WorldWideScience

Sample records for universiteit amsterdam conditions

  1. Jaarverslag 2003: Erasmus Universiteit Rotterdam

    NARCIS (Netherlands)

    2004-01-01

    textabstractDe Erasmus Universiteit Rotterdam heeft in 2003 resultaten ge- boekt waar zij voor staat, zowel op het gebied van wetenschap- pelijk onderwijs, wetenschappelijk onderzoek als in de sfeer van maatschappelijke dienstverlening. Daarvan kunt u in dit verslag kennisnemen. Veel aandacht is

  2. Jaarverslag 2001: Erasmus Universiteit Rotterdam

    NARCIS (Netherlands)

    2002-01-01

    textabstractDe Erasmus Universiteit Rotterdam heeft in 2001 resultaten geboekt waar zij voor staat, zowel op het gebied van wetenschappelijk onderwijs, wetenschappelijk onderzoek als in de sfeer van maatschappelijke dienstverlening. Met genoegen presenteren we u daarom dit verslag. Daarin laten we

  3. De Amsterdam a Figueroles : Experiencias UNIGIS

    NARCIS (Netherlands)

    Koomen, E.

    2006-01-01

    Eric Koomen es un investigador en SlG del Departamento de Economía Espacial de Ia Vrije Universiteit de Amsterdam. Su principal ámbito de investigacíon es el modelado del cambio del uso del suelo y su tesis doctoral se centra en Ia applicacíon de indicadores de modelos de cambios de usos del suelo.

  4. Bioprospektering, wetgewing en navorsing by universiteite in Suid-Afrika

    Directory of Open Access Journals (Sweden)

    J.L. Du Plessis

    2006-09-01

    Full Text Available Suid-Afrika is besonder ryk aan biodiversiteit. Dié biodiversiteit kan benut word en het kommersiële potensiaal. Bioprospektering is die sistematiese evaluering van biodiversiteit deur gebruik te maak van gevorderde tegnologie in die soeke na en ontwikkeling van kommersieel waardevolle nuwe produkte. Die internasionale Konvensie vir Biodiversiteit en die nasionale Biodiversiteitwet beklemtoon die volhoubare benutting en bewaring van biodiversiteit en stel sekere vereistes aan bioprospektering en die navorsing daarby betrokke. Navorsing op inheemse biologiese hulpbronne word ook deur die wetgewing geraak. Feitlik elke universiteit in Suid-Afrika is betrokke by bioprospekteringsprojekte en/of navorsing op inheemse biologiese hulpbronne. ’n Kort oorsig oor die ontstaan van die Biodiversiteitwet word gegee. Navorsingsbestuur en navorsers word hiermee meegedeel wat die huidige wetlike implikasies van die Biodiversiteitwet op navorsing by universiteite in Suid-Afrika is.

  5. Die opleiding van bedryfsielkundiges aan die universiteit van Fort Hare

    Directory of Open Access Journals (Sweden)

    W. Botha

    1977-11-01

    Full Text Available Die Departement Bedryfsielkunde aan die Universiteit van Fort Hare is 'n relatiewe jong departement en het eers in 1965 tot stand gekom. Voor hierdie datum is Bedryfsielkunde as 'n kort kursus deur die departement van suiwer Sielkunde aangebied en een van die destydse dosente, Dr. W. Backer, het die inisiatief geneem om 'n selfstandige departement van Bedryfsielkunde in die Fakulteit van Ekonomiese Wetenskappe op die been te bring.

  6. Grote Hotels in Amsterdam

    NARCIS (Netherlands)

    Vermeer, G.

    2014-01-01

    De reiziger die Amsterdam binnenkomt via het Centraal Station ziet rechts van het Damrak meteen een beknopte geschiedenis van de hotelbouw in Amsterdam. Op de hoek, om twee kleinere huisjes heen, staat het oudste deel van het Victoriahotel (nu Victoria Plaza Hotel), dat in 1890 zijn deuren opende.

  7. 14 November 2014 - F. van der Duyn Schouten Rector Magnificus Vrije Universiteit University Amsterdam Kingdom of the Netherlands

    CERN Multimedia

    Guillaume, Jeanneret

    2014-01-01

    signing the Guest Book with ATLAS Collaboration, Dutch senior physicist H. ten Kate and visiting the ATLAS cavern with ATLAS Collaboration Deputy Spokesperson T. Wengler; ATLAS Collaboration, Director of Nikhef as of December 1, 2014 S. Bentvelsen and ATLAS Collaboration, Nikhef P. de Jong.

  8. The Amsterdam proton microbeam

    International Nuclear Information System (INIS)

    Bos, A.J.J.

    1984-01-01

    The aim of the work presented in this thesis is to develop a microbeam setup such that small beam spot sizes can be produced routinely, and to investigate the capabilities of the setup for micro-PIXE analysis. The development and performance of the Amsterdam proton microbeam setup are described. The capabilities of the setup for micro-PIXE are shown with an investigation into the presence of trace elements in human hair. (Auth.)

  9. Clinical highlights from Amsterdam

    Directory of Open Access Journals (Sweden)

    Jouke T. Annema

    2016-07-01

    Full Text Available This article contains highlights and a selection of the scientific advances from the Clinical Assembly that were presented at the 2015 European Respiratory Society International Congress in Amsterdam, the Netherlands. The most relevant topics for clinicians will be discussed, covering a wide range of areas including interventional pulmonology, rehabilitation and chronic care, thoracic imaging, diffuse and parenchymal lung diseases, and general practice and primary care. In this comprehensive review, exciting novel data will be discussed and put into perspective.

  10. Quickscan QTI addendum #1 - Usability study of QTI for De Digitale Universiteit

    NARCIS (Netherlands)

    dr. Pierre Gorissen

    2003-01-01

    De Digitale Universiteit (DU) performed a quickscan to determine the usability of the IMS Question and TestInteroperability (QTI) specification as a format to store questions and tests developed for and by the consortium. The original report is available in Dutch from the website of De Digitale

  11. Diverse artikelen in Gay Amsterdam News

    NARCIS (Netherlands)

    Hekma, G.

    2002-01-01

    Vernedering, in: Gay Amsterdam News 125 (jan 2002), pp. 20-21; Webseks, zaad, zweetseks, in: Gay Amsterdam News 126 (feb 2002), pp. 30-31; Wurgseks, in: Gay Amsterdam News 127 (mrt 2002), pp. 30-31; Wijnandus Johannes Sengers (1927-2002), in: Gay Amsterdam News 133 (sept 2002), pp. 49.

  12. Digital Amsterdam : Digital Art and Public Space in Amsterdam

    NARCIS (Netherlands)

    Cnossen, Boukje; Franssen, Thomas; De Wilde, Mandy

    2015-01-01

    In this report we explore digital art interventions in public space in Amsterdam as part of the ‘participatory public space’ project lead by the University of Melbourne. We focus specifically on artistic interventions in public space, rather than on the more general ways in which public space is

  13. Milieukwaliteitsplan Regionaal Orgaan Amsterdam; hoofdlijnenrapport

    NARCIS (Netherlands)

    Borch, ter M.; Coenen, E.; Frederiks, N.; Haas, de W.; Harmsen, T.; Jonker, G.; Kersten, G.; Klundert, van de B.; Loeven, L.; Steinhaus, R.; Timmermans, W.; Tjallingii, S.; Veer, van 't K.; Vink, S.; Wiersinga, W.; Witte, T.

    1995-01-01

    Het Milieukwaliteitsplan van het Regionaal Orgaan Amsterdam (ROA) speelt in op de nieuwe bestuurlijke verhoudingen in het ROA-gebied. Het geeft geen vaste doelstellingen waaraan iedere gemeente moet voldoen, maar is een instrumenteel en faciliërend kader voor uitwisseling van kennis en ervaringen,

  14. Values of Development and Educational Goals. Verhandelingen no. 8, tevens publikatie no. 21 van het Sociografisch Instituut der Universiteit van Amsterdam.

    Science.gov (United States)

    Fortuijn, A. B. Droogleever; Oud, P. J.

    This paper examines the concept of national development in terms of the realization of values; it is intended to serve as the basis for a research project focused on the formulation of a development strategy for developing countries, with special attention to the role of education in the development process. Chapter 1 briefly summarizes the…

  15. Environmental space management in the harbor of Amsterdam, Netherlands; Milieuruimtemanagement haven Amsterdam

    Energy Technology Data Exchange (ETDEWEB)

    Klok, L.; Hulskotte, J. [TNO Built Environment and Geosciences, Den Haag (Netherlands); Van Breemen, T. [Haven Amsterdam, Amsterdam (Netherlands)

    2012-02-15

    A new calculation tool will quickly offer the Harbor of Amsterdam insight in the effect of activities in the harbor on the air quality and hence the available environmental space. [Dutch] Een nieuw rekeninstrument geeft Haven Amsterdam snel inzicht in het effect van alle activiteiten in de haven op de luchtkwaliteit en daarmee in de beschikbare milieuruimte.

  16. Fietsongevallen in Amsterdam : een analyse ten behoeve van de gemeente Amsterdam (Rapport + bijlage).

    NARCIS (Netherlands)

    Polak, P.H.

    1983-01-01

    By order of the municipality of Amsterdam a study has been made into the development of traffic hazards for cyclists in Amsterdam during the period 1977-1980, and into the distribution of this insecurity within the city, and on the type of road in relationship with traffic counts. It is shown that

  17. Board and Deans of Amsterdam University, Netherlands

    CERN Document Server

    Patrice Loïez

    2001-01-01

    L. to r.: Dr Thomas Taylor, CERN IT Deputy Division Leader; Prof. Dymph C. van den Boom, Dean Faculty of Social and Behavioural Sciences, Professor in Empirical Thoretical Pedagogy; Prof. Jos Engelen, NIKHEF/University of Amsterdam, Dutch Delegate to the Scientific Policy Committee and Chairman of the LHC Committee; Prof. Jacob van der Gaag, Dean Faculty of Economic Science and Econometry, Professor in Developmenteconomy;Mr Jan van der Boon, CERN Director of Admnistration; Prof. Jan Robert Bausch, Dean Faculty of Dental Medicine, Professor in general Dentistry; Dr Sijbolt J. Noorda, President of the Board of the University of Amsterdam.

  18. The Vision on Wind. Space for Wind Turbines in Amsterdam, Netherlands; De Windvisie. Ruimte voor windmolens in Amsterdam

    Energy Technology Data Exchange (ETDEWEB)

    Godschalk, M.; Jacobs, S.; Van der Linden, K.; Plomp, M.; Rijntjes, R.; Ruiter, R.; Ydema, G.; Zonderland, H.

    2012-07-15

    With drafting the 'Wind Vision' the city of Amsterdam takes the initiative to realize more windmills in Amsterdam. Amsterdam aims for an efficient, sustainable energy, which will also benefit the Amsterdam population economically. The 'Wind Vision' shows that there are enough opportunities to supply one third of the households in Amsterdam with renewable electricity [Dutch] Met de Windvisie neemt Amsterdam het initiatief om meer windmolens in Amsterdam te realiseren. Amsterdam streeft naar een efficiente, duurzame energieopwekking, waar Amsterdammers ook economisch van kunnen profiteren. De Windvisie laat zien dat er op dit moment in de stad kansen zijn om genoeg windmolens te realiseren om een derde van de Amsterdamse huishoudens van duurzaam opgewekte elektriciteit te voorzien.

  19. Conservering bij zoutschade; De Waag in Amsterdam

    NARCIS (Netherlands)

    Lubelli, B.A.; Hees, R.P.J. van

    2007-01-01

    In de Waag in Amsterdam bevinden zich enkele waardevolle meesterproeven van metselwerk. Deze hebben zwaar te lijden onder aantasting van zouten. Aan de auteurs werd gevraagd om de oorzaken van de scahde te onderzoeken en advies uit te brengen over mogelijke interventie om het verval aan te pakken.

  20. Organising smart city projects : lessons from Amsterdam

    NARCIS (Netherlands)

    van Winden, Willem; Oskam, Inge; van den Buuse, Daniel; Schrama, Wieke; van Dijck, Egbert-Jan

    2016-01-01

    We studied 12 smart city projects in Amsterdam, and –among other things- analysed their upscaling potential and dynamics. Here are some of our findings: First, upscaling comes in various forms: rollout, expansion and replication. In roll-out, a technology or solution that was successfully tested and

  1. 'Flying markets': activating public spaces in Amsterdam

    NARCIS (Netherlands)

    Janssens, F.; Sezer, C.

    2013-01-01

    Marketplaces can be used by city planners as urban development strategies because they have the potential to turn open spaces in the city into public space, thereby improving both the social and the spatial qualities of those spaces. In Amsterdam, however, marketplaces currently fail to activate

  2. Drug use trends in Amsterdam nightlife, 2013

    NARCIS (Netherlands)

    Wouters, M.; Nabben, T.; Benschop, A.; Korf, D.J.

    2014-01-01

    The established club scene in Amsterdam is being challenged. Bright young entrepreneurs are organising parties at alternative venues outside the city centre. In 2013, the key word is ‘rave’. The mounting numbers of students in the city are also affecting Amsterdam’s nightlife. Antenna monitors these

  3. 2. The Amsterdam Declaration on fungal nomenclature

    DEFF Research Database (Denmark)

    Hawksworth, David L.; Crous, Pedro W.; Redhead, Scott A.

    2011-01-01

    The Amsterdam Declaration on Fungal Nomenclature was agreed at an international symposium convened in Amsterdam on 19-20 April 2011 under the auspices of the International Commission on the Taxonomy of Fungi (ICTF). The purpose of the symposium was to address the issue of whether or how the current...... to advise on the problem. The Declaration recognizes the need for an orderly transition to a single-name nomenclatural system for all fungi, and to provide mechanisms to protect names that otherwise then become endangered. That is, meaning that priority should be given to the first described name, except...... where there is a younger name in general use when the first author to select a name of a pleomorphic monophyletic genus is to be followed, and suggests controversial cases are referred to a body, such as the ICTF, which will report to the Committee for Fungi. If appropriate, the ICTF could be mandated...

  4. Congenitale afwijkingen in Amsterdam: resultaten 'Amsterdam born children and their development'-studie

    NARCIS (Netherlands)

    Sikkens, J.J.; Eijsden, van M.; Bezemer, P.D.; Bakker, M.K.; Bonsel, G.J.; Wal, van der M.F.; Cornel, M.C.

    2009-01-01

    OBJECTIVE: To describe the prevalence of congenital anomalies in children born in Amsterdam and to analyse potential differences between groups based on risk factors such as ethnicity and maternal age. DESIGN: Secondary analysis of a prospective cohort study. METHODS: Between 2003 and 2004, mothers

  5. The fast Amsterdam multiprocessor (FAMP) operation system

    International Nuclear Information System (INIS)

    Gosman, D.; Hertzberger, L.O.; Holthuizen, D.J.; Por, G.J.A.; Schoorel, M.

    1981-01-01

    The Fast Amsterdam Multi Processor system (FAMP system) is developed for on-line filtering and second stage triggering. The system is based on the MC 68000 microprocessor from MOTOROLA. In this report we will describe: The FAMP operating system software, the features of the slaves and supervisor in the FAMP operating system, the communication between supervisor and slaves using the dual port memories, the communication between user programs and the operating system. The hardware as well as the application of the system will be described elsewhere. (orig.)

  6. Effectiveness of clean taxi priority incentive at Amsterdam Central Station

    NARCIS (Netherlands)

    van der Flier, A.S.; Dam, J.; van den Hoed, R.

    2017-01-01

    The municipality of Amsterdam wants to have an emission free taxi sector by 2025. In order to reach that goal, the city has taken a number of measures which favour clean taxis above conventional taxis. One of these measures is an innovative priority privilege scheme at the Amsterdam Central Station

  7. Medical anthropology: essays and reflections from an Amsterdam graduate programme

    NARCIS (Netherlands)

    van der Geest, S.; Gerrits, T.; Challinor, J.

    2014-01-01

    This volume is a collection of twenty articles by graduates of the Amsterdam Master’s in Medical Anthropology (AMMA) at the University of Amsterdam. The university is known for outstanding and innovative work in the field of medical anthropology and teaching combines a strong ethnographic basis with

  8. TCS Amsterdam Marathon 2014 : economische impact, tevredenheid, gezondheidseffecten

    NARCIS (Netherlands)

    Baart de la Faille-Deutekom, Marije; Verhoogt, Pieter

    Op zondag 19 oktober 2014 vond de 39ste editie plaats van de TCS Amsterdam Marathon. Met 44.100 deelnemers is het evenement uitgegroeid tot één van de grootste participatiesportevenementen van ons land. Dankzij het stadsparcours is de TCS Amsterdam Marathon voor zowel de deelnemers als de inwoners

  9. Work in Amsterdam on local intelligence

    International Nuclear Information System (INIS)

    Dorenbosch, J.; Gosman, D.; Holthuizen, D.J.; Vermeulen, J.C.; Hertzberger, L.O.; Tuynman, F.

    1984-07-01

    Work on local intelligence at NIKHEF-H was started in 1979 with a proposal to design a multi microprocessor system for real-time event selection in high-energy physics experiments. The outcome of this is the Fast Amsterdam Multi Processor (FAMP) system which has the following properties: a high degree of modularity, facilitating easy system expansion; the possibility to realize hierarchical structures of processing elements; use of commercially available microprocessors. The system consists of modules that mechanically fit into a CAMAC crate. From the CAMAC standard only the CAMAC power supply lines are used. The FAMP system is described as it is used in the NA11/NA32 and UA1 experiments at CERN SPS (inclusive phi-meson production; proton-antiproton collisions.) Moreover, the FAMP distributed operating system (FADOS) is discussed in its present-day and future developments. (Auth.)

  10. Struggles for success : Youth work rituals in Amsterdam and Beirut

    NARCIS (Netherlands)

    Abdallah, S.E.

    2017-01-01

    In Amsterdam and Beirut, Abdallah has ethnographically researched interactional dynamics between disadvantaged young people, regarding experiences of success, in settings of education, work, sports, and music. He analyzed how focus, mood, and bodily deployment produced shared symbols, emotional

  11. Amsterdam and London as financial centers in the eighteenth century

    OpenAIRE

    Ann M. Carlos; Larry Neal

    2011-01-01

    In the seventeenth century, Amsterdam and London developed distinctive innovations in finance through both banks and markets that facilitated the growth of trade in each city. In the eighteenth century, a symbiotic relation developed that led to bank-oriented finance in Amsterdam cooperating with market-oriented finance in London. The relationship that emerged allowed each to rise to unprecedented dominance in Europe, while the respective financial innovations in each city provided the means ...

  12. El Plan General de Amsterdam. A.U.P (II

    Directory of Open Access Journals (Sweden)

    Helma Hellinga

    1998-07-01

    Full Text Available El presente texto corresponde a la segunda parte del artículo "Het Algemeen Uitbreidingsplan van Amsterdam"publicado originalmente en el volumen Het Nieuwe Bouwen, Amsterdam 1920-1960, y cuya parte correspondiente a lo relativo a acontecimientos anteriores a la Segunda Guerra Mundial se presentó traducida en Cuaderno de Notas 5. Por consiguiente, en esta segunda entrega se recogen los desarrollos de los nuevos barrios o partir del final de la guerra hasta aproximadamente 1960

  13. Agrocentre Amsterdam. Design for agroparks in harbor areas; Agrocentrum Amsterdam. Ontwerpen voor agroparken in havengebieden

    Energy Technology Data Exchange (ETDEWEB)

    Broeze, J. [Agrotechnology en Food Innovations, Wageningen UR, Wageningen (Netherlands); Van Steekelenburg, M.G.N.; Smeets, P.J.A.M. [Alterra, Wageningen UR, Wageningen (Netherlands)

    2006-05-15

    A number of concepts for an Agropark in the Port of Amsterdam is discussed. Several variants are developed that differ in scale and functional combinations. The core of the agrocenter is to set up an energy chain with pig farming, horticulture, animal feed production, manure processing and biogas production. Mushroom cultivation and fisheries are also options [Dutch] Een aantal ontwerpen voor een Agropark in de Amsterdamse Haven wordt besproken. Verschillende varianten worden uitgewerkt die verschillen in schaalgrootte en functiecombinaties. Kern van het agrocentrum is het opzetten van een energieketen met varkenshouderij, glastuinbouw, veevoerproductie, mestverwerking en biogasproductie. Ook champignonteelt en viskweek zijn opties.

  14. Solar vision Amsterdam. Citizens and businesses go for the sun; Zonvisie Amsterdam. Burgers en bedrijven gaan voor de zon

    Energy Technology Data Exchange (ETDEWEB)

    Stam, T.; Diependaal, F.; Van ' t Hull, C.

    2013-06-15

    In the Solar Vision it is explained how the Amsterdam municipality plans to enable its citizens and businesses to realize their own solar energy project. The Solar Vision is prepared based on input from residents, businesses and institutions [Dutch] In de zonvisie staat hoe de gemeente Amsterdam haar burgers en bedrijven in staat wil stellen om hun eigen zonne-energieproject te realiseren. De zonvisie is mede opgesteld op basis van input van bewoners, bedrijven en instellingen.

  15. Soil Investigation Aspects of a Complex Metro Project in Amsterdam

    Science.gov (United States)

    Herbschleb, Jurgen

    The municipality of Amsterdam wishes to reduce the level of car traffic within the City Centre. As a consequence the public transport is to be extended by a new (bored) North/South Metro line. The excavation depths for the stations will exceed 30 m and will be constructed in difficult soft soil conditions. A further significant aspect is that the building pits are very near (3 to 5 m) to buildings of historical importance. The design philosophy of the station boxes was to determine an acceptable balance between the safety requirements and construction costs. The guidelines for the design, both for the building pits and the bored tunnel, are the predicted deformations of the adjacent building foundations. One of the more important geotechnical risks for this project is incorrect determination of the deformations arising from the building processes alongside the route of the metro. As such it should be realised that advanced finite element programs with second order material models require different geotechnical parameters than analytical models. The careful selection of calculation (soil) models, the level of safety (risk analysis), and site investigation is the start of the determination of the geotechnical parameters. This paper will focus on the interpretation of the site investigation for this complex project and will concentrate on the process followed, the problems encountered with the interpretation, the obtained results, and the used tools for geotechnical risk management.

  16. Measured and calculated NO2 concentrations in Amsterdam in 2008

    International Nuclear Information System (INIS)

    Wesseling, J.P.; Nguyen, P.L.; Van der Zee, S.

    2010-08-01

    Calculations using the Dutch standard calculation method for air quality in urban streets performed for 38 streets in Amsterdam in 2008 yield, on average, lower Nitrogen dioxide concentrations than measurements at those locations. This follows from research by the RIVM and the Public Health Service of Amsterdam (GGD Amsterdam). The average difference between measured and calculated concentrations is 11 %. At measuring locations of the National Air Quality Measuring Network in the Netherlands no significant underestimation of concentrations by the model is observed. The research was performed by the Dutch ministry of Housing, Spatial Planning en the Environment (VROM). The air quality in the streets that were investigated is mainly determined by emissions from local traffic. The measurements have been performed during thirteen periods of four weeks each, using so called 'Palmes' diffusion tubes. These measurements have been calibrated using the European reference method that is operational in the permanent measuring stations of the GGD Amsterdam. The calculations were performed using the geometry of the roads and information of the traffic at the measuring locations. Part of the differences can be explained, as some locations are not within the scope of the model. In these situations the model is known to perform slightly less. Apart from local traffic, other sources, like shipping, also contribute to the NO2 background concentrations in streets in Amsterdam. Sources that have only globally been included in the calculation of this background concentration may influence concentrations at specific locations. Further studies on this subject will be conducted in 2010. [nl

  17. Amsterdam wrist rules: A clinical decision aid

    Directory of Open Access Journals (Sweden)

    Bentohami Abdelali

    2011-10-01

    obtained of all patients entering one of the participating hospitals with trauma to the wrist. However, this is ethically and logistically not feasible and one could argue that patients, for whom no radiography is required according to their physician, are not suspected of having a distal radius fracture and thus are not part of the domain. Trial registration This study is registered at the Netherlands Trial Register (NTR 2544 and was granted permission by the Medical Ethical Committee of the Academic Medical Center Amsterdam on 06-01-2011.

  18. Experimental light scattering by small particles in Amsterdam and Granada

    Directory of Open Access Journals (Sweden)

    Volten H.

    2010-06-01

    Full Text Available We report on two light scattering instruments located in Amsterdam and Granada, respectively. These instruments enable measuring scattering matrices as functions of the scattering angle of collections of randomly orieneted irregular particles. In the past decades, the experimental setup located in Amsterdam, The Netherlands, has produced a significant amount of experimental data. Unfortunately, this setup was officially closed a couple of years ago. We also present a modernized descendant of the Dutch experimental setup recently constructed at the Instituto de Astrofísica de Andalucía (IAA in Granada, Spain. We give a brief description of the instruments, and present some representative results.

  19. The Willingness-to-Pay for Facilities at the Amsterdam Zuidas

    NARCIS (Netherlands)

    de Graaff, T.; de Groot, H.L.F.; Rodenburg, C.A.; Verhoef, E.T.

    2007-01-01

    This paper reports the results of a stated preference study investigating the willingness-to-pay (WTP) of employees at the Amsterdam Zuidas for the presence of nonshopping and shopping facilities. The Amsterdam Zuidas area, surrounding the current train-metro-tram station Amsterdam Zuid

  20. Hotels 'on hold' : Economische effecten van nieuw hotelbeleid in de gemeente Amsterdam

    NARCIS (Netherlands)

    Tieben, B.; Buunk, E.

    Amsterdam will tighten its licensing policy for new hotels. Under the new policy, the principle of “no, unless” will apply to the entire city. The development of new hotels in Amsterdam will only be possible in exceptional circumstances. SEO Amsterdam Economics has been commissioned by the

  1. An excellence initiative in liberal arts and science education: the case of Amsterdam University College

    NARCIS (Netherlands)

    van der Wende, Marijk; Wang, Q; Cheng, Y.

    2013-01-01

    Amsterdam University College (AUC) was established in 2009 as an excellence initiative jointly undertaken by the University of Amsterdam (UvA) and VU University Amsterdam (VU). AUC is a selective and residential honours college that offers an international liberal arts and sciences bachelor

  2. Lessons Learned from Field Operational Test of Integrated Network Management in Amsterdam

    NARCIS (Netherlands)

    Hoogendoorn, S.P.; van Kooten, J; Adams, R

    2016-01-01

    The Amsterdam Practical Trial (APT) is a multiyear program initiated by the Dutch Ministry of Transport and the Environment and is carried out in close cooperation by Rijkswaterstaat, the City of Amsterdam, the Province of North Holland, and the Amsterdam Metropolitan Region. The APT aims to

  3. CO2 footprint 2008 District Oud-Zuid, Amsterdam, Netherlands; CO2-voetafdruk 2008 Stadsdeel Oud-Zuid [Amsterdam

    Energy Technology Data Exchange (ETDEWEB)

    Hanekamp, E; Van Merksteijn, C [Partners for Innovation, Amsterdam (Netherlands)

    2009-06-15

    The district 'Oud-Zuid' in Amsterdam, Netherlands, plans to become CO2 neutral in 2015. For this purpose, the CO2 footprint of the district is determined and a plan of action developed. By means of scenarios, the district council can make choices for climate investments [Dutch] Stadsdeel Oud-Zuid van de gemeente Amsterdam wil CO2-neutraal zijn in 2015. Daartoe is de CO2-voetafdruk van Oud-Zuid bepaald en een plan van aanpak uitgewerkt. Met behulp van scenario's zal de stadsdeelraad keuzes kunnen maken over haar klimaatinvesteringen.

  4. Superincentive public transport contracting in the greater Amsterdam area

    NARCIS (Netherlands)

    Bakker, B.; Van de Velde, D.M.

    2009-01-01

    All suburban/regional bus services around Amsterdam City have been submitted to competitive tendering. This is done under a very innovative form of revenue-based contract that can be classified as a ‘super incentive’ contract. Payments to operators (‘subsidies’) are based on realised passenger

  5. AMSTERDAM-NIJMEGEN EVERYDAY LANGUAGE TEST - CONSTRUCTION, RELIABILITY AND VALIDITY

    NARCIS (Netherlands)

    BLOMERT, L; KEAN, ML; KOSTER, C; SCHOKKER, J

    1994-01-01

    The Amsterdam-Nijmegen Everyday Language Test (ANELT) is designed to measure, first, the level of verbal communicative abilities of aphasic patients and, second, changes in these abilities over time. The level of communicative effectiveness is determined by the adequacy of bringing a message across.

  6. Data on healthy food accessibility in Amsterdam, the Netherlands

    NARCIS (Netherlands)

    Helbich, M; Hagenauer, J

    2017-01-01

    This data descriptor introduces data on healthy food supplied by supermarkets in the city of Amsterdam, The Netherlands. In addition to two neighborhood variables (i.e., share of autochthons and average housing values), the data comprises three street network-based accessibility measures derived

  7. Fifteen years medical information sciences: the Amsterdam curriculum

    NARCIS (Netherlands)

    Jaspers, Monique W.; Fockens, Paul; Ravesloot, Jan H.; Limburg, Martien; Abu-Hanna, Ameen

    2004-01-01

    Objectives: To inform the medical informatics community on the rational, goals, evolution and present contents of the Medical Information Sciences program of the University of Amsterdam and our achievements. Methods: We elaborate on the history of our program, the philosophy, contents and

  8. Polychaeten aus den Zoologischen Museen von Leiden und Amsterdam I

    NARCIS (Netherlands)

    Augener, H.

    1933-01-01

    In der vorliegenden Arbeit ist die Untersuchung eines sehr umfangreichen Polychaeten-Materials niedergelegt, das mir von Herrn Prof. Dr. E. D. van Oort in Leiden und Herrn Prof. Dr. L. F. de Beaufort in Amsterdam zur Bearbeitung übergeben wurde. Von diesem Material ist der dem Museum in Leiden

  9. The anatomy lessons of the Amsterdam Guild of Surgeons

    NARCIS (Netherlands)

    IJpma, F.F.A.

    2014-01-01

    Mandatory lessons in anatomy, taught by the praelector anatomiae (lecturer in anatomy) of the Amsterdam Guild of Surgeons, were an important part of the surgical training starting in the 16th century. We describe how surgeons were trained approximately 350 years ago at the Surgeons’ Guild. The role

  10. Kinderen in Amsterdam : waar en hoe zij verongelukken.

    NARCIS (Netherlands)

    Wegman, F.C.M.

    1975-01-01

    The report contains a part of the study to the traffic unsafety of children in Amsterdam. Difference is made between the incidental and structural approach. In the last one is thought of intervening changes in the traffic circulation, measures in the field of planning etc. Starting point is the

  11. The acoustics of the Amsterdam Opera House 'Het Muziektheater'

    NARCIS (Netherlands)

    Lange, P.A. de; Luxemburg, L.C.J. van; Muchall, R.C.

    1996-01-01

    The first opera house ever to be built in the Netherlands opened its doors on 26 Septem-ber 1986. Erected in the heart of old Am-sterdam, the building houses the Dutch Op-era Company, the National Ballet and the Ballet Orchestra. The design and planning of the building has an interesting history.

  12. Legionella-uitbraak in Amsterdam: koeltoren als bron

    NARCIS (Netherlands)

    Hoek, J A R van den; IJzerman, E P F; Coutinho, Roel A

    2006-01-01

    During the period 6-28 July 2006, 30 confirmed cases of Legionella infection were identified in Amsterdam, 2 of which were fatal. All had a positive urinary antigen test, by which Legionella pneumophila serogroup I could be demonstrated. Consultations between the parties involved in the control of

  13. The dynamic spatial impact of Amsterdam Airport Schiphol

    NARCIS (Netherlands)

    Warffemius, P.; van der Hoorn, T.; Klaassen, H.

    2008-01-01

    This paper is about the agglomeration effect of Amsterdam Airport Schiphol and its implications for location policy regarding the airport region. We focus on a specific case, namely the important concentration of European Distribution Centers (EDCs) around the airport. The traditional answer to the

  14. Researchcode in het Academisch Medisch Centrum te Amsterdam: nuttig

    NARCIS (Netherlands)

    Vermeulen, M.

    2002-01-01

    At the Academic Medical Centre (AMC) of the University of Amsterdam, the Netherlands, it was decided to set up a research code committee. The first thing that was done was to define what were considered the most relevant types of scientific misconduct: falsification, plagiarism and invasion of

  15. Cyber Resilience in de Bestuurskamer : The Grand Conference in Amsterdam

    NARCIS (Netherlands)

    Klaver, M.H.A.

