections), ultrarelativistic heavy ion interactions and search for the quark-gluon plasma, as well as the spectra, composition and interactions of high energy cosmic ray particles. Research on detectors and accelerator components as well as the development of the apparatus for the high energy physics experiments at future accelerators: LHC (CERN, Geneva), RHIC (Brookhaven), B-Factory (KEK, Tsukuba) and TESLA (DESY) is also presented. The technology of new materials with unique properties such as carbon-carbon composites is also worked on from the point of view of their application in high energy physics experiments. The Division is located in a separate building on the campus of the University of Mining and Metallurgy (UMM). This location, close to the Jagiellonian University (JU), facilitates the collaboration with the latter and with the UMM. The joint weekly seminars carried out for nearly 40 years prove this long term tradition. A substantial part of the activities is teaching and training students from the academic community in Cracow. Joint research, teaching and academic training in the high energy physics are carried out within the M. Miesowicz

  13. Department of Particle Theory - Overview

    International Nuclear Information System (INIS)

    Jezabek, M.

    1999-01-01

    Full text: Research performed at the Department of Particle Theory is devoted to fundamental particles and their interactions. These studies are closely related to the current and future high energy experiments at e + e - and hadron-hadron colliders: LEP, TESLA, Tevatron and LHC. The papers reported below cover a wide range of particle physics from neutrino masses and oscillations to processes involving heavy particles like gauge and Higgs bosons or the top quark. An evidence of neutrino oscillations observed by the SuperKamiokande Collaboration was the most spectacular discovery of the year 1998. In a theoretical investigation performed at our department a relation has been found between the so called see-saw mechanism and the bi-maximal neutrino mixing. Since many years a very important and labour-consuming part of the research activities is related to precision tests of the Standard Model. In the last year successful runs of LEP2 stimulated an impressive progress in theoretical description of processes with two- and four-fermion final states in electron-positron annihilation. It is worth stressing that the results of the calculations have been distributed in the form of the computer programs (Monte Carlo and other types) which serve as an indispensable tool in the analysis of the experimental data. Although the whole scientific program is a natural continuation of the activities started earlier a few results obtained in the last year should be mentioned: Publication of the four-fermion Monte Carlo program KORALW for high energy e + e - colliders; Development of the exponentiation scheme at the spin amplitude level and studies of the anomalous couplings for the e + e - → f (anti)f (nγ) processes; Relation between QCD static potentials in momentum and position spaces, and its consequences for bottom and top quark pair production and spectroscopy; Participation in the preparation of the physics program of the pp experiments on LHC collider particularly for Higgs

  14. LECI Department of Nuclear Materials

    International Nuclear Information System (INIS)

    2006-01-01

    The LECI is a 'hot' laboratory dedicated mostly to the characterization of irradiated materials. It has, however, limited activities on fuel, as a back up to the LECA STAR in Cadarache. The LECI belongs to the Section of Research on Irradiated Materials (Department of Nuclear Materials). The Department for Nuclear Materials (DMN) has for its missions: - to contribute, through theoretical and experimental investigations, to the development of knowledge in materials science in order to be able to predict the evolution of the material physical and mechanical properties under service conditions (irradiation, thermomechanical solicitations, influence of the environment,..); - to characterize the properties of the materials used in the nuclear industry in order to determine their performance and to be able to predict their life expectancy, in particular via modelling. These materials can be irradiated or not, and originate from surveillance programs, experimental neutron irradiations or simulated irradiations with charged particles; - to establish, maintain and make use of the databases generated by these data; - to propose new or optimized materials, satisfying future service conditions and extend the life or the competitiveness of the associated systems; - to establish constitutive laws and models for the materials in service, incidental, accidental and storage conditions, and contribute to the development of the associated design codes in order to support the safety argumentation of utilities and vendors; - to provide expertise on industrial components, in particular to investigate strain or rupture mechanisms and to offer leads for improvement. This document presents, first, the purpose of the LECI (Historical data, Strategy, I and K shielded cell lines (building 605), M shielded cell line (building 625), Authorized materials). Then, it presents the microscopy and irradiation damage studies laboratory of the Saclay centre (Building 605) Which belongs to the Nuclear

  15. Advertising emergency department wait times.

    Science.gov (United States)

    Weiner, Scott G

    2013-03-01

    Advertising emergency department (ED) wait times has become a common practice in the United States. Proponents of this practice state that it is a powerful marketing strategy that can help steer patients to the ED. Opponents worry about the risk to the public health that arises from a patient with an emergent condition self-triaging to a further hospital, problems with inaccuracy and lack of standard definition of the reported time, and directing lower acuity patients to the higher cost ED setting instead to primary care. Three sample cases demonstrating the pitfalls of advertising ED wait times are discussed. Given the lack of rigorous evidence supporting the practice and potential adverse effects to the public health, caution about its use is advised.

  16. Advertising Emergency Department Wait Times

    Science.gov (United States)

    Weiner, Scott G.

    2013-01-01

    Advertising emergency department (ED) wait times has become a common practice in the United States. Proponents of this practice state that it is a powerful marketing strategy that can help steer patients to the ED. Opponents worry about the risk to the public health that arises from a patient with an emergent condition self-triaging to a further hospital, problems with inaccuracy and lack of standard definition of the reported time, and directing lower acuity patients to the higher cost ED setting instead to primary care. Three sample cases demonstrating the pitfalls of advertising ED wait times are discussed. Given the lack of rigorous evidence supporting the practice and potential adverse effects to the public health, caution about its use is advised. PMID:23599836

  17. Advertising Emergency Department Wait Times

    Directory of Open Access Journals (Sweden)

    Scott G. Weiner

    2013-03-01

    Full Text Available Advertising emergency department (ED wait times has become a common practice in the UnitedStates. Proponents of this practice state that it is a powerful marketing strategy that can help steerpatients to the ED. Opponents worry about the risk to the public health that arises from a patient withan emergent condition self-triaging to a further hospital, problems with inaccuracy and lack of standarddefinition of the reported time, and directing lower acuity patients to the higher cost ED setting insteadto primary care. Three sample cases demonstrating the pitfalls of advertising ED wait times arediscussed. Given the lack of rigorous evidence supporting the practice and potential adverse effects tothe public health, caution about its use is advised

  18. Next HR Department Public meeting

    CERN Multimedia

    2012-01-01

      Dear Colleagues, I am pleased to invite you to the next public meeting organized by HR Department, which will take place on Monday 25 June at 14:30, for the first time in the Globe (in front of the Reception). The agenda will comprise of: ·         the recent staff member survey results ·         the Diversity at CERN ·         the Learning and Development Policy The first topic concerns, more specifically, staff members. All presentations will be made in English, however, we are pleased to inform you that a simultaneous interpretation in French is foreseen. Should you not be able to attend the meeting, it can also be followed via Webcast and the recording will be made available on Indico. Finally, subject to a favourable weather, refreshments...

  19. Department of Nuclear Reactions - Overview

    International Nuclear Information System (INIS)

    Nowicki, L.