    2013-01-01

    Op 16 oktober 2012 vond in Amsterdam The Grand Conference plaats. Deze conferentie werd georganiseerd door het Centre for the Protection of National lnfrastructure (CPNI.NL) in nauwe samenwerking met de Europese Commissie, de Europese Networkand Information Security Agency (ENISA), het Amerikaanse

  16. Gentrification in Amsterdam: assessing the importance of context

    NARCIS (Netherlands)

    Hochstenbach, C.; Musterd, S.; Teernstra, A.

    2015-01-01

    This paper investigates the income levels and income developments of in-migrating, out-migrating, and sitting households in gentrifying neighbourhoods in Amsterdam over a 10-year period (1999-2008). First, to analyse these data, this paper discusses the impact of institutional and housing market

  17. HIV testing behaviour among heterosexual migrants in Amsterdam

    NARCIS (Netherlands)

    Stolte, I. G.; Gras, M.; van Benthem, B. H.; Coutinho, R. A.; van den Hoek, J. A. R.

    2003-01-01

    This cross-sectional study among heterosexual migrant groups in south-eastern Amsterdam, the city area where the largest migrant groups live, provides an insight into HIV testing behaviour in this particular group. Participants were recruited at street locations (May 1997-July 1998) and interviewed

  18. Case note: Rb Amsterdam (Vzr.) (internet, onrechtmatige publicatie, portretrecht, privacy)

    NARCIS (Netherlands)

    Alberdingk Thijm, C.A.

    2008-01-01

    De Voorzieningenrechter te Amsterdam verbiedt vereniging van pedofielen Martijn foto's van kinderen van leden van de koninklijke familie te publiceren. Door het publiceren van die foto's wordt inbreuk gemaakt op het portretrecht van die kinderen en op de persoonlijke levenssfeer van die leden van de

  19. Capturing the imaginary: Students and other tribes in Amsterdam

    NARCIS (Netherlands)

    Arbonés Aran, N.

    2015-01-01

    This thesis wants to contribute to operationalize insights into student identities, urban images and city/educational marketing and management communication. Instead of harping on the discourse of managing and increasing the positive image of Amsterdam, this thesis aims to give insight into a more

  20. Mass casualty triage after an airplane crash near Amsterdam

    NARCIS (Netherlands)

    Postma, Ingri L. E.; Weel, Hanneke; Heetveld, Martin J.; van der Zande, Ineke; Bijlsma, Taco S.; Bloemers, Frank W.; Goslings, J. Carel

    2013-01-01

    Triage is an important aspect of the management of mass casualty incidents. This study describes the triage after the Turkish Airlines Crash near Amsterdam in 2009. The results of the triage and the injuries of P3 casualties were evaluated. In addition, the role of the trauma mechanism and its

  1. De Hollandsche Schouwburg : lieu de mémoire [Amsterdam

    NARCIS (Netherlands)

    van Montfrans, M.; Mesnard, P.; Jurgenson, L.

    2016-01-01

    The Hollandsche Schouwburg, a memorial Site Until 1940, The Hollandsche Schouwburg, located just outside the Jewish quarter of Amsterdam, was a popular theatre, putting on many well-known Dutch plays. In 1941 the Nazi occupiers changed the theatre's name into Joodsche Schouwburg (Jewish Theatre).

  2. Supporting electric vehicles in freight transport in Amsterdam

    NARCIS (Netherlands)

    Trip, J.J.; Konings, J.W.

    2014-01-01

    Report written within the framework of Activity 7.4 of the Interreg IVB project E-Mobility NSR, file nr. 35-2-6-11. During the last decade the Municipality of Amsterdam has initiated quite elaborate policies to improve the air quality within the city, both for reasons of public health and spatial

  3. Smart Grids for Aquifer Thermal Energy Storage (ATES): a case study for the Amsterdam Zuidas district

    Science.gov (United States)

    Jaxa-Rozen, Marc; Bloemendal, Martin; Rostampour, Vahab

    2017-04-01

    In the context of increasingly strict requirements for building energy efficiency, Aquifer Thermal Energy Storage (ATES) systems have emerged as an effective means to reduce energy demand for space heating and cooling in larger buildings. In the Netherlands, over 2000 systems are currently active, which has already raised issues with spatial planning in some areas; current planning schemes may lack the flexibility to properly address variations in ATES operation, which are driven by uncertainties across a broad range of time scales - from daily changes in building energy demand, to decadal trends for climate or groundwater conditions. This work is therefore part of a broader research effort on ATES Smart Grids (ATES-SG), which has focused on more adaptive methods for ATES management and control. In particular, improved control schemes which allow for coordination between neighboring ATES systems may offer more robust performance under uncertainty (Rostampour & Keviczky, 2016). The case studies for the ATES-SG project have so far focused on idealized cases, and on a historical simulation of ATES development in the city center of Utrecht. This poster will present an additional case study for the city center of Amsterdam, which poses several geohydrological challenges for ATES: for instance, variable density flow due to salinity gradients in the local aquifer, and varying depths for ATES systems due to the thickness of the aquifer. To study the effect of these conditions, this case uses an existing 15-layer geohydrological model of the Amsterdam region, cropped to an area of 4500m x 2500m around the Amsterdam Zuidas district. This rapidly developing business district is one of the densest areas of ATES use in Amsterdam, with 32 well doublets and 53 monowells currently registered. The geohydrological model is integrated with GIS data to accurately represent ATES spatial planning; simulated well flows are provided by a model predictive control component. This model is

  4. Car2x with software defined networks, network functions virtualization and supercomputers technical and scientific preparations for the Amsterdam Arena telecoms fieldlab

    NARCIS (Netherlands)

    Meijer R.J.; Cushing R.; De Laat C.; Jackson P.; Klous S.; Koning R.; Makkes M.X.; Meerwijk A.

    2015-01-01

    In the invited talk 'Car2x with SDN, NFV and supercomputers' we report about how our past work with SDN [1, 2] allows the design of a smart mobility fieldlab in the huge parking lot the Amsterdam Arena. We explain how we can engineer and test software that handle the complex conditions of the Car2X

  5. Car2x with software defined networks, network functions virtualization and supercomputers : technical and scientific preparations for the Amsterdam Arena telecoms fieldlab

    NARCIS (Netherlands)

    Meijer, R.; Cushing, R.; de Laat, C.; Jackson, P.; Klous, S.; Koning, R.; Makkes, M.; Meerwijk, A.; Smari, W.W.

    2015-01-01

    In the invited talk “Car2x with SDN, NFV and supercomputers” we report about how our past work with SDN [1, 2] allows the design of a smart mobility fieldlab in the huge parking lot the Amsterdam Arena. We explain how we can engineer and test software that handle the complex conditions of the Car2X

  6. El Plan General de Amsterdam. A.U.P (I

    Directory of Open Access Journals (Sweden)

    Helma Hellinga

    1997-07-01

    Full Text Available El siguiente texto fue publicado en el volumen Het Nieuwe Bouwen, Amsterdam 1920-1960, Stedelijk Museum-Delft University Press, 1983, pp. 52-111 con el título original "Het Algemeen Uitbreidinsplan van Amsterdam" y es una exposición ampliamente documentada de los antecedentes inmediatos y el desarrollo del Plan General de 1935. La traducción que aquí se ofrece de este largo artículo es solamente parcial, incluyendo exclusivamente lo que corresponde hasta la Segunda Guerra Mundial. Por consiguiente, no se recoge su parte final relativa a la realización efectiva del Plan en los años de posguerra y en las décadas siguientes. Aparte de esta exclusión principal, se han eliminado algunos pasajes intermedios de cierta redundancia a fin de adaptarlo a un formato más reducido.

  7. Amsterdam's Airport Library Serves Passengers in 30 Languages

    Science.gov (United States)

    Dempsey, Kathy

    2011-01-01

    In the summer of 2010, Schiphol Airport in Amsterdam started offering the world's first library in an airport. This article describes Airport Library which is no ordinary library. It holds more than 1,200 items, but it lends nothing. It operates 24/7, yet it's only staffed by volunteers for 2 or 3 hours a day. It offers just nine public-access…

  8. Capita Selecta Early Music Amsterdam : Kas eestlastele ainus koht varajase muusika õpinguteks? / Taavi-Mats Utt

    Index Scriptorium Estoniae

    Utt, Taavi-Mats

    2000-01-01

    SICi (Stichting Internationale Concerten en Werkgroepen) korraldatavast varajase muusika koolitusest, seminaride sarjast "Capita Selecta Early Music Amsterdam", SICi plaanist laiendada tegevust Kiievi ja Peterburi konservatooriumidesse

  9. Falende Universiteit: Voer voor Methodologen.

    NARCIS (Netherlands)

    Verschuren, P.J.M.

    2002-01-01

    Universities do not come up to a growing demand for practice oriented research and for students trained in this type of activity. Existing methodology mainly is theory oriented. We in large part miss methodology for producing prescriptive knowledge, for a holistic approach and for design oriented

  10. Restoration of the former site of the institute for nuclear physics research in Amsterdam

    International Nuclear Information System (INIS)

    Louwrier, Pieter W.F.; Bakker, C.N.M.; Peperkamp, J.A.M.

    2000-01-01

    In 1946 the Institute for Nuclear Physics Research (IKO) started operations on the site of an old gas factory made available by the City of Amsterdam. In 1997 IKO became part of the National Institute for Nuclear Physics and High-Energy Physics (NIKHEF). In 1996 NIKHEF left the laboratory site after 50 years of occupation. The City of Amsterdam, being the owner of the area, decided that in view of the plants for development of the area, the buildings should be demolished and the area made suitable for public use. The site was used as a nuclear research laboratory since 1946, housing a synchrocyclotron from 1947 to 1977 and a linear electron accelerator from 1968 to 1977. Several nuclear chemistry laboratories were in operation from 1946 to 1984. During the 50-year period the original buildings were modified and enlarged, and new buildings were added. Before the responsibility for the area could be transferred to the City and the operating licence could be adjusted to the new situation the Dutch authorities required that a site restoration project be executed. The site restoration project was planned in stages, each of which was supervised and evaluated by the Dutch Ministry of Housing, Spatial Planning and the Environment, and the Ministry of Social Affairs and Employment. Special interest groups such as Greenpeace, LAKA Foundation (a non-profit organisation acting as a consultant for the neighbouring population), the City of Amsterdam and the local City-Boards were following the process closely. The project encompassed the following stages: Set-up of a plan for the clearance of the building structures, including the criteria for release, in consultation with the ministries involved. Radiation protection was an integral part of the plan. Investigation of possible radioactive contamination of the evacuated buildings. Six undocumented contaminations and one documented contamination were identified. Supervised removal of contaminated building structures by a

  11. Book received: Paul van den Akker, Looking for Lines: Theories of the Essence of Art and the Problem of Mannerism, Amsterdam: Amsterdam University Press 2010 including preface, contents and introduction.

    Directory of Open Access Journals (Sweden)

    Paul van den Akker

    2010-12-01

    Full Text Available Paul van den Akker, Looking for Lines: Theories of the Essence of Art and the Problem of Mannerism, Amsterdam: Amsterdam University Press 2010 including preface, contents and introduction.

  12. Shelter-based convalescence for homeless adults in Amsterdam: a descriptive study

    Directory of Open Access Journals (Sweden)

    Klazinga Niek

    2009-11-01

    Full Text Available Abstract Background Adequate support for homeless populations includes shelter and care to recuperate from illness and/or injury. This is a descriptive analysis of diagnoses and use of shelter-based convalescence in a cohort of homeless adults in Amsterdam. Methods Demographics of ill homeless adults, diagnoses, referral pattern, length of stay, discharge locations, and mortality, were collected by treating physicians during outreach care provision in a shelter-based convalescence care facility in Amsterdam, from January 2001 through October 2007. Results 629 individuals accounted for 889 admissions to the convalescence care facility. 83% were male and 53% were born in the Netherlands. The mean age was 45 years (SD 10 years. The primary physical problems were skin disorders (37%, respiratory disorders (33%, digestive disorders (24% and musculoskeletal disorders (21%. Common chronic conditions included addictions 78%, mental health disorders 20%, HIV/AIDS 11% and liver cirrhosis 5%. Referral sources were self-referred (18%, general hospitals (21% and drug clinics (27%. The median length of stay was 20 days. After (selfdischarge, 63% went back to the previous circumstances, 10% obtained housing, and 23% went to a medical or nursing setting. By March 2008, one in seven users (n = 83; 13% were known to have died, the Standard Mortality Ratio was 7.5 (95% CI: 4.1-13.5. Over the years, fewer men were admitted, with significantly more self neglect, personality disorders and cocaine use. Lengths of stay increased significantly during the study period. Conclusion Over the last years, the shelter-based convalescence care facility users were mainly homeless single males, around 45 years of age, with chronic problems due to substance use, mental health disorders and a frail physical condition, many of whom died a premature death. The facility has been flexible and responsive to the needs of the users and services available.

  13. Hinke Piersma en Jeroen Kemperman, Openstaande rekeningen. De gemeente Amsterdam en de gevolgen van roof en rechtsherstel, 1940-1950.

    Directory of Open Access Journals (Sweden)

    Regina Grüter

    2017-05-01

    Full Text Available Hinke Piersma en Jeroen Kemperman, Openstaande rekeningen. De gemeente Amsterdam en de gevolgen van roof en rechtsherstel, 1940-1950 (Amsterdam: Boom, 2015, 256 pp., isbn 978 908 953 661 7.

  14. Impact of AIDS on premature mortality in Amsterdam, 1982-1992

    NARCIS (Netherlands)

    Bindels, P. J.; Reijneveld, S. A.; Mulder-Folkerts, D. K.; Coutinho, R. A.; van den Hoek, A. A.

    1994-01-01

    OBJECTIVE: To study the impact of AIDS on premature mortality in the city of Amsterdam (1982-1992). METHODS: We combined aggregated data from the Netherlands Central Bureau for Statistics with data from the municipal death and population registry and data from the Amsterdam AIDS surveillance system

  15. Religious and territorial identities in a cosmopolitan and secular city: youth in Amsterdam

    NARCIS (Netherlands)

    Mamadouh, V.; van der Welle, I.; Brunn, S.D.

    2015-01-01

    Religion is a much contested issue in Dutch politics and more specifically in Amsterdam. We investigate whether and how religion works as an obstacle or a vehicle for integration for youth in the secular and cosmopolitan Amsterdam. First, we describe the role religion played in the process of nation

  16. Quiet Areas and the Need for Quietness in Amsterdam

    Directory of Open Access Journals (Sweden)

    Hester Booi

    2012-03-01

    Full Text Available This paper describes the Quiet Places Project in Amsterdam. The purpose of the study was to find out: (1 which public quiet places there are according to Amsterdam residents; (2 what characterizes a quiet place; (3 to what extent do residents want peace and quiet; (4 how do residents realize these needs. The factors determining the need for quietness are presented in a model showing the influence of demographic and socio-economic issues, health status, sensitiveness to noise, daily activities and the noisiness in and around home. Most important of these factors is sensitivity to noise. Elderly and less healthy people are more often sensitive to noise. People who are annoyed by sound from traffic, airplanes and the like show a higher need for quietness. People with a lively household or neighbourhood report lower needs for quietness. Visiting a quiet place and going outside to walk or bike can have a compensating effect on the need for quietness. This suggests that creating quiet places and enhancing possibilities for quiet recreation in urban environments can have a positive effect on the quality of life in the city. Objective noise levels at the quiet places were taken from environmental noise maps. This shows that there may be a preference for low transportation noise levels, but levels up to 60 dB Lday are acceptable. Apparently this depends on a relative quietness or on non-acoustic characteristics of an area: the presence of vegetation and other pleasant stimuli.

  17. Continuïteit en verandering in de handelsgeschiedenis van Amsterdam

    Directory of Open Access Journals (Sweden)

    O. Gelderblom

    2003-01-01

    Full Text Available Continuity and change in the trading history of Amsterdam,Oscar GelderblomThis article argues that Clé Lesger's Handel in Amsterdam (2001 overestimates the impact of the Dutch Revolt on the emergence of the Amsterdam market as the centre for international trade. The immigration of merchants from Brabant and Flanders at the end of the sixteenth century was a direct outcome of the increased economic interaction between Antwerp andAmsterdam after 1540. It was indeed after they had settled in the Dutch port that these newcomers accumulated most of their considerable wealth. Finally, Amsterdam's faceless markets for foodstuffs, raw materials, industrial products, and transportation services played just as important a role in the efficient exchange of information as the international networks of the Antwerp merchants.

  18. Civil society in beweging: Vier moskeeorganisaties in Amsterdam Slotervaart

    Directory of Open Access Journals (Sweden)

    Inge de Jong

    2007-03-01

    Full Text Available In this article, a picture is drawn of four mosques and affiliated foundations in the civil society of the Amsterdam city district Slotervaart. The focus in this article is concerned with civil society and religion. We took a closer look at what activities were being organised, what developments were underway, and what view the boards of the foundations and mosque councils held with respect to citizenship and the function of places of worship in Dutch society. The results of the study show that members of the board and volunteers try to build a bridge to Dutch society by appealing to the community from the perspective of theirn bonding function. The organisations find themselves in a field of force with internal and external developments in which they must function and within which they try to give their social responsibility shape.

  19. Exploring public databases to characterize urban flood risks in Amsterdam

    Science.gov (United States)

    Gaitan, Santiago; ten Veldhuis, Marie-claire; van de Giesen, Nick

    2015-04-01

    Cities worldwide are challenged by increasing urban flood risks. Precise and realistic measures are required to decide upon investment to reduce their impacts. Obvious flooding factors affecting flood risk include sewer systems performance and urban topography. However, currently implemented sewer and topographic models do not provide realistic predictions of local flooding occurrence during heavy rain events. Assessing other factors such as spatially distributed rainfall and socioeconomic characteristics may help to explain probability and impacts of urban flooding. Several public databases were analyzed: complaints about flooding made by citizens, rainfall depths (15 min and 100 Ha spatio-temporal resolution), grids describing number of inhabitants, income, and housing price (1Ha and 25Ha resolution); and buildings age. Data analysis was done using Python and GIS programming, and included spatial indexing of data, cluster analysis, and multivariate regression on the complaints. Complaints were used as a proxy to characterize flooding impacts. The cluster analysis, run for all the variables except the complaints, grouped part of the grid-cells of central Amsterdam into a highly differentiated group, covering 10% of the analyzed area, and accounting for 25% of registered complaints. The configuration of the analyzed variables in central Amsterdam coincides with a high complaint count. Remaining complaints were evenly dispersed along other groups. An adjusted R2 of 0.38 in the multivariate regression suggests that explaining power can improve if additional variables are considered. While rainfall intensity explained 4% of the incidence of complaints, population density and building age significantly explained around 20% each. Data mining of public databases proved to be a valuable tool to identify factors explaining variability in occurrence of urban pluvial flooding, though additional variables must be considered to fully explain flood risk variability.

  20. Distinct Neisseria gonorrhoeae Transmission Networks Among Men Who Have Sex With Men in Amsterdam, the Netherlands

    NARCIS (Netherlands)

    Heymans, Raymond; A Matser, Amy; Bruisten, Sylvia M.; Heijman, Titia; Geskus, Ronald B.; Speksnijder, Adrianus G. C. L.; Davidovich, Udi; de Vries, Henry J. C.; Coutinho, Roel A.; Schim van der Loeff, Maarten F.

    2012-01-01

    Background. Molecular typing was used to elucidate Neisseria gonorrhoeae transmission networks among men who have sex with men (MSM) in Amsterdam, the Netherlands. We determined whether clusters of patients infected with specific N. gonorrhoeae genotypes were related to various epidemiological

  1. Assembly of an endcap of the ATLAS silicon strip detector at NIKHEF, Amsterdam.

    CERN Multimedia

    Ginter, P

    2005-01-01

    Assembly of an endcap of the ATLAS silicon strip detector (SCT) at NIKHEF, Amsterdam. Technicians are mounting the power distribution cables on the cylinder that houses nine disks with silicon sensors.

  2. Housing liberalisation and gentrification: the social effects of tenure conversions in Amsterdam

    NARCIS (Netherlands)

    Boterman, W.R.; van Gent, W.P.C.

    2014-01-01

    Privatisation and liberalisation of the housing market are often used as governmental strategies for engineering the social composition of urban neighbourhoods. Drawing on longitudinal register data, this study reports findings from the highly-regulated housing context of Amsterdam. Through

  3. Soil and worm: on eating as relating

    NARCIS (Netherlands)

    Bertoni, F.

    2013-01-01

    Earthworms and soil combine in an ecotoxicological experiment in the Vrije Universiteit in Amsterdam. To determine the effects of a toxic compound produced by genetically modified broccoli, ecotoxicologists use the earthworm in a standardized test to understand the conditions of the soil. In the

  4. Study on depleted uranium at the airplane accident in Bijlmermeer, Amsterdam, Netherlands

    International Nuclear Information System (INIS)

    Veltkamp, A.C.; Van Hienen, J.F.A.

    1998-09-01

    The El Al airplane, which crashed in the urban area Bijlmermeer in Amsterdam, Netherlands, October 4th, 1992, contained balance weights of depleted uranium. Part of the balance weights has not been found after the disaster and its not sure what happened with the lost part. One of the options is that the uranium atomized during or after the fire. To clarify this the Dutch Civil Aviation Authority (RLD) ordered the Netherlands Energy Research Foundation (ECN) to study the fore-mentioned option on the basis of the following questions: (1) at which temperature will depleted uranium atomize and thus be released into the air?; (2) at which temperature will depleted uranium burn?; and (3) what is the chance that depleted uranium will atomize under the conditions as they occurred during the aircraft accident in the Bijlmermeer? The overall impression is that during the fire little if any uranium oxide has been released into the air. Because of lack of knowledge about the actual conditions, partial or complete oxidation can not be excluded with cast-iron certainty. 16 refs

  5. Do Neighborhood Characteristics in Amsterdam Influence Adiposity at Preschool Age?

    Directory of Open Access Journals (Sweden)

    E. Jessica Hrudey

    2015-05-01

    Full Text Available Background: Neighborhood characteristics may contribute to adiposity in young children, but results in the current literature are inconsistent. This study aimed to investigate whether objective (socioeconomic status (SES and subjective (perceived safety, satisfaction with green spaces and perceived physical disorder neighborhood characteristics directly influence child adiposity (as measured by BMI, percent body fat (%BF and waist-to-height ratio (WHtR. Methods: Data on child BMI, %BF and WHtR were obtained from the Amsterdam Born Children and their Development cohort at 5–6 years of age. Three thousand four hundred and sixty nine (3469 children were included in the analyses. Mixed models, using random intercepts for postal code area to account for neighborhood clustering effects, were used to analyze the relationships of interest. Results: Associations were observed for both perceived safety and neighborhood SES with %BF after adjustment for maternal education and ethnicity. All relationships were eliminated with the inclusion of individual covariates and parental BMI into the models. Conclusions: In general, child adiposity at age 5–6 years was not independently associated with neighborhood characteristics, although a small relationship between child %BF and both neighborhood SES and perceived safety cannot be ruled out. At this young age, familial and individual factors probably play a more important role in influencing child adiposity than neighborhood characteristics.

  6. Italian validation of the Amsterdam Preoperative Anxiety and Information Scale.

    Science.gov (United States)

    Buonanno, Pasquale; Laiola, Anna; Palumbo, Chiara; Spinelli, Gianmario; Terminiello, Virginia; Servillo, Giuseppe

    2017-07-01

    Preoperative anxiety is usually experienced by patients awaiting surgical procedures and it can negatively impact patient's outcome. The Amsterdam Preoperative Anxiety and Information Scale (APAIS) is a questionnaire created to identify anxious patients and their need for information: it has been translated and validated in many languages because of its reliability and ease of completion. To date, no Italian version of the APAIS has been produced; our aim was to translate and validate the APAIS in Italian. We produced an Italian version of the APAIS and we administered it to 110 patients undergoing elective surgery; we explored its structure by factor analysis and its reliability by Cronbach's alpha. We analyzed its external validity by confronting it to the Spielberg's State-Trait Anxiety Inventory (STAI). Sensitivity, specificity, and positive and negative predictive values of the Italian version of the APAIS were determined. The Italian version of the APAIS confirmed the original structure of the questionnaire and its internal consistency; it well correlated with the STAI-Y1, the subscale of the STAI which explore the anxiety "state." An APAIS score of 14 was found as best cutoff to distinguish anxious and non-anxious patients. The Italian translation of the APAIS showed psychometric properties similar to the original version. Its reliability and its efficiency make it a powerful tool even in Italian population to detect anxiety and need for information.

  7. The Amsterdam model for control of tattoo parlours and businesses.

    Science.gov (United States)

    Veenstra, Thijs

    2015-01-01

    In the early 1980s, an outbreak of hepatitis B in Amsterdam stood at the start of the development of the first hygiene guidelines for tattooists in The Netherlands. Ever since, infection control in tattoo practice has continued to prove its importance as tattoo-related outbreaks of infectious diseases have continued to be reported in Europe. Furthermore, the act of tattooing includes breaking the skin barrier but is performed by professionals who are not medically trained. The Ministry of Health has now implemented uniform regulations that apply to professionals who perform tattooing and apply permanent make-up. These regulations include hygiene guidelines that were developed by the National Institute for Public Health and the Environment in cooperation with representatives of the tattooing associations. The guidelines contain a list of requirements, including for the studio interior, the cleanness of the studio, the safe use of permitted equipment and products, sterilization methods, and the information provided to the customer. A permit may be granted after an inspection by the local health service, during which the act of tattooing has to be performed. It is now estimated that over 95% of all tattoos in The Netherlands were obtained at one of the almost 900 licensed studios. Reports of complications are generally low in number. We suggest that uniform European hygiene guidelines would further contribute to the safety of tattooing. © 2015 S. Karger AG, Basel.

  8. Inguinal hernia repair in the Amsterdam region 1994-1996.

    Science.gov (United States)

    Schoots, I G; van Dijkman, B; Butzelaar, R M; van Geldere, D; Simons, M P

    2001-03-01

    In the Netherlands, approximately 30,000 inguinal hernia repairs are performed yearly. At least 15% are for recurrence. New procedures are being introduced creating discussion on which technique is the best. Currently it is not possible to choose on evidence alone because of the long follow-up that is needed. In 1996 an inventory was taken of all inguinal hernia repairs that were performed in the Amsterdam region (9 hospitals). These results were compared with the results from a similar study performed in 1994. Major changes in treatment strategy were noted. The Bassini repair was replaced by Shouldice and Lichtenstein techniques. There was a significant increase in the use of prostheses for both primary and recurrent inguinal hernias. There was no significant decrease in the percentage of operations performed for recurrent hernia from 19.5% to 16.8%. However, there was a significant decrease in operations performed for early recurrences (5.1%-3.4%) (p = 0.05). These results suggest that the Shouldice and Lichtenstein repairs may be superior to the Bassini repair in terms of early hernia recurrence.

  9. HIV testing behaviour among heterosexual migrants in Amsterdam.

    Science.gov (United States)

    Stolte, I G; Gras, M; Van Benthem, B H; Coutinho, R A; van den Hoek, J A

    2003-08-01

    This cross-sectional study among heterosexual migrant groups in south-eastern Amsterdam, the city area where the largest migrant groups live, provides an insight into HIV testing behaviour in this particular group. Participants were recruited at street locations (May 1997-July 1998) and interviewed using structured questionnaires. They also donated saliva for HIV testing. In total, 705 males and 769 females were included in this study (Afro-Surinamese (45%), Dutch-Antilleans (15%) and West Africans (40%)). Prior HIV testing was reported by 38% of all migrants (556/1479), of which only a minority (28%) had actively requested HIV testing. Multivariate logistic regression showed that not actively requesting HIV testing was more likely among younger (migrants, especially women (ORwomen: 4.79, p risk should be facilitated by promoting HIV testing and by improving accurate self-assessment of risk for HIV infection, especially among the groups that do not actively request HIV testing. This would increase HIV awareness and provide the opportunity of better medical care earlier in HIV infection.

  10. Municipal climate change policies. A case study for Amsterdam

    International Nuclear Information System (INIS)

    Schol, E.; Van den Bosch, A.; Ligthart, F.A.T.M.; Roemer, J.C.; Ruijg, G.J.; Schaeffer, G.J.; Dinkelman, G.H.; Kok, I.C.; De Paauw, K.F.B.

    1999-01-01

    Insight in the local policy options with respect to climate change is provided, in this case within the sphere of influence of Amsterdam local authorities. A list of new policy options for CO 2 reduction has been made with the assistance of local policy makers and representatives of interest groups. These policy options have been divided into three qualitative scenarios: Institutional Cultural Change, Technological Innovation and Least-Regrets. The environmental, economic and other effects have been described for each policy option. The three most interesting policy options have been selected by local policymakers and representatives of interest groups during a workshop. Implementation strategies have been developed for the options selected. These strategies have been discussed during a second workshop. The reduction target, stabilisation of CO 2 emissions in 2015 compared to 1993, can be reached by a combination of all the new policy options. The three selected policy options count for 40% of this total CO 2 emission reduction. Finally, a general outline on the methodology can also be applied to other cities and municipalities. For example, this methodology can be used by participants of Cities for Climate Protection, an initiative of the International Council for Local Environmental Initiatives, or the Netherlands Climate Association. 136 refs

  11. Energy in the fast lane. Energy consumption of datahotels and ICT in Amsterdam, Netherlands; Energie snel weg. Bitspakhuizen in Amsterdam vreten ruimte en vermogen

    Energy Technology Data Exchange (ETDEWEB)

    Schrauwers, A. [ed.

    2000-11-29

    The rise of Information and Communication Technology (ICT) businesses (also known as datahotels) in the region of Amsterdam, Netherlands, causes electric power capacity problems. A brief overview is given of the required capacity of the ICT-sector in the Netherlands and the energy balance of a datahotel.

  12. Honouring the Dual Commitment: Remittance Strategies of Ghanaian Migrants in Amsterdam

    Directory of Open Access Journals (Sweden)

    Ntokozo Nzama

    2014-08-01

    Full Text Available This paper seeks to understand the rationale behind the practice of remittances and to examine its impact on the living standards and conditions of Ghanaian remitters living in Amsterdam, the Netherlands. This study investigates how remitters are able to sustain their lifestyles in a foreign country, and the sacrifices and compromises made in terms of their dual commitment to support families in Ghana and in the Netherlands. A qualitative approach using in-depth interviews was adopted in order to give research participants an opportunity to talk broadly about their lived experiences as Ghanaians residing in a foreign country and the challenges associated with sending remittances. Push factors such as political unrest, poverty, low income, and unemployment influenced movement out of Ghana. A better quality of life (better paying jobs, improved qualifications was the major pull factor that attracted migrants to the Netherlands. Remittances from migrants in the Netherlands supported the welfare of many households in Ghana, especially in terms of improved standards of living and better access to health care and education. Sending remittances is not “a feel good gesture” only, but an obligation to the family members back in Ghana. This study shows that there were major compromises and trade-offs in terms of migrant lifestyles because of their dual commitments.

  13. [The Amsterdam Dementia Screening Test in cognitively healthy and clinical samples. An update of normative data].

    Science.gov (United States)

    van Toutert, Meta; Diesfeldt, Han; Hoek, Dirk

    2016-10-01

    The six tests in the Amsterdam Dementia Screening Test (ADST) examine the cognitive domains of episodic memory (delayed picture recognition, word learning), orientation, category fluency (animals and occupations), constructional ability (figure copying) and executive function (alternating sequences). New normative data were collected in a sample of 102 elderly volunteers (aged 65-94), including subjects with medical or other health conditions, except dementia or frank cognitive impairment (MMSE > 24). Included subjects were independent in complex instrumental activities of daily living.Fluency, not the other tests, needed adjustment for age and education. A deficit score (0-1) was computed for each test. Summation (range 0-6) proved useful in differentiating patients with dementia (N = 741) from normal elderly (N = 102).Positive and negative predictive power across a range of summed deficit scores and base rates are displayed in Bayesian probability tables.In the normal elderly, delayed recall for eight words was tested and adjusted for initial recall. A recognition test mixed the target words with eight distractors. Delayed recognition was adjusted for immediate and delayed recall.The ADST and the normative data in this paper help the clinical neuropsychologist to make decisions concerning the presence or absence of neurocognitive disorder in individual elderly examinees.

  14. Smart Policies and Metropolitan Vision: the Spatial Dimension in the Experience of Amsterdam Smart City Platform

    Directory of Open Access Journals (Sweden)

    Giulia Fini

    2014-11-01

    Full Text Available The paper aims at presenting the main projects and policies recently developed by the Municipality of Amsterdam in the field of energy policies, with particular reference to the projects promoted in the context of the ASC - Amsterdam Smart City Platform. The analyzed projects and policies seem to be relevant for at least three aspects and for the matters raised by them:I. for the aim to connect policies and projects of the Amsterdam Smart City with the definition of a territorial vision for the Amsterdam metropolitan area;II. for the strong connection characterizing this experience between energy-management policies on the territory and the management’s choices related to urban planning and urban design;III. finally, the experience is relevant in relation with the consolidation of the ACS’s platform as a place where several individuals are directly involved in the management of public good and where all requests and peculiarities contribute to defining a common planning process on the energy and environmental subjects in the urban and metropolitan area.  Based on the latest, most significant information of the activities performed by Amsterdam Smart City Platform, the paper focuses on the results after four years since the projects and tests have been carried out, on the basis of a network structuring, predetermined energy-saving targets and of some space-related choices regarding the whole territory as well as ASC’s policies.

  15. Additional value of typing Noroviruses in gastroenteritis outbreaks in Amsterdam, The Netherlands.

    Science.gov (United States)

    Koek, A G; Bovée, L P M J; van den Hoek, J A R; Bos, A J; Bruisten, S M

    2006-02-01

    In Amsterdam, 17 of the 55 gastroenteritis (GI) outbreaks reported from January 2002 to May 2003 were confirmed to be caused by noroviruses (NV). In this study, we describe the molecular epidemiology of a group of nine outbreaks associated with a catering firm and two outbreaks, 5 months apart, in an Amsterdam hospital. All outbreaks were typed to confirm their linkage, and the hospital-related cases were studied to see if the two outbreaks were caused by one persisting NV strain or by a reintroduction after 5 months. For the outbreaks associated with the catering firm one NV genogroup I strain was found which was identical in sequence among customers and employees of the caterer. This was not the strain that predominantly circulated in 2002/2003 in and around Amsterdam, which was the NV genogroup II4 "new variant" (GgII4nv) strain. In the Amsterdam hospital, the two outbreaks were caused by this predominant GgII4nv type, and we argue that NV was most likely reintroduced in the second outbreak from the Amsterdam community.

  16. The Compilation of Multilingual Concept Literacy Glossaries at the University of Cape Town: A Lexicographical Function Theoretical Approach Die samestelling van veeltaligekonsep-geletterheidswoordelyste by die Universiteit van Kaapstad: 'n Leksikografiesefunksieteoretiese benadering.

    Directory of Open Access Journals (Sweden)

    Dion Nkomo

    2012-01-01

    Full Text Available

    This article proposes a lexicographical approach to the compilation of multilingual concept literacy glossaries which may play a very important role in supporting students at institutions of higher education. In order to support concept literacy, especially for students for whom English is not the native language, a number of universities in South Africa are compiling multilingual glossaries through which the use of languages other than English may be employed as auxiliary media. Terminologies in languages other than English are developed by translating English terms or coining new terms in these languages to exploit the native language competence of most students. The glossary project at the University of Cape Town (UCT which was conceived under the auspices of the Multilingualism Education Project (MEP is discussed. It is shown that the UCT glossaries are compiled using methods consistent with those employed in modern lexicography or proffered in lexicographical theory. The lexicographical function theory is specifically used to account for the glossaries and their production. It is suggested that modern lexicography can provide useful guidance for the production of glossaries, given that the earliest glossaries constitute the humble beginnings of lexicography.

    Hierdie artikel stel 'n leksikografiese benadering tot die samestelling van meertaligekonsep-geletterheidswoordelyste voor wat 'n baie belangrike rol kan speel by die ondersteuning van studente by instellings vir hoër onderwys. Om konsepgeletterdheid te ondersteun, veral vir studente vir wie Engels nie die moedertaal is nie, stel 'n aantal universiteite in Suid-Afrika meertalige woordelyste saam waardeur die gebruik van ander tale as Engels as hulpmedia aangewend kan word. Terminologieë in ander tale as Engels word ontwikkel deur Engelse terme te vertaal of nuwe terme in hierdie tale te skep om die moedertaalvaardigheid van die meeste

  17. Ordinary People in the New World: The City of Amsterdam, Colonial Policy, and Initiatives from Below, 1656-1664

    NARCIS (Netherlands)

    Blom, F.; Looijesteijn, H.; Jacob, M.C.; Secretan, C.

    2013-01-01

    Between 1656 and 1664 the City of Amsterdam, uniquely, possessed a "City Colony" in the Dutch colony of New Netherland. Called New Amstel, this fledgling colony on the South River—the current Delaware—for a brief time cemented the commitment of Amsterdam to the preservation of the Dutch colony in

  18. Urinary uranium and kidney function parameters in professional assistance workers in the Epidemiological Study Air Disaster in Amsterdam (ESADA)

    NARCIS (Netherlands)

    J.A. Bijlsma (Joost); P. Slottje (Pauline); A.C. Huizink (Anja); J.W.R. Twisk (Jos); G.B. van der Voet (Gijsbert); F.A. de Wolff (Frederik); F. Vanhaecke (Frank); L. Moens (Luc); T. Smid (Tjabe)

    2008-01-01

    textabstractBackground. The Epidemiological Study Air Disaster in Amsterdam (ESADA) aimed to assess long-term health effects in professional assistance workers involved in the 1992 air disaster in Amsterdam. As part of ESADA indications of nephrotoxicity due to exposure to uranium from the balance

  19. Urinary uranium and kidney function parameters in professional assistance workers in the Epidemiological Study Air Disaster in Amsterdam (ESADA)

    NARCIS (Netherlands)

    Bijlsma, Joost A.; Slottje, Pauline; Huizink, Anja C.; Twisk, Jos W. R.; van der Voet, Gijsbert B.; de Wolff, Frederik A.; Vanhaecke, Frank; Moens, Luc; Smid, Tjabe

    2008-01-01

    The Epidemiological Study Air Disaster in Amsterdam (ESADA) aimed to assess long-term health effects in professional assistance workers involved in the 1992 air disaster in Amsterdam. As part of ESADA indications of nephrotoxicity due to exposure to uranium from the balance weights of the crashed

  20. The creation of play spaces in twentieth-century Amsterdam: from an intervention of civil actors to a public policy

    NARCIS (Netherlands)

    Verstrate, L.; Karsten, L.

    2011-01-01

    This case study uncovers a turning point in the production of play space in Amsterdam. Whereas over the first half of the twentieth century the creation of play spaces used to be the primary responsibility of the Amsterdam civil society, this situation started to change after the Second World War.

  1. Speaking of Belonging: Learning to Be "Good Citizens" in the Context of Voluntary Language Coaching Projects in Amsterdam, the Netherlands

    Science.gov (United States)

    Mosher, Rhiannon

    2015-01-01

    This article explores citizenship education for adult immigrants through informal language education in Amsterdam, the Netherlands. Based on data collected over thirteen months of ethnographic research among volunteer Dutch language coaches in Amsterdam, the primary methods used in this study were in-depth semi-structured interviews and…

  2. The air quality impact of the port of Amsterdam on its environment: Development of an air quality tool

    NARCIS (Netherlands)

    Klok, L.; Breemen, T. van; Hulskotte, J.

    2011-01-01

    Due to the expansion of the Port of Amsterdam, Urban development and the construction of new highways, air pollution levels are about to exceed European guidelines in and around the port region of Amsterdam. To assess the air quality in this region and the impact of theport emissions on its

  3. Career choices of migrant artists between Amsterdam and Antwerp. The Van Nieulandt brothers

    Directory of Open Access Journals (Sweden)

    Eric Jan Sluijter

    2015-12-01

    Full Text Available This essay examines the career choices of the brothers Guilliam II and Adriaen II van Nieulandt. Both were born in Antwerp but moved with their parents to Amsterdam at a young age. Guilliam returned to Antwerp to make his career, while Adriaen became embedded in Amsterdam’s artistic community. All members of their family – in Antwerp, Amsterdam and Rome – remained in close contact with each other, though changes in the religious and political culture left their mark on their professional decisions. Their choices did not yield artistic innovations but conservative styles and subjects based on shared Netherlandish traditions with a strong international flavour.

  4. Travelling Concepts : Text, Subjectivity, Hybridity : Amsterdam, 11, 12 y 13 de enero de 2000

    OpenAIRE

    Barros, Claudia; Zusman, Perla Brígida

    2000-01-01

    La Amsterdam School for Cultural Analysis, Theory and Intepretation (ASCA) ha organizado, los días 11, 12 y 13 de enero del 2000, el evento: Travelling Concepts: Text, Subjectivity, Hybridity. A la luz del «giro cultural» que la geografía ha realizado a partir de la década de 1990, la participación en encuentros de esta índole resultan de interés para incentivar los intercambios entre el campo de la geografía y el de los estudios culturales. L'Amsterdam School for Cultural Analysis, Theory...

  5. Designing Public Space for Mobility: Contestation, Negotiation and Experiment at Amsterdam Airport Schiphol

    DEFF Research Database (Denmark)

    Nikolaeva, Anna

    2012-01-01

    The paper investigates airport design, using the example of Amsterdam Airport Schiphol, from the point of view of managers, architects and designers. It is argued that existing accounts of the airport as a space of transit as well as a place for shopping and entertainment have underrated the comp......The paper investigates airport design, using the example of Amsterdam Airport Schiphol, from the point of view of managers, architects and designers. It is argued that existing accounts of the airport as a space of transit as well as a place for shopping and entertainment have underrated...

  6. The Island of Amsterdamøya: A key site for studying past climate in the Arctic Archipelago of Svalbard

    Science.gov (United States)

    Bakke, Jostein; Balascio, Nicholas; van der Bilt, Willem G. M.; Bradley, Raymond; D'Andrea, William J.; Gjerde, Marthe; Ólafsdóttir, Sædís; Røthe, Torgeir; De Wet, Greg

    2018-03-01

    This paper introduces a series of articles assembled in a special issue that explore Holocene climate evolution, as recorded in lakes on the Island of Amsterdamøya on the westernmost fringe of the Arctic Svalbard archipelago. Due to its location near the interface of oceanic and atmospheric systems sourced from Arctic and Atlantic regions, Amsterdamøya is a key site for recording the terrestrial response to marine and atmospheric changes. We employed multi-proxy approaches on lake sediments, integrating physical, biogeochemical, and isotopic analyses to infer past changes in temperature, precipitation, and glacier activity. The results comprise a series of quantitative Holocene-length paleoclimate reconstructions that reveal different aspects of past climate change. Each of the four papers addresses various facets of the Holocene climate history of north-western Svalbard, including a reconstruction of the Annabreen glacier based on the sedimentology of the distal glacier-fed lake Gjøavatnet, a reconstruction of changing hydrologic conditions based on sedimentology and stratigraphy in Lake Hakluytvatnet, reconstruction of summer temperature based on alkenone paleothermometry from lakes Hakluytvatnet and Hajeren, and a hydrogen isotope-based hydrological reconstruction from lake Hakluytvatnet. We also present high-resolution paleomagnetic secular variation data from the same lake, which document important regional magnetic field variations and demonstrate the potential for use in synchronizing Holocene sedimentary records in the Arctic. The paleoclimate picture that emerges is one of early Holocene warmth from ca. 10.5 ka BP interrupted by transient cooling ca. 10-8ka BP, and followed by cooling that mostly manifested as two stepwise events ca. 7 and 4 ka BP. The past 4ka were characterized by dynamic glaciers and summer temperature fluctuations decoupled from the declining summer insolation.

  7. Optimality aspects with assigning of Magistrates to Sessions and Teams of the Amsterdam Criminal Court

    NARCIS (Netherlands)

    Schreuder, J.A.M.; Burke, E.K.; Rudova, H.

    2006-01-01

    In the criminal court (Arrondissements rechtbank, sector strafrecht) of Amsterdam the assignment of magistrates (judges, officers, etc) to sessions needed to handle the cases presented, has become a problem last years mainly caused by the increase of so called mega-sessions. One complicating factor

  8. The organisational legitimacy of immigrant groups: Turks and Moroccans in Amsterdam

    NARCIS (Netherlands)

    Vermeulen, F.; Brünger, M.

    2014-01-01

    This article analyses the organising process of Turkish and Moroccan immigrant groups in Amsterdam over a long-term period. In it, we argue that organisational legitimacy is the driving factor of an organisational process. We understand legitimacy as a generalised belief that an organisation's

  9. The ''Amsterdam Castle'': A case study of wiggle matching and the proper calibration curve

    NARCIS (Netherlands)

    van der Plicht, J; Jansma, E|info:eu-repo/dai/nl/074965255; Kars, H

    1995-01-01

    We have performed a high-precision 14C wiggle-matching study on two oak beams from the "Castle of Amsterdam". These beams are also dated by dendrochronology. Our two dating methods can only be made consistent using the recommended calibration curve (1986) instead of the revised one (1993).

  10. Increasing awareness and prompting HIV testing: Contributions of Amsterdam HIV Testing Week 2016.

    NARCIS (Netherlands)

    den Daas, C; Meddens, E M; van Bergen, Jeam; de Bree, G J; Hogewoning, A A; Brinkman, K; de Wit, Jbf

    2018-01-01

    We evaluated Amsterdam HIV Testing Week (HTW) 2016 regarding its primary goals of raising awareness and prompting HIV testing. Participating services offered free, anonymous HIV testing, with a focus on reaching men who have sex with men (MSM) and people with a non-western migration background.

  11. Ecstacy and cocaine : Patterns of use among prime age individuals in Amsterdam

    NARCIS (Netherlands)

    van Ours, J.C.

    2005-01-01

    This paper uses information about prime age individuals living in Amsterdam to study the patterns of use of ecstasy and cocaine.The information was collected in surveys in 1994, 1997 and 2001.The analysis shows that the use of ecstasy and cocaine is mainly influenced by calendar year, family

  12. Sustainable entrepreneurship ecosystem emergence and development : a case study of Amsterdam Denim City

    NARCIS (Netherlands)

    DiVito, Lori; Ingen-Housz, Zita

    2017-01-01

    Our paper investigates the interaction of mechanisms that drive the emergence and development of a sustainable entrepreneurship ecosystem (SEE). We study a specific geographic context, the Amsterdam metropolitan area, and a specific industrial context, the denim industry. We conducted a qualitative,

  13. Location-based technology and game-based learning in secondary education: learning about medieval Amsterdam

    NARCIS (Netherlands)

    Admiraal, W.; Akkerman, S.; Huizenga, J.; van Zeijts, H.

    2009-01-01

    Mobile games in education are excellent ways to combine situated, active and constructive learning with fun. In the mobile city game Frequency 1550 teams -of four students each- step into the game's world. With help of the Internet, smart phones and GPS technology, Amsterdam changes into a medieval

  14. Intraday Analysis of Market Integration: Dutch Blue Chips traded in Amsterdam and New York

    NARCIS (Netherlands)

    A.J. Menkveld (Bert)

    2000-01-01

    textabstractMarket integration is studied for Dutch stocks cross-listed at the NYSE. Trading starts in Amsterdam and ends in New York with a one-hour overlap. Both markets are not perfectly integrated in that they can be viewed as one market with the well-documented U-shape in volatility, volume and

  15. Placing prostitution: the spatial-sexual order of Amsterdam and its growth coalition

    NARCIS (Netherlands)

    Aalbers, M.B.; Deinema, M.

    2012-01-01

    Amsterdam's red-light district is the paradigmatic case of window prostitution, but it is not a stable case: both the regulatory context of prostitution in the Netherlands and the socio-spatial dynamics of the district have changed throughout the years. This paper advances our understanding of

  16. The Lost Art of Regulated tolerance? Fifteen Years of Regulating Vices in Amsterdam

    NARCIS (Netherlands)

    Huisman, W.; Nelen, J.M.

    2014-01-01

    Fifteen years ago, Brants explored the idiosyncrasies of Dutch policy with regard to prostitution, focusing on the situation in the Dutch capital. Amsterdam was on the brink of the enactment of new policies and legislation regarding the legalization of prostitution and the crackdown on organized

  17. Die Lehre aus Amsterdam: Neue Urbanität in der alten Stadt

    NARCIS (Netherlands)

    Kloosterman, R.C.

    2010-01-01

    Cultural industries as an instrument seem to offer a way to revitalize derelict areas in and around the urban core that have been blighted by deindustrialization in the 1970 and 1980s. In this article, we explore how cultural industries have affected two such areas close to the Amsterdam central

  18. Children of immigrants in schools in New York and amsterdam : The factors shaping attainment

    NARCIS (Netherlands)

    Crul, Maurice; Holdaway, Jennifer

    Background/Context: This article considers the ways in which school systems in New York City and Amsterdam have shaped the educational trajectories of two groups of relatively disadvantaged immigrant youth: the children of Dominican immigrants in New York and the children of Moroccan immigrants in

  19. Risk behavior and social-cognitive determinants of condom use among ethnic minority communities in Amsterdam

    NARCIS (Netherlands)

    Wiggers, Louise C. W.; de Wit, John B. F.; Gras, Mitzi J.; Coutinho, Roel A.; van den Hoek, Anneke

    2003-01-01

    This study assessed sexual risk behavior and determinants of condom use among migrants in Amsterdam, the Netherlands. We tested the predictive utility of constructs derived from the health belief model and the theory of planned behavior. Data were collected by means of a cross-sectional study in a

  20. Winkelen als bevrijding? Vrouwen en stedelijke ruimte in Amsterdam, 1863-1913

    NARCIS (Netherlands)

    Furnée, W.J.H.

    2015-01-01

    Shopping as Liberation?: Women and Urban Space in Amsterdam, 1863-1913 In recent decades several historians have argued that the emergence of shopping as a leisure activity in the second half of the nineteenth century substantially enhanced women’s freedom of movement in public spaces and promoted

  1. Congenital anomalies in the teratological collection of Museum Vrolik in Amsterdam, The Netherlands. II: Skeletal dysplasias

    NARCIS (Netherlands)

    Oostra, R. J.; Baljet, B.; Dijkstra, P. F.; Hennekam, R. C.

    1998-01-01

    The Museum Vrolik collection of the Department of Anatomy and Embryology of the University of Amsterdam, founded by Gerardus Vrolik (1775-1859) and his son Willem Vrolik (1801-1863), consists of more than five thousand specimens of human and animal anatomy, embryology, pathology, and congenital

  2. Prevalence of Chlamydophila psittaci in fecal droppings from feral pigeons in Amsterdam, The Netherlands

    NARCIS (Netherlands)

    Heddema, Edou R.; ter Sluis, Sietske; Buys, Jan A.; Vandenbroucke-Grauls, Christina M. J. E.; van Wijnen, Joop H.; Visser, Caroline E.

    2006-01-01

    In many cities, the feral rock dove is an abundant bird species that can harbor Chlamydophila psittaci. We determined the prevalence and genotype of C. psittaci in fresh fecal samples from feral pigeons in Amsterdam, The Netherlands. The prevalence was 7.9% overall (26/331; 95% confidence interval,

  3. Let's do Diversity : report of the University of Amsterdam Diversity Commission

    NARCIS (Netherlands)

    G. Wekker (Gloria); M.W. Slootman (Marieke W.); R.A. Icaza Garza (Rosalba); H. Jansen (Hans); R. Vázquez (Rolando)

    2016-01-01

    markdownabstractBetween March and September 2016, the Diversity Commission studied diversity at the University of Amsterdam. Recognizing that the challenge to enhance social justice at the University requires active engagement with diversity, the Commission approached the topic along two lines:

  4. The association between ethnicity and vaginal microbiota composition in Amsterdam, the Netherlands

    NARCIS (Netherlands)

    Borgdorff, Hanneke; van der Veer, Charlotte; van Houdt, Robin; Alberts, Catharina J.; de Vries, Henry J.; Bruisten, Sylvia M.; Snijder, Marieke B.; Prins, Maria; Geerlings, Suzanne E.; Schim van der Loeff, Maarten F.; van de Wijgert, Janneke H. H. M.

    2017-01-01

    To evaluate whether ethnicity is independently associated with vaginal microbiota (VMB) composition in women living in Amsterdam, the Netherlands, as has been shown for American women. Women (18-34 years, non-pregnant, N = 610) representing the six largest ethnic groups (Dutch, African Surinamese,

  5. The Micropolitics of Criminalisation: Power, Resistance and the Amsterdam Squatting Movement

    NARCIS (Netherlands)

    Dadusc, D.

    2017-01-01

    This research analyses how the criminalisation of the Amsterdam squatting movement works. The key research question addresses how criminalisation operates as a technology of government, what kind of relations of power are constituted through this processes, and how these are experienced and

  6. Desalination of historical brick masonry. The case of the Waag building in Amsterdam

    NARCIS (Netherlands)

    Lubelli, B.A.; Hees, R.P.J. van

    2013-01-01

    The Waag building in Amsterdam (148g) (Figure 1) is a remnant of the former city walls (14g 1_ 1492); originally it was one of the city gates (St Anthoniespoort), When in the late six_ teenth century the city expanded, the walls were demolished and the building ceased to function as a gate, The

  7. HIV-surveys bij hoog-risicogroepen in Amsterdam 2003-2004

    NARCIS (Netherlands)

    van Veen MG; Wagemans MAJ; Op de Coul ELM; Fennema JSA; van der Helm TCM; Walter J; Prins M; van de Laar MJW; CIE

    2006-01-01

    Hoog-risicogroepen kunnen een brugfunctie vervullen voor de verspreiding van HIV en SOA naar de rest van de bevolking in Nederland. Dit blijkt uit de HIV-survey onder migranten en prostituees en hun klanten die is uitgevoerd in Amsterdam. Hierbij is gevonden dat de HIV-prevalentie onder

  8. Tattooing, permanent makeup and piercing in Amsterdam; guidelines, legislation and monitoring

    NARCIS (Netherlands)

    Worp, J.; Boonstra, A.; Coutinho, R. A.; van den Hoek, J. A. R.

    2006-01-01

    Tattooing, body piercing and permanent makeup are increasing in popularity. Here, we describe the procedures involved in these practices, their risks, the content of guidelines developed by the Municipal Health Service in Amsterdam (the Netherlands) to reduce infection risks, the legislation in the

  9. House Price Risk and Sub-District House Price Dynamics : The Case of Amsterdam

    NARCIS (Netherlands)

    Teye, A.L.; de Haan, J.; Elsinga, M.G.

    2016-01-01

    The recent Global Financial Crisis has lent even greater urgency to the need for households to understand the risks and dynamics of the residential property market better. This paper uses a rich dataset on individual residential property transactions between 1995 and 2014 in Amsterdam to study the

  10. Renewable energy technology feasibility study for a new hotel building in Amsterdam

    NARCIS (Netherlands)

    Bischoff, J.M.A.; Hensen, J.L.M.; Hassan Mohamed, Mohamed; Philips, C.

    2016-01-01

    This article discusses the economic and environmental feasibility of applying renewable energy technology (RET) to a new hotel building in Amsterdam using the simulation software HOMER. The study shows that applying PV including a surface up to 750m² can be both economical and environmentally

  11. The fight against human trafficking in the Amsterdam Red Light District

    NARCIS (Netherlands)

    Spapens, A.C.M.; Rijken, C.R.J.J.

    The Amsterdam Red Light District is famous for its sex-oriented businesses. Although prostitution was legalized in 2000, this did not end some of its criminal side effects, particularly the trafficking in women. In an effort to combat human trafficking in the district, the local authorities launched

  12. Veilig op de fiets in Amsterdam : de campagne 'Veilig op de fiets' : effecten, process en motivatie.

    NARCIS (Netherlands)

    Twisk, D.A.M.

    1994-01-01

    A campaign was organised to increase cycling safety in the Dutch municipality of Amsterdam. The campaign was based on marketing principles, and centred on cyclists' needs in safety and comfort. The emphasis in the 'Safe Cycling' campaign was on infrastructure improvements and police enforcement.

  13. Children's social capital in the segregated context of Amsterdam: an historical-geographical approach

    NARCIS (Netherlands)

    Karsten, L.

    2011-01-01

    This paper addresses children’s social capital across space and over time. Empirical evidence comes from an in-depth study of changes in children’s daily lives in Amsterdam over the past 50 years. Different dimensions of religious and ethnic segregation at school and in the neighbourhood have

  14. Romance Languages and Linguistic Theory 2013: Selected Papers from 'Going Romance' Amsterdam 2013

    NARCIS (Netherlands)

    Aboh, E.O.; Schaeffer, J.C.; Sleeman, P.

    2015-01-01

    The Going Romance conferences are a major European annual discussion forum for theoretically relevant research on Romance languages. This volume assembles a selection of the papers that were presented at the 27th edition of Going Romance, which was organized by the University of Amsterdam in

  15. Shelter-based convalescence for homeless adults in Amsterdam: a descriptive study

    NARCIS (Netherlands)

    van Laere, Igor; de Wit, Matty; Klazinga, Niek

    2009-01-01

    ABSTRACT: BACKGROUND: Adequate support for homeless populations includes shelter and care to recuperate from illness and/or injury. This is a descriptive analysis of diagnoses and use of shelter-based convalescence in a cohort of homeless adults in Amsterdam. METHODS: Demographics of ill homeless

  16. Amsterdam Short-Term Memory test: a new procedure for the detection of feigned memory deficits

    NARCIS (Netherlands)

    Schagen, S.; Schmand, B.; de Sterke, S.; Lindeboom, J.

    1997-01-01

    The validity of two malingering tests, the newly developed Amsterdam Short-Term Memory (ASTM) test and the Distraction test (Baker, Hanley, Jackson, Kimmance, & Slade, 1993) was examined in a group of patients with closed-head injury (CHI), a normal control group, and a control group with

  17. Data-driven Travel Demand Modelling and Agent-based Traffic Simulation in Amsterdam Urban Area

    NARCIS (Netherlands)

    Melnikov, V.R.; Krzhizhanovskaya, V.V.; Lees, M.H.; Boukhanovsky, A.V.

    2016-01-01

    The goal of this project is the development of a large-scale agent-based traffic simulation system for Amsterdam urban area, validated on sensor data and adjusted for decision support in critical situations and for policy making in sustainable city development, emission control and electric car

  18. Salt damage and RH changes: The case of the Waag Building in Amsterdam

    NARCIS (Netherlands)

    Hees, R.P.J. van; Lubelli, B.A.

    2007-01-01

    Changes in the air MM can cause damage to building materials contaminated with hygroscopic saus, even in the absence of any other moishwe source. This phenomenon has been observed in the case of the iflag build ing in Amsterdam, affècted by severe salt decay. The investigation, canied out by means

  19. Interobserver reliability of the Amsterdam Severity Scale in Stenosing Tenosynovitis (ASSiST)

    NARCIS (Netherlands)

    Peter, W.F.; Steultjens, M.P.M.; Mesman, T.; Dekker, J.; Hoeksma, A.F.

    2009-01-01

    STUDY DESIGN: Interobserver reliability study. INTRODUCTION: A scale was developed to measure the severity of stenosing tenosynovitis: the Amsterdam Severity Scale in Stenosing Tenosynovitis (ASSiST). PURPOSE OF THE STUDY: To study the interobserver reliability of the ASSiST. METHODS: Patients

  20. Microscopical examination of the effectiveness of conservation-treatment methods of the National Monument in Amsterdam

    NARCIS (Netherlands)

    Larbi, J.A.; Hees, R.P.J. van

    1999-01-01

    The Dutch National Monument in Amsterdam, a World War-II memorial structure, was built with an outer face consisting of slabs of travertine. In 1995, the masonry structure forming the core of the monument showed severe deterioration. In order to determine the actual cause of deterioration and to

  1. Amsterdam Book Design: Irma Boom, Hansje van Halem, Lesley Moore = Amsterdamskij knižnyj dizajn

    NARCIS (Netherlands)

    Lommen, M.

    2012-01-01

    Published on the occasion of the exhibition 'Amsterdam Book Design : Irma Boom, Hansje van Halem, Lesley Moore', from May 26th until June 17th 2012 in the creative platform Taiga Space, Saint Petersburg. In cooperation with Netherlands Institute Saint-Petersburg.

  2. Occupational exposure to bloodborne viruses in the Amsterdam police force, 2000-2003

    NARCIS (Netherlands)

    Sonder, Gerard J. B.; Bovée, Lian P. M. J.; Coutinho, Roel A.; Baayen, Dorothé; Spaargaren, Joke; van den Hoek, Anneke

    2005-01-01

    Objectives: To assess and evaluate the rate and outcome of occupational exposure to hepatitis B virus (HBV), hepatitis C virus (HCV), and human immunodeficiency virus (HIV) in the Amsterdam police force. Methods: Retrospectively, all accidents with risk for viral transmission reported to the

  3. Patterns of retail location and urban form in Amsterdam in the mid-eighteenth century

    NARCIS (Netherlands)

    Lesger, C.

    2011-01-01

    In this article location theory is used to map and analyse the patterns of retail location in Amsterdam in the eighteenth century. In the city centre as well as along the main axes to markets and the city gates the retailing of shopping goods (textiles, consumer durables) was much more prominent

  4. The Central Institute forBrain Research in Amsterdam and its directors

    NARCIS (Netherlands)

    Eling, Paul; Hofman, Michel A

    2014-01-01

    The Central Institute for Brain Research was founded in Amsterdam in 1908 as part of an international effort to study the nervous system with multiple institutions and various disciplines. The development of research in the past hundred years at the Brain Institute has hardly been documented. We

  5. The importance of agglomeration effects for distribution centres around Amsterdam Airport Schiphol

    NARCIS (Netherlands)

    Warffemius, P.; van der Hoorn, T.; Klaassen, H.

    2010-01-01

    Amsterdam Airport Schiphol is a main European airport and represents an important concentration of European distribution centres (EDCs). It is commonly assumed that distribution centres are attracted to the airport region because of its air transport services. However, if one considers economies of

  6. Moving faces, looking places: validation of the Amsterdam Dynamic Facial Expression Set (ADFES)

    NARCIS (Netherlands)

    van der Schalk, J.; Hawk, S.T.; Fischer, A.H.; Doosje, B.

    2011-01-01

    We report two studies validating a new standardized set of filmed emotion expressions, the Amsterdam Dynamic Facial Expression Set (ADFES). The ADFES is distinct from existing datasets in that it includes a face-forward version and two different head-turning versions (faces turning toward and away

  7. Technical feasibility study for a solar energy system at Amsterdam Airport Schiphol (AAS)

    NARCIS (Netherlands)

    Janssen, P.N.J.W.; Myrzik, J.M.A.; Kling, W.L.; Reinders, L.

    2010-01-01

    This work arises within the framework of the introduction of renewable energies at Amsterdam Airport Schiphol (AAS) and the focus is on the technical feasibility of a solar energy system (SES) on ground level. The flight safety must always be guaranteed if solar panels are implemented on AAS. The

  8. Risks and interrelationships of subdistrict house prices : the case of Amsterdam

    NARCIS (Netherlands)

    Teye, A.L.; de Haan, J.G.; Elsinga, M.G.

    2017-01-01

    This paper uses individual house transaction data from 1995 to 2014 in Amsterdam to explore the risks and interrelationships of the subdistrict house prices. Simple indicators suggest that house prices grow faster and are more risky in the central business district and its immediate surrounding

  9. Reevaluation of the Amsterdam Inventory for Auditory Disability and Handicap Using Item Response Theory

    Science.gov (United States)

    Hospers, J. Mirjam Boeschen; Smits, Niels; Smits, Cas; Stam, Mariska; Terwee, Caroline B.; Kramer, Sophia E.

    2016-01-01

    Purpose: We reevaluated the psychometric properties of the Amsterdam Inventory for Auditory Disability and Handicap (AIADH; Kramer, Kapteyn, Festen, & Tobi, 1995) using item response theory. Item response theory describes item functioning along an ability continuum. Method: Cross-sectional data from 2,352 adults with and without hearing…

  10. Hypertension control in a large multi-ethnic cohort in Amsterdam, The Netherlands: the HELIUS study

    NARCIS (Netherlands)

    Agyemang, Charles; Kieft, Suzanne; Snijder, Marieke B.; Beune, Erik J.; van den Born, Bert-Jan; Brewster, Lizzy M.; Ujcic-Voortman, Joanne J.; Bindraban, Navin; van Montfrans, Gert; Peters, Ron J.; Stronks, Karien

    2015-01-01

    Hypertension is a major problem among European ethnic minority groups. We assessed the current situation of hypertension prevalence and its management among a multi-ethnic population in Amsterdam, The Netherlands. Data from the HELIUS study were used including 12,974 participants (1871 Ghanaian,

  11. Additional value of typing Noroviruses in gastroenteritis outbreaks in Amsterdam, The Netherlands

    NARCIS (Netherlands)

    Koek, A. G.; Bovée, L. P. M. J.; van den Hoek, J. A. R.; Bos, A. J.; Bruisten, S. M.