    2006-01-01

    In 2005 the Department held a steady course. Topics of nuclear physics, atomic physics and materials research that started in previous years were continued. Although our team was smaller than years ago, the scientific activity, estimated by number of published papers is still very high. Scientists of the Department are co-authors or authors of more than 50 papers. Nuclear physics, which is our main-stream activity, covered a wide energy range. It started close to the Coulomb barrier, where 6 He breakup on heavy nuclei were studied, and ended at zones of tens of GeV; such high energies were used to investigate spin structure of deuterons and to explore hadron leptoproduction. Traditionally, experimental investigations in the fields of atomic physics and of physics of materials completed the scene. Our old Van de Graaff accelerator Lech was used for studies of M-shell ionisation of heavy elements, for hardening of Ultra-High Molecular Weight Polyethylene and for characterisation of materials with RBS and NRA techniques. The VdG runs perfectly although it is over 40 years old. Two Ph.D. students finished their theses and were promoted. Izabela Fijal's work concerned multi-ionization and intrashell coupling effects for L-shell x-ray emission induced by heavy ions, while Sergiy Mezhevych showed studies on scattering of 11 B from carbon isotopes. It is obvious that contemporary works on physics do not arise in a single lab. Our contributions to many papers were possible due owing to collaborations involving many institutions. Some of them are listed: GSI, Darmstadt (PANDA Collaboration) DESY, Hamburg (HERMES Collaboration) Institut fuer Kernphysik, Forschungszentrum Juelich Forschungszentrum Rossendorf CSNSM, Orsay GANIL, Caen University of Huelva Institute of Nuclear Research, Kiev SLCJ, Warsaw ITME, Warsaw Some of our colleagues traditionally gave lectures and made physical demonstrations on Warsaw informal learning events: 9 th Science Picnic and 9 th Science Festival

  20. Department of Nuclear Reactions: Overview

    International Nuclear Information System (INIS)

    Rusek, K.

    2000-01-01

    Full text: During last year the physicists of the Department of Nuclear Reactions were involved in many experiments and projects: -Low energy nuclear reactions: For the first time a heavy ion beam from the Warsaw Cyclotron C-200 was used to investigate elastic and inelastic scattering of 12 C ions from 12 C target. The experiment is a part of a long range programme devoted to study the energy dependence of the nucleus-nucleus interactions. -Multifragmentation of relativistic heavy ions: Multifragmentation reactions induced by 12 C on different heavy targets and at different energies were studied in experiments performed at Gesellschaft fuer Schwerionenforschung by the ALADIN Collaboration. These asymmetric systems were investigated in order to study the interplay between preequilibrium and equilibrium phenomena in the nuclear liquid - gas phase transition. -The structure of nucleons: A novel, two-structure description of the Roper resonance was proposed on the basis of the α-p scattering data reanalysed by means of a T-matrix formalism. -Atomic physics: Emission of the X-rays by fast heavy ions (S, Ti, Fe) as they traverse the matter (thin carbon or other light element foil) was investigated in a series of experiments performed at University of Erlangen. It was demonstrated, that the characteristic K α X-rays emitted by a heavy ion can serve as a tool for Z-value control of the ion. -Material research: Semiconductor heterostructures were investigated by means of Rutherford Back Scattering and Channeling methods using the 2 MeV α particles from the Van de Graaff accelerator ''Lech'' at the Department. The following reports present the results and major successes which were achieved in 1999. (author)

  1. Department of Nuclear Reactions: Overview

    International Nuclear Information System (INIS)

    Rusek, K.

    2004-01-01

    Full text: In spite of reduced personnel the number of papers published and in press exceeded fifty, almost ten more than a year ago. Another good sign is the growing number of PhD students. The following short reports cover the three major domains of our scientific activities: nuclear, material and atomic physics. Nuclear physics: The structure of light nuclei was investigated, and studies of nuclear reactions induced by heavy ions were performed including experiments at the Heavy Ion Laboratory of Warsaw University. The experiments were carried out in collaboration with scientists from the Institute of Nuclear Research from Kiev, Ukraine. Proton induced reactions on zirconium were investigated theoretically by means of a multistep-direct model extended for the unbound particle - hole states. Good agreement with the experimental data was achieved. Isospin effects in multifragmentation of relativistic heavy ions were studied by the ALADIN Collaboration. Elements of a new generation detector PANDA were tested experimentally using a proton beam provided by the C-30 compact cyclotron at Swierk. Evidence of a narrow baryon state was found in a quasi - real photoproduction on the deuterium target by the HERMES Collaboration. Atomic physics: Ionisation of selected heavy elements by sulphur ions was investigated in collaboration with the Swietokrzyska Academy, Kielce. Materials research: Hydrogen release from ultrahigh molecular weight polythene was investigated by means of an α - particle beam from the Van de Graaff accelerator of our Department. Last but not least, many of our colleagues have been involved in education. Lectures on nuclear physics, accelerators, detectors used in nuclear research as well as nuclear methods applied in solid state studies for students from many high schools of Warsaw and for students of Warsaw University were given by Dr. Andrzej Korman and Dr. Lech Nowicki. Also, our Department made a significant contribution to the 7 th Science

  2. Department of Leptonic Interactions - Overview

    International Nuclear Information System (INIS)

    Rybicki, K.

    2002-01-01

    Full text: Our Department has evolved from the Laboratory of Electronic Particle Detectors (originally called the Laboratory of Filmless Detectors) founded in 1972. The department is involved in two running experiments (H1 at DESY and Belle at KEK). In 2000 the DELPHI experiment has finished a decade of successful running. The analysis of collected data will continue for a couple of years. Since 1999 our group is a member of the LHC-b experiment at CERN. In addition, a few department members work part-time for the ATLAS collaboration at CERN, and our engineers as well as technicians have been working for several years on the construction and testing of superconducting cavities for the TESLA project. This arrangement provides a neat equilibrium between data analysis, running experiments and work on future projects. The main results of work done in 2001 are covered in reports on research. Here we mention only a few highlights: * The Belle experiment demonstrated a strong CP violation in B 0 d decays. The measured asymmetry was sin(2φ 1 ) 0:99 ±0:14±0:06. This is the first (together with the BaBar experiment at SLAC) observation of the CP violation outside the K 0 sector. * The DELPHI collaboration (together with other LEP experiments) determined very precisely the parameters of the Standard Model in the electroweak sector and showed the strongest limit on the direct Higgs search i.e. m H >114 GeV. * The H1 experiment has measured the cross section for the b quark production to be much larger than the NLO QCD predictions. This is especially surprising in Deep Inelastic ep Scattering where the predictions should be fairly solid. * The Cracow LHCb group has designed and tested the prototype of the outer tracker. One should also mention high-quality carbon-carbon composites designed and produced in collaboration with the High Energy Physics Detector Construction Group. In 2001 there were 43 papers (meeting the highest Polish State Committee for Scientific Research

  3. Materials Research Department annual report 1997

    Energy Technology Data Exchange (ETDEWEB)

    Soerensen, B F; Hansen, N [eds.

    1998-04-01

    Selected activities of the Materials Research Department at Risoe National Laboratory during 1997 are described. The scientific work is presented in four chapters: Materials Science, Materials Chemistry, Materials Engineering and Materials Technology. A survey is given of the Department`s participation in international collaboration and of its activities within education and training. Furthermore, the main figures outlining the funding and expenditure of the Department are given. Lists of staff members, visiting scientists, publications and other Department activities are included. (au) 278 refs.

  4. High Energy Physics Departments - Overview

    International Nuclear Information System (INIS)

    Bartke, J.