    2006-01-01

    In Amsterdam, 17 of the 55 gastroenteritis (GI) outbreaks reported from January 2002 to May 2003 were confirmed to be caused by noroviruses (NV). In this study, we describe the molecular epidemiology of a group of nine outbreaks associated with a catering firm and two outbreaks, 5 months apart, in

  12. When the spell is broken: gentrification, urban tourism and privileged discontent in the Amsterdam canal district

    NARCIS (Netherlands)

    Pinkster, F.M.; Boterman, W.R.

    2017-01-01

    Expansion of urban tourism in historic districts in European cities is putting increasing pressure on these areas as places to live. In Amsterdam, an ever-growing number of tourists visit the famous canal district, which also forms the home of a group of long-term, upper-middle-class residents.

  13. Advertising Amsterdam: the rise and growth of an international advertising industry

    NARCIS (Netherlands)

    Röling, R.

    2011-01-01

    Cultural industries have experienced dynamic growth in the Netherlands since the 1990s. Amsterdam is the indisputable cultural and creative capital of the country and one of the city’s most prominent cultural industries is the advertising industry. This study has explored processes of globalisation

  14. The HIV prevalence among pregnant women in the Amsterdam region (1988-1991)

    NARCIS (Netherlands)

    Bindels, P. J.; Mulder-Folkerts, D. K.; Boer, K.; Schutte, M. F.; van der Velde, W. j; Wong, F. J.; van den Hoek, A. J.; van Doornum, G. J.; Coutinho, R. A.

    1994-01-01

    The objective of the study was to monitor the HIV prevalence in the years 1988-1991 among pregnant women in the Amsterdam region, visitors to an abortion clinic and 3 outpatient infertility clinics. All women attending these clinics were asked to participate in the study on a voluntary basis and

  15. Building damage related to Amsterdam subway : Comparison of traditional monitoring with satellite monitoring results

    NARCIS (Netherlands)

    Korff, M.; Maccabiani, J

    2017-01-01

    This paper describes the evaluation of the monitoring data obtained from the construction of the North/South Line, a new subway line crossing the historic center of Amsterdam. During construction of the line (2003-2014), building deformations were monitored with Robotic Total Stations and with

  16. Hodorkovski advokaat : Venemaa ei ole õigusriik / Robert R. Amsterdam ; interv. Aleksei Günter

    Index Scriptorium Estoniae

    Amsterdam, Robert R.

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 24. juuli lk. 10. Naftamagnaadi Mihhail Hodorkovski advokaat vastab küsimustele, mis puudutavad ärimehe olukorda ja elamistingimusi vanglas ning tema võimalust ennetähtaegselt vabaneda. Lisa: Robert R. Amsterdam

  17. Astronomia instaurata? The third edition of Copernicus's De Revolutionibus (Amsterdam, 1617)

    NARCIS (Netherlands)

    van Netten, D.

    2012-01-01

    The article discusses the 1617 third edition of the book "De revolutionibus orbium coelestium" by Nicolaus Copernicus, published under the title "Astronomia instaurata (Restored astronomy)" in Amsterdam, the Netherlands, edited by Nicolaus Mulerius, and produced by Willem Janszoon. It considers why

  18. Als ze maar van me afblijven : Een onderzoek naar antihomoseksueel geweld in Amsterdam

    NARCIS (Netherlands)

    Buijs, Laurens; Duyvendak, Jan Willem; Hekma, Gert

    2008-01-01

    Geweld tegen homo's is een veelvoorkomend en structureel verschijnsel in Nederlands gay capital. Ondanks de liberale reputatie van Amsterdam zijn vooroordelen over mannelijkheid en (homo)seksualiteit wijdverspreid. Dat leidt, voornamelijk bij jonge mannen, tot het plegen van geweld. Als ze maar van

  19. 20 Jahre Vertrag von Amsterdam: Reelle Vision oder reale Desillusion Europäischer Gleichstellungspolitik?

    NARCIS (Netherlands)

    Ahrens, P.; Scheele, A.; Vleuten, J.M. van der

    2016-01-01

    In 1997 the principles of gender mainstreaming and anti-discrimination based on sex, racial or ethnic origin, religion or belief, disability, age or sexual orientation were enshrined in the Treaty of Amsterdam. The introduction to this special issue takes stock of the results twenty years after and

  20. Towards sustainable urban distribution using city canals: the case of amsterdam

    NARCIS (Netherlands)

    van Duin, Ron; Kortmann, L.J.; van de Kamp, Maarten

    2017-01-01

    This study investigates whether a system of hub locations distributing goods across the water to the city of Amsterdam can be a potential future solution to guarantee same-day delivery to shopkeepers. A simulation model was developed to analyse the logistics performances and to optimise the number

  1. Towards sustainable urban distribution using city canals; the case of Amsterdam

    NARCIS (Netherlands)

    Dr. L.J. Kortmann; Dr. L.M. van de Kamp; dr. J.H.R. van Duin

    2017-01-01

    This study investigates whether a system of hub locations distributing goods across the water to the city of Amsterdam can be a potential future solution to guarantee same-day delivery to shopkeepers. A simulation model was developed to analyse the logistics performances and to optimise the number

  2. Estimating the size of the HIV epidemic among injecting drug users in Amsterdam

    NARCIS (Netherlands)

    van Haastrecht, H. J.; Bindels, P. J.; van den Hoek, A. A.; Coutinho, R. A.

    1997-01-01

    Aim of this study was to assess the cumulative incidence of HIV-infection, AIDS and pre-AIDS death in the population of injecting drug users (IDU) in Amsterdam. By assuming equivalence, between a cohort of IDU and the IDU population, of the ratios of incidences of AIDS and pre-AIDS death to the

  3. HIV prevalence, sexual risk behaviour and sexual mixing patterns among migrants in Amsterdam, The Netherlands

    NARCIS (Netherlands)

    Gras, M. J.; Weide, J. F.; Langendam, M. W.; Coutinho, R. A.; van den Hoek, A.

    1999-01-01

    To study (1) HIV prevalence; (2) sexual risk behaviour; (3) sexual mixing patterns; (4) determinants of disassortative (between-group) mixing among migrant groups in Amsterdam, the Netherlands and to gain insight into the potential for heterosexual spread of HIV/sexually transmitted diseases.

  4. Population-based study on the seroprevalence of parvovirus B19 in Amsterdam

    NARCIS (Netherlands)

    van Rijckevorsel, G. G. C.; Sonder, G. J. B.; Schim van der Loeff, M. F.; van den Hoek, J. A. R.

    2009-01-01

    A study was undertaken to estimate the seroprevalence of parvovirus B19 infection in the general adult population of Amsterdam, The Netherlands. To our knowledge this is the first study testing parvovirus B19 in a random sample of the Dutch adult population. The study was a cross-sectional survey,

  5. Greening the EU: National positions in the run‐up to the Amsterdam treaty

    DEFF Research Database (Denmark)

    Andersen, Mikael Skou; Liefferink, Duncan

    1998-01-01

    for an investigation into the 'self-perception' of the 'green' member states and for a detailed assessment of the national positions of the six countries with regard to environmental issues in the preparatory phase of the Amsterdam Treaty. Although the six 'forerunners' are often grouped together, differences among...

  6. The Amsterdam Hypermedia Model: Adding Time and Context to the Dexter Model

    NARCIS (Netherlands)

    L. Hardman (Lynda); D.C.A. Bulterman (Dick); G. van Rossum (Guido)

    1994-01-01

    textabstractFrom Computing Reviews, by Jeanine Meyer The purpose of this paper is to convince the reader of the need for a general model for hypermedia and present the Amsterdam hypermedia model (AHM) as fulfilling that need. Hypertext, which is described by the authors as a 'relatively mature

  7. 'Three centuries of urban and provincial public debt: Amsterdam and Holland'

    NARCIS (Netherlands)

    Fritschy, W.; M.Boone en C.A. Davids,

    2003-01-01

    An analysis of the development of Amsterdam's and Holland's public debt between 1500 and 1800 led to the following conclusion. If public finance is the nerve of any state-system, it is quite adequate to describe the Dutch Republic as a league of seven 'province-republics', much less so, however, to

  8. Looking back on a successful project. The Restoration of the Royal Palace in Amsterdam

    Directory of Open Access Journals (Sweden)

    Bert van Bommel

    2013-06-01

    the restoration of the natural stone provided an opportunity to suppress the ‘interference’ that marred the façades of the palace as well. This process was prepared on the basis of research that was done at the Gunckel façade of the Binnenhof building in The Hague. Those results were supplemented by the results of research and tests at the Amsterdam palace. Suppressing the interference was deemed necessary, as the 17th-century architecture had become less legible because of discoloration and pollution of the sandstone. At the same time, the building was not supposed to lose its old character. The aim was to arrive at a more serene picture that would allow the architecture to speak for itself again. After the façades had been cleansed by removing dirt and pigeon droppings by steam, further cleaning was applied only when necessary. The stone was then, with the greatest restraint, made either slightly lighter or darker. After the presentation of the restoration plan consultations with the authorities began. Its intentions were however not always fully understood. Therefore, an initial test was done at the back of the tower, after which the façades could be treated as planned. Because of budget cuts the overall size of the project had to be limited. The slated roofs and the tower are therefore still waiting to be restored. The west tympanum too is still in poor condition and should be treated sooner rather than later.

  9. Local health systems in 21st century: who cares?-An exploratory study on health system governance in Amsterdam.

    Science.gov (United States)

    Plochg, T; Delnoij, D M J; Hogervorst, W V G; van Dijk, P; Belleman, S; Klazinga, N S

    2006-10-01

    There is a growing awareness that there should be a public health perspective to health system governance. Its intrinsic population health orientation provides the ultimate ground for determining the health needs and governing collaborative care arrangements within which these needs can be met. Notwithstanding differences across countries, population health concerns are not central to European health reforms. Governments currently withdraw leaving governance roles to care providers and/or financiers. Thereby, incentives that trigger the uptake of a public health perspective are often ignored. In this study we addressed this issue in the city of Amsterdam. Using a qualitative study design, we explored whether there is a public health perspective to the governance practices of the municipality and the major sickness fund in Amsterdam. And if so, what the scope of this perspective is. And if not, why not. Findings indicate that the municipality has a public health perspective to local health system governance, but its scope is limited. The municipality facilitates rather than governs health care provision in Amsterdam. Furthermore, the sickness fund runs major financial risks when adapting a public health perspective. It covers an insured population that partly overlaps the Amsterdam population. Returns on investments in population health are therefore uncertain, as competitors would also profit from the sickness fund's investments. The local health system in Amsterdam is not consistently aligned to the health needs of the Amsterdam population. The Amsterdam case is not unique and general consequences for local health system governance are discussed.

  10. First-Trimester Working Conditions and Birthweight: A Prospective Cohort Study

    NARCIS (Netherlands)

    Vrijkotte, Tanja G. M.; van der Wal, Marcel F.; van Eijsden, Manon; Bonsel, Gouke J.

    2009-01-01

    Objectives. We investigated the relationship between women's first-trimester working conditions and infant birthweight. Methods. Pregnant women (N=8266) participating in the Amsterdam Born Children and Their Development study completed a questionnaire gathering information on employment and working

  11. Erwin van Loo, ‘Eenige wakkere jongens’. Nederlandse oorlogsvliegers in de Britse luchtstrijdkrachten, 1940-1945

    Directory of Open Access Journals (Sweden)

    Marc Dierikx

    2016-11-01

    Full Text Available Erwin van Loo, ‘Eenige wakkere jongens’. Nederlandse oorlogsvliegers in de Britse luchtstrijdkrachten, 1940-1945 (Proefschrift Universiteit van Amsterdam 2013; Amsterdam: Boom, 2013, 515 pp., isbn 978 94 6105 926 0.

  12. Salinization may attack you from behind: upconing and related long-term downstream salinization in the Amsterdam Water Supply Dunes (Invited)

    Science.gov (United States)

    Olsthoorn, T.

    2010-12-01

    Groundwater from the Amsterdam Water Supply Dunes (GE: 52.35°N 4.55°E) has been used for the drinking water supply of Amsterdam since 1853. During the first half of the 20th century, severe intrusion and upconing occurred, with many of the wells turning brackish or saline. Already in 1903, the hydrologist/director of the Amsterdam Water Supply, Pennink, predicted this, based on his unique sand-box modeling, which he published in 1915 in the form of a large-size hard-bound book in four languages showing detailed black and white photographs of his tests. This book is now on the web: http://www.citg.tudelft.nl/live/pagina.jsp?id=68e12562-a4d2-489a-b82e-deca5dd32c42&lang=en Pennink devoted much of his work on saltwater upconing below wells, which he so feared. He simulated simultaneous flow of fresh and salt water, using milk to represent the saltwater having about the same density. With our current modeling tools, we can simulate his experiments, allowing to better understand his setup and even to verify our code. Pennink took interest in the way these cones form and in the point at which the salt water enters the screen. Surprizing, at least to many, is that this entry point is not necessarily the screen bottom. Measurements of the salinity distribution in salinized wells in the Amsterdam Water Supply Dune area confirmed this thirty years later when salinzation was severely occurring. The curved cone shape under ambient flow conditions provides part of the explanation why a short-term shut down of a well almost immediately diminishes salt concentrations, but salinization downstream of the wells in case with substantial lateral groundwater flow is not affected. Downstream salinization due to extraction was clearly shown in Pennink's experiments. However, the phenomenon seems still largely unknown or ignored. Downstream salinization also affects downstream heads for years after extraction has stopped. The presentation demonstrates and explains these local and more

  13. Status, near future and distant future of the Amsterdam electron scattering facility

    International Nuclear Information System (INIS)

    Vries, C. de.

    1982-01-01

    The experimental program with the electron Medium Energy Accelerator (MEA), located in Amsterdam, has been started. The general design features of the accelerator and electron scattering facilities are summarised in an Appendix. Some aspects of the Amsterdam instrumentation are discussed which have shown to be of importance from the point of view of flexibility, reproducibility, ease of tuning for high resolution and other time-saving elements. As such they are believed to be of importance for the design of future - especially third generation - facilities. Some of the on-going and near future experiments are presented, emphasizing those which have become within experimental reach due to the advanced level of instrumentation. Finally preliminary ideas are presented on how to increase the accelerator duty factor in the distant future by adding a pulse stretcher device, while maintaining all of the present buildings and 500 MeV equipment. (Auth.)

  14. [The zoological garden of Amsterdam Natura Artis Magistra during world War II].

    Science.gov (United States)

    Frankenhuis, Maarten Th

    2009-01-01

    Thanks to the wise management of its director, dr. Armand Sunier, and his team, 'Artis' survived the difficult war period without great losses of its animals and only material damage to some buildings. Artis has meant very much for the inhabitants of the city of Amsterdam during the war. In the first place for the employees and their families, that were kept for starvation and forced labour by extra rations of food and safe hiding places. But also for jewish persons in hiding, who could escape from a certain death by hiding in animal houses or other buildings in the garden. And also for hundreds of thousands people of Amsterdam who found in their zoological garden an oasis of relaxation in a town full of threat and violence.

  15. Measuring drifted dust near coal transhipment in the harbour of Amsterdam, Netherlands; Meten aan verwaaiend stof bij kolenoverslag in het Amsterdams havengebied

    Energy Technology Data Exchange (ETDEWEB)

    Weijers, E.P.; Rodink, R.; Hensen, A. [ECN Environment and Energy Engineering, Petten (Netherlands)

    2013-02-15

    For two months, particulate matter measurements were performed at the Rietlanden coal terminal in the Africa harbour in Amsterdam. At eight places around the coal terminal particulate matter concentrations were measured with relatively simple (and relatively inexpensive) optical sensors (which have been further developed by ECN). The primary purpose of the measurement campaign was to determine the performance and robustness of the sensors 'in the field'. After the satisfactory performance, the feasibility of a monitoring c.q. alarm system were studied and an estimate was made of particulate matter emissions from the terminal with a dispersion model during the measurement period [Dutch] Gedurende twee maanden zijn bij de Rietlanden kolenterminal in de Afrikahaven te Amsterdam fijnstofmetingen uitgevoerd. Op een achttal plaatsen rondom het bedrijf zijn fijnstofconcentraties gemeten met relatief eenvoudige (en relatief goedkope) optische sensoren (die door ECN verder zijn ontwikkeld). In de eerste plaats had de meetcampagne ten doel de prestatie en robuustheid van de sensoren 'in het veld' vast te stellen. Na gebleken geschiktheid is de haalbaarheid van een monitoring- c.q. alarmeringssysteem bestudeerd en is de fijnstofemissie afkomstig van de terminal geschat voor de periode van de metingen met een verspreidingsmodel.

  16. Human (InConsistencies in Ian McEwan’s Amsterdam

    Directory of Open Access Journals (Sweden)

    Anghel Florentina

    2016-12-01

    Full Text Available Ian McEwan’s Amsterdam has supplied its readers with psychological, moral and social topical issues presented in an easy flowing and exhilarating style. Starting from the assumption that life consists of a series of inconsistencies which are inherent and bring their contribution to the individual’s formation, the paper aims at demonstrating that the protagonists’ judgmental and moral inconsistencies, which are used as a plot generator and are environmentally determined, reveal features of their personality.

  17. Sur deux Cynoglossus de la collection ichthyologique du Zoölogisch Museum, Amsterdam

    NARCIS (Netherlands)

    Chabanaud, Paul

    1951-01-01

    Sous le nom de Cynoglossus xiphoideus Günther, la collection ichthyologique du Zoölogisch Museum, Amsterdam possède 2 spécimens dont l’un est originaire de Shanghaï et l’autre, de la mer de Timor. Le spécimen de Shanghaï a été cédé au Zoölogisch Museum (sans doute à titre d’échange) par le British

  18. Developing future precipitation events from historic events: An Amsterdam case study.

    Science.gov (United States)

    Manola, Iris; van den Hurk, Bart; de Moel, Hans; Aerts, Jeroen

    2016-04-01

    Due to climate change, the frequency and intensity of extreme precipitation events is expected to increase. It is therefore of high importance to develop climate change scenarios tailored towards the local and regional needs of policy makers in order to develop efficient adaptation strategies to reduce the risks from extreme weather events. Current approaches to tailor climate scenarios are often not well adopted in hazard management, since average changes in climate are not a main concern to policy makers, and tailoring climate scenarios to simulate future extremes can be complex. Therefore, a new concept has been introduced recently that uses known historic extreme events as a basis, and modifies the observed data for these events so that the outcome shows how the same event would occur in a warmer climate. This concept is introduced as 'Future Weather', and appeals to the experience of stakeholders and users. This research presents a novel method of projecting a future extreme precipitation event, based on a historic event. The selected precipitation event took place over the broader area of Amsterdam, the Netherlands in the summer of 2014, which resulted in blocked highways, disruption of air transportation, flooded buildings and public facilities. An analysis of rain monitoring stations showed that an event of such intensity has a 5 to 15 years return period. The method of projecting a future event follows a non-linear delta transformation that is applied directly on the observed event assuming a warmer climate to produce an "up-scaled" future precipitation event. The delta transformation is based on the observed behaviour of the precipitation intensity as a function of the dew point temperature during summers. The outcome is then compared to a benchmark method using the HARMONIE numerical weather prediction model, where the boundary conditions of the event from the Ensemble Prediction System of ECMWF (ENS) are perturbed to indicate a warmer climate. The two

  19. Holocene multi-proxy environmental reconstruction from lake Hakluytvatnet, Amsterdamøya Island, Svalbard (79.5°N)

    Science.gov (United States)

    Gjerde, Marthe; Bakke, Jostein; D'Andrea, William J.; Balascio, Nicholas L.; Bradley, Raymond S.; Vasskog, Kristian; Ólafsdóttir, Sædis; Røthe, Torgeir O.; Perren, Bianca B.; Hormes, Anne

    2018-03-01

    High resolution proxy records of past climate are sparse in the Arctic due to low organic production that restricts the use of radiocarbon dating and challenging logistics that make data collection difficult. Here, we present a new lake record from lake Hakluytvatnet at Amsterdamøya island (79.5°N), the northwesternmost island on Svalbard. Multi-proxy analyses of lake sediments in combination with geomorphological mapping reveal large environmental shifts that have taken place at Amsterdamøya during the Holocene. A robust chronology has been established for the lake sediment core through 28 AMS radiocarbon ages, and this gives an exceptionally well-constrained age control for a lake at this latitude. The Holocene was a period with large changes in the Hakluytvatnet catchment, and the onset of the Neoglacial (ca. 5 ka) marks the start of modern-day conditions in the catchment. The Neoglacial is characterized by fluctuations in the minerogenic input to the lake as well as internal productivity, and we suggest that these fluctuations are driven by atmospherically forced precipitation changes as well as sea ice extent modulating the amount of moisture that can reach Hakluytvatnet.

  20. Productivity and quality improvements. A report on cost management in gas distribution at the energy distribution company Amsterdam (Energie Noord West Amsterdam NV)

    International Nuclear Information System (INIS)

    Bosch, T.

    1997-01-01

    In a more competitive times traditional and technical industries like gas distribution have to change. They have to commercialize. A way to support this transition is to introduce an activity based cost control system (ABC) with proper delegation of financial responsibilities. This report is about the history of cost management in Amsterdam and the introduction of ABC in our distribution company. The message to other gas distributors is that introducing some form of ABC can be worth wile in the future and is probably inescapable because of growing competition. In the end gas distribution will probably turn out to be one of the few places where money can be earned in the entire gas trade. Not by increasing distribution prices, but by decreasing distribution costs and strategic investments. (au)

  1. Annotated translation of "Nota in verband met de voorgenomen putboring nabij Amsterdam [Note concerning the intended well drilling near Amsterdam]" by J. Drabbe and W. Badon Ghijben (1889)

    Science.gov (United States)

    Post, Vincent E. A.

    2018-06-01

    The famous report by engineers Drabbe and Badon Ghijben (1889), on an intended well drilling near Amsterdam (the Netherlands), was one of the key documents that contributed to the Ghijben-Herzberg formula, which links water-table elevation to the depth of the freshwater-saltwater interface in coastal aquifers. The report has been often cited but no English translation has appeared in the literature to date. The aim of this annotated translation of the report is to provide the international scientific community with easier access than was hitherto the case, plus electronic access to the original in Dutch. A brief introduction to the report is provided, followed by a translation that follows the original text as closely as possible.

  2. [Veterinary issues in the proceedings of the Amsterdam Agricultural Society, 1776-1832].

    Science.gov (United States)

    Mathijsen, A H H M

    2006-01-01

    The Amsterdam Agricultural Society, founded in 1776, was created by six wealthy gentlemen, well known for the important positions in society held by them. They invested the money earned through trade among others in the acquisition of land, partially newly reclaimed in the surroundings of Amsterdam. As a consequence of the expansion of the population the profitability of agriculture had increased. The merchants and regents knew how to combine business with pleasure. In the second half of the 17th and the first half of the 18th century, they have built about 500 country estates in the surroundings of Amsterdam. Besides the pleasures of country-life, the owners gained a practical interest in agriculture and animal husbandry. Missing practical knowledge in these fields themselves, they felt the moral obligation to contribute to the general welfare of the society by the promotion of new ideas or experiences gained by others. In the first volume of the Proceedings is stated: 'It is beyond question that chemistry, botany, meteorology and the Ars veterinaria are to be considered as the true fundaments of agricultural knowledge'. Inspired by the ideas of the Enlightenment and, quite in conformity with the spirit of the time, the establishment of a society was thought to be the answer in order to bring agricultural and thus economical reform. The method used was copied from the learned societies. The members proposed subjects for prize competitions and judged the answers sent in. The crowned answers were the main, but not the only, contents of the Society's Proceedings. The paper analyses the membership (the number of ordinary members decreased from 70 at the start to 56; that of honorary members was stable at about 20; further there were a few orrespondents), and quantifies the distribution of articles in the Proceedings, devoted respectively to agricultural, veterinary and zootechnical subjects. In addition, a detailed list with commentary, of the veterinary and

  3. Risks and interrelationships of subdistrict house prices: the case of Amsterdam.

    Science.gov (United States)

    Teye, Alfred Larm; de Haan, Jan; Elsinga, Marja G

    2018-01-01

    This paper uses individual house transaction data from 1995 to 2014 in Amsterdam to explore the risks and interrelationships of the subdistrict house prices. Simple indicators suggest that house prices grow faster and are more risky in the central business district and its immediate surrounding areas than in the peripherals. Furthermore, we observe an over time decreasing intervariations between the subdistrict house price growth rates, whereas we find a lead-lag and house price causal flow from the more central to the peripheral subdistricts.

  4. Educated Guess van gevolgen voor verkeersslachtoffers door maatregel Snorfiets op de rijbaan (SOR) in Amsterdam : een eerste inschatting van effecten gerelateerd aan verkeersveiligheid.

    NARCIS (Netherlands)

    Wijlhuizen, G.J. Dijkstra, A. Bos, N.M. Goldenbeld, C. & Stipdonk, H.L.

    2013-01-01

    Educated Guess about the consequences for casualties as a result of introduction of the measure Light moped in the carriageway (SOR) in Amsterdam : a first estimate of the effects related to road safety. The Board of Mayor and Eldermen of the City of Amsterdam considers moving light mopeds in 50km/h

  5. Retrofit and commissioning of a 600 MW combined-cycle power plant in Amsterdam

    Energy Technology Data Exchange (ETDEWEB)

    Dijkman, B. (NV UNA, Amsterdam (Netherlands)); Keppel, W. (ABB Mannheim (Germany, F.R.))

    1991-01-01

    In 1982, NV UNA (formerly Energiebedrijf Amsterdam) had already begun to consider measures, from an economic point of view, which could be taken for the optimum technical conversion of the existing conventional 511 MW unit (oil and natural gas firing) at the Hemweg Power Plant in Amsterdam. At that point in time, there was no reason to erect new conventional units because of economic stagnation in the European economy and existing over-capacity in the energy sector. The very high fuel prices resulted in requirements for high thermal efficiency, meaning better use of fuel. For these reasons, work was carried out on modern, technically and economically attractive alternatives for the conversion of existing plants. The extension of the steam power plant by adding an upstream gas turbine equipped with a low-polluting combustion system made it possible to improve the efficiency of the operation and to reduce the emissions at the same time. It was ensured that natural gas would be available continously as the fuel for the gas turbine. 13 figs., 4 refs.

  6. Holocene glacier activity reconstructed from proglacial lake Gjøavatnet on Amsterdamøya, NW Svalbard

    Science.gov (United States)

    de Wet, Gregory A.; Balascio, Nicholas L.; D'Andrea, William J.; Bakke, Jostein; Bradley, Raymond S.; Perren, Bianca

    2018-03-01

    Well-dated and highly resolved paleoclimate records from high latitudes allow for a better understanding of past climate change. Lake sediments are excellent archives of environmental change, and can record processes occurring within the catchment, such as the growth or demise of an upstream glacier. Here we present a Holocene-length, multi-proxy lake sediment record from proglacial lake Gjøavatnet on the island of Amsterdamøya, northwest Svalbard. Today, Gjøavatnet receives meltwater from the Annabreen glacier and contains a record of changes in glacier activity linked to regional climate conditions. We measured changes in organic matter content, dry bulk density, bulk carbon isotopes, elemental concentrations via Itrax core-scanning, and diatom community composition to reconstruct variability in glacier extent back through time. Our reconstruction indicates that glacially derived sedimentation in the lake decreased markedly at ∼11.1 cal kyr BP, although a glacier likely persisted in the catchment until ∼8.4 cal kyr BP. During the mid-Holocene (∼8.4-1.0 cal kyr BP) there was significantly limited glacial influence in the catchment and enhanced deposition of organic-rich sediment in the lake. The deposition of organic rich sediments during this time was interrupted by at least three multi-centennial intervals of reduced organic matter accumulation (∼5.9-5.0, 2.7-2.0, and 1.7-1.5 cal kyr BP). Considering our chronological information and a sedimentological comparison with intervals of enhanced glacier input, we interpret these intervals not as glacial advances, but rather as cold/dry episodes that inhibited organic matter production in the lake and surrounding catchment. At ∼1.0 cal kyr BP, input of glacially derived sediment to Gjøavatnet abruptly increased, representing the rapid expansion of the Annabreen glacier.

  7. Winkelen als bevrijding? Vrouwen en stedelijke ruimte in Amsterdam, 1863-1913

    Directory of Open Access Journals (Sweden)

    Jan Hein Furnée

    2015-06-01

    Full Text Available Shopping as Liberation?: Women and Urban Space in Amsterdam, 1863-1913In recent decades several historians have argued that the emergence of shopping as a leisure activity in the second half of the nineteenth century substantially enhanced women’s freedom of movement in public spaces and promoted female emancipation in general. Based on urban descriptions and digitised newspaper articles on nineteenth-century Amsterdam – on its main shopping street, the Kalverstraat, in particular – this article takes a more nuanced stance. Shopping as a leisure activity was older in origin than is often assumed and to some extent was a male activity as well. While shopping, ladies encountered numerous factors thathampered their spatial mobility, from road debris, pawing, mugging, the presence of prostitutes to ‘moral harassment’ over exploited shop girls. Indeed, a single feminist framed the right to shop and to visit restaurants in an explicit discourse of ‘liberation’. However, to argue that shopping promoted female emancipation in general would suggest a too linear and monolithic approach. In de afgelopen decennia hebben diverse historici betoogd dat de opkomst van het winkelen als vrijetijdsbesteding in de tweede helft van de negentiende eeuw de uithuizige bewegingsvrijheid van vrouwen uit de gegoede standen aanzienlijk heeft vergroot en hun emancipatie zo belangrijk heeft bevorderd. Op basis van stadsbeschrijvingen en gedigitaliseerde krantenartikelen over winkelen in Amsterdam – in de Kalverstraat in het bijzonder – neemt dit artikel enig gas terug. Het winkelen als vrijetijdsbesteding had een oudere oorsprong dan vaakis verondersteld en was tot op zekere hoogte ook een mannenzaak. Winkelende dames werden op verschillende manieren in hun ruimtelijke bewegingsvrijheid belemmerd: door straatvuil, handtastelijkheden, straatroof, de aanwezigheid van prostituees of ‘morele kwellingen’ over uitgebuite winkelmeisjes. Zeker, een enkele

  8. Development of a Healthy Urban Route Planner for cyclists and pedestrians in Amsterdam

    Science.gov (United States)

    van der Molen, Michiel; Ligtenberg, Arend; Vreugdenhil, Corne; Steeneveld, Gert-Jan

    2017-04-01

    Cities are hotspots of air pollution and heat stress, the exposure to which results in nuisance, health risks, cost of medication, reduced labour productivity and sick leave for citizens. Yet the air pollution and heat stress are spatially and temporally unevenly distributed over the city, depending on pollutant emissions, street design and atmospheric turbulent mixing and radiation. This spatiotemporal variation allows pedestrians and bikers to choose alternative routes to minimize their exposure, if the distribution is known. In this project, we develop a route planner for bicyclists and pedestrians for Amsterdam (NL), that proposes routes and departure times based on model simulations of weather and air quality. We use the WRF-Chem atmosphere and air quality model at unprecedented grid spacing of 100-m (Ronda et al, 2015, Super et al, 2016), with an underlying urban canopy model and NOx and PM10 emissions. The emissions by traffic are calculated based on observed traffic intensities and emission factors. An urban land use map will characterize urban density and street configuration to estimate urban heat storage (Attema et al, 2015). WRF-Chem runs will be issued daily for a lead time of 48 hours, resulting in forecast maps of temperature and pollutant concentrations that will be uniquely expressed in a metric that combines both threats. The hourly fields of this metric are provided to the route planner based on the open source routing library pgRouting to identify the more healthy routes on the route network of Amsterdam. The objectives of the healthy urban route planner are to raise awareness of heat and air quality issues in Amsterdam, to provide an innovative adaptation tool for citizens and tourists, to locate the most important bottlenecks in (the exposure to) air pollution and heat stress, and ultimately to test the readiness of the travellers to use the information and adapt the route. We expect to particularly target a group of lung- and cardiovascular

  9. Between Care and Order: Street-Level Workers’ Discretion and Drug Policies in Amsterdam (the Netherlands) and Porto Alegre (Brazil)

    NARCIS (Netherlands)

    R. Quadros Rigoni (Rafaela)

    2015-01-01

    markdownabstract__Abstract__ This comparative study analyses the implementation of policies on so-called ‘problem drugs’ (crack cocaine and heroin) for the cities of Amsterdam (in the Netherlands) and Porto Alegre (in Brazil). Using a variant on the street level bureaucracy approach, the study

  10. Hydrogeochemical transport modeling of 24 years of Rhine water infiltration in the dunes of the Amsterdam Water Supply.