    2000-01-01

    Full text: Following our long-time tradition we will present under a common header the activities of the seven new units created in 1997 on the basis of the former Department of High Energy Physics: Department of Particle Theory (Dept. V); Department of Leptonic Interactions (Dept XI); Department of Hadron Structure (Dept XII); Department of High Energy Nuclear Interactions (Dept XIII); The ALICE Experiment Laboratory (NAL); The ATLAS Experiment Laboratory (NAT); High Energy Physics Detector Construction Group (PBD). At the end we will list our common activities: lectures and courses as well as seminars. Our research covers a variety of problems of the experimental and theoretical high energy particle physics: the hadronic and leptonic interactions with nucleons and nuclei (characteristics of particle production, including heavy quark physics), e + e - interactions and tests of the Standard Model (also evaluation of radiative corrections), ultrarelativistic heavy ion interactions and search for the quark-gluon plasma, as well as the spectra, composition and interactions of high energy cosmic ray particles. Research on detectors and accelerator components as well as the development of the apparatus for the high energy physics experiments at future accelerators: LHC (CERN, Geneva), RHIC (Brookhaven), B-Factory (KEK, Tsukuba) and TESLA (DESY, Hamburg) is also carried out. The technology of new materials with unique properties such as carbon-carbon composites is also worked on from the point of view of their application in high energy physics experiments. The Division is located in a separate building on the campus of the University of Mining and Metallurgy. This location, close to the Jagiellonian University, facilitates the collaboration with the latter and with the University of Mining and Metallurgy. The joint weekly seminars carried out for nearly 40 years prove this long term tradition. A substantial part of our activities is teaching and training students from

  5. Department of Nuclear Theory: Overview

    International Nuclear Information System (INIS)

    Wilk, G.

    2000-01-01

    Full text: The Department of Nuclear Theory consists of 18 physicists and 3 graduate students working on different aspects of low energy, high energy, plasma and nonlinear physics and, recently, also on a general problem of quantization of particle dynamics. In addition to this activity, close collaboration with SMC, LEAR and ALICE Collaborations at CERN must be also emphasized. This year was particularly fruitful for our Department because of the success of our colleague, Dr. Robert Smolanczuk (at present Fullbright Fellow at LBL, Berkeley). In a series of papers he demonstrated a new possibility of obtaining superheavy elements hinting at the existence of the ''island of stability'' for some combinations of charges and atomic numbers. His ideas were behind the experiment done at Berkeley claiming the discovery of two new elements with A=116 and 118. If confirmed, this could be a dawn of a new approach to the physics of superheavy nuclei. The weight of this discovery is such that the name of our colleague was mentioned in international journals and papers of very broad dissemination, radio and TV included. He was also rewarded by ''J.M.Nitschke Technical Excellence Award'' (USA) for this achievement. Other studies were perhaps not so spectacular but still they brought us in total (including collaborations with experimental groups, mostly from the Department of High Energy Physics) 38 regular papers (plus over 14 already accepted for publication). The specific topics worthy of special emphasis are: - Studies of structure and decay of heaviest nuclei have been continued. Much attention was given to rotational properties of deformed superheavy nuclei. An intensive study of cross sections for the synthesis of heaviest nuclei via various reaction channels has been performed. - Studies of strange nuclear matter have been continued focusing this time on the proper description of the pion spectra from the strangeness exchange reactions measured recently at BNL. - The work

  6. Department of Nuclear Reactions: Overview

    International Nuclear Information System (INIS)

    Rusek, K.

    1999-01-01

    Full text: The Department of Nuclear Reactions had a very productive year. The following reports cover three major domains of our activities: nuclear, material and atomic physics. One of the current questions in modern nuclear physics is question of the phase transitions in nuclear matter. Our physicists, the members of the ALADIN Collaboration at Gesellschaft fuer Schwerionenforschung, participated in new experiments exploring properties of highly excited nuclear matter and the phenomenon of the liquid - gas phase transition. The experiments yielded a number of important results. Details can be found in the three short reports presented in this volume. Structure of a nucleon is another important subject of nuclear science research. In the last year energy region of Δ resonance has been investigated by means of charge exchange reaction. The experiment was performed at Laboratory National Saturne in Saclay by SPESIV-π collaboration consisting of physicist from Institute of Nuclear Physics Orsay, Niels Bohr Institute Copenhagen and from our Department. The main achievement of the experiment was evidence for a Δ - hole attraction in the spin longitudinal channel. Reactions induced by radioactive ion beams such as 6 He recently attract a lot of interest. There exist some evidences that the 6 He nucleus has a two-neutron halo structure similar to that well established for 11 Li. An analysis of 6 He + 4 He scattering data reported in this volume revealed some similarities between the loosely bound 6 Li nucleus and the neutron rich 6 He. Research in material physics has focused on two basic topics: a crystallographic model of uranium dioxide, a material currently used as a nuclear fuel and transformations of defects in GaAs crystals at low temperature. The investigations have been carried out in a wide collaboration with scientists from the University of Jena, Research Center Karlsruhe and Centre de Spectrometrie Nucleaire Orsay. Some experiments have been performed at

  7. Department of Nuclear Reactions: Overview

    International Nuclear Information System (INIS)

    Rusek, K.

    2001-01-01

    Full text: The last year of the twentieth-century was productive for our Department. Although the name of the Department suggests that we are all involved in investigations of nuclear reactions, in fact our activities are spread over three major domains: nuclear, atomic and material physics. Some of the projects we were involved in the last year have been realized using national facilities and accelerators, like the Van de Graaff accelerator of our Department at 69 Hoza Street, Warsaw Cyclotron U-200P of Warsaw University, and compact C30 cyclotron of our Institute at Swierk. Other projects were done abroad, using facilities of the Gesellschaft fuer Schwerionenforschung in Darmstadt, Institute de Physique Nucleaire at Orsay, and Universitaet Erlangen-Nuernberg in Erlangen. We carried out our work in close collaborations with physicists from many laboratories, Polish and foreign. - Low energy nuclear reactions. In collaboration with scientists from Ukraine experiments, using heavy ion beam provided by the Warsaw Cyclotron, were started. The aim of the experiments is to study nuclear reactions leading to the exotic light nuclei in exit channels and energy dependence of the nucleus - nucleus interaction. Efforts were made to develop a multistep direct model of nuclear reactions. In the model contributions due to the low energy collective excitations were taken into account. Good agreement with the experimental data was achieved. - Multifragmentation of relativistic heavy ions. ALADIN Collaboration studied multifragmentation reactions induced by relativistic heavy ions. The main activities of our scientists concentrated on an upgrade of the detecting system in order to replace photo multipliers with large area avalanche photodiodes in the central section of the TOF-wall. Some tests of the photodiodes manufactured by Advanced Photonix Inc. were performed using standard β - and γ-sources. - Structure of a nucleon. Decay properties of the Roper resonance were studied. A

  8. Department of Nuclear Reactions: Overview

    International Nuclear Information System (INIS)

    Rusek, K.