    NARCIS (Netherlands)

    van Breukelen, B.M.; Appelo, C.A.J.; Olsthoorn, T.N.

    1998-01-01

    Water quality changes were modelled along a flowpath in a plume of artificially recharged, pretreated Rhine water in the dunes of the Amsterdam Water Supply, after 24 years of infiltration. The hydrogeochemical transport model PHREEQC was extended with dispersion/diffusion and kinetics for selected

  11. Jet grout strut for deep station boxes of the north/south metro line Amsterdam : Design and back analysis

    NARCIS (Netherlands)

    Delfgaauw, S.; Buykx, S.M.; Bosch, J.W.

    2009-01-01

    The new North/South metro line in Amsterdam contains several stations, some of which with an excavation depth of 30 m below surface. The design of these station boxes is very much determined by the adjacent historic buildings, high water table and the relatively soft soil. A lot of effort is put

  12. Transnational class formation and concepts of control: notes towards a genealogy of the Amsterdam Project in International Political Economy

    NARCIS (Netherlands)

    Overbeek, H.W.

    2004-01-01

    International political economy (IPE) has been enriched, since the late 1970s, by flourishing numbers of critical approaches. The contributions during the 1980s and 1990s to this literature by some members of the Department of International Relations at the University of Amsterdam occupy a distinct

  13. Pharmaco-economic evaluation of targeted hepatitis A vaccination for children of ethnic minorities in Amsterdam (The Netherlands)

    NARCIS (Netherlands)

    Postma, M.J.; Beutels, Ph; Schilthuis, H.; Bos, J.M.; van den Hoek, J.A.R.

    2004-01-01

    Objective: Estimate cost-effectiveness of vaccination against hepatitis A virus (HAV) for children of ethnic minorities in Amsterdam. Background: Pharmaco-economic analysis is relevant for motivating reimbursement of vaccination costs in the framework of a programmatic approach to vaccination of

  14. Understanding urban practitioners' perspectives on social-mix policies in Amsterdam: the importance of design and social space

    NARCIS (Netherlands)

    Lawton, P.

    2013-01-01

    Throughout recent decades, socially-mixed neighbourhoods have become a key element of urban policy and debate. This paper argues, with Amsterdam as an empirical case, that the design, layout and everyday use of social space—including public and private space—is of key importance in understanding the

  15. Intelligent Virtual Agents : 9th International Conference, IVA 2009 Amsterdam, The Netherlands, September 14-16, 2009 Proceedings

    NARCIS (Netherlands)

    Ruttkay, Z.M.; Kipp, M.; Nijholt, Antinus; Vilhjalmsson, H.H.

    2009-01-01

    Welcome to the Proceedings of the 9th International Conference on Intelligent Virtual Agents, held 14-16 September, 2009 in Amsterdam, The Netherlands. Intelligent Virtual Agents (IVAs) are interactive characters that exhibit humanlike qualities and communicate with humans or with each other using

  16. 97 Medical Apparatuses tested at the Academic Medical Center (AMC) Amsterdam for interference by WLAN/WiFi signals

    NARCIS (Netherlands)

    Hensbroek, R.

    2009-01-01

    This research describes the influence of WLAN 1 signals on medical apparatuses in the Academic Medical Center (AMC) Amsterdam. The results in this report were obtained by testing medical equipment with WLAN signals. A comparable research was reported earlier. See TNO report KvL/P&Z 2007.117 dated

  17. Risk indicators and potential risk factors for caries in 5-year-olds of different ethnic groups in Amsterdam.

    NARCIS (Netherlands)

    Verrips, G.H.; Frencken, J.E.; Kalsbeek, H.; Horst, G. ter; Filedt Kok-Weimar, T.L.

    1992-01-01

    The aim of this study was threefold: first, to assess the oral health of Turkish, Moroccan, Surinamese, Dutch and "other" 5-yr-old children living in Amsterdam; second, to identify risk indicators for caries, in addition to ethnicity; and third, to identify potential risk factors related to

  18. Culture, product differentiation and market segmentation: a structural analysis of the motivation and satisfaction of tourists in Amsterdam

    NARCIS (Netherlands)

    Romao, J.; Neuts, B.; Nijkamp, P.; van Leeuwen, E.S.

    2015-01-01

    The varied supply of tourism services - with particular emphasis on tangible and intangible cultural aspects - corresponds ideally to visitors' characteristics and wishes. This paper considers a major tourist destination, such as Amsterdam, as an export-oriented multi-product company, characterized

  19. Preventing evictions as a potential public health intervention: Characteristics and social medical risk factors of households at risk in Amsterdam

    NARCIS (Netherlands)

    van Laere, Igor; de Wit, Matty; Klazinga, Niek S.

    2009-01-01

    Aims: The public health problems precipitating evictions are understudied and no systemic data have been collected. We aim to identify the magnitude of evictions and the characteristics and social medical risk factors of households at risk in Amsterdam. This will help inform policies designed to

  20. Motives for and against injecting drug use among young adults in Amsterdam: qualitative findings and considerations for disease prevention

    NARCIS (Netherlands)

    Witteveen, Ewald; van Ameijden, Erik J. C.; Schippers, Gerard M.

    2006-01-01

    To elucidate injection initiation and risky injection practices among young drug users (YDUs) in Amsterdam, this study identifies self-reported motives for injecting and not injecting to inform interventions to be targeted at issues personally relevant for this population. A qualitative study was

  1. Translational HIV-1 research: from routine diagnostics to new virology insights in Amsterdam, the Netherlands during 1983-2013

    NARCIS (Netherlands)

    van der Kuyl, Antoinette C.; Bakker, Margreet; Jurriaans, Suzanne; Back, Nicole K. T.; Pasternak, Alexander O.; Cornelissen, Marion; Berkhout, Ben

    2013-01-01

    An HIV-1 diagnostic laboratory was established in the Academic Medical Center (AMC) of the University of Amsterdam after the discovery of human immunodeficiency virus (HIV) as the cause of the acquired immunodeficiency syndrome (AIDS). The first AIDS patients were diagnosed here in 1981 and since

  2. Congenital anomalies in the teratological collection of Museum Vrolik in Amsterdam, The Netherlands. IV: closure defects of the neural tube

    NARCIS (Netherlands)

    Oostra, R. J.; Baljet, B.; Hennekam, R. C.

    1998-01-01

    The Museum Vrolik collection of the Department of Anatomy and Embryology of the University of Amsterdam, founded by Gerardus Vrolik (1775-1859) and his son Willem Vrolik (1801-1863), consists of more than 5,000 specimens of human and animal anatomy, embryology, pathology, and congenital anomalies.

  3. The relation between calcium intake and body composition in a Dutch population: the Amsterdam Growth and Health Longitudinal Study

    NARCIS (Netherlands)

    Boon, N.; Koppes, L.L.J.; Saris, W.H.; van Mechelen, W.

    2005-01-01

    To investigate whether dietary calcium intake is related to body mass index and the sum of four skinfolds among subjects in the Amsterdam Growth and Health Longitudinal Study (the Netherlands), the authors followed a cohort of men and women from age 13 years in 1977 to age 36 years in 2000.

  4. Incorporating insights from Time Series Analysis in groundwater modelling for the urban area of the city of Amsterdam

    NARCIS (Netherlands)

    Graafstra, P.; Smits, F.J.C.; Janse, T.

    2017-01-01

    As the public water authority of the city of Amsterdam and surrounding areas, Waternet makes use of both steady-state and transient groundwater models for a variety of purposes involving urban groundwater management. For instance when determining the effect of planned measures on the occurrence of

  5. Increase in HCV incidence among men who have sex with men in Amsterdam most likely caused by sexual transmission

    NARCIS (Netherlands)

    van de Laar, T.J.W.; van der Bij, A.K.; Prins, M.; Bruisten, S.M.; Brinkman, K.; Ruys, T.A.; van der Meer, J.T.M.; de Vries, H.J.C.; Mulder, J.W.; van Agtmael, M.; Jurriaans, S.; Wolthers, K.C.; Coutinho, R.A.

    2007-01-01

    We retrospectively screened 1836 men who have sex with men (MSM) participating in the Amsterdam Cohort Studies (1984-2003) for hepatitis C virus (HCV) antibodies. HCV incidence was 0.18/100 person-years (PY) in human immunodeficiency virus (HIV)-positive MSM (8/4408 PY [95% confidence interval {CI},

  6. Dealing with diversity: middle-class family households and the issue of 'black' and 'white' schools in Amsterdam

    NARCIS (Netherlands)

    Boterman, W.R.

    2013-01-01

    The urban middle classes often celebrate the diversity of their neighbourhood. As soon as they have children, however, the desire to display symbolic capital may conflict with the need to reproduce cultural capital through the educational system. In the ethnically diverse Amsterdam schooling

  7. Estimating the number of opiate users in amsterdam by capture-recapture: the importance of case definition

    NARCIS (Netherlands)

    Buster, M. C.; van Brussel, G. H.; van den Brink, W.

    2001-01-01

    One of the objectives of Amsterdam's methadone maintenance treatment is maximising its coverage among problematic opiate users. In order to evaluate what proportion is reached, the capture-recapture method is conducted to estimate the prevalence of problematic opiate use. Samples of opiate users in

  8. Affective foodscapes in an economy of passion : repetition, opposition and adaptation in Mexican restaurants in Amsterdam, Madrid and San Francisco

    NARCIS (Netherlands)

    Matus Ruiz, M.

    2012-01-01

    The
 main
 goal
 of
 my
 research
 was
 to
 analyze
 how
 the
 desire
 to
 affect
 and
 be
 affected
 by
 foreign
 signs
relates
 to
 the
 commoditization
 of
 food
 products
 offered
 in
 Mexican
 restaurants
 in
 Amsterdam,
 Madrid
and
 San
 Francisco.
 I
 conceive
 restaurants
 as


  9. Reliability and validity of a self-administered tool for online neuropsychological testing : The Amsterdam Cognition Scan

    NARCIS (Netherlands)

    Feenstra, H.E.M.; Murre, J.M.J.; Vermeulen, I. E.; Kieffer, J.M.; Schagen, S.B.

    2018-01-01

    Introduction : To facilitate large-scale assessment of a variety of cognitive abilities in clinical studies, we developed a self-administered online neuropsychological test battery: the Amsterdam Cognition Scan (ACS). The current studies evaluate in a group of adult cancer patients: test–retest

  10. Reliability and validity of a self-administered tool for online neuropsychological testing : The Amsterdam Cognition Scan

    NARCIS (Netherlands)

    Feenstra, Heleen E.M.; Murre, Jaap M.J.; Vermeulen, Ivar E.; Kieffer, Jacobien M.; Schagen, Sanne B.

    2018-01-01

    Introduction: To facilitate large-scale assessment of a variety of cognitive abilities in clinical studies, we developed a self-administered online neuropsychological test battery: the Amsterdam Cognition Scan (ACS). The current studies evaluate in a group of adult cancer patients: test–retest

  11. Hepatitis B vaccination and changes in sexual risk behaviour among men who have sex with men in Amsterdam

    NARCIS (Netherlands)

    Xridou, M.; Wallinga, J.; Dukers-Muijers, N.; Coutinho, R.

    The impact of hepatitis B vaccination in men having sex with men in Amsterdam has been marginal until now, possibly because of increases in sexual risk behaviour counterbalancing the effect of vaccination. A mathematical model is used to describe the hepatitis B epidemic. The model shows that, with

  12. Hepatitis B vaccination and changes in sexual risk behaviour among men who have sex with men in Amsterdam

    NARCIS (Netherlands)

    Xridou, M.; Wallinga, J.; Dukers-Muijers, N.; Coutinho, R.

    2009-01-01

    The impact of hepatitis B vaccination in men having sex with men in Amsterdam has been marginal until now, possibly because of increases in sexual risk behaviour counterbalancing the effect of vaccination. A mathematical model is used to describe the hepatitis B epidemic. The model shows that, with

  13. Multivariate analysis of the risk of stomach cancer after ulcer surgery in an Amsterdam cohort of postgastrectomy patients

    NARCIS (Netherlands)

    Tersmette, A. C.; Goodman, S. N.; Offerhaus, G. J.; Tersmette, K. W.; Giardiello, F. M.; Vandenbroucke, J. P.; Tytgat, G. N.

    1991-01-01

    Although gastric cancer incidence is decreasing in the western world, it remains an important cause of death, and there has been debate about screening persons who have undergone gastrectomy for benign ulcers. The authors analyzed risk factors for stomach cancer mortality in an Amsterdam cohort of

  14. Psychological distress of rescue workers eight and one-half years after professional involvement in the Amsterdam air disaster

    NARCIS (Netherlands)

    Witteveen, Anke B.; Bramsen, Inge; Twisk, Jos W. R.; Huizink, Anja C.; Slottje, Pauline; Smid, Tjabe; van der Ploeg, Henk M.

    2007-01-01

    This study examined specific and general psychological distress 8.5 years following the 1992 cargo aircraft crash in Amsterdam. Participants included 334 occupationally exposed fire fighters and 834 occupationally exposed police officers compared with reference groups of 194 fire fighters and 634

  15. Congenital anomalies in the teratological collection of Museum Vrolik in Amsterdam, The Netherlands. V: conjoined and acardiac twins

    NARCIS (Netherlands)

    Oostra, R. J.; Baljet, B.; Verbeeten, B. W.; Hennekam, R. C.

    1998-01-01

    The Museum Vrolik collection of the Department of Anatomy and Embryology of the Academic Medical Center, University of Amsterdam, founded by Gerardus Vrolik (1775-1859) and his son Willem Vrolik (1801-1863), consists of more than 5,000 specimens of human and animal anatomy, embryology, pathology,

  16. HIV and hepatitis C treatment uptake among people who use drugs participating in the Amsterdam Cohort Studies, 1985-2015

    NARCIS (Netherlands)

    van Santen, Daniëla K.; van der Helm, Jannie J.; Lindenburg, Karen; Schim van der Loeff, Maarten; Prins, Maria

    2017-01-01

    Background: HIV-positive people who use drugs (PWUD) start antiretroviral therapy (ART) later than other risk groups, and among HCV-positive PWUD, HCV treatment uptake is low. Nowadays, HCV direct acting antivirals (DAAs) are available and reimbursed in the Netherlands (since 2014). The Amsterdam

  17. Reading the Qur,ān in the 17th-Century Sephardi Community of Amsterdam

    Directory of Open Access Journals (Sweden)

    den Boer, Harm

    2014-12-01

    Full Text Available This article presents an unknown Spanish translation of the Qur’ān, extant at the Ets Haim/Livraria Montezinos Library of the Portuguese Jewish Community of Amsterdam. The manuscript dates from the seventeenth century and was the work of a Spanish or Portuguese Jew living in Amsterdam or another community of the Sephardi diaspora. In the present contribution, a detailed material description of the manuscript and its contents, as well as of its Italian and Spanish sources, is offered. While the translator claimed that the work was translated “word for word from Arabic,” he actually used the Italian version of the Qur’ān by Giovanni Battista Castrodardo, published by Andrea Arrivabene in Venice in 1547. The short appendix on the life of Muḥammad, on the other hand was based on a Spanish polemical work addressed to the minority of the moriscos: the Confutación del Al corán y secta mahometana by Lope de Obregón, published in Granada in 1555. This translation represents a unique case-study of the re-contextualization of the Qur’ān in early modern Europe and of the History of Reading across European and Mediterranean confessions.Este trabajo presenta una traducción del Corán al castellano, desconocida hasta ahora, conservada en la Ets Haim/Biblioteca Montezinos de la comunidad judío-portuguesa de Amsterdam. El manuscrito data del siglo XVII y fue la obra de un judío español o portugués que vivía en Amsterdam o en otra comunidad de la diaspora Sefardí. En este estudio se ofrece una descripción material detallada del manuscrito y de su contenido, así como un análisis de sus fuentes italianas y españolas. Aunque el traductor dice haber traducido la obra «palabra por palabra del árabe», en realidad, parece haber utilizado la versión italiana del Corán realizada por Giovanni Battista Castrodardo y publicada por Andrea Arrivabene en Venecia (1547. Un corto apéndice sobre la vida de Mahoma, por otro lado, se basa en una

  18. Toxic fear: the management of uncertainty in the wake of the Amsterdam air crash.

    Science.gov (United States)

    Boin, A; van Duin, M; Heyse, L

    2001-12-14

    This paper examines the management of uncertainty among emergency responders, the media, and the public following the crash of an Israeli cargo plane carrying apparently hazardous cargo in Amsterdam's Bijlmermeer area. While the authorities' management of the emergency created by the initial crash was effective, the long-term crisis management performance was considerably less effective. It is argued that, particularly in hazardous materials emergencies, considerable management attention is required in the long-term aftermath rather than seeking a quick declaration of "all clear" or determination that the crisis is over. This paper examines the roles of all actors in the crisis and addresses the nature of communications in the "disaster after the disaster". The evolution of a "toxic fear" among citizens is documented and the social psychology of crisis management in the aftermath is examined.

  19. When the spell is broken: gentrification, urban tourism and privileged discontent in the Amsterdam canal district

    Science.gov (United States)

    Pinkster, Fenne M; Boterman, Willem R

    2017-01-01

    Expansion of urban tourism in historic districts in European cities is putting increasing pressure on these areas as places to live. In Amsterdam, an ever-growing number of tourists visit the famous canal district, which also forms the home of a group of long-term, upper-middle-class residents. While such residents are generally depicted as instigators of urban transformation, in this case, they are on the receiving end. Bringing together the literature on the socio-spatial impact of tourism, belonging and the lived experience of place, this article explores the changing relationship between these established residents and their neighbourhood and provides insight into their growing sense of discontent and even powerlessness in the face of neighbourhood change. PMID:29278248

  20. When the spell is broken: gentrification, urban tourism and privileged discontent in the Amsterdam canal district.

    Science.gov (United States)

    Pinkster, Fenne M; Boterman, Willem R

    2017-07-01

    Expansion of urban tourism in historic districts in European cities is putting increasing pressure on these areas as places to live. In Amsterdam, an ever-growing number of tourists visit the famous canal district, which also forms the home of a group of long-term, upper-middle-class residents. While such residents are generally depicted as instigators of urban transformation, in this case, they are on the receiving end. Bringing together the literature on the socio-spatial impact of tourism, belonging and the lived experience of place, this article explores the changing relationship between these established residents and their neighbourhood and provides insight into their growing sense of discontent and even powerlessness in the face of neighbourhood change.

  1. The Central Institute for Brain Research in Amsterdam and its directors.

    Science.gov (United States)

    Eling, Paul; Hofman, Michel A

    2014-01-01

    The Central Institute for Brain Research was founded in Amsterdam in 1908 as part of an international effort to study the nervous system with multiple institutions and various disciplines. The development of research in the past hundred years at the Brain Institute has hardly been documented. We analyze the history of this institute by means of brief portraits of its directors and their main research topics. It appears that each director introduced his own branch of neuroscience into the institute. Initially, mainly comparative neuroanatomical data were collected. Following the Second World War, the multidisciplinary approach slowly developed with research programs on systems neuroscience, neuroendocrinology, and brain disorders. Every new director introduced new approaches to the study of the brain and thus played an important role in keeping brain research in the Netherlands at the international forefront where it has been ever since its foundation in 1908.

  2. The Chemistry Departement of the Institute for Nuclear Physics Research, Amsterdam, The Netherlands

    International Nuclear Information System (INIS)

    Lindner, L.

    1977-01-01

    In 1946, the Institute for Nuclear Physics Research (IKO) in Amsterdam was founded as a typical post World War II effort to cope with the surge in scientific research, primarily in the USA. At present, the Institute encompasses almost 250 workers - including a Philips research group - out of which nearly 30 are members of the Chemistry Department. In the beginning, the investigations dealt with more or less conventional tracerwork using long-lived radionuclides produced in nuclear reactors. This changed rapidly with the synchrocyclotron coming into operation in 1947. The present can be best characterized as a sort of a transition state. Emphasis has been laid upon more typical chemical aspects of the research program: a shift from ''nuclear'' chemistry to ''radio'' chemistry. The future is determined by the 500 MeV linear electron accelerator, dubbed MEA (Medium Energy Accelerator) already under construction. (T.G.)

  3. Endolithic algae in living stony corals: algal concentrations under influence of depth-dependent light conditions and coral tissue fluorescence in Agaricia agaricites (L.) and Meandrina meandrites (L.) (Scleractinia, Anthozoa)

    NARCIS (Netherlands)

    Delvoye, Laurent

    1992-01-01

    DELVOYE, L., 1992. Endolithic algae in living stony corals: Algal concentrations under influence of depth-dependent light conditions and coral tissue fluorescence in Agaricia agaricites (L) and Meandrina meandrites (L.) (Sclereactinia, Anthozoa). Studies Nat. Hist. Caribbean Region 71, Amsterdam

  4. Persistence after treatment of pharyngeal gonococcal infections in patients of the STI clinic, Amsterdam, the Netherlands, 2012-2015: a retrospective cohort study

    NARCIS (Netherlands)

    Hananta, I. Putu Yuda; de Vries, Henry John Christiaan; van Dam, Alje P.; van Rooijen, Martijn Sebastiaan; Soebono, Hardyanto; Schim van der Loeff, Maarten Franciscus

    2017-01-01

    Infection of Neisseria gonorrhoeae in the pharynx (pharyngeal Ng) is associated with gonococcal transmission and development of antimicrobial resistance. We assessed proportion of and determinants for persistence after treatment of pharyngeal Ng. At the STI clinic of Amsterdam, the Netherlands,

  5. Intrapartum and neonatal mortality in primary midwife-led and secondary obstetrician-led care in the Amsterdam region of the Netherlands: A retrospective cohort study

    NARCIS (Netherlands)

    Wiegerinck, M.M.J.; van der Goes, B.Y.; Ravelli, A.C.J.; van der Post, J.A.M.; Klinkert, J.; Brandenbarg, J.; Buist, F.C.D.; Wouters, M.G.A.J.; Tamminga, P.; de Jonge, A.; Mol, B.W.

    2015-01-01

    Objective: to compare intrapartum- and neonatal mortality and intervention rates in term women starting labour in primary midwife-led versus secondary obstetrician-led care. Design: retrospective cohort study. Setting: Amsterdam region of the Netherlands. Participants: women with singleton

  6. HIV incidence on the increase among homosexual men attending an Amsterdam sexually transmitted disease clinic: using a novel approach for detecting recent infections

    NARCIS (Netherlands)

    Dukers, Nicole H. T. M.; Spaargaren, Joke; Geskus, Ronald B.; Beijnen, Jos; Coutinho, Roel A.; Fennema, Han S. A.

    2002-01-01

    Objective: Dramatic increases have occurred in sexually transmitted diseases (STD) and in sexual risk behaviour among homosexual men in Amsterdam and internationally. We investigated whether these trends indicate a resurgence of the HIV epidemic. Methods: HIV incidence was determined among

  7. Digital Destinations in the Tourist Sector: A Path Model for the Impact of e-Services on Tourist Expenditures in Amsterdam

    NARCIS (Netherlands)

    Neuts, B.; Romao, J.; Nijkamp, P.; van Leeuwen, E.S.

    2013-01-01

    Innovations in information and communication technologies (ICT) in recent decades have had profound implications for tourism services, promotion, or distribution. We apply a Structural Equations Model (SEM) to analyse the relationships between the characteristics of tourists visiting Amsterdam, the

  8. Beyond a lesbian space? An investigation on the intergenerational discourse surrounding lesbian public social places in Amsterdam.

    Science.gov (United States)

    Fobear, Katherine

    2012-01-01

    This article investigates intergenerational discourse on public lesbian social spaces within Amsterdam, Netherlands. The author seeks to address how lesbian women from different generations talk about lesbian social spaces in Amsterdam through anthropological ethnographic research and semistructured interviews with 20 lesbian women who have or currently are attending these places. The author also addresses the gradual decline of lesbian specific spaces in the city and the current belief that lesbian women are beyond having a public social space that services only the lesbian community. The rise in popularity of mixed gay- and lesbian-friendly bars and girl circuit parties will be identified as a key area where generational tensions and discourse are being played out. Issues pertaining to generational disagreements over lesbian identity, visibility, and space will be addressed.

  9. The association between ethnicity and vaginal microbiota composition in Amsterdam, the Netherlands.

    Science.gov (United States)

    Borgdorff, Hanneke; van der Veer, Charlotte; van Houdt, Robin; Alberts, Catharina J; de Vries, Henry J; Bruisten, Sylvia M; Snijder, Marieke B; Prins, Maria; Geerlings, Suzanne E; Schim van der Loeff, Maarten F; van de Wijgert, Janneke H H M

    2017-01-01

    To evaluate whether ethnicity is independently associated with vaginal microbiota (VMB) composition in women living in Amsterdam, the Netherlands, as has been shown for American women. Women (18-34 years, non-pregnant, N = 610) representing the six largest ethnic groups (Dutch, African Surinamese, South-Asian Surinamese, Turkish, Moroccan, and Ghanaian) were sampled from the population-based HELIUS study. Sampling was performed irrespective of health status or healthcare seeking behavior. DNA was extracted from self-sampled vaginal swabs and sequenced by Illumina MiSeq (16S rRNA gene V3-V4 region). The overall prevalence of VMBs not dominated by lactobacilli was 38.5%: 32.2% had a VMB resembling bacterial vaginosis and another 6.2% had a VMB dominated by Bifidobacteriaceae (not including Gardnerella vaginalis), Corynebacterium, or pathobionts (streptococci, staphylococci, Proteus or Enterobacteriaceae). The most prevalent VMB in ethnically Dutch women was a Lactobacillus crispatus-dominated VMB, in African Surinamese and Ghanaian women a polybacterial G. vaginalis-containing VMB, and in the other ethnic groups a L. iners-dominated VMB. After adjustment for sociodemographic, behavioral and clinical factors, African Surinamese ethnicity (adjusted odds ratio (aOR) 5.1, 95% confidence interval (CI) 2.1-12.0) and Ghanaian ethnicity (aOR 4.8, 95% CI 1.8-12.6) were associated with having a polybacterial G. vaginalis-containing VMB, and African Surinamese ethnicity with a L. iners-dominated VMB (aOR 2.8, 95% CI 1.2-6.2). Shorter steady relationship duration, inconsistent condom use with casual partners, and not using hormonal contraception were also associated with having a polybacterial G. vaginalis-containing VMB, but human papillomavirus infection was not. Other sexually transmitted infections were uncommon. The overall prevalence of having a VMB not dominated by lactobacilli in this population-based cohort of women aged 18-34 years in Amsterdam was high (38.5%), and

  10. The association between ethnicity and vaginal microbiota composition in Amsterdam, the Netherlands.

    Directory of Open Access Journals (Sweden)

    Hanneke Borgdorff

    Full Text Available To evaluate whether ethnicity is independently associated with vaginal microbiota (VMB composition in women living in Amsterdam, the Netherlands, as has been shown for American women.Women (18-34 years, non-pregnant, N = 610 representing the six largest ethnic groups (Dutch, African Surinamese, South-Asian Surinamese, Turkish, Moroccan, and Ghanaian were sampled from the population-based HELIUS study. Sampling was performed irrespective of health status or healthcare seeking behavior. DNA was extracted from self-sampled vaginal swabs and sequenced by Illumina MiSeq (16S rRNA gene V3-V4 region.The overall prevalence of VMBs not dominated by lactobacilli was 38.5%: 32.2% had a VMB resembling bacterial vaginosis and another 6.2% had a VMB dominated by Bifidobacteriaceae (not including Gardnerella vaginalis, Corynebacterium, or pathobionts (streptococci, staphylococci, Proteus or Enterobacteriaceae. The most prevalent VMB in ethnically Dutch women was a Lactobacillus crispatus-dominated VMB, in African Surinamese and Ghanaian women a polybacterial G. vaginalis-containing VMB, and in the other ethnic groups a L. iners-dominated VMB. After adjustment for sociodemographic, behavioral and clinical factors, African Surinamese ethnicity (adjusted odds ratio (aOR 5.1, 95% confidence interval (CI 2.1-12.0 and Ghanaian ethnicity (aOR 4.8, 95% CI 1.8-12.6 were associated with having a polybacterial G. vaginalis-containing VMB, and African Surinamese ethnicity with a L. iners-dominated VMB (aOR 2.8, 95% CI 1.2-6.2. Shorter steady relationship duration, inconsistent condom use with casual partners, and not using hormonal contraception were also associated with having a polybacterial G. vaginalis-containing VMB, but human papillomavirus infection was not. Other sexually transmitted infections were uncommon.The overall prevalence of having a VMB not dominated by lactobacilli in this population-based cohort of women aged 18-34 years in Amsterdam was high (38

  11. The impact of regulatory approaches targeting collaborative economy in the tourism accommodation sector::Barcelona, Berlin, Amsterdam and Paris

    OpenAIRE

    Dredge, Dianne; Gyimóthy, Szilvia; Birkbak, Andreas; Jensen, Torben Elgaard; Madsen, Anders Koed

    2016-01-01

    This paper has been commissioned by the European Commission’s DG GROWTH to examine the impact of regulatory approaches targeting collaborative economy in the tourism accommodation sector in the cities of Barcelona, Berlin, Amsterdam and Paris. In relation to tourism, the growth of the collaborative economy peer-to-peer accommodation sector has significant impacts for traditional tourism industry structures and relationships. The growth of the collaborative economy peer-to-peer accommodation m...

  12. Validation of the Malay version of the Amsterdam Preoperative Anxiety and Information Scale (APAIS).

    Science.gov (United States)

    Mohd Fahmi, Z; Lai, L L; Loh, P S

    2015-08-01

    Preoperative anxiety is a significant problem worldwide that may affect patients' surgical outcome. By using a simple and reliable tool such as the Amsterdam Preoperative Anxiety and Information Scale (APAIS), anaesthesiologists would be able to assess preoperative anxiety adequately and accurately. The purpose of this study was to develop and validate the Malay version of APAIS (Malay-APAIS), and assess the factors associated with higher anxiety scores. The authors performed forward and backward translation of APAIS into Malay and then tested on 200 patients in the anaesthetic clinic of University Malaya Medical Centre. Psychometric analysis was performed with factor analysis, internal consistency and correlation with Spielberger's State-Trait Anxiety Inventory (STAI-state). A good correlation was shown with STAI-state (r = 0.59). Anxiety and need for information both emerged with high internal consistency (Cronbach's alpha 0.93 and 0.90 respectively). Female gender, surgery with a higher risk and need for information were found to be associated with higher anxiety scores. On the other hand, previous experience with surgery had lower need for information. The Malay-APAIS is a valid and reliable tool for the assessment of patients' preoperative anxiety and their need for information. By understanding and measuring patient's concerns objectively, the perioperative management will improve to a much higher standard of care.

  13. The spatiality of specialty coffee bars and the cognitive-cultural economy in Amsterdam

    Directory of Open Access Journals (Sweden)

    Reza Shaker Ardekani

    2016-12-01

    Full Text Available Economic restructuring has led to the emergence of new socio-economic arrangements in cities based on the cognitive-cultural economy. Furthermore, the arrival of new middle classes in inner-cities has contributed to a renaissance of interest in urban culture and new consumption spaces. Focusing on specialty coffee bars (SCBs, the study explores their spatial patterns and spatial distributions in Amsterdam in order to find the spatial correlations between new urban consumption spaces and their locational economic strategies in terms of the cognitive-cultural opportunities. By employing geographic information system (GIS, the findings suggest a positive spatial correlation between urban areas involved in the cognitive-cultural economy and the concentration of SCBs. Although the argued correlation does not imply causation, it provides distinct insights related to the interconnectedness of new urban consumption spaces and their contextual urban economy. The paper also slightly touches upon some of the capabilities of GIS in the field of urban studies and poses some questions for further investigations.

  14. Improving rational thermal comfort prediction by using subpopulation characteristics: A case study at Hermitage Amsterdam.