    1998-01-01

    (full text) During the last year our activities were spread over the three major domains: nuclear, atomic and material physics. The nuclear physics experimental programme covered a broad range of nuclear reactions induced by light and heavy ions. New experiments were performed at the compact C-30 cyclotron at Swierk, at University of Jyvaeskylae, GSI Darmstadt, LN Saturne. Prospects for future experiments on nucleon structure at Forschungszentrum Juelich were open. The collaboration with INR Kiev was tightened and work was done in order to prepare experiments at the C-200 heavy ion cyclotron in Warsaw. An effort to install the ion guide isotope separator on line (IGISOL) at the C-200 cyclotron has also to be mentioned A half a year stay of Dr. Nicholas Keeley in the Department, who received The Royal Society/Polish Academy of Science grant, resulted in many interesting results on breakup of light nuclei. Details can be found in the short abstracts presented in this report. As far as atomic physics is concerned, the activity of a group lead by Prof. Marian Jaskola yielded various new results. The experiments were performed at the University of Erlangen, in close collaboration with the Pedagogical University in Kielce and the University of Basel. Fast neutrons generated in the 3 H(d,n) 4 He reaction induced by the 2 MeV deuteron beam from the Van der Graaff accelerator at the Department were used to calibrate solid state-nuclear-track detectors. This was a very good year for material physics research: Jan Kaczanowski and Slawomir Kwiatkawski received Ph.D. degrees based on dissertation research performed in the material physics research programme, while Pawel Kolodziej completed his MSc. thesis in collaboration with the Institute of Electronic Materials Technology in Warsaw, Research Center Karlsruhe, University of Jena and CSNSM Orsay many results were obtained. Lech Nowicki and Prof. Andrzej Turos were awarded by the Director of the IPJ prizes for their scientific

  9. Department of Nuclear Reactions: Overview

    International Nuclear Information System (INIS)

    Rusek, K.

    2003-01-01

    Full text: In 2002, the Department has been involved in two new experimental programmes. Our colleagues led by Prof. Pawel Zupranski joined a large international collaboration HERMES and took part in experiments at DESY devoted to the study of the spin structure of the nucleon. Another group directed by Associate Prof. Bogdan Zwieglinski has worked on a conceptual design of a new generation detector PANDA (Proton-Antiproton Detection) which will be used in future experiments at GSI. Moreover, the experimental programmes covering three major domains of our scientific activities: nuclear physics, materials research and atomic physics were continued. - Nuclear physics: Experimental studies of nuclear reactions induced by heavy ions provided by the Warsaw U-200P Cyclotron were performed in collaboration with scientists from the Institute for Nuclear Studies in Kiev, Ukraine. The aim of the experiments was to investigate isotopic effects in the scattering of 11 B from carbon nuclides. Also, excited states of 6 Li predicted theoretically but never seen in experiments were investigated by means of one-neutron transfer reactions. Proton induced reactions were investigated theoretically by means of the multistep-direct model. Good agreement with the experimental data was achieved. The mechanism of fragments production in collisions of 197 Au with a gold target in the wide range of energies was studied by ALADIN and INDRA Collaborations. The production of η mesons from proton - proton collisions was investigated experimentally at the Juelich Cooler Synchrotron COSY. - Atomic physics: The ionisation of Au, Bi, Th and U atoms by Si ions was investigated in collaboration with the Swietokrzyska Academy, Kielce, and the University of Erlangen-Nuernberg. - Materials research: The sensitivity of the Solid State Nuclear Track PM-355 detectors was tested against intensive gamma and electron radiation. Moreover, using a monoenergetic sulphur ion beam from the Warsaw Cyclotron, the

  10. Department of Nuclear Reactions: Overview

    International Nuclear Information System (INIS)

    Rusek, K.

    2002-01-01

    Full text: Department of Nuclear Reactions has had a very productive year. We have carried out our work in close collaborations with physicists from many laboratories, home and foreign. The following reports cover three major domains of our activities: nuclear, material and atomic physics. * Nuclear physics: In collaboration with scientists from Ukraine experimental studies of nuclear reaction induced by heavy ions from the Warsaw Cyclotron have been performed. The aim of the experiments is to study nuclear reactions leading to the exotic light nuclei in exit channels and energy dependence of the nucleus - nucleus interactions. Proton induced charge-exchange reactions were investigated theoretically by means of multistep-direct model. Good agreement with the experimental data was achieved. A novel approach to the problem of the nuclear liquid → gas phase transition was proposed, based on synergetics - a domain of science dealing with self-organization in macroscopic systems. Decay properties of the Roper resonance were studied. Final analysis of the analysing powers for the polarized deuterons scattered on protons was accomplished. Experimental programme of the near-threshold meson production in proton - proton scattering has been started in collaboration with Forschungszentrum. Juelich. * Atomic physics: Spectra of the X-rays emitted by energetic sulphur ions scattered off carbon atoms were analysed in order to study the role of the multiple charge states of the inner shells in the dynamics of the collision process. Ionization probabilities in collision of oxygen ions with gold atoms were measured. The observed disagreement of the experimental data with the theoretical predictions suggest a strong effect generated by the sub-shell couplings. * Materials research: Ion channelling method was applied to investigate transformation of the defects in Al x Ga 1-x As crystalline layers. Activities of our colleagues in didactics have grown considerably. Lectures

  11. Department of Energy licensing strategy

    International Nuclear Information System (INIS)

    Frei, M.W.

    1984-01-01

    The Department of Energy (DOE) is authorized by the Nuclear Waste Policy Act of 1982 (Act) to site, design, construct, and operate mined geologic repositories for high-level radioactive wastes and is required to obtain licenses from the Nuclear Regulatory Commission (NRC) to achieve that mandate. To this end the DOE has developed a licensing approach which defines program strategies and which will facilitate and ease the licensing process. This paper will discuss the regulatory framework within which the repository program is conducted, the DOE licensing strategy, and the interactions between DOE and NRC in implementing the strategy. A licensing strategy is made necessary by the unique technical nature of the repository. Such a facility has never before been licensed; furthermore, the duration of isolation of waste demanded by the proposed EPA standard will require a degree of reliance on probabilistic performance assessment as proof of compliance that is a first of a kind for any industry. The licensing strategy is also made necessary by the complex interrelationships among the many involved governmental agencies and even within DOE itself, and because these relationships will change with time. Program activities which recognize these relationships are essential for implementing the Act. The guiding principle in this strategy is an overriding commitment to safeguarding public health and safety and to protecting the environment

  12. Department of Structural Research - Overview

    International Nuclear Information System (INIS)

    Wasiutynski, T.

    2001-01-01

    Full text: The research activity of our department concerns structural and dynamical properties of molecular solids. The particular subjects of interest in the year 2000 were orientational and conformational disorder on organic materials and the magnetism of new molecular and intermetallic compounds. The experimental work in our department relies on the complementary use of large instruments at international research centres and of the equipment operating in our laboratories. In the neutron scattering studies (ICNS inelastic coherent neutron scattering, IINS inelastic incoherent neutron scattering, QNS quasielastic neutron scattering etc) we mostly avail ourselves of neutron sources of The Institute for Energy Technology (IFE), Kjeller, Norway, and of The Joint Institute for Nuclear Research (JINR) Dubna, Russia. Our proposals are also regularly accepted in the other neutron centres such as Leon Brillouin Laboratory (LLB) Saclay, France, Rutherford Appleton Laboratory (RAL) Oxford, UK. etc. Thermodynamic characteristics of the materials are determined in our calorimetric laboratory equipped with adiabatic and differential scanning calorimeters. It is due to the invention of our researchers that these instruments, partly prototypic, are now capable of providing quantitative results on the kinetic behaviour of materials out of equilibrium. The scanning mode operation of our upgraded Fourier-transform infrared spectrometer allows US to follow the evolution of the dynamics of a material in the real time and in the temperature range 10-310 K. Textures arising in phase transitions are observed with the use of the polarising microscope with temperature-controlled stage. Molecular reorientation motions and relaxation processes are studied in the dielectric measurements. The laboratory of magnetic research possesses a set of modern instruments for measurements of magnetisation and of the AC susceptibility operating down to the helium temperatures. Computation facilities

  13. Department of Nuclear Spectroscopy - Overview

    International Nuclear Information System (INIS)

    Styczen, J.

    2000-01-01

    Full text: The contributions given hereafter to this Annual Report cover a broad activity of the Department in 1999 both in the pure nuclear spectroscopy and in the applied spectroscopy investigations. That activity is then assembled in the two main groups: the nuclear structure studies with the application of the multidetector systems such as GASP, GAMMASPHERE, EUROBALL and the RFD - as its ancillary device, and investigations of condensed matter properties with the use of nuclear methods. In addition, non-nuclear methods such as the atomic force microscopy provided several new encouraging results. The nice data obtained are due to the great skill and hard work of all members of the staff, and a vast cooperation both with international and national institutes and institutions. When anticipated for calling the attractive results of the past year, I would rather admit that all data given here pretend to be those. To meet with, I refer directly to the short presentations given in the next pages. (author)

  14. Public meetings in the departments

    CERN Multimedia

    Staff Association

    2012-01-01

    During our recent information meetings, we discussed four topics: the new Saved Leave Scheme (LTSLS); the new developments concerning pensions; the MARS Advancement and Promotion scheme and its 2012 budget; the recently updated Administrative and Operation Circulars. These meetings were attended by a large number of staff members and were a great opportunity for the Staff Association to engage in direct dialogue with the staff in the various departments. The vast majority of questions or comments were on the LTSLS and on the possibility to save leave, which is to be taken at the end of a career.  A few comments were also made on MARS, a system many considered to be not very motivating and that takes up a lot of resources for minimal positive results. Thanks and encouragement After the presentation on Pensions, on behalf of the Staff Association we thanked Dorothée Duret, who for personal reasons had to resign from the Pension Fund Governing Board (PFGB) and from the Staff Council...

  15. Key parameters controlling radiology departments

    International Nuclear Information System (INIS)

    Busch, Hans-Peter

    2011-01-01

    For radiology departments and outstanding practises control and optimization of processes demand an efficient management based on key data. Systems of key data deliver indicators for control of medical quality, service quality and economics. For practices effectiveness (productivity), for hospitals effectiveness and efficiency are in the focus of economical optimization strategies. Task of daily key data is continuous monitoring of activities and workflow, task of weekly/monthly key data is control of data quality, process quality and achievement of objectives, task of yearly key data is determination of long term strategies (marketing) and comparison with competitors (benchmarking). Key parameters have to be defined clearly and have to be available directly. For generation, evaluation and control of key parameters suitable forms of organization and processes are necessary. Strategies for the future will be directed more to the total processes of treatment. To think in total processes and to steer and optimize with suitable parameters is the challenge for participants in the healthcare market of the future. (orig.)

  16. Managing hypopituitarism in emergency departments.

    Science.gov (United States)

    Welsh, Jeanette

    2015-10-01

    Healthcare professionals manage patients with a vast range of conditions, but often specialise and acquire expertise in specific disease processes. Emergency and pre-hospital clinicians care for patients with various conditions for short periods of time, so have less opportunity to become familiar with more unusual conditions, yet it is vital that they have some knowledge and understanding of these. Patients with rare conditions can present at emergency departments with common complaints, but the effect of their original diagnosis on the presenting complaint may be overlooked or underestimated. This article uses a case study to describe the experience of one patient who presented with vomiting, but who also had hypopituitarism and therefore required specific management she did not at first receive. The article describes hypopituitarism and the initial management of patients with this condition who become unwell, and discusses how the trust responded to the patient's complaint to improve patient safety and care. It has been written with the full participation and consent of the patient and her husband.

  17. Effects of emergency department expansion on emergency department patient flow.

    Science.gov (United States)

    Mumma, Bryn E; McCue, James Y; Li, Chin-Shang; Holmes, James F

    2014-05-01

    Emergency department (ED) crowding is an increasing problem associated with adverse patient outcomes. ED expansion is one method advocated to reduce ED crowding. The objective of this analysis was to determine the effect of ED expansion on measures of ED crowding. This was a retrospective study using administrative data from two 11-month periods before and after the expansion of an ED from 33 to 53 adult beds in an academic medical center. ED volume, staffing, and hospital admission and occupancy data were obtained either from the electronic health record (EHR) or from administrative records. The primary outcome was the rate of patients who left without being treated (LWBT), and the secondary outcome was total ED boarding time for admitted patients. A multivariable robust linear regression model was used to determine whether ED expansion was associated with the outcome measures. The mean (±SD) daily adult volume was 128 (±14) patients before expansion and 145 (±17) patients after. The percentage of patients who LWBT was unchanged: 9.0% before expansion versus 8.3% after expansion (difference = 0.6%, 95% confidence interval [CI] = -0.16% to 1.4%). Total ED boarding time increased from 160 to 180 hours/day (difference = 20 hours, 95% CI = 8 to 32 hours). After daily ED volume, low-acuity area volume, daily wait time, daily boarding hours, and nurse staffing were adjusted for, the percentage of patients who LWBT was not independently associated with ED expansion (p = 0.053). After ED admissions, ED intensive care unit (ICU) admissions, elective surgical admissions, hospital occupancy rate, ICU occupancy rate, and number of operational ICU beds were adjusted for, the increase in ED boarding hours was independently associated with the ED expansion (p = 0.005). An increase in ED bed capacity was associated with no significant change in the percentage of patients who LWBT, but had an unintended consequence of an increase in ED boarding hours. ED expansion alone does

  18. The effect of emergency department expansion on emergency department overcrowding.

    Science.gov (United States)

    Han, Jin H; Zhou, Chuan; France, Daniel J; Zhong, Sheng; Jones, Ian; Storrow, Alan B; Aronsky, Dominik

    2007-04-01

    To examine the effects of emergency department (ED) expansion on ambulance diversion at an urban, academic Level 1 trauma center. This was a pre-post study performed using administrative data from the ED and hospital electronic information systems. On April 19, 2005, the adult ED expanded from 28 to 53 licensed beds. Data from a five-month pre-expansion period (November 1, 2004, to March 1, 2005) and a five-month postexpansion period (June 1, 2005, to October 31, 2005) were included for this analysis. ED and waiting room statistics as well as diversion status were obtained. Total ED length of stay (LOS) was defined as the time from patient registration to the time leaving the ED. Admission hold LOS was defined as the time from the inpatient bed request to the time leaving the ED for admitted patients. Mean differences (95% confidence interval [CI]) in total time spent on ambulance diversion per month, diversion episodes per month, and duration per diversion episode were calculated. An accelerated failure time model was performed to test if ED expansion was associated with a reduction in ambulance diversion while adjusting for potential confounders. From pre-expansion to postexpansion, daily patient volume increased but ED occupancy decreased. There was no significant change in the time spent on ambulance diversion per month (mean difference, 10.9 hours; 95% CI = -74.0 to 95.8), ambulance diversion episodes per month (two episodes per month; 95% CI = -4.2 to 8.2), and duration of ambulance diversion per episode (0.3 hours; 95% CI = -4.0 to 3.5). Mean (+/-SD) total LOS increased from 4.6 (+/-1.9) to 5.6(+/-2.3) hours, and mean (+/-SD) admission hold LOS also increased from 3.0 (+/-0.2) to 4.1 (+/-0.2) hours. The proportion of patients who left without being seen was 3.5% and 2.7% (p = 0.06) in the pre-expansion and postexpansion periods, respectively. In the accelerated failure time model, ED expansion did not affect the time to the next ambulance diversion episode

  19. Department of Nuclear Reactions: Overview

    International Nuclear Information System (INIS)

    Rusek, K.