    Science.gov (United States)

    Kramer, Rick; Schellen, Lisje; Schellen, Henk; Kingma, Boris

    2017-01-01

    This study aims to improve the prediction accuracy of the rational standard thermal comfort model, known as the Predicted Mean Vote (PMV) model, by (1) calibrating one of its input variables "metabolic rate," and (2) extending it by explicitly incorporating the variable running mean outdoor temperature (RMOT) that relates to adaptive thermal comfort. The analysis was performed with survey data ( n = 1121) and climate measurements of the indoor and outdoor environment from a one year-long case study undertaken at Hermitage Amsterdam museum in the Netherlands. The PMVs were calculated for 35 survey days using (1) an a priori assumed metabolic rate, (2) a calibrated metabolic rate found by fitting the PMVs to the thermal sensation votes (TSVs) of each respondent using an optimization routine, and (3) extending the PMV model by including the RMOT. The results show that the calibrated metabolic rate is estimated to be 1.5 Met for this case study that was predominantly visited by elderly females. However, significant differences in metabolic rates have been revealed between adults and elderly showing the importance of differentiating between subpopulations. Hence, the standard tabular values, which only differentiate between various activities, may be oversimplified for many cases. Moreover, extending the PMV model with the RMOT substantially improves the thermal sensation prediction, but thermal sensation toward extreme cool and warm sensations remains partly underestimated.

  15. 'De strijd om Amsterdam'. Een nieuwe benadering in het onderzoek naar de NSB

    Directory of Open Access Journals (Sweden)

    Josje Damsma

    2009-01-01

    Full Text Available ‘The Fight for Amsterdam’. A New Approach in Research into the NSBThe main characteristics of the members of the Dutch Nazi-movement (Nationaal- Socialistische Beweging, NSB are constructed by historians De Jong and De Jonge. Both labeled the members of the NSB as ‘opportunistic’ and ‘isolated’. Up until now, that image has remained unchallenged. Inspired by Aristotle Kallis, Roger Griffin and Robert Paxton, we analyzed the behavior and social position of members of the NSB in Amsterdam during the Second World War in a new way. By focusing on their actions instead of on ideology, their isolated position can be brought into doubt along with opportunism as the main motivational factor. It is more likely that a combination of idealism, opportunism and social networks led to membership of the NSB. The interaction pattern differed from person to person and per political, economic or social level of communication. The results of this research show that Dutch political history and identity is complex and a lot of research still has to be done in this field.

  16. The 'Amstel Canal' in Amsterdam Canal construction as part of the medieval reclamation and drainage system of the Western Netherlands wilderness

    Science.gov (United States)

    Abrahamse, Jaap-Evert; Kosian, Menne; Weerts, Henk

    2013-04-01

    Usually, Amsterdam is presented as a river city, with the river Amstel as the trade route towards its hinterland, the IJ sea-branch as the portal to the world and its Dam as a focal point of transshipment and trade. Geomorphological, sedimentological, historical and historical-geographical evidence however, points towards the straight part of the Amstel, now located in Amsterdam, as a drainage canal that was dug in the aftermath of the 'Great Reclamation' of the 11th and 12th centuries. During this period, large parts of the wilderness in Utrecht and Holland were cultivated and put to agricultural use. Prior to the 'Great Reclamations', large oligotrophic (Sphagnum) peat bogs drained by small rivers were characteristic of the entire region. All along the straight Amstel canal, Sphagnum peat is found, which is indicative of the area's former peat bog conditions. The 'Amstel Canal' connected two natural meandering watercourses, one at the north and one at the south of the canal. The soil along both watercourses exists of eutrophic peat, which is indicative of repeated natural flooding. This is a strong indication of the anthropogenous origin of the straight part of the Amstel. The reason for digging the Amstel canal was not to create better trade links; it was a local component of a solution for major regional drainage problems in the provinces of Utrecht and Holland. These problems arose from the silting up of the Rhine rivermouth around 1100AD. Because of this, the precipitation surplus of the entire region could not be drained to the North Sea by this route anymore. This led to increased flooding and subsequently to conflicts between the rulers of Holland and Utrecht. In 1165AD, these conflicts reached a point where the Holy Roman Emperor intervened. The ruling of Barbarossa eventually led to a compromise: Utrecht and Holland redirected the entire drainage system of the region from the North Sea to the Zuiderzee in a concerted effort. This operation consisted of

  17. Validation of the Spanish version of the Amsterdam Preoperative Anxiety and Information Scale (APAIS).

    Science.gov (United States)

    Vergara-Romero, Manuel; Morales-Asencio, José Miguel; Morales-Fernández, Angelines; Canca-Sanchez, Jose Carlos; Rivas-Ruiz, Francisco; Reinaldo-Lapuerta, Jose Antonio

    2017-06-07

    Preoperative anxiety is a frequent and challenging problem with deleterious effects on the development of surgical procedures and postoperative outcomes. To prevent and treat preoperative anxiety effectively, the level of anxiety of patients needs to be assessed through valid and reliable measuring instruments. One such measurement tool is the Amsterdam Preoperative Anxiety and Information Scale (APAIS), of which a Spanish version has not been validated yet. To perform a Spanish cultural adaptation and empirical validation of the APAIS for assessing preoperative anxiety in the Spanish population. A two-step forward/back translation of the APAIS scale was performed to ensure a reliable Spanish cultural adaptation. The final Spanish version of the APAIS questionnaire was administered to 529 patients between the ages of 18 to 70 undergoing elective surgery at hospitals of the Agencia Sanitaria Costa del Sol (Spain). Cronbach's alpha, homogeneity index, intra-class correlation coefficient, and confirmatory factor analysis were calculated to assess internal consistency and criteria and construct validity. Confirmatory factor analysis showed that a one-factor model was better fitted than a two-factor model, with good fitting patterns (root mean square error of approximation: 0.05, normed-fit index: 0.99, goodness-of-fit statistic: 0.99). The questionnaire showed high internal consistency (Cronbach's alpha: 0.84) and a good correlation with the Goldberg Anxiety Scale (CCI: 0.62 (95% CI: 0.55 to 0.68). The Spanish version of the APAIS is a valid and reliable preoperative anxiety measurement tool and shows psychometric properties similar to those obtained by similar previous studies.

  18. The Amsterdam Resting-State Questionnaire reveals multiple phenotypes of resting-state cognition

    Directory of Open Access Journals (Sweden)

    B. Alexander eDiaz

    2013-08-01

    Full Text Available Resting-state neuroimaging is a dominant paradigm for studying brain function in health and disease. It is attractive for clinical research because of its simplicity for patients, straightforward standardization, and sensitivity to brain disorders. Importantly, non-sensory experiences like mind wandering may arise from ongoing brain activity. However, little is known about the link between ongoing brain activity and cognition, as phenotypes of resting-state cognition—and tools to quantify them—have been lacking. To facilitate rapid and structured measurements of resting-state cognition we developed a 50-item self-report survey, the Amsterdam Resting-State Questionnaire (ARSQ. Based on ARSQ data from 813 participants assessed after five minutes eyes-closed rest in their home, we identified seven dimensions of resting-state cognition using factor analysis: Discontinuity of Mind, Theory of Mind, Self, Planning, Sleepiness, Comfort, and Somatic Awareness. Further, we showed that the structure of cognition was similar during resting-state fMRI and EEG, and that the test-retest correlations were remarkably high for all dimensions. To explore whether inter-individual variation of resting-state cognition is related to health status, we correlated ARSQ-derived factor scores with psychometric scales measuring depression, anxiety, and sleep quality. Mental health correlated positively with Comfort and negatively with Discontinuity of Mind. Finally, we show that sleepiness may partially explain a resting-state EEG profile previously associated with Alzheimer’s disease. These findings indicate that the ARSQ readily provides information about cognitive phenotypes and that it is a promising tool for research on the neural correlates of resting-state cognition in health and disease.

  19. Predicting Early Mortality After Hip Fracture Surgery: The Hip Fracture Estimator of Mortality Amsterdam.

    Science.gov (United States)

    Karres, Julian; Kieviet, Noera; Eerenberg, Jan-Peter; Vrouenraets, Bart C

    2018-01-01

    Early mortality after hip fracture surgery is high and preoperative risk assessment for the individual patient is challenging. A risk model could identify patients in need of more intensive perioperative care, provide insight in the prognosis, and allow for risk adjustment in audits. This study aimed to develop and validate a risk prediction model for 30-day mortality after hip fracture surgery: the Hip fracture Estimator of Mortality Amsterdam (HEMA). Data on 1050 consecutive patients undergoing hip fracture surgery between 2004 and 2010 were retrospectively collected and randomly split into a development cohort (746 patients) and validation cohort (304 patients). Logistic regression analysis was performed in the development cohort to determine risk factors for the HEMA. Discrimination and calibration were assessed in both cohorts using the area under the receiver operating characteristic curve (AUC), the Hosmer-Lemeshow goodness-of-fit test, and by stratification into low-, medium- and high-risk groups. Nine predictors for 30-day mortality were identified and used in the final model: age ≥85 years, in-hospital fracture, signs of malnutrition, myocardial infarction, congestive heart failure, current pneumonia, renal failure, malignancy, and serum urea >9 mmol/L. The HEMA showed good discrimination in the development cohort (AUC = 0.81) and the validation cohort (AUC = 0.79). The Hosmer-Lemeshow test indicated no lack of fit in either cohort (P > 0.05). The HEMA is based on preoperative variables and can be used to predict the risk of 30-day mortality after hip fracture surgery for the individual patient. Prognostic Level II. See Instructions for Authors for a complete description of levels of evidence.

  20. Multidisciplinary integrated Parent and Child Centres in Amsterdam: a qualitative study

    Directory of Open Access Journals (Sweden)

    Vincent Busch

    2013-04-01

    Full Text Available Background: In several countries centres for the integrated delivery of services to the parent and child have been established. In the Netherlands family health care service centres, called Parent and Child Centres (PCCs involve multidisciplinary teams. Here doctors, nurses, midwives, maternity help professionals and educationists are integrated into multidisciplinary teams in neighbourhood-based centres. To date there has been little research on the implementation of service delivery in these centres.Study Design: A SWOT analysis was performed by use of triangulation data; this took place by integrating all relevant published documents on the origin and organization of the PCCs and the results from interviews with PCC experts and with PCC professionals (N=91. Structured interviews were performed with PCC-professionals (health care professionals (N=67 and PCC managers N=12 and PCC-experts (N=12 in Amsterdam and qualitatively analysed thematically. The interview themes were based on a pre-set list of codes, derived from a prior documentation study and a focus group with PCC experts. Results: Perceived advantages of PCCs were more continuity of care, shorter communication lines, low-threshold contact between professionals and promising future perspectives. Perceived challenges included the absence of uniform multidisciplinary guidelines, delays in communication with hospitals and midwives, inappropriate accommodation for effective professional integration, differing expectations regarding the PCC-manager role among PCC-partners and the danger of professionals' needs dominating clients' needs.Conclusions: Professionals perceive PCCs as a promising development in the integration of services. Remaining challenges involved improvements at the managerial and organizational level. Quantitative research into the improvements in quality of care and child health is recommended.

  1. Multidisciplinary integrated Parent and Child Centres in Amsterdam: a qualitative study

    Directory of Open Access Journals (Sweden)

    Vincent Busch

    2013-04-01

    Full Text Available Background: In several countries centres for the integrated delivery of services to the parent and child have been established. In the Netherlands family health care service centres, called Parent and Child Centres (PCCs involve multidisciplinary teams. Here doctors, nurses, midwives, maternity help professionals and educationists are integrated into multidisciplinary teams in neighbourhood-based centres. To date there has been little research on the implementation of service delivery in these centres. Study Design: A SWOT analysis was performed by use of triangulation data; this took place by integrating all relevant published documents on the origin and organization of the PCCs and the results from interviews with PCC experts and with PCC professionals (N=91. Structured interviews were performed with PCC-professionals (health care professionals (N=67 and PCC managers N=12 and PCC-experts (N=12 in Amsterdam and qualitatively analysed thematically. The interview themes were based on a pre-set list of codes, derived from a prior documentation study and a focus group with PCC experts.  Results: Perceived advantages of PCCs were more continuity of care, shorter communication lines, low-threshold contact between professionals and promising future perspectives. Perceived challenges included the absence of uniform multidisciplinary guidelines, delays in communication with hospitals and midwives, inappropriate accommodation for effective professional integration, differing expectations regarding the PCC-manager role among PCC-partners and the danger of professionals' needs dominating clients' needs. Conclusions: Professionals perceive PCCs as a promising development in the integration of services. Remaining challenges involved improvements at the managerial and organizational level. Quantitative research into the improvements in quality of care and child health is recommended.

  2. Cannabis intoxication inhibits avoidance action tendencies: a field study in the Amsterdam coffee shops.

    Science.gov (United States)

    Cousijn, Janna; Snoek, Robin W M; Wiers, Reinout W

    2013-09-01

    Experimental laboratory studies suggest that the approach bias (relatively fast approach responses) toward substance-related materials plays an important role in problematic substance use. How this bias is moderated by intention to use versus recent use remains unknown. Moreover, the relationship between approach bias and other motivational processes (satiation and craving) and executive functioning remains unclear. The aim of this study was to investigate the cannabis approach bias before and after cannabis use in real-life setting (Amsterdam coffee shops) and to assess the relationship between approach bias, craving, satiation, cannabis use, and response inhibition. Cannabis, tobacco, and neutral approach and avoidance action tendencies were measured with the Approach Avoidance Task and compared between 42 heavy cannabis users with the intention to use and 45 heavy cannabis users shortly after cannabis use. The classical Stroop was used to measure response inhibition. Multiple regression analyses were conducted to investigate relationships between approach bias, satiation, craving, cannabis use, and response inhibition. In contrast to the hypotheses, heavy cannabis users with the intention to use did not show a cannabis approach bias, whereas intoxicated cannabis users did show an approach bias regardless of image category. This could be attributed to a general slowing of avoidance action tendencies. Moreover, craving was negatively associated with the approach bias, and no relationships were observed between the cannabis approach bias, satiation, prior cannabis use, and response inhibition. Cannabis intoxication in a real-life setting inhibited general avoidance. Expression of the cannabis approach bias appeared not to be modulated by satiation or response inhibition.

  3. Multilocus sequence typing of Trichomonas vaginalis clinical samples from Amsterdam, the Netherlands.

    Science.gov (United States)

    van der Veer, C; Himschoot, M; Bruisten, S M

    2016-10-13

    In this cross-sectional epidemiological study we aimed to identify molecular profiles for Trichomonas vaginalis and to determine how these molecular profiles were related to patient demographic and clinical characteristics. Molecular typing methods previously identified two genetically distinct subpopulations for T. vaginalis; however, few molecular epidemiological studies have been performed. We now increased the sensitivity of a previously described multilocus sequence typing (MLST) tool for T. vaginalis by using nested PCR. This enabled the typing of direct patient samples. From January to December 2014, we collected all T. vaginalis positive samples as detected by routine laboratory testing. Samples from patients either came from general practitioners offices or from the sexually transmitted infections (STI) clinic in Amsterdam. Epidemiological data for the STI clinic patients were retrieved from electronic patient files. The primary outcome was the success rate of genotyping direct T. vaginalis positive samples. The secondary outcome was the relation between T. vaginalis genotypes and risk factors for STI. All 7 MLST loci were successfully typed for 71/87 clinical samples. The 71 typed samples came from 69 patients, the majority of whom were women (n=62; 90%) and half (n=34; 49%) were STI clinic patients. Samples segregated into a two population structure for T. vaginalis representing genotypes I and II. Genotype I was most common (n=40; 59.7%). STI clinic patients infected with genotype II reported more sexual partners in the preceding 6 months than patients infected with genotype I (p=0.028). No other associations for gender, age, ethnicity, urogenital discharge or co-occurring STIs with T. vaginalis genotype were found. MLST with nested PCR is a sensitive typing method that allows typing of direct (uncultured) patient material. Genotype II is possibly more prevalent in high-risk sexual networks. Published by the BMJ Publishing Group Limited. For

  4. The Amsterdam Resting-State Questionnaire reveals multiple phenotypes of resting-state cognition

    Science.gov (United States)

    Diaz, B. Alexander; Van Der Sluis, Sophie; Moens, Sarah; Benjamins, Jeroen S.; Migliorati, Filippo; Stoffers, Diederick; Den Braber, Anouk; Poil, Simon-Shlomo; Hardstone, Richard; Van't Ent, Dennis; Boomsma, Dorret I.; De Geus, Eco; Mansvelder, Huibert D.; Van Someren, Eus J. W.; Linkenkaer-Hansen, Klaus

    2013-01-01

    Resting-state neuroimaging is a dominant paradigm for studying brain function in health and disease. It is attractive for clinical research because of its simplicity for patients, straightforward standardization, and sensitivity to brain disorders. Importantly, non-sensory experiences like mind wandering may arise from ongoing brain activity. However, little is known about the link between ongoing brain activity and cognition, as phenotypes of resting-state cognition—and tools to quantify them—have been lacking. To facilitate rapid and structured measurements of resting-state cognition we developed a 50-item self-report survey, the Amsterdam Resting-State Questionnaire (ARSQ). Based on ARSQ data from 813 participants assessed after 5 min eyes-closed rest in their home, we identified seven dimensions of resting-state cognition using factor analysis: Discontinuity of Mind, Theory of Mind, Self, Planning, Sleepiness, Comfort, and Somatic Awareness. Further, we showed that the structure of cognition was similar during resting-state fMRI and EEG, and that the test-retest correlations were remarkably high for all dimensions. To explore whether inter-individual variation of resting-state cognition is related to health status, we correlated ARSQ-derived factor scores with psychometric scales measuring depression, anxiety, and sleep quality. Mental health correlated positively with Comfort and negatively with Discontinuity of Mind. Finally, we show that sleepiness may partially explain a resting-state EEG profile previously associated with Alzheimer's disease. These findings indicate that the ARSQ readily provides information about cognitive phenotypes and that it is a promising tool for research on the neural correlates of resting-state cognition in health and disease. PMID:23964225

  5. Groundwater impacts on surface water quality and nutrient loads in lowland polder catchments: monitoring the greater Amsterdam area

    Science.gov (United States)

    Yu, Liang; Rozemeijer, Joachim; van Breukelen, Boris M.; Ouboter, Maarten; van der Vlugt, Corné; Broers, Hans Peter

    2018-01-01

    The Amsterdam area, a highly manipulated delta area formed by polders and reclaimed lakes, struggles with high nutrient levels in its surface water system. The polders receive spatially and temporally variable amounts of water and nutrients via surface runoff, groundwater seepage, sewer leakage, and via water inlets from upstream polders. Diffuse anthropogenic sources, such as manure and fertiliser use and atmospheric deposition, add to the water quality problems in the polders. The major nutrient sources and pathways have not yet been clarified due to the complex hydrological system in lowland catchments with both urban and agricultural areas. In this study, the spatial variability of the groundwater seepage impact was identified by exploiting the dense groundwater and surface water monitoring networks in Amsterdam and its surrounding polders. A total of 25 variables (concentrations of total nitrogen (TN), total phosphorus (TP), NH4, NO3, HCO3, SO4, Ca, and Cl in surface water and groundwater, N and P agricultural inputs, seepage rate, elevation, land-use, and soil type) for 144 polders were analysed statistically and interpreted in relation to sources, transport mechanisms, and pathways. The results imply that groundwater is a large source of nutrients in the greater Amsterdam mixed urban-agricultural catchments. The groundwater nutrient concentrations exceeded the surface water environmental quality standards (EQSs) in 93 % of the polders for TP and in 91 % for TN. Groundwater outflow into the polders thus adds to nutrient levels in the surface water. High correlations (R2 up to 0.88) between solutes in groundwater and surface water, together with the close similarities in their spatial patterns, confirmed the large impact of groundwater on surface water chemistry, especially in the polders that have high seepage rates. Our analysis indicates that the elevated nutrient and bicarbonate concentrations in the groundwater seepage originate from the decomposition of

  6. Groundwater impacts on surface water quality and nutrient loads in lowland polder catchments: monitoring the greater Amsterdam area

    Directory of Open Access Journals (Sweden)

    L. Yu

    2018-01-01

    Full Text Available The Amsterdam area, a highly manipulated delta area formed by polders and reclaimed lakes, struggles with high nutrient levels in its surface water system. The polders receive spatially and temporally variable amounts of water and nutrients via surface runoff, groundwater seepage, sewer leakage, and via water inlets from upstream polders. Diffuse anthropogenic sources, such as manure and fertiliser use and atmospheric deposition, add to the water quality problems in the polders. The major nutrient sources and pathways have not yet been clarified due to the complex hydrological system in lowland catchments with both urban and agricultural areas. In this study, the spatial variability of the groundwater seepage impact was identified by exploiting the dense groundwater and surface water monitoring networks in Amsterdam and its surrounding polders. A total of 25 variables (concentrations of total nitrogen (TN, total phosphorus (TP, NH4, NO3, HCO3, SO4, Ca, and Cl in surface water and groundwater, N and P agricultural inputs, seepage rate, elevation, land-use, and soil type for 144 polders were analysed statistically and interpreted in relation to sources, transport mechanisms, and pathways. The results imply that groundwater is a large source of nutrients in the greater Amsterdam mixed urban–agricultural catchments. The groundwater nutrient concentrations exceeded the surface water environmental quality standards (EQSs in 93 % of the polders for TP and in 91 % for TN. Groundwater outflow into the polders thus adds to nutrient levels in the surface water. High correlations (R2 up to 0.88 between solutes in groundwater and surface water, together with the close similarities in their spatial patterns, confirmed the large impact of groundwater on surface water chemistry, especially in the polders that have high seepage rates. Our analysis indicates that the elevated nutrient and bicarbonate concentrations in the groundwater seepage originate

  7. Status report 500 MeV, 10% d.f. linear accelerator (MEA) under construction at Amsterdam

    International Nuclear Information System (INIS)

    Bruinsma, P.J.T.; Vries, C. de.

    1979-03-01

    The design parameters and the general lay-out of buildings and of the main components of the accelerator are presented. Some of the accelerator technology features which are typical for the Amsterdam machine are then described. The performance obtained so far with the first part of the machine is indicated with some remarks on the planning for the next 2 years during which the facility ought to be fully operational. The type of experimental facilities under construction are described and the status and the planning schedule are indicated. (Auth.)

  8. Bloedzuigers in pluimveestallen

    NARCIS (Netherlands)

    Mul, M.F.; Mullens, B.A.; Koenraadt, C.J.M.

    2009-01-01

    Wageningen UR en Universiteit Amsterdam werken aan mogelijke maatregelen tegen de vogelmijt, Dermanyssus gallinae, in Nederlandse legpluimveestallen. Ook is uitbreiding van een ander vogelmijt-type gesignaleerd: de noordelijke vogelmijt, of Ornithonyssus sylviarum

  9. De kloof tussen wetenschap en praktijk dichten Carel hulshof

    NARCIS (Netherlands)

    Putten, D. van

    2011-01-01

    Carel Hulshof is per 1 mei 2011 benoemd tot bijzonder hoogleraar Arbeids- en Bedrijfsgeneeskunde aan de Universiteit van Amsterdam bij het Coronel Instituut voor Arbeid en Gezondheid van het Academisch Medisch Centrum.

  10. Coordination Approaches for Complex Software Systems

    NARCIS (Netherlands)

    Bosse, T.; Hoogendoorn, M.; Treur, J.

    2006-01-01

    This document presents the results of a collaboration between the Vrije Universiteit Amsterdam, Department of Artificial Intelligence and Force Vision to investigate coordination approaches for complex software systems. The project was funded by Force Vision.

  11. Adriaan van Veldhuizen, De partij. Over het politieke leven in de vroege S.D.A.P.

    Directory of Open Access Journals (Sweden)

    Dirk Jan Wolffram

    2016-11-01

    Full Text Available Adriaan van Veldhuizen, De partij. Over het politieke leven in de vroege S.D.A.P. (Dissertatie Universiteit Leiden 2015; Amsterdam: Prometheus/Bert Bakker, 2015, 375 pp., isbn 978 90 3513 857 5.

  12. Hypertension control in a large multi-ethnic cohort in Amsterdam, The Netherlands: the HELIUS study.

    Science.gov (United States)

    Agyemang, Charles; Kieft, Suzanne; Snijder, Marieke B; Beune, Erik J; van den Born, Bert-Jan; Brewster, Lizzy M; Ujcic-Voortman, Joanne J; Bindraban, Navin; van Montfrans, Gert; Peters, Ron J; Stronks, Karien

    2015-03-15

    Hypertension is a major problem among European ethnic minority groups. We assessed the current situation of hypertension prevalence and its management among a multi-ethnic population in Amsterdam, The Netherlands. Data from the HELIUS study were used including 12,974 participants (1871 Ghanaian, 2184 African Surinamese, 2278 South-Asian Surinamese, 2277 Turkish, 2222 Moroccan and 2142 Dutch origin people), aged 18-70 years. Comparisons among groups were made using proportions and age-adjusted prevalence ratios (PRs). Hypertension prevalence ranged from 24% and 16% in Moroccan men and women to 52% and 62% in Ghanaian men and women. Except for Moroccan women, age-adjusted PR of hypertension was higher in all the ethnic minority groups than in Dutch. Among hypertensives, ethnic minority groups generally had higher levels of hypertension awareness and BP lowering treatment than Dutch. Moreover, prevalence rates for the prescription of more than one BP lowering drug were generally higher in African and South-Asian origin groups compared with Dutch origin people. By contrast, BP control levels were lower in all the ethnic groups than in Dutch, with control rates being significantly lower in Ghanaian men (26%, PR=0.49; 95% CI, 0.37-0.66) and women (45%, PR=0.64; 0.52-0.77), African-Surinamese men (30%, PR=0.61; 0.46-0.81) and women (45%, PR=0.72; 0.51-0.77), and South-Asian Surinamese men (43%, PR=0.77; 0.61-0.97) and women (47%, PR=0.76; 0.63-0.92) compared with Dutch men (53%) and women (61%). Our findings indicate poor BP control in ethnic minority groups despite the high treatment levels. More work is needed to unravel the potential factors contributing to the poor control in order to improve BP control in ethnic minority groups, particularly among African and South-Asian origin groups. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  13. De AERA. Gedroomde machines en de praktijk van het rekenwerk aan het Mathematisch Centrum te Amsterdam

    Directory of Open Access Journals (Sweden)

    Gerard Alberts

    2008-06-01

    Full Text Available AERA. Dream machines and computing practices at the Mathematical Center  Dream machines may be just as effective as the ones materialised. Their symbolic thrust can be quite powerful. The Amsterdam ‘Mathematisch Centrum’ (Mathematical Center, founded February 11, 1946, created a Computing Department in an effort to realise its goal of serving society. When Aad van Wijngaarden was appointed as head of the Computing Department, however, he claimed space for scientific research and computer construction, next to computing as a service. Still, the computing service following the five stage style of Hartree’s numerical analysis remained a dominant chara c ter istic of the work of the Computing Department.The high level of ambition held by Aad van Wijngaarden lead to ever renewed projections of big automatic computers, symbolised by the never-built AERA. Even a machine that was actually constructed, the ARRA which followed A.D. Booth’s design of the ARC, never made it into real operation. It did serve Van Wijngaarden to bluff his way into the computer age by midsummer 1952. Not until January 1954 did the computing department have a working stored program computer, which for reasons of policy went under the same name: ARRA. After just one other machine, the ARMAC, had been produced, a separate company, Electrologica, was set up for the manufacture of computers, which produced the rather successful X1 computer.The combination of ambition and absence of a working machine lead to a high level of work on programming, way beyond the usual ideas of libraries of subroutines. Edsger W. Dijkstra in particular led the way to an emphasis on the duties of the programmer within the pattern of numerical analysis. Programs generating programs, known elsewhere as autocoding systems, were at the ‘Mathematisch Centrum’ called ‘superprograms’. Practical examples were usually called a ‘complex’, in Dutch, where in English one might say

  14. Comparison of general health status, myocardial infarction, obesity, diabetes, and fruit and vegetable intake between immigrant Pakistani population in the Netherlands and the local Amsterdam population.

    Science.gov (United States)

    Raza, Qaisar; Nicolaou, Mary; Dijkshoorn, Henriëtte; Seidell, Jacob C

    2017-12-01

    South Asians living in Western countries have shown higher prevalence of cardiovascular disease and related non-communicable diseases as compared to the local populations. The aim of this study was to compare the general health status and prevalence of myocardial infarction (MI), diabetes, high blood pressure, overweight, obesity, and fruit and vegetable intake between Pakistani immigrants in the Netherlands and local Amsterdam population. A health survey was conducted in 2012-2013 among Pakistanis in the Netherlands. Results were compared with a health survey conducted among inhabitants of Amsterdam in 2012. One hundred and fifty-four Pakistanis from four big cities of the Netherlands and 7218 inhabitants of Amsterdam participated. The data for Amsterdam population were weighed on the basis of age, gender, city district, marital status, ethnicity and income level while the data for Pakistanis were weighed on the basis of age and gender to make both data-sets representative of their general population. Pakistanis reported a high prevalence of MI (3.3%), diabetes (11.4%), high blood pressure (14.4%), overweight (35.5%) and obesity (18.5%) while Amsterdam population reported the prevalence as 2.5% for MI, 6.8% for diabetes, 15.3% for high blood pressure, 28.1% for overweight and 11.1% for obesity. Pakistanis had a significantly higher level of MI (OR = 2.71; 95% CI: 1.19-6.14), diabetes (OR = 4.41; 95% CI: 2.66-7.33) and obesity (OR = 2.51; 95% CI: 1.53-4.12) after controlling for age, sex and educational level with Amsterdam population as the reference group. Pakistanis showed a higher intake of fruit and fruit juice as compared to Amsterdam population though the latter showed a higher intake of cooked vegetables. Higher prevalence of MI, diabetes and obesity among Pakistanis than Amsterdam population indicates the need for health scientists and policy-makers to develop interventions for tackling non-communicable diseases and its determinants among

  15. Pathways into homelessness: recently homeless adults problems and service use before and after becoming homeless in Amsterdam

    Directory of Open Access Journals (Sweden)

    de Wit Matty A

    2009-01-01

    Full Text Available Abstract Background To improve homelessness prevention practice, we met with recently homeless adults, to explore their pathways into homelessness, problems and service use, before and after becoming homeless. Methods Recently homeless adults (last housing lost up to two years ago and legally staying in the Netherlands were sampled in the streets, day centres and overnight shelters in Amsterdam. In April and May 2004, students conducted interviews and collected data on demographics, self reported pathways into homelessness, social and medical problems, and service use, before and after becoming homeless. Results among 120 recently homeless adults, (male 88%, Dutch 50%, average age 38 years, mean duration of homelessness 23 weeks, the main reported pathways into homelessness were evictions 38%, relationship problems 35%, prison 6% and other reasons 22%. Compared to the relationship group, the eviction group was slightly older (average age 39.6 versus 35.5 years; p = 0.08, belonged more often to a migrant group (p = 0.025, and reported more living single (p Conclusion the recently homeless fit the overall profile of the homeless population in Amsterdam: single (Dutch men, around 40 years, with a mix of financial debts, addiction, mental and/or physical health problems. Contacts with services were fragmented and did not prevent homelessness. For homelessness prevention, systematic and outreach social medical care before and during homelessness should be provided.

  16. Population-based study on the seroprevalence of hepatitis A, B, and C virus infection in Amsterdam, 2004.

    Science.gov (United States)

    Baaten, G G G; Sonder, G J B; Dukers, N H T M; Coutinho, R A; Van den Hoek, J A R

    2007-12-01

    In order to enhance screening and preventive strategies, this study investigated the seroprevalence of hepatitis A, B, and C in the general adult urban population and in subgroups. In 2004, sera from 1,364 adult residents of Amsterdam were tested for viral markers. Sociodemographic characteristics were collected using a standardized questionnaire. For hepatitis A, 57.0% was immune. Of first-generation immigrants from Turkey and Morocco, 100% was immune. Of all Western persons and second-generation non-Western immigrants, approximately half was still susceptible. For hepatitis B, 9.9% had antibodies to hepatitis B core antigen (anti-HBc) and 0.4% had hepatitis B surface antigen. Anti-HBc seroprevalences were highest among first-generation immigrants from Surinam, Morocco, and Turkey, and correlated with age at the time of immigration, and among men with a sexual preference for men. Seroprevalence among second-generation immigrants was comparable to Western persons. The seroprevalence of hepatitis C virus antibodies was 0.6%. In conclusion, a country with overall low endemicity for viral hepatitis can show higher endemicity in urban regions, indicating the need for differentiated regional studies and prevention strategies. More prevention efforts in cities like Amsterdam are warranted, particularly for hepatitis A and B among second-generation immigrants, for hepatitis B among men with a sexual preference for men, and for hepatitis C. Active case finding strategies are needed for both hepatitis B and C. (c) Wiley-Liss, Inc.

  17. Energy supply for the Zuidas district [Amsterdam, Netherlands] 1995-2005, 2005-2020. Review, analysis and preview; Energievoorziening Zuidas 1995-2005, 2005-2020. Terugblik, analyse, vooruitblik

    Energy Technology Data Exchange (ETDEWEB)

    Frederiks, N.