    2005-01-01

    Full text: It is surprising how so few under-paid scientists could do so much. During 2004 the number of papers published or being in press exceeded fifty, making almost three papers per person employed in our department. Furthermore, among these papers one was published in Nature, the World's highest-ranked scientific journal. This is a result that will be difficult to beat. It is my pleasure to mention that one of our PhD students, Mr Sergiy Mezhevych, won a prestigious Heavy Ion Laboratory Prize founded by Prof. Inamura, for his experimental work using a beam from the Warsaw Cyclotron. Thanks to the effort of our colleagues the Hermes Collaboration Meeting organized by IPJ in Kazimierz Dolny (June 25 - July 1) turned out a success. The following short reports cover the three major domains of our scientific activities: nuclear, materials and atomic physics. -Nuclear physics - The structure of light nuclei, including exotic radioactive isotopes, was investigated both experimentally and theoretically. Some experimental studies were performed at the Heavy Ion Laboratory of Warsaw University in collaboration with scientists from the Institute of Nuclear Research in Kiev, Ukraine. The two reports present interesting results for the rare carbon isotope, 14 C. In the framework of Feshbach, Kerman and Koonin theory the multistep emission of one particle as well as more complicated direct processes were studied. It was found that these more complex processes play an important role in proton induced reactions. Experimental data from projectile-multifragmentation experiments with stable and radioactive beams were analysed. Some preliminary results are presented. Using a proton beam provided by the C-30 compact cyclotron at Swierk, detectors consisting of a PWO scintillator coupled to avalanche photodiodes were tested. The aim of these tests was to find the best detectors for the large electromagnetic calorimeter which will be used in future PANDA Collaboration experiments

  20. Pharmaceutical advertising in emergency departments.

    Science.gov (United States)

    Marco, Catherine A

    2004-04-01

    Promotion of prescription drugs represents a growing source of pharmaceutical marketing expenditures. This study was undertaken to identify the frequency of items containing pharmaceutical advertising in clinical emergency departments (EDs). In this observational study, emergency physician on-site investigators quantified a variety of items containing pharmaceutical advertising present at specified representative times and days, in clinical EDs. Measurements were obtained by 65 on-site investigators, representing 22 states. Most EDs in this study were community EDs (87% community and 14% university or university affiliate), and most were in urban settings (50% urban, 38% suburban, and 13% rural). Investigators measured 42 items per ED (mean = 42; median = 31; interquartile range of 14-55) containing pharmaceutical advertising in the clinical area. The most commonly observed items included pens (mean 15 per ED; median 10), product brochures (mean 5; median 3), stethoscope labels (mean 4; median 2), drug samples (mean 3; median 0), books (mean 3.4), mugs (mean 2.4), and published literature (mean 3.1). EDs with a policy restricting pharmaceutical representatives in the ED had significantly fewer items containing pharmaceutical advertising (median 7.5; 95% CI = 0 to 27) than EDs without such a policy (median 35; 95% CI = 27 to 47, p = 0.005, nonparametric Wilcoxon two-sample test). There were no differences in quantities of pharmaceutical advertising for EDs in community compared with university settings (p = 0.5), rural compared with urban settings (p = 0.3), or annual ED volumes (p = 0.9). Numerous items containing pharmaceutical advertising are frequently observed in EDs. Policies restricting pharmaceutical representatives in the ED are associated with reduced pharmaceutical advertising.

  1. Department of Nuclear Theory: Overview

    International Nuclear Information System (INIS)

    Wilk, G.

    1999-01-01

    Full text: The Department of Nuclear Theory consists of 18 physicists and 3 graduate students working on different aspects of low energy, high energy, plasma and nonlinear physics. Most of the effort is phenomenologically oriented. Close collaboration with SMC, LEAR and ALICE Collaborations at CERN must be also emphasized. The specific topics are: Studies of strangeness in nuclei stem from a long Warsaw tradition of hypernuclear physics. These include attempts to understand the elusive Σ-hypernuclei, studies of nuclear bound states of η-mesons that introduce hidden strangeness into nuclei. Some studies have been devoted to the structure of superheavy elements, which resulted in predicting properties of deformed superheavy nuclei. They are continued with calculations of collective motion, neutron haloes and energy dissipation in heavy ion collisions. An increasing effort is also devoted to research on nuclear collisions at high energies. Much attention is paid to the study of the mass of exotic nuclei. Studies in high energy physics are devoted to understanding deep inelastic lepton scattering, formal properties of the contour gauge theories, the phenomenology of high energy multiparticle and production processes in both hadronic and nuclear collisions, (especially the systematics of leading particle production in these processes). A new approach to the standard model via conformed unification of general relativity has been attempted. The new attempt at quantization of nonlinear theories has been undertaken and first positive and interesting results obtained. Theoretical studies of soliton solutions in several branches of physics are performed. Methods of testing the stability and metamorphosis of these soliton solutions have been developed. Results have implications in solid state physics as well as for plasmas and hydrodynamics. Collaborations with several universities have been maintained. These include the Universities of Warsaw, Bucharest, Kielce, T.U. Munich

  2. Department of Nuclear Reactions - Overview

    International Nuclear Information System (INIS)

    Rusek, K.

    2007-01-01

    The scientific activity of our department is traditionally focused on nuclear physics, atomic physics and material research. Our interest in nuclear physics is broad, ranging from the structure of a nucleon to the structure of the nucleus. The spin structure of a nucleon has been investigated within the HERMES Collaboration which comprises 32 institutions from 11 countries. The collaboration performs experiments at Deutches Elektronen-Synchrotron in Hamburg. Another large-scale international collaboration we are participating in is PANDA. The PANDA (antiProton ANnihilation at DArmstadt) experiment will be installed at the High Energy Storage Ring for antiprotons of the future Facility for Antiproton and Ion Research (FAIR) in Darmstadt. Our colleagues, led by Dr. B. Zwieglinski, have been working on the concept of a calorimeter, testing different scintillators. Many experiments in low energy nuclear physics were performed in collaboration with University of Jyvaeskylae, the Institute of Nuclear Research of the Ukrainian Academy of Science and Heavy Ion Laboratory of the Warsaw University. They were devoted to studying nucleus-nucleus interactions near the Coulomb barrier. This year, atomic studies focused on the L-shell ionisation of some heavy elements by silicon ions accelerated to the energy of 8.5-36 MeV. The results are presented in this report and are compared to different model calculations. Finally, I take great pleasure in congratulating Dr. L. Nowicki, whose study of uranium oxide structure, performed in collaboration with Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse in Orsay, was chosen as an important scientific achievement of our Institute in 2006. Apart from purely scientific activities, a few of our colleagues have been involved in education, giving lectures to students from high schools in Warsaw and Warsaw University. R. Ratajczak contributed to the 10 th Science Festival, an event organized for the general public every year

  3. Lyme Disease: Emergency Department Considerations.

    Science.gov (United States)

    Applegren, Nathan D; Kraus, Chadd K

    2017-06-01

    Lyme disease (LD) is the most common vector-borne illness in North America. Reported cases of LD have increased from approximately 10,000 cases annually in 1991 to >25,000 cases in 2014. Greater recognition, enhanced surveillance, and public education have contributed to the increased prevalence, as have geographic expansion and the number of infected ticks. Cases are reported primarily in the Northeastern United States, Wisconsin, and Minnesota, with children having the highest incidence of LD among all age groups. The increased incidence and prevalence of LD in the United States makes it increasingly more common for patients to present to the emergency department (ED) for tick bites and LD-related chief complaints, such as the characteristic erythema migrans skin manifestation. We sought to review the etiology of LD, describe its clinical presentations and sequela, and provide a practical classification and approach to ED management of patients with LD-related presentations. In this review, ED considerations for LD are presented and clinical presentations and management of the disease at different stages is discussed. Delayed sequelae that have significant morbidity, including Lyme carditis and Lyme neuroborreliosis, are discussed. Diagnostic tests and management are described in detail. The increasing prevalence and growing geographic reach of Lyme disease makes it critically important for emergency physicians to consider the diagnosis in patients presenting with symptoms suggestive of LD and to initiate appropriate treatment to minimize the potential of delayed sequelae. Special consideration should be made for the epidemiology of LD and a high clinical suspicion should be present for patients in endemic areas or with known exposures to ticks. Emergency physicians can play a critical role in the recognition, diagnosis, and treatment of LD. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. Idaho Transportation Department 2016 Customer Communication Survey

    Science.gov (United States)

    2017-06-23

    In 2016, the Idaho Transportation Department contracted with the University of Idaho's Social Science Research Unit to conduct a survey on the general public's engagement and communication with the department. The goal of conducting this survey was t...

  5. Asthma Medication Ratio Predicts Emergency Depart...

    Data.gov (United States)

    U.S. Department of Health & Human Services — According to findings reported in Asthma Medication Ratio Predicts Emergency Department Visits and Hospitalizations in Children with Asthma, published in Volume 3,...

  6. Hazards Control Department 1995 annual report

    International Nuclear Information System (INIS)

    Campbell, G.W.

    1996-01-01

    This annual report of the Hazards Control Department activities in 1995 is part of the department's efforts to foster a working environment at Lawrence Livermore National Laboratory (LLNL) where every person desire to work safely

  7. 2015 Oregon Department Forestry Lidar: Northwest OR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — GeoTerra, Inc. was selected by Oregon Department of Forestry to provide Lidar remote sensing data including LAZ files of the classified Lidar points and surface...

  8. Priorities for emergency department syncope research

    NARCIS (Netherlands)

    Sun, Benjamin C.; Costantino, Giorgio; Barbic, Franca; Bossi, Ilaria; Casazza, Giovanni; Dipaola, Franca; McDermott, Daniel; Quinn, James; Reed, Matthew; Sheldon, Robert S.; Solbiati, Monica; Thiruganasambandamoorthy, Venkatesh; Krahn, Andrew D.; Beach, Daniel; Bodemer, Nicolai; Brignole, Michele; Casagranda, Ivo; Duca, Piergiorgio; Falavigna, Greta; Ippoliti, Roberto; Montano, Nicola; Olshansky, Brian; Raj, Satish R.; Ruwald, Martin H.; Shen, Win-Kuang; Stiell, Ian; Ungar, Andrea; van Dijk, J. Gert; van Dijk, Nynke; Wieling, Wouter; Furlan, Raffaello

    2014-01-01

    There is limited evidence to guide the emergency department (ED) evaluation and management of syncope. The First International Workshop on Syncope Risk Stratification in the Emergency Department identified key research questions and methodological standards essential to advancing the science of

  9. Materials Research Department annual report 1996

    International Nuclear Information System (INIS)

    Soerensen, B.F.; Hansen, N.

    1997-04-01

    Selected activities of the Materials Research Department at Risoe National Laboratory during 1996 are described. The scientific work is presented in four chapters: Materials Science, Materials Chemistry, Materials Engineering and Materials Technology. A survey is given of the Department's participation in international collaboration and of its activities within education and training. Furthermore, the main figures outlining the funding and expenditure of the Department are given. Lists of staff members, visiting scientists, publications and other Department activities are included. (au)

  10. Materials Research Department annual report 1997

    International Nuclear Information System (INIS)

    Soerensen, B.F.; Hansen, N.

    1998-04-01

    Selected activities of the Materials Research Department at Risoe National Laboratory during 1997 are described. The scientific work is presented in four chapters: Materials Science, Materials Chemistry, Materials Engineering and Materials Technology. A survey is given of the Department's participation in international collaboration and of its activities within education and training. Furthermore, the main figures outlining the funding and expenditure of the Department are given. Lists of staff members, visiting scientists, publications and other Department activities are included. (au)

  11. Department of Nuclear Reactions - Overview

    International Nuclear Information System (INIS)

    Marianski, B.

    2010-01-01

    of polychromatic decorations from ancient Egyptian tombs. Important findings on the origin and dating of wall paintings at different archaeological sites are reported. · In this year the study of nuclear track detectors continued. These detectors will be used in a planned tokamak experiment in Great Britain. A new subject undertaken in the Department in collaboration with the Institute of Nuclear Physics of the Polish Academy of Science concerns diamond detectors. Diamond detectors have a large energy gap and very short pulse rise time. They are able to measure high intensity particle beams. As every year, apart from purely scientific activities. a few of our colleagues have been involved in education, giving lectures to students of many High Schools in Warsaw and to students of Warsaw University. (author)

  12. Department of Nuclear Reactions - Overview

    Energy Technology Data Exchange (ETDEWEB)

    Marianski, B [The Andrzej Soltan Institute for Nuclear Studies, Swierk-Otwock (Poland)

    2010-07-01

    -ray emission (PIXE) studies of polychromatic decorations from ancient Egyptian tombs. Important findings on the origin and dating of wall paintings at different archaeological sites are reported. centre dot In this year the study of nuclear track detectors continued. These detectors will be used in a planned tokamak experiment in Great Britain. A new subject undertaken in the Department in collaboration with the Institute of Nuclear Physics of the Polish Academy of Science concerns diamond detectors. Diamond detectors have a large energy gap and very short pulse rise time. They are able to measure high intensity particle beams. As every year, apart from purely scientific activities. a few of our colleagues have been involved in education, giving lectures to students of many High Schools in Warsaw and to students of Warsaw University. (author)

  13. 49 CFR 89.45 - Department determination.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Department determination. 89.45 Section 89.45... Referral of Debts to IRS for Tax Refund Offset § 89.45 Department determination. (a) Following review of... supporting rationale. (b) If the Department either sustains or amends its determination, it shall notify the...