    2005-07-15

    The project The Zuidas in Amsterdam, Netherlands, is the connection between the residential areas Amsterdam South and Buitenveldertbaan. It is a large spatial development that generates significant strategic and economic effects for both municipality, region and the Netherlands. Amsterdam plans to generate and use as much sustainable energy as possible in the most efficient way. This report describes how the Zuidas can become a sustainable and energy efficient project. The public version of the report is described in DMB magazine No. 1 [Dutch] Het projectgebied De Zuidas in Amsterdam vormt de verbinding tussen woonwijken (Zuid en Buitenveldert). Het is een groot ruimtelijk-ontwikkelingsproject dat belangrijke strategische en economische effecten genereert voor zowel gemeente, regio als Nederland. Amsterdam wil zoveel mogelijk duurzame energie efficiënt opwekken en gebruiken. In dit rapport wordt beschreven hoe de Zuidas een duurzaam en energiezuinig project moet worden. De publieksversie wordt beschreven in DMB magazine nr. 1.

  18. The role of the architect as a facilitator of a new “common” space : Transformation of the NDSM shipwharf, Amsterdam

    NARCIS (Netherlands)

    Havik, K.M.

    2016-01-01

    This paper discusses the collaborative process of the redevelopment of the Dutch state heritage shipwharf NDSM in Amsterdam into a cultural incubator: a creative hub with artist studios, theater spaces, a skatepark and other (sub) cultural facilities. This process of redevelopment, which started in

  19. Goede resultaten van de behandeling van patiënten met buikklachten op de afdeling Spoedeisende Hulp van het Onze Lieve Vrouwe Gasthuis te Amsterdam

    NARCIS (Netherlands)

    van Geloven, A. A.; Luitse, J. S.; Hoitsma, H. F.

    1998-01-01

    Evaluation of the treatment of patients with abdominal complaints at the first aid department of a city hospital, where patients were treated by emergency doctors (EMD) in combination with specialists. Retrospective, descriptive. Onze Lieve Vrouwe Gasthuis, first aid department, Amsterdam, the

  20. List of the primary types of social wasps (Hymenoptera: Vespidae) deposited in the Nationaal Natuurhistorisch Museum, Leiden, and the Zoölogisch Museum, Amsterdam

    NARCIS (Netherlands)

    Kojima, J.; Achterberg, van C.

    1997-01-01

    The primary types of social wasp subfamilies Vespinae, Polistinae and Stenogastrinae housed in the Nationaal Natuurhistorisch Museum in Leiden and the Zoölogisch Museum in Amsterdam are listed. Their complete label data are given unless they are available elsewhere. Lectotypes of Polistes snelleni

  1. Strong association between failure of T cell homeostasis and the syncytium-inducing phenotype among HIV-1-infected men in the Amsterdam Cohort Study

    NARCIS (Netherlands)

    Maas, J. J.; Gange, S. J.; Schuitemaker, H.; Coutinho, R. A.; van Leeuwen, R.; Margolick, J. B.

    2000-01-01

    OBJECTIVE: To assess the association between T cell homeostasis and its failure and 1.) the occurrence of AIDS and 2.) the switch from the non-syncytium-inducing (NSI) to the syncytium-inducing (SI) HIV virus phenotype. METHODS: For each of 325 homosexual men in the Amsterdam Cohort Study, the slope

  2. De waarde van studentensport : onderzoek naar de relatie tussen USC lidmaatschap en studieprestaties van bachelorstudenten in Amsterdam, Utrecht, Wageningen en Nijmegen

    NARCIS (Netherlands)

    Dekkers, Vera; Deutekom, Marije

    Er bestaan significante verschillen tussen het aantal behaalde studiepunten van niet-leden en leden van een Universitair Sportcentrum (USC). Dat blijkt uit onderzoek van het lectoraat “Kracht van Sport” van de Hogeschool van Amsterdam (HvA) en Hogeschool Inholland. Het onderzoek laat zien dat leden

  3. The implementation of the neighbourhood unit concept in the Western Garden Cities in Amsterdam in the early post-war period

    NARCIS (Netherlands)

    Mens, E.H.M.; Hein, Carola

    2016-01-01

    This paper analyses the way the General Expansion Plan for Amsterdam was modified after 1945 to accommodate the principles of the neighborhood unit concept, using the Western Garden Cities as a case study. The purpose is to evaluate continuities and discontinuities between per-war and post-war

  4. Transitions in drug use in a new generation of problem drug users in Amsterdam: a 6-year follow-up study

    NARCIS (Netherlands)

    Buster, Marcel C. A.; Witteveen, Ewald; Prins, Maria; van Ameijden, Erik J. C.; Schippers, Gerard; Krol, Anneke

    2009-01-01

    This study describes the transitions in drug use in Amsterdam among young drug users (YDUs) who are inhaling or injecting cocaine or using illicitly obtained opiates. From 2000 until 2003, 187 YDUs (

  5. Low prevalence of human T-cell leukaemia virus-I and -II infection among drug users in Amsterdam, The Netherlands

    NARCIS (Netherlands)

    van den Hoek, J. A.; Al, E. J.; Huisman, J. G.; Goudsmit, J.; Coutinho, R. A.

    1991-01-01

    The prevalence of human T-cell leukaemia virus-I and -II infection was studied in a cohort of 346 intravenous and nonintravenous drug users in Amsterdam. Three participants (0.86%) had antibodies to HTLV-I by two commercially available HTLV-I enzyme immunoassays (EIA). Infection in these three

  6. Is the institutionalization of urban movements inevitable? : A comparison of the opportunities for sustained squatting in New York City and Amsterdam

    NARCIS (Netherlands)

    H.D. Pruijt (Hans)

    2003-01-01

    textabstractAbstract: In this article the opportunity structures of New York City and Amsterdam for organized squatting are compared. New York City knew two distinct squatting waves, with an intermission of several years. The literature on US urban movements predicts transformation through

  7. From Amsterdam to Auburn: an explanation for the rise of the prison in seventeenth-century Holland and nineteenth-century America

    NARCIS (Netherlands)

    P.C. Spierenburg (Pieter)

    1987-01-01

    textabstractThe article attempts to make the difference in timing between Europe and the United States with respect to the rise of imprisonment understandable. It starts with Europe, taking Amsterdam as its main example. As a punitive institution, the prison became well-established in various

  8. Intrapartum and neonatal mortality in primary midwife-led and secondary obstetrician-led care in the Amsterdam region of the Netherlands: A retrospective cohort study

    NARCIS (Netherlands)

    Wiegerinck, M. M. J.; van der Goes, B. Y.; Ravelli, A. C. J.; van der Post, J. A. M.; Klinkert, J.; Brandenbarg, J.; Buist, F. C. D.; Wouters, M. G. A. J.; Tamminga, P.; de jonge, A.; Mol, B. W.

    2015-01-01

    To compare intrapartum- and neonatal mortality and intervention rates in term women starting labour in primary midwife-led versus secondary obstetrician-led care. Retrospective cohort study. Amsterdam region of the Netherlands. Women with singleton pregnancies who gave birth beyond 37+0 weeks

  9. Decline in HIV incidence and injecting, but not in sexual risk behaviour, seen in drug users in Amsterdam: a 19-year prospective cohort study

    NARCIS (Netherlands)

    Lindenburg, Catharina E. A.; Krol, Anneke; Smit, Colette; Buster, Marcel C. A.; Coutinho, Roel A.; Prins, Maria

    2006-01-01

    OBJECTIVE: To study temporal changes in HIV incidence, HIV transmission routes, and both injecting and sexual risk behaviour in the open Amsterdam Cohort Study (ACS) among drug users. Initiated in 1985, the ACS enables us to study changes in trends since HAART became widespread in 1996. METHODS:

  10. On Governance Structures and Maritime Conflict Resolution in Early Modern Amsterdam: The Case of the Chamber of Insurance and Average (sixteenth to Eighteenth Centuries)

    NARCIS (Netherlands)

    Go, Sabine C.P.J.

    2017-01-01

    The resolution of commercial conflicts was an important issue for the municipality of Amsterdam. The city’s government realised that commerce and trade could be hampered if commercial disputes were not dealt with quickly and effectively. A special type of commercial disputes centred on marine

  11. Vaginal and anal human papillomavirus infection and seropositivity among female sex workers in amsterdam, the Netherlands: prevalence, concordance and risk factors

    NARCIS (Netherlands)

    Marra, E.; Kroone, N.; Freriks, E.; van Dam, C. L.; Alberts, C. J.; Hogewoning, A. A.; Bruisten, S.; van Dijk, A.; Kroone, M. M.; Waterboer, T.; Schim van der Loeff, M. F.

    2017-01-01

    We studied prevalence, risk factors and concordance of vaginal and anal HPV infection and L1 seropositivity among female sex workers (FSW) in Amsterdam. In 2016, FSW aged ≥18 years having a sexually transmitted infections (STI) consultation were invited to participate. Participation entailed taking

  12. Implementation of a Prehospital Triage System for Patients With Chest Pain and Logistics for Primary Percutaneous Coronary Intervention in the Region of Amsterdam, The Netherlands

    NARCIS (Netherlands)

    Adams, Rob; Appelman, Yolande; Bronzwaer, Jean G.; Slagboom, Ton; Amoroso, Giovanni; van Exter, Pieternel; Tijssen, G. P. Jan; de Winter, Robbert J.

    2010-01-01

    We aimed to describe the logistics of a prehospital triage system for patients with acute chest pain in the region of Amsterdam, The Netherlands. Ambulance electrocardiograms (ECGs) were evaluated immediately in 1 of the percutaneous coronary intervention (PCI)-capable centers. Patients accepted for

  13. Liberal Arts and Sciences Education for the 21st Century Knowledge Economy : A Case Study of Amsterdam University College, The Netherlands

    NARCIS (Netherlands)

    van der Wende, M.C.

    2016-01-01

    This chapter describes how Amsterdam University College (AUC), a liberal arts and science honours college in The Netherlands, promotes internationalization and adopts a global approach in its curriculum and academic community. It shows how global learning outcomes and 21st century skills can be

  14. Liberal Arts and Sciences Education for the 21st Century Knowledge Economy: A Case Study of Amsterdam University College, The Netherlands

    NARCIS (Netherlands)

    Klein Bog, Deirdre; van der Wende, Marijk; Jung, Insung; Nishimura, Mikiko; Sasao, Toshiaki

    2016-01-01

    This chapter describes how Amsterdam University College (AUC), a liberal arts and science honours college in The Netherlands, promotes internationalization and adopts a global approach in its curriculum and academic community. It shows how global learning outcomes and 21st century skills can be

  15. Partitioning of perfluorooctanesulfonate and perfluorohexanesulfonate in the aquatic environment after an accidental release of aqueous film forming foam at Schiphol Amsterdam Airport

    NARCIS (Netherlands)

    Kwadijk, C.J.A.F.; Kotterman, M.J.J.; Koelmans, A.A.

    2014-01-01

    In the summer of 2008, an accidental release of Aqueous Film Forming Foam (AFFF) took place at Schiphol Amsterdam Airport (The Netherlands). After the release, water, fish and sediment samples were collected and analyzed for perfluoroalkyl sulfonates (PFSA). In situ perfluorooctane sulfonate (PFOS)

  16. Men who have sex with men more often chose daily than event-driven use of pre-exposure prophylaxis: baseline analysis of a demonstration study in Amsterdam.

    NARCIS (Netherlands)

    Hoornenborg, Elske; Achterbergh, Roel Ca; van der Loeff, Maarten F Schim; Davidovich, Udi; van der Helm, Jannie J; Hogewoning, Arjan; van Duijnhoven, Yvonne Thp; Sonder, Gerard Jb; de Vries, Henry Jc; Prins, Maria

    The Amsterdam PrEP project is a prospective, open-label demonstration study at a large sexually transmitted infection (STI) clinic. We examined the uptake of PrEP; the baseline characteristics of men who have sex with men (MSM) and transgender persons initiating PrEP; their choices of daily versus

  17. Congenital anomalies in the teratological collection of Museum Vrolik in Amsterdam, The Netherlands. III: primary field defects, sequences, and other complex anomalies

    NARCIS (Netherlands)

    Oostra, R. J.; Baljet, B.; Verbeeten, B. W.; Hennekam, R. C.

    1998-01-01

    The Museum Vrolik collection of the Department of Anatomy and Embryology of the Academic Medical Center, University of Amsterdam, founded by Gerardus Vrolik (1775-1859) and his son Willem Vrolik (1801-1863), consists of more than 5,000 specimens of human and animal anatomy, embryology, pathology,

  18. The Amsterdam region - A home for creative knowledge workers and graduates? Understanding the attractiveness of the metropolitan region for creative knowledge workers

    NARCIS (Netherlands)

    Bontje, M.A.; Pethe, H.A.A.; Rühmann, P.

    2008-01-01

    The report brings together the results of a survey of creative knowledge workers in the Amsterdam region. How do creative knowledge workers judge the living situation and what activities do they pursue in the different parts of the region? How satisfied are creative knowledge workers with their

  19. Amount of self-reported illicit drug use compared to quantitative hair test results in community-recruited young drug users in Amsterdam

    NARCIS (Netherlands)

    Welp, Esther A. E.; Bosman, Ingrid; Langendam, Miranda W.; Totté, Maja; Maes, Robert A. A.; van Ameijden, Erik J. C.

    2003-01-01

    To assess the dose-effect relationship between self-reported drug intake and the concentration of drugs and/or their metabolites in hair and to examine factors that may mediate this relationship. A cohort study among young drug users (YDU) in Amsterdam, the Netherlands, which began in July 2000. At

  20. What if every drop of rain that falls on the roofs of Amsterdam is used to make beer?

    Science.gov (United States)

    Hut, Rolf; Lugt, Dorien; Ceccarini, Iacopo; van der Horst, Teije; des Tombe, Bas; Schilperoort, Bart; Hoebe, Joris

    2017-04-01

    The city of Amsterdam, like many cities in the world, faces the problem that because of our changing climate, rainfall events become more intense. Sewers designed to only flood once every 10 years now flood multiple times a year. In an award winning idea, the aptly named brewery Heavenswater, in dutch: "Hemelswater" decided to raise awareness for the growing urban rainwater drainages problems by brewing a beer using rain collected from their roof in stead of from drinking water. In this "what if" research we study the implications of this idea on a large scale. We look into the consequences for the rainwater drainage, but also wastewater, city planning, health care and last but not least: novel economic opportunities.

  1. Associations between Safety from Crime, Cycling, and Obesity in a Dutch Elderly Population: Results from the Longitudinal Aging Study Amsterdam

    Directory of Open Access Journals (Sweden)

    Stef P. J. Kremers

    2012-01-01

    Full Text Available The objective of this cross-sectional study was to investigate differences in associations between crime rates, cycling, and weight status between people living in low and high socioeconomic status (SES neighbourhoods. In total, 470 participants in the Longitudinal Aging Study Amsterdam were included (age: 63–70 y. Body height and weight were measured using a stadiometer and calibrated weight scale, respectively. Cycling behaviour was assessed in a face-to-face interview, and neighbourhood crime rates were assessed using data from police reports. Men residing in high SES neighbourhoods cycled more than males residing in low SES neighbourhoods. Cycling was negatively related to crime rates among both men and women living in low SES neighbourhoods. Among men living in low SES neighbourhoods, more cycling was associated with lower BMI. Interventions aiming to prevent obesity in older people may consider aiming at increasing bicycle use in lower SES neighbourhoods, but neighbourhood safety issues should be considered.

  2. Buying a house with solar cells. Survey among subscribers and buyers of newly built houses in Amsterdam, Netherlands

    International Nuclear Information System (INIS)

    Van Mierlo, B.; Sprengers, M.

    1995-12-01

    In a new housing estate in Amsterdam in 1995 the regional energy utility (EBA) has integrated a photovoltaic (PV) system (250 kWp) into 63 houses out of 245 houses. The parts of these owner-occupied houses with PV panels are not owned by the occupants. In order to determine which are the motives to buy solar houses and in order to analyze changes in their attitudes questionnaires were sent to potential occupants twice. First to the people who registered for the new housing project (subscribers), and second to the people who bought one of the 245 houses either with or without PV (buyers). The overall conclusion is that PV does not play an important role in the decision making process when buying a new house. It is recommended to study differences in PV preferences and opinions a few years after the buyers have moved to their new houses. 10 figs., 17 tabs., 9 refs., 3 appendices

  3. The monitoring of atmospheric mercury species in the Southern Indian Ocean at Amsterdam Island (38°S

    Directory of Open Access Journals (Sweden)

    Barret M.

    2013-04-01

    Full Text Available The role of oceans in the global cycle of mercury is still poorly characterized, mainly because of a lack a long-term data on atmospheric mercury concentrations in the remote Southern Ocean. In the frame of GMOS (Global Mercury Observation System, we present here the first results from a new monitoring station at Amsterdam Island in the Southern Indian Ocean. For the period January to April 2012, we recorded mean concentration of gaseous elemental mercury (GEM, reactive gaseous mercury (RGM and particulate-bounded mercury (PHg of 1.03 ng m−3, 0.37 and 0.34 pg m−3 respectively. While GEM concentrations showed little variations, RGM and PHg exhibited fast variations with alternation of value below the instrumental detection limit and maximum values up to 4 pg m−3.

  4. Hepatitis B vaccination and changes in sexual risk behaviour among men who have sex with men in Amsterdam.

    Science.gov (United States)

    Xiridou, M; Wallinga, J; Dukers-Muijers, N; Coutinho, R

    2009-04-01

    The impact of hepatitis B vaccination in men having sex with men in Amsterdam has been marginal until now, possibly because of increases in sexual risk behaviour counterbalancing the effect of vaccination. A mathematical model is used to describe the hepatitis B epidemic. The model shows that, with the current vaccination coverage, the decrease in incidence is small in the beginning. However, the number of infections prevented per vaccine administered rises over time. Nevertheless, increased risk behaviour reduces the benefit of vaccination. Targeting high-risk men is more successful in reducing and containing the epidemic than targeting low-risk men. In conclusion, the vaccination campaign is effective and should be intensified. High-risk men should be targeted for vaccination and for risk reduction.

  5. Pathways into homelessness: recently homeless adults problems and service use before and after becoming homeless in Amsterdam.

    Science.gov (United States)

    van Laere, Igor R; de Wit, Matty A; Klazinga, Niek S

    2009-01-07

    To improve homelessness prevention practice, we met with recently homeless adults, to explore their pathways into homelessness, problems and service use, before and after becoming homeless. Recently homeless adults (last housing lost up to two years ago and legally staying in the Netherlands) were sampled in the streets, day centres and overnight shelters in Amsterdam. In April and May 2004, students conducted interviews and collected data on demographics, self reported pathways into homelessness, social and medical problems, and service use, before and after becoming homeless. among 120 recently homeless adults, (male 88%, Dutch 50%, average age 38 years, mean duration of homelessness 23 weeks), the main reported pathways into homelessness were evictions 38%, relationship problems 35%, prison 6% and other reasons 22%. Compared to the relationship group, the eviction group was slightly older (average age 39.6 versus 35.5 years; p = 0.08), belonged more often to a migrant group (p = 0.025), and reported more living single (p homelessness, in the total group, contacts with any social service were 38% and with any medical service 27%. Despite these contacts they did not keep their house. During homelessness only contacts with social work and benefit agencies increased, contacts with medical services remained low. the recently homeless fit the overall profile of the homeless population in Amsterdam: single (Dutch) men, around 40 years, with a mix of financial debts, addiction, mental and/or physical health problems. Contacts with services were fragmented and did not prevent homelessness. For homelessness prevention, systematic and outreach social medical care before and during homelessness should be provided.

  6. The role of Surinamese migrants in the transmission of Chlamydia trachomatis between Paramaribo, Suriname and Amsterdam, The Netherlands.

    Science.gov (United States)

    Bom, Reinier J M; van der Helm, Jannie J; Bruisten, Sylvia M; Grünberg, Antoon W; Sabajo, Leslie O A; Schim van der Loeff, Maarten F; de Vries, Henry J C

    2013-01-01

    The large Surinamese migrant population in the Netherlands is a major risk group for urogenital Chlamydia trachomatis infection. Suriname, a former Dutch colony, also has a high prevalence of C. trachomatis. Surinamese migrants travel extensively between the Netherlands and Suriname. Our objective was to assess whether the Surinamese migrants in the Netherlands form a bridge population facilitating transmission of C. trachomatis between Suriname and the Netherlands. If so, joint prevention campaigns involving both countries might be required. Between March 2008 and July 2010, participants were recruited at clinics in Paramaribo, Suriname and in Amsterdam, the Netherlands. Participants were grouped as native Surinamese, native Dutch, Surinamese migrant, Dutch migrant, or Other, based on country of residence and country of birth of the participant and of their parents. Risk behavior, such as sexual mixing between ethnic groups, was recorded and C. trachomatis positive samples were typed through multilocus sequence typing (MLST). A minimum spanning tree of samples from 426 participants showed four MLST clusters. The MLST strain distribution of Surinamese migrants differed significantly from both the native Surinamese and Dutch populations, but was not an intermediate state between these two populations. Sexual mixing between the Surinamese migrants and the Dutch and Surinamese natives occurred frequently. Yet, the MLST cluster distribution did not differ significantly between participants who mixed and those who did not. Sexual mixing occurred between Surinamese migrants in Amsterdam and the native populations of Suriname and the Netherlands. These migrants, however, did not seem to form an effective bridge population for C. trachomatis transmission between the native populations. Although our data do not seem to justify the need for joint campaigns to reduce the transmission of C. trachomatis strains between both countries, intensified preventive campaigns to

  7. Adherence to guidelines for the treatment of Behçet's syndrome in New York and Amsterdam.

    Science.gov (United States)

    Kerstens, Floor G; Turkstra, Franktien; Atalay, Selma; van Vugt, Richard M; Swearingen, Christopher J; Yazici, Yusuf

    2017-01-01

    To assess adherence to published guidelines for the treatment of Behçet's syndrome (BS) in two geographic areas. We extracted guideline statements from the 2008 EULAR recommendations. Adherence to these statements was evaluated retrospectively in both New York (USA) and Amsterdam (The Netherlands), by reviewing records from patients fulfilling the ISG criteria. We analysed data per statement and event, and divided data according to the year in which an event occurred. We compared events prior to 2009 to those after publication of the EULAR recommendations (2009 and later). 474 patients were evaluated, 24 of whom were from Amsterdam. Treatment adherence varied substantially across various Behçet's manifestations, ranging from 21% vs. 31% in posterior uveitis, 50% vs. 25% in arterial disease, 29% vs. 29% in arthritis and 38% vs. 55% in erythema nodosum to 65% vs. 67% in deep venous thrombosis (DVT), before and after publication of the guidelines respectively. Topical treatment of mucocutaneous disease was only 2% vs. 8%, whereas adherence in neuro-Behçet was ≥ 94% and 100% in gastrointestinal disease. Adherence to treatment guidelines varies substantially by Behçet's manifestation. Lack of adherence in manifestations such as eye disease and arthritis suggests that current recommendations are not sufficient or other concurrent manifestations require more aggressive treatment. The extensive use of anti-TNF agents might indicate a shift towards more aggressive treatment. Thus, our results suggest the 2008 guidelines were not in line with treatment in clinical practice over the past years and the recent revision of the recommendations was indeed needed.

  8. Speaking of Belonging: Learning to be “Good Citizens” in the Context of Voluntary Language Coaching Projects in Amsterdam, the Netherlands

    Directory of Open Access Journals (Sweden)

    Rhiannon Mosher

    2015-09-01

    Full Text Available This article explores citizenship education for adult immigrants through informal language education in Amsterdam, the Netherlands. Based on data collected over thirteen months of ethnographic research among volunteer Dutch language coaches in Amsterdam, the primary methods used in this study were in-depth semi-structured interviews and participant observation. While the primary focus of this article is on the ways in which informal educational settings contribute to processes of adult citizenship education, this paper also underscores some of the perceived barriers to integration faced by adult immigrants in the Netherlands. Adopting a Foucauldian theoretical approach to governmentality, this paper considers how volunteer Dutch language coaches both reproduce and challenge contemporary discourses around citizenship and belonging in Dutch society. Experiences and expressions of citizenship among volunteer Dutch language coaches reveal how entangled discourses of cultural difference and neoliberal “active” citizenship shape state and everyday notions of good citizenship practice and integration.

  9. The role of the architect as a facilitator of a new “common” space: Transformation of the NDSM shipwharf, Amsterdam

    OpenAIRE

    Havik, K.M.

    2016-01-01

    This paper discusses the collaborative process of the redevelopment of the Dutch state heritage shipwharf NDSM in Amsterdam into a cultural incubator: a creative hub with artist studios, theater spaces, a skatepark and other (sub) cultural facilities. This process of redevelopment, which started in the late nineteen nineties, differed in multiple ways from conventional heritage redevelopment practices. The NDSM wharf has become an emblematic case of transformation processes initiated from the...

  10. Findings on prenatal, lactational and later childhood exposure to dioxins and dioxin-like compounds: a review of the Amsterdam-Zaandam cohort 1987–2005

    Directory of Open Access Journals (Sweden)

    Gavin W. ten Tusscher

    2015-02-01

    Full Text Available The Amsterdam-Zaandam cohort has been studied intermittently since 1987. The cohort was selected for optimal pregnancy and birth, in whom prenatal, lactational and more recently current dioxin exposures were measured. In the perinatal period and during the years thereafter, effects on various organ systems have been documented: thyroid, metabolism, immunity, haematology, motor development, brain development, lung function and puberty. We present a review of the endpoints studied, from the perinatal period into adolescence.

  11. A newly designed 45 to 60 mer oligonucleotide Agilent platform microarray for global gene expression studies of Synechocystis PCC6803: example salt stress experiment

    NARCIS (Netherlands)

    Aguirre von Wobeser, E.; Huisman, J.; Ibelings, B.; Matthijs, H.C.P.; Matthijs, H.C.P.

    2005-01-01

    A newly designed 45 to 60 mer oligonucleotide Agilent platform microarray for global gene expression studies of Synechocystis PCC6803: example salt stress experiment Eneas Aguirre-von-Wobeser 1, Jef Huisman1, Bas Ibelings2 and Hans C.P. Matthijs1 1 Universiteit van Amsterdam, Amsterdam, The

  12. Increasing risk behaviour can outweigh the benefits of antiretroviral drug treatment on the HIV incidence among men-having-sex-with-men in Amsterdam

    Directory of Open Access Journals (Sweden)

    Zhu Yifan

    2011-05-01

    Full Text Available Abstract Background The transmission through contacts among MSM (men who have sex with men is one of the dominating contributors to HIV prevalence in industrialized countries. In Amsterdam, the capital of the Netherlands, the MSM risk group has been traced for decades. This has motivated studies which provide detailed information about MSM's risk behavior statistically, psychologically and sociologically. Despite the era of potent antiretroviral therapy, the incidence of HIV among MSM increases. In the long term the contradictory effects of risk behavior and effective therapy are still poorly understood. Methods Using a previously presented Complex Agent Network model, we describe steady and casual partnerships to predict the HIV spreading among MSM. Behavior-related parameters and values, inferred from studies on Amsterdam MSM, are fed into the model; we validate the model using historical yearly incidence data. Subsequently, we study scenarios to assess the contradictory effects of risk behavior and effective therapy, by varying corresponding values of parameters. Finally, we conduct quantitative analysis based on the resulting incidence data. Results The simulated incidence reproduces the ACS historical incidence well and helps to predict the HIV epidemic among MSM in Amsterdam. Our results show that in the long run the positive influence of effective therapy can be outweighed by an increase in risk behavior of at least 30% for MSM. Conclusion We recommend, based on the model predictions, that lowering risk behavior is the prominent control mechanism of HIV incidence even in the presence of effective therapy.

  13. Association between Self-Rated Health and the Ethnic Composition of the Residential Environment of Six Ethnic Groups in Amsterdam

    Science.gov (United States)

    Veldhuizen, Eleonore M.; Musterd, Sako; Dijkshoorn, Henriëtte; Kunst, Anton E.

    2015-01-01

    Background: Studies on the association between health and neighborhood ethnic composition yielded inconsistent results, possibly due to methodological limitations. We assessed these associations at different spatial scales and for different measures of ethnic composition. Methods: We obtained health survey data of 4673 respondents of Dutch, Surinamese, Moroccan, Turkish other non-Western and other Western origin. Neighborhood ethnic composition was measured for buffers varying from 50–1000 m. Associations with self-rated health were measured using logistic multilevel regression analysis, with control for socioeconomic position at the individual and area level. Results: Overall ethnic heterogeneity was not related to health for any ethnic group. The presence of other Surinamese was associated with poor self-rated health among Surinamese respondents. The presence of Moroccans or Turks was associated with poor health among some groups. The presence of Dutch was associated with better self-rated health among Surinamese and Turks. In most cases, these associations were stronger at lower spatial scales. We found no other associations. Conclusions: In Amsterdam, self-rated health was not associated with ethnic heterogeneity in general, but may be related to the presence of specific ethnic groups. Policies regarding social and ethnic mixing should pay special attention to the co-residence of groups with problematic interrelations. PMID:26569282

  14. Theory of Mind and the Whole Brain Functional Connectivity: Behavioral and Neural Evidences with the Amsterdam Resting State Questionnaire.

    Science.gov (United States)

    Marchetti, Antonella; Baglio, Francesca; Costantini, Isa; Dipasquale, Ottavia; Savazzi, Federica; Nemni, Raffaello; Sangiuliano Intra, Francesca; Tagliabue, Semira; Valle, Annalisa; Massaro, Davide; Castelli, Ilaria

    2015-01-01

    A topic of common interest to psychologists and philosophers is the spontaneous flow of thoughts when the individual is awake but not involved in cognitive demands. This argument, classically referred to as the "stream of consciousness" of James, is now known in the psychological literature as "Mind-Wandering." Although of great interest, this construct has been scarcely investigated so far. Diaz et al. (2013) created the Amsterdam Resting State Questionnaire (ARSQ), composed of 27 items, distributed in seven factors: discontinuity of mind, theory of mind (ToM), self, planning, sleepiness, comfort, and somatic awareness. The present study aims at: testing psychometric properties of the ARSQ in a sample of 670 Italian subjects; exploring the neural correlates of a subsample of participants (N = 28) divided into two groups on the basis of the scores obtained in the ToM factor. Results show a satisfactory reliability of the original factional structure in the Italian sample. In the subjects with a high mean in the ToM factor compared to low mean subjects, functional MRI revealed: a network (48 nodes) with higher functional connectivity (FC) with a dominance of the left hemisphere; an increased within-lobe FC in frontal and insular lobes. In both neural and behavioral terms, our results support the idea that the mind, which does not rest even when explicitly asked to do so, has various and interesting mentalistic-like contents.

  15. Longitudinal interrelationships between frequent geographic relocation and personality development: results from the Amsterdam Growth and Health Longitudinal Study.

    Science.gov (United States)

    Lin, Kuan-Chia; Twisk, Jos W R; Rong, Jiin-Ru

    2011-04-01

    This study is part of the Amsterdam Growth and Health Longitudinal Study, which was undertaken to assess the long-term interrelationships between cumulative frequency of geographic relocation (CFGR) and the development of personality characteristics (i.e., Inadequacy, Rigidity, Social Inadequacy, Dominance, Self-sufficiency, Self-esteem, and Hostility). We found that participants who had more mobility experiences had lower consistency in their personality characteristics (the exception being Rigidity). Residential mobility from different life stages was positively associated with the continuity and change of Inadequacy and Dominance. In addition, young adults with higher Rigidity personality experienced fewer geographic moves during the transition from young adulthood to mid-life. Our study provides evidence that CFGR in different life stages may be associated with the development of personality characteristics from young adulthood to mid-life in different ways. Increased awareness of the potential interrelationships between frequent geographic relocation and personality development may have positive consequences for adult psychological health. © 2011 American Orthopsychiatric Association.

  16. Climatic change and local policy, Amsterdam, Netherlands. Policy options and implementation strategies to reduce emission of CO2

    International Nuclear Information System (INIS)

    Schol, E.; Van den Bosch, A.; Ligthart, F.A.T.M.; Roemer, J.C.; Ruijg, G.J.; Schaeffer, G.J.; Dinkelman, D.H.; Kok, I.C.; De Paauw, K.F.B.