  14. Repositioning an Academic Department to Stimulate Growth

    Science.gov (United States)

    Elrod, Cassandra C.; Daughton, William J.; Murray, Susan L.; Fisher, Caroline M.; Flachsbart, Barry B.

    2011-01-01

    The complexity of the market in higher education, and the lack of literature regarding marketing, particularly branding, at the academic department level, presented an opportunity to establish a systematic process for evaluating an academic department's brand meaning. A process for evaluating a brand's meaning for an academic department is…

  15. Nuclear Safety Research Department annual report 2000

    DEFF Research Database (Denmark)

    Majborn, B.; Nielsen, Sven Poul; Damkjær, A.

    2001-01-01

    The report presents a summary of the work of the Nuclear Safety Research Department in 2000. The department's research and development activities were organized in two research programmes: "Radiation Protection and Reactor Safety" and "Radioecology andTracer Studies". In addtion the department...

  16. Nuclear Safety Research Department annual report 2001

    DEFF Research Database (Denmark)

    Majborn, B.; Damkjær, A.; Nielsen, Sven Poul

    2002-01-01

    The report presents a summary of the work of the Nuclear Safety Research Department in 2001. The department's research and development activities were organized in two research programmes: "Radiation Protection and Reactor Safety" and "Radioecology andTracer Studies". In addition the department...

  17. Radiation Research Department annual report 2002

    International Nuclear Information System (INIS)

    Majborn, B.; Damkjaer. A.; Nielsen, S.P.

    2003-06-01

    The report presents a summary of the work of the Radiation Research Department in 2002. The departments research and development activities are organized in two research programmes: 'Radiation Physics' and 'Radioecology and Tracer Studies'. In addition the department is responsible for the task 'Dosimetry'. Lists of publications, committee memberships and staff members are included. (au)

  18. Department of Nuclear Reactions - Overview

    International Nuclear Information System (INIS)

    Rusek, K.

    2009-01-01

    Full text: Our activity in 2008 has focused on well-established domains of research: nuclear and atomic physics, and applications. · As far as nuclear physics is concerned; our interests are very broad, ranging from the structure of the nucleon to the structure of the nucleus including high-energy multifragmentation studies. Our colleagues led by Prof. Pawel Zupranski, members of the HERMES collaboration that comprises 32 institutions from eleven countries at the Deutsches Elektronen Synchrotron (DESY) in Hamburg, worked last year on the extraction of Spin Density Matrix Elements of vector mesons from scattering experiments on hydrogen targets. They also studied the distribution of quarks and gluons in nucleon. A team led by Prof. B. Zwieglinski was involved in the large-scale international collaboration PANDA (antiProton ANnihilation at DArmstadt). They studied the response of cooled PWO scintillators irradiated by gammas in the energy range of 4-20 MeV. The gammas were produced radiative proton capture on light by nuclei using a proton beam from the Van de Graaff accelerator of our Department. As a result, an important extrapolation of measurements performed by another group of physicists at much higher γ-ray energies was obtained. Low energy nuclear physics experiments were continued at the Heavy Ion Laboratory of Warsaw University in collaboration with foreign institutions: the University of Jyvaeskylae, the Institute of Nuclear Research of the Ukrainian Academy of Science and the Institute de Recherches Subatomique in Strasbourg. At high energies, a study of the isospin - dependence of the caloric curve was performed by the ALADIN Collaboration in a series of experiments at GSI - Darmstadt using radioactive beams of Sn and La. It was found that the asymmetry due to isospin is very weak. · Atomic physics studies were devoted to ionisation of heavy atoms by oxygen ions from the tandem accelerator of Erlangen-Nuernberg University. X-rays generated in the

  19. Department of Nuclear Reactions - Overview

    Energy Technology Data Exchange (ETDEWEB)

    Rusek, K [The Andrzej Soltan Institute for Nuclear Studies, Swierk-Otwock (Poland)

    2009-07-01

    Full text: Our activity in 2008 has focused on well-established domains of research: nuclear and atomic physics, and applications. {center_dot} As far as nuclear physics is concerned; our interests are very broad, ranging from the structure of the nucleon to the structure of the nucleus including high-energy multifragmentation studies. Our colleagues led by Prof. Pawel Zupranski, members of the HERMES collaboration that comprises 32 institutions from eleven countries at the Deutsches Elektronen Synchrotron (DESY) in Hamburg, worked last year on the extraction of Spin Density Matrix Elements of vector mesons from scattering experiments on hydrogen targets. They also studied the distribution of quarks and gluons in nucleon. A team led by Prof. B. Zwieglinski was involved in the large-scale international collaboration PANDA (antiProton ANnihilation at DArmstadt). They studied the response of cooled PWO scintillators irradiated by gammas in the energy range of 4-20 MeV. The gammas were produced radiative proton capture on light by nuclei using a proton beam from the Van de Graaff accelerator of our Department. As a result, an important extrapolation of measurements performed by another group of physicists at much higher {gamma}-ray energies was obtained. Low energy nuclear physics experiments were continued at the Heavy Ion Laboratory of Warsaw University in collaboration with foreign institutions: the University of Jyvaeskylae, the Institute of Nuclear Research of the Ukrainian Academy of Science and the Institute de Recherches Subatomique in Strasbourg. At high energies, a study of the isospin - dependence of the caloric curve was performed by the ALADIN Collaboration in a series of experiments at GSI - Darmstadt using radioactive beams of Sn and La. It was found that the asymmetry due to isospin is very weak. {center_dot} Atomic physics studies were devoted to ionisation of heavy atoms by oxygen ions from the tandem accelerator of Erlangen-Nuernberg University. X

  20. Department of Nuclear Radiospectroscopy - Overview

    International Nuclear Information System (INIS)

    Jasinski, A.

    2001-01-01

    Full text: Research at the Department of Nuclear Radiospectroscopy encompasses various aspects of nuclear magnetic resonance (NMR) and its applications to solids and to biosystems. Current research activity covers two areas: investigation of molecular dynamics and structures in solids using NMR spectroscopy, and examination of human organs, small animals and plants using MR imaging and localized spectroscopy. MAGNETIC RESONANCE IMAGING LABORATORY Biomedical applications of magnetic resonance imaging (MRI) and spectroscopy (MRS) together with development and modification of the existing hardware were our main topic of research in the year 2000. The following projects have been carried out: * Investigation of the water diffusion tensor in biological systems in vivo and in vitro; * Study of localized MR spectra in the skeletal muscles of the human limbs; * Structure and physiological processes of the tissue and organs in the normal and pathological state studied by MRI and MRS methods; * Generation of the magnetic field gradients and design of highly specialized RF coils for MR localized spectroscopy and MR Imaging. This work has been done in collaboration with Collegium Medicum of the Jagiellonian University and the Institute for Biodiagnostics in Winnipeg, Canada. As far as the hardware and the methodology side are concerned our, tasks in the year 2000 included: * Development and modifications of home-built MR Microscopy based on 8.4T magnet; * Modifications of the 4.7T magnet console; * Designing and optimizing the ergometer used in skeletal muscle research; * Implementation of the fast imaging methods based on the spin echo sequences. MAGNETIC RESONANCE LABORATORY Deuteron NMR spectroscopy was applied to the study of reorientational dynamics and tunnelling rotation of ammonium ion isotopomers. As particular achievements we point out results concerning structure refinement of structure, establishing the symmetry of the rotational potential, and detection of the