    1998-04-01

    Insight is given into the local policy options with respect to climate change, in this case within the sphere of influence of Amsterdam local authorities. A list of new policy options for CO2-reduction has been made with the assistance of local policy makers and representatives of interest groups. These policy options have been divided into three qualitative scenarios: Institutional Cultural Change, Technological Innovation and Least Regrets. The environmental, economic and other effects have been described for each policy option. The three most interesting policy options have been selected by local policy makers and representatives of interest groups during a workshop. Implementation strategies have been developed for the options selected. These strategies have been discussed during a second workshop. The reduction target, stabilization of CO2-emissions in 2015 compared to 1993, can be realized by a combination of all the new policy options. The three selected policy options count for 40% of this total CO2-emission reduction. Finally, a general outline on the methodology to construct local policies for climate protection has been described. This methodology can also be applied to other cities and municipal administrators, e.g. participants of Cities for Climate Protection, an initiative of the International Council for Local Environmental Initiatives, or the Netherlands Climate Association. 136 refs

  17. Slow Art in the Creative City: Amsterdam, Street Photography, and Urban Renewal

    NARCIS (Netherlands)

    Lindner, C.; Meissner, M.

    2015-01-01

    Global cities have been studied predominantly in terms of speed and movement, acceleration and circulation. This article examines the relationship between globalization and cities in terms that run counter to such emphases, focusing instead on slowness as a condition in contemporary urban life.

  18. Varieties of glocalisation: the international economic strategies of Amsterdam, Manchester, and Zurich compared

    OpenAIRE

    Nico van der Heiden; Pieter Terhorst

    2007-01-01

    Our aim in this paper is to explain the international strategies of cities by focusing on market conditions. Drawing on a critique of the glocalisation thesis we show that the design of these strategies can plausibly be explained by the specific characteristics of urban capitalism found in the different cities. Whereas the international strategy of Manchester must be seen as a response to problems of postindustrial restrictions, the importance of the logistic sector in Dutch capitalism strong...

  19. Systematic study on genetic and epimutational profile of a cohort of Amsterdam criteria-defined Lynch Syndrome in Singapore.

    Directory of Open Access Journals (Sweden)

    Yanqun Liu

    Full Text Available BACKGROUND: Germline defects of mismatch repair (MMR genes underlie Lynch Syndrome (LS. We aimed to gain comprehensive genetic and epigenetic profiles of LS families in Singapore, which will facilitate efficient molecular diagnosis of LS in Singapore and the region. METHODS: Fifty nine unrelated families were studied. Mutations in exons, splice-site junctions and promoters of five MMR genes were scanned by high resolution melting assay followed by DNA sequencing, large fragment deletions/duplications and promoter methylation in MLH1, MSH2, MSH6 and PMS2 were evaluated by multiplex ligation-dependent probe amplification. Tumor microsatellite instability (MSI was assessed with five mononucleotide markers and immunohistochemical staining (IHC was also performed. RESULTS: Pathogenic defects, all confined to MLH1 and MSH2, were identified in 17 out of 59 (28.8% families. The mutational spectrum was highly heterogeneous and 28 novel variants were identified. One recurrent mutation in MLH1 (c.793C>T was also observed. 92.9% sensitivity for indication of germline mutations conferred by IHC surpassed 64.3% sensitivity by MSI. Furthermore, 15.6% patients with MSS tumors harbored pathogenic mutations. CONCLUSIONS: Among major ethnic groups in Singapore, all pathogenic germline defects were confined to MLH1 and MSH2. Caution should be applied when the Amsterdam criteria and consensus microsatellite marker panel recommended in the revised Bethesda guidelines are applied to the local context. We recommend a screening strategy for the local LS by starting with tumor IHC and the hotspot mutation testing at MLH1 c.793C>T followed by comprehensive mutation scanning in MLH1 and MSH2 prior to proceeding to other MMR genes.

  20. Recent 210Pb, 137Cs and 241Am accumulation in an ombrotrophic peatland from Amsterdam Island (Southern Indian Ocean).

    Science.gov (United States)

    Li, Chuxian; Le Roux, Gaël; Sonke, Jeroen; van Beek, Pieter; Souhaut, Marc; Van der Putten, Nathalie; De Vleeschouwer, François

    2017-09-01

    Over the past 50 years, 210 Pb, 137 Cs and 241 Am have been abundantly used in reconstructing recent sediment and peat chronologies. The study of global aerosol-climate interaction is also partially depending on our understanding of 222 Rn- 210 Pb cycling, as radionuclides are useful aerosol tracers. However, in comparison with the Northern Hemisphere, few data are available for these radionuclides in the Southern Hemisphere, especially in the South Indian Ocean. A peat core was collected in an ombrotrophic peatland from the remote Amsterdam Island (AMS) and was analyzed for 210 Pb, 137 Cs and 241 Am radionuclides using an underground ultra-low background gamma spectrometer. The 210 Pb Constant Rate of Supply (CRS) model of peat accumulations is validated by peaks of artificial radionuclides ( 137 Cs and 241 Am) that are related to nuclear weapon tests. We compared the AMS 210 Pb data with an updated 210 Pb deposition database. The 210 Pb flux of 98 ± 6 Bq·m -2 ·y -1 derived from the AMS core agrees with data from Madagascar and South Africa. The elevated flux observed at such a remote location may result from the enhanced 222 Rn activity and frequent rainfall in AMS. This enhanced 222 Rn activity itself may be explained by continental air masses passing over southern Africa and/or Madagascar. The 210 Pb flux at AMS is higher than those derived from cores collected in coastal areas in Argentina and Chile, which are areas dominated by marine westerly winds with low 222 Rn activities. We report a 137 Cs inventory at AMS of 144 ± 13 Bq·m -2 (corrected to 1969). Our data thus contribute to the under-represented data coverage in the mid-latitudes of the Southern Hemisphere. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Energy from biomass and biofuels. Current market initiatives. Altener seminar, Amsterdam, Netherlands, 26 May 1997

    International Nuclear Information System (INIS)

    1997-01-01

    Biomass, organic wastes, hydroelectric power, wind power and solar energy contribute to approximately 6% of the current energy demand in the European Union (EU). Goals are set by the EU to double this share in the energy production in the next decade. The EU Altener Programme aims to increase the use of renewables as source of energy, the trade in renewable energy products and related equipment and services, supporting a wide variety of projects, sector and market studies, events and technical standards. The Agricultural and Forestrial Biomass Network (AFB-Nett) promotes and stimulates, as part of the Altener Programme, the implementation and commercial exploitation of energy from biomass by the initiation of among other things business opportunities and information exchange. The AFB-Nett National Coordinator for the Netherlands, Novem, organised in this respect the title seminar. 85 participants from several European countries attended presentations covering the whole bio-energy chain: from information on biomass supply, through trade, logistics and pretreatment issues up to discussion on conversion technologies. It became clear to the audience that it is a necessary condition to take into account the total chain when developing projects in a specific field of this chain. However, non-technical aspects must be considered as well. Therefore, in developing business opportunities the challenge remains to connect all good project initiatives covering parts of the chain into a few 'whole-chain'-projects

  2. Anal infections with concomitant Chlamydia trachomatis genotypes among men who have sex with men in Amsterdam, the Netherlands

    Directory of Open Access Journals (Sweden)

    van der Loeff Maarten

    2011-03-01

    Full Text Available Abstract Background Lymphogranuloma venereum (LGV proctitis is caused by Chlamydia trachomatis (Ct genotype L and is endemic among men who have sex with men (MSM in western society. Genotype L infections need to be distinguished from non-LGV (genotypes A-K Ct infections since they require prolonged antibiotic treatment. For this purpose, an in-house developed pmpH based LGV polymerase chain reaction (PCR test is used at the Amsterdam STI outpatient clinic. We investigated retrospectively the anal Ct genotype distribution, and the frequency of concomitant genotype infections in MSM infected with LGV and non-LGV Ct infections. To detect concomitant Ct genotype infections, the pmpH LGV PCR and genoTyping Reverse Hybridization Assay (Ct-DT RHA were used. Methods A total of 201 Ct positive rectal swabs from MSM were selected, which were previously diagnosed as either LGV (n = 99 or non-LGV Ct infection (n = 102 according to the algorithm of Ct detection by the commercially available Aptima Combo 2 assay followed by an in-house pmpH LGV PCR. The samples were retested with the commercially available Ct-DT RHA, which differentiates between 14 major genotypes and is able to detect concomitant Ct genotypes. Results Excellent genotyping agreement was observed between the Ct-DT RHA and the pmpH LGV PCR (Kappa = 0.900, 95%CI = 0.845-0.955, McNemar's p = 1.000. A concomitant non-LGV genotype was detected in 6/99 (6.1% LGV samples. No additional LGV infections were observed with the Ct-DT RHA among the non-LGV Ct group. In the non-LGV group genotype G/Ga (34.3% was seen most frequent, followed by genotype D/Da (22.5% and genotype J (13.7%. All LGV infections were caused by genotype L2. Conclusions Concomitant non-LGV genotypes do not lead to missed LGV proctitis diagnosis. The pmpH LGV PCR displayed excellent agreement with the commercially available Ct-DT genotyping RHA test. The genotypes G/Ga, D/Da and J were the most frequent non-LGV Ct strains in MSM.

  3. A post audit and inverse modeling in reactive transport: 50 years of artificial recharge in the Amsterdam Water Supply Dunes

    Science.gov (United States)

    Karlsen, R. H.; Smits, F. J. C.; Stuyfzand, P. J.; Olsthoorn, T. N.; van Breukelen, B. M.

    2012-08-01

    SummaryThis article describes the post audit and inverse modeling of a 1-D forward reactive transport model. The model simulates the changes in water quality following artificial recharge of pre-treated water from the river Rhine in the Amsterdam Water Supply Dunes using the PHREEQC-2 numerical code. One observation dataset is used for model calibration, and another dataset for validation of model predictions. The total simulation time of the model is 50 years, from 1957 to 2007, with recharge composition varying on a monthly basis and the post audit is performed 26 years after the former model simulation period. The post audit revealed that the original model could reasonably predict conservative transport and kinetic redox reactions (oxygen and nitrate reduction coupled to the oxidation of soil organic carbon), but showed discrepancies in the simulation of cation exchange. Conceptualizations of the former model were inadequate to accurately simulate water quality changes controlled by cation exchange, especially concerning the breakthrough of potassium and magnesium fronts. Changes in conceptualization and model design, including the addition of five flow paths, to a total of six, and the use of parameter estimation software (PEST), resulted in a better model to measurement fit and system representation. No unique parameter set could be found for the model, primarily due to high parameter correlations, and an assessment of the predictive error was made using a calibration constrained Monte-Carlo method, and evaluated against field observations. The predictive error was found to be low for Na+ and Ca2+, except for greater travel times, while the K+ and Mg2+ error was restricted to the exchange fronts at some of the flow paths. Optimized cation exchange coefficients were relatively high, especially for potassium, but still within the observed range in literature. The exchange coefficient for potassium agrees with strong fixation on illite, a main clay mineral in

  4. Southeast Indian Ridge Between the Rodriguez Triple Junction and the Amsterdam and Saint-Paul Islands: Detailed Kinematics for the Past 20 m.y.

    Science.gov (United States)

    Royer, Jean-Yves; Schlich, Roland

    1988-11-01

    The Southeast Indian Ridge has the fastest spreading rates of the three mid-oceanic ridge systems of the Indian Ocean and has recorded the movements of Antarctica relative to Australia and India since the Late Cretaceous. New bathymetric and magnetic data have been collected by the R/V Marion Dufresne (1983) and the R/V Jean Charcot (1984), on the western part of this ridge, between the Rodriguez Triple Junction (25.5°S, 70.0°E) and the Amsterdam and Saint-Paul islands (38°S, 78°E). These data bring additional information on the seafloor magnetic pattern produced by the Southeast Indian Ridge during the past 20 m.y. A new tectonic chart is proposed for the area around the Amsterdam and Saint-Paul islands. We have mapped 17 isochrons ranging from anomalies 6 to 1 (20.5-0.7 Ma) based on the compilation of all the data available in this area (25 cruises). Their distribution clearly shows asymmetric features. Reconstructions at short time intervals show that stage poles of rotation describe oscillatory movements along a direction parallel to the Southeast Indian Ridge axis. Observed changes in spreading rates and the stability of the spreading directions since the Miocene support this result.

  5. Energy Flexibility from Large Prosumers to Support Distribution System Operation—A Technical and Legal Case Study on the Amsterdam ArenA Stadium

    Directory of Open Access Journals (Sweden)

    Dirk Kuiken

    2018-01-01

    Full Text Available To deal with the rising integration of stochastic renewables and energy intensive distributed energy resources (DER to the electricity network, alternatives to expensive network reinforcements are increasingly needed. An alternative solution often under consideration is integrating flexibility from the consumer side to system management. However, such a solution needs to be contemplated from different angles before it can be implemented in practice. To this end, this article considers a case study of the Amsterdam ArenA stadium and its surrounding network where flexibility is expected to be available to support the network in the future. The article studies the technical aspects of using this flexibility to determine to what extent, despite the different, orthogonal goals, the available flexibility can be used by various stakeholders in scenarios with a large load from electric vehicle charging points. Furthermore, a legal study is performed to determine the feasibility of the technical solutions proposed by analysing current European Union (EU and Dutch law and focusing on the current agreements existing between the parties involved. The article shows that flexibility in the network provided by Amsterdam ArenA is able to significantly increase the number of charging points the network can accommodate. Nonetheless, while several uses of flexibility are feasible under current law, the use of flexibility provided by electric vehicles specifically faces several legal challenges in current arrangements.

  6. Doctors of Amsterdam

    NARCIS (Netherlands)

    Mooij, Annet

    2001-01-01

    Holland 's Golden Age of the arts was also a bright era for medical science. Public dissections in the anatomy theatre were a popular attraction, and visitors came from far and wide to view the wonderful anatomy collections of Frederik Ruysch. In the intervening 350 years, every aspect of medicine

  7. Doctors of Amsterdam

    NARCIS (Netherlands)

    Mooij, Annet

    2001-01-01

    Holland 's Golden Age of the arts was also a bright era for medical science. Public dissections in the anatomy theatre were a popular attraction, and visitors came from far and wide to view the wonderful anatomy collections of Frederik Ruysch.In the intervening 350 years, every aspect of medicine

  8. Seroprevalence of hepatitis E virus differs in Dutch and first generation migrant populations in Amsterdam, the Netherlands: a cross-sectional study.

    Science.gov (United States)

    Sadik, S; van Rijckevorsel, G G C; van Rooijen, M S; Sonder, G J B; Bruisten, S M

    2016-11-08

    In the last decade hepatitis E virus (HEV) is increasingly recognized as a cause of acute viral hepatitis in developed countries. HEV is transmitted via the fecal-oral route. In countries like the Netherlands, HEV infection is suspected to be a zoonosis but HEV may also be introduced by migrants. We studied the seroprevalence of HEV among different migrants, mainly Moroccans and Turks, and compared this to that of the native Dutch population in Amsterdam, the Netherlands. Data were obtained from a cross-sectional survey of the adult Amsterdam population performed in 2004; the Amsterdam Health Monitor. A total of 1199 plasma samples were tested for IgG-and IgM antibodies to HEV using the Wantai kit according to instructions of the manufacturer. Basic demographic data (gender, age, country of birth, and age at immigration) were used in the analyses. Hepatitis A virus (HAV) serology data were available from a previous study. The total weighted anti-HEV IgG seroprevalence in the overall Amsterdam population was 26.7 %, based on 1199 samples. In the study population (not-weighted) this HEV seroprevalence was 157/426 (36.9 %) for the Dutch participants and it was 161/257 (62.6 %) for Moroccans, 99/296 (33.4 %) for Turks and 42/220 (19.1 %) for other ethnicities. HEV seroprevalence increased significantly with age. First-generation Moroccan migrants (44.0 %) had a significantly higher weighted HEV seroprevalence than the Dutch participants (29.7 %). In the first generation Turks (20.3 %) and first generation migrants from other countries (16.7 %) this weighted seroprevalence was lower, but this was only significant for the 'other ethnicities'. The median age of migration was significantly higher in the Moroccan and Turkish migrants who were HEV IgG positive versus HEV IgG negative. However, when stratifying for age at time of study, median migration age was only significantly different for HEV sero-status for younger Turks and younger 'other ethnicities'. HEV Ig

  9. Biology, Management and Utilization of Common Reed Pharagnites australis.

    Science.gov (United States)

    1987-02-01

    Vrije Universiteit Waterways Experiment Staticn Department of Ecology and Ecotoxicology Environmental Laboratory P.O. Box 7161 P.O. Box 631 1007 MC...Madelijn van der Werff Vrije Universiteit Department of Ecology and Ecotoxicology Amsterdam and John W. Simmers and Stratford H. Kay Waterways...lowing and cutting 67 5.2.4. Active regulation of the water table 68 5.5. Nature conservation 68 5.4. Reed cultivation 69 Z.4. 1. Reed harvest 69 6

  10. Local conditional entropy in measure for covers with respect to a fixed partition

    Science.gov (United States)

    Romagnoli, Pierre-Paul

    2018-05-01

    In this paper we introduce two measure theoretical notions of conditional entropy for finite measurable covers conditioned to a finite measurable partition and prove that they are equal. Using this we state a local variational principle with respect to the notion of conditional entropy defined by Misiurewicz (1976 Stud. Math. 55 176–200) for the case of open covers. This in particular extends the work done in Romagnoli (2003 Ergod. Theor. Dynam. Syst. 23 1601–10), Glasner and Weiss (2006 Handbook of Dynamical Systems vol 1B (Amsterdam: Elsevier)) and Huang et al (2006 Ergod. Theor. Dynam. Syst. 26 219–45).

  11. The Amsterdam Studies of Acute Psychiatry I (ASAP-I; A prospective cohort study of determinants and outcome of coercive versus voluntary treatment interventions in a metropolitan area

    Directory of Open Access Journals (Sweden)

    Mulder Niels

    2008-05-01

    Full Text Available Abstract Background The overall number of involuntary admissions is increasing in many European countries. Patients with severe mental illnesses more often progress to stages in which acute, coercive treatment is warranted. The number of studies that have examined this development and possible consequences in terms of optimizing health care delivery in emergency psychiatry is small and have a number of methodological shortcomings. The current study seeks to examine factors associated with compulsory admissions in the Amsterdam region, taking into account a comprehensive model with four groups of predictors: patient vulnerability, social support, responsiveness of the health care system and treatment adherence. Methods/Design This paper describes the design of the Amsterdam Study of Acute Psychiatry-I (ASAP-I. The study is a prospective cohort study, with one and two-year follow-up, comparing patients with and without forced admission by means of a selected nested case-control design. An estimated total number of 4,600 patients, aged 18 years and over, consecutively coming into contact with the Psychiatric Emergency Service Amsterdam (PESA are included in the study. From this cohort, a randomly selected group of 125 involuntary admitted subjects and 125 subjects receiving non-coercive treatment are selected for further evaluation and comparison. First, socio-demographic, psychopathological and network characteristics, and prior use of health services will be described for all patients who come into contact with PESA. Second, the in-depth study of compulsory versus voluntary patients will examine which patient characteristics are associated with acute compulsory admission, also taking into account social network and healthcare variables. The third focus of the study is on the associations between patient vulnerability, social support, healthcare characteristics and treatment adherence in a two-year follow-up for patients with or without

  12. Building the image of modern art : the rhetoric of two museums and the representation and canonization of modern art (1935-1975) : the Stedelijk Museum in Amsterdam and the Museum of Modern Art in New York

    NARCIS (Netherlands)

    Leigh, Nana

    2008-01-01

    The Rhetoric of Two Museums and the Representation and Canonization of Modern Art (1935-1975): The Stedelijk Museum in Amsterdam and the Museum of Modern Art in New York Museums of modern art have determined the course of modern art history. Their contributions to the representation and

  13. REPAiR: REsource Management in Peri-urban AReas: Going Beyond Urban Metabolism : D3.3 Process model for the two pilot cases: Amsterdam, the Netherlands & Naples, Italy

    NARCIS (Netherlands)

    Geldermans, R.J.; Wandl, A.; Steenmeijer, M.A.; Furlan, C.; Streefland, Tamara; Formato, E.; Cerreta, Maria; Amenta, L.; Varju, Viktor; Inglese, Pasquale; Iodice, Silvia; Berruti, Gilda; Varju, Viktor; Grünhut, Z; Bodor, Akos; Lovász, Virág; Moticska, Zsombor; Tonini, Davide; Taelman, Sue Ellen

    2018-01-01

    Deliverable 3.3 of Work Package 3 concerns an integrated analysis of the two pilot case studies within the REPAiR project, Amsterdam and Naples, from the vantage point of waste production and processing, and the transition to circular societies. It comprises spatial, social and material flow

  14. Amplified Fragment Length Polymorphism Fingerprinting for Identification of a Core Group of Neisseria gonorrhoeae Transmitters in the Population Attending a Clinic for Treatment of Sexually Transmitted Diseases in Amsterdam, The Netherlands

    OpenAIRE

    Spaargaren, Joke; Stoof, Jeroen; Fennema, Han; Coutinho, Roel; Savelkoul, Paul

    2001-01-01

    Amplified fragment length polymorphism analysis seems well suited for studying the epidemiology of isolates of Neisseria gonorrhoeae obtained from patients attending the Sexually Transmitted Disease Outpatient Clinic in Amsterdam, The Netherlands. It shows potential to identify the core group of transmitters.

  15. Usage of purchased self-tests for HIV and sexually transmitted infections in Amsterdam, the Netherlands: results of population-based and serial cross-sectional studies among the general population and sexual risk groups

    NARCIS (Netherlands)

    Bil, Janneke P.; Prins, Maria; Stolte, Ineke G.; Dijkshoorn, Henriëtte; Heijman, Titia; Snijder, Marieke B.; Davidovich, Udi; Zuure, Freke R.

    2017-01-01

    Objectives There are limited data on the usage of commercially bought self-tests for HIV and other sexually transmitted infections (STIs). Therefore, we studied HIV/STI self-test usage and its determinants among the general population and sexual risk groups between 2007 and 2015 in Amsterdam, the

  16. A summary on the effectiveness of the Amsterdam memory and attention training for children (Amat-c) in children with brain injury.

    Science.gov (United States)

    Dvorak, Elizabeth; van Heugten, Caroline

    2018-01-01

    To summarise the current research on the effectiveness of the Amsterdam Memory and Attention Training for Children (Amat-c). A literature search was conducted to find articles published about the Amat-c, using PubMed, psychINFO, and PsychBITE databases. Relevant search terms included Amat-c, attention and memory, and childhood ABI. Our literature search identified 7 articles that described 5 separate studies including 61 children in total (mostly TBI). Only one study had a control group. All results indicated positive effects on memory and attention, although in three of the studies, these results were not statistically tested. Positive results were generally maintained six months follow up. This review showed that the Amat-c is effective for treating attention and memory disturbances in children with ABI. However, evidence is limited and training material is outdated. We suggest that the Amat-c should be digitised and implemented in a school setting and further evaluated.

  17. An "ethics of the self" in the novel-cronicle-journal-short story Ana de Amsterdam, by Ana Cássia Rebelo

    Directory of Open Access Journals (Sweden)

    Lilian Reichert Coelho

    2017-11-01

    Full Text Available We present a Reading of the relations between the plurality of Genres collected by Ana Cássia Rebelo, a writer with roots in Portugal, Goa and Moçambique at the same time, in the book Ana de Amsterdam, and the themes dealt. As theoretical bias, we approached to Agamben, Gumbrecht and Barthes. As method, we chose the inductive perspective. As main theoretical notions, we adopted “the ethics of the self”, the production of presence and biografeme. After the mentioned effort, we concluded that boredom insulated from anguish, produced in the core of the Contemporary world, affects the narrator in such a deep way that compels her to take a strong position and highlight her privacy in an obscene way. It allows her to frame her own “self” as a mosaic of Genres and Themes, arised from the relation between the body as materiality and the subjective experience of Reading and Writing.

  18. Anorectal and inguinal lymphogranuloma venereum among men who have sex with men in Amsterdam, The Netherlands: trends over time, symptomatology and concurrent infections.

    Science.gov (United States)

    de Vrieze, Nynke Hesselina Neeltje; van Rooijen, Martijn; Schim van der Loeff, Maarten Franciscus; de Vries, Henry John C

    2013-11-01

    To examine lymphogranuloma venereum (LGV) trends over time among men who have sex with men (MSM) visiting the Amsterdam sexually transmitted infection (STI) clinic; to investigate anal LGV symptomatology; and to examine the positivity and characteristics of anorectal and inguinal LGV. We included MSM consultations from whom a swab (from anorectum, bubo or an genital ulcer) was taken for Chlamydia trachomatis (Ct) screening. Anorectal swabs were taken from all MSM who reported receptive anorectal intercourse in the preceding 6 months. Ct positive samples were further tested with a pmpH PCR to identify L-genovars. Patient symptoms, clinical and anoscopic inflammatory signs, and STI co-infections were noted; Gram-stained anorectal mucosal smears were examined. Between January 2005 and June 2012, 48 570 consultations among MSM were conducted. In 3628/35 650 visits, anorectal Ct infections were diagnosed, including 411 anal LGV (1.2%). Moreover, 65/1649 genital ulcer swabs were Ct positive; 10 were inguinal LGV (0.6%) Since January 2011 a significant increase in the positivity of LGV occurred (p<0.0001). 89 (27.2%) anorectal LGV cases were asymptomatic. HIV prevalence among anorectal LGV cases was significantly higher (p=0.008) than among inguinal LGV cases. STI co-morbidity in anorectal LGV cases remained invariably high during the study period. Since January 2011, LGV positivity in MSM consultations in Amsterdam has risen significantly. The great majority comprise anal LGV; inguinal LGV is rare. Anal LGV is asymptomatic in a quarter of cases. In all MSM with anal Ct infections LGV should be excluded, irrespective of symptoms or inflammatory signs.

  19. Feelings of loneliness, but not social isolation, predict dementia onset : results from the Amsterdam Study of the Elderly (AMSTEL)

    NARCIS (Netherlands)

    Holwerda, Tjalling Jan; Deeg, Dorly J. H.; Beekman, Aartjan T. F.; van Tilburg, Theo G.; Stek, Max L.; Jonker, Cees; Schoevers, Robert A.

    Background Known risk factors for Alzheimer's disease and other dementias include medical conditions, genetic vulnerability, depression, demographic factors and mild cognitive impairment. The role of feelings of loneliness and social isolation in dementia is less well understood, and prospective

  20. Feelings of loneliness, but not social isolation, predict dementia onset: Results from the Amsterdam Study of the Elderly (AMSTEL)

    NARCIS (Netherlands)

    Holwerda, T.J.; Deeg, D.; Beekman, A.T.F.; van Tilburg, T.G.; Stek, M.L.; Jonker, C.; Schoevers, R.A.

    2014-01-01

    Background Known risk factors for Alzheimer's disease and other dementias include medical conditions, genetic vulnerability, depression, demographic factors and mild cognitive impairment. The role of feelings of loneliness and social isolation in dementia is less well understood, and prospective

  1. The Amsterdam Sexual Abuse Case (ASAC)-study in day care centers: longitudinal effects of sexual abuse on infants and very young children and their parents, and the consequences of the persistence of abusive images on the internet.

    Science.gov (United States)

    Lindauer, Ramón J L; Brilleslijper-Kater, Sonja N; Diehle, Julia; Verlinden, Eva; Teeuw, Arianne H; Middeldorp, Christel M; Tuinebreijer, Wilco; Bosschaart, Thekla F; van Duin, Esther; Verhoeff, Arnoud

    2014-11-08

    Little research has been done on the signs of child sexual abuse (CSA) in infants and very young children, or on the consequences that such abuse - including the persistence of the abusive pornographic images on the internet - might have for the children and their parents. The effects of CSA can be severe, and a variety of risk- and protective factors, may influence those effects. CSA may affect the psychosocial-, emotional-, cognitive-, and physical development of children, their relationships with their parent(s), and the relations between parents. In the so called 'the Amsterdam sexual abuse case' (ASAC), infants and very young children were victimized by a day-care employee and most of the victims were boys. Research involving the children and their parents would enable recognition of the signs of CSA in very young children and understanding the consequences the abuse might have on the long term. The proposed research project consists of three components: (I) An initial assessment to identify physical- or psychological signs of CSA in infants and very young children who are thought to have been sexually abused (n = 130); (II) A cross-sequential longitudinal study of children who have experienced sexual abuse, or for whom there are strong suspicions; (III) A qualitative study in which interviews are conducted with parents (n = 25) and with therapists treating children from the ASAC. Parents will be interviewed on the perceived condition of their child and family situation, their experiences with the service responses to the abuse, the effects of legal proceedings and media attention, and the impact of knowing that pornographic material has been disseminated on the internet. Therapists will be interviewed on their clinical experiences in treating children and parents. The assessments will extend over a period of several years. The outcome measures will be symptoms of posttraumatic stress disorder (PTSD), dissociative symptoms, age-inappropriate sexual behaviors

  2. Use of portable exposure meters for comparing mobile phone base station radiation in different types of areas in the cities of Basel and Amsterdam.

    Science.gov (United States)

    Urbinello, Damiano; Huss, Anke; Beekhuizen, Johan; Vermeulen, Roel; Röösli, Martin

    2014-01-15

    Radiofrequency electromagnetic fields (RF-EMF) are highly variable and differ considerably within as well as between areas. Exposure assessment studies characterizing spatial and temporal variation are limited so far. Our objective was to evaluate sources of data variability and the repeatability of daily measurements using portable exposure meters (PEMs). Data were collected at 12 days between November 2010 and January 2011 with PEMs in four different types of urban areas in the cities of Basel (BSL) and Amsterdam (AMS). Exposure from mobile phone base stations ranged from 0.30 to 0.53 V/m in downtown and business areas and in residential areas from 0.09 to 0.41 V/m. Analysis of variance (ANOVA) demonstrated that measurements from various days were highly reproducible (measurement duration of approximately 30 min) with only 0.6% of the variance of all measurements from mobile phone base station radiation being explained by the measurement day and only 0.2% by the measurement time (morning, noon, afternoon), whereas type of area (30%) and city (50%) explained most of the data variability. We conclude that mobile monitoring of exposure from mobile phone base station radiation with PEMs is useful due to the high repeatability of mobile phone base station exposure levels, despite the high spatial variation. © 2013.

  3. Genetic, clinical and pharmacological determinants of out-of-hospital cardiac arrest: rationale and outline of the AmsteRdam Resuscitation Studies (ARREST) registry

    Science.gov (United States)

    Blom, M T; van Hoeijen, D A; Bardai, A; Berdowski, J; Souverein, P C; De Bruin, M L; Koster, R W; de Boer, A; Tan, H L

    2014-01-01

    Introduction Out-of-hospital cardiac arrest (OHCA) is a major public health problem. Recognising the complexity of the underlying causes of OHCA in the community, we aimed to establish the clinical, pharmacological, environmental and genetic factors and their interactions that may cause OHCA. Methods and analysis We set up a large-scale prospective community-based registry (AmsteRdam Resuscitation Studies, ARREST) in which we prospectively include all resuscitation attempts from OHCA in a large study region in the Netherlands in collaboration with Emergency Medical Services. Of all OHCA victims since June 2005, we prospectively collect medical history (through hospital and general practitioner), and current and previous medication use (through community pharmacy). In addition, we include DNA samples from OHCA victims with documented ventricular tachycardia/fibrillation during the resuscitation attempt since July 2007. Various study designs are employed to analyse the data of the ARREST registry, including case–control, cohort, case only and case-cross over designs. Ethics and dissemination We describe the rationale, outline and potential results of the ARREST registry. The design allows for a stable and reliable collection of multiple determinants of OHCA, while assuring that the patient, lay-caregiver or medical professional is not hindered in any way. Such comprehensive data collection is required to unravel the complex basis of OHCA. Results will be published in peer-reviewed journals and presented at relevant scientific symposia. PMID:25332818

  4. Height system connection between island and mainland using a hydrodynamic model: a case study connecting the Dutch Wadden islands to the Amsterdam ordnance datum (NAP)

    Science.gov (United States)

    Slobbe, D. C.; Klees, R.; Verlaan, M.; Zijl, F.; Alberts, B.; Farahani, H. H.

    2018-03-01

    We present an efficient and flexible alternative method to connect islands and offshore tide gauges with the height system on land. The method uses a regional, high-resolution hydrodynamic model that provides total water levels. From the model, we obtain the differences in mean water level (MWL) between tide gauges at the mainland and at the islands or offshore platforms. Adding them to the MWL relative to the national height system at the mainland's tide gauges realizes a connection of the island and offshore platforms with the height system on the mainland. Numerical results are presented for the connection of the Dutch Wadden islands with the national height system (Normaal Amsterdams Peil, NAP). Several choices of the period over which the MWLs are computed are tested and validated. The best results were obtained when we computed the MWL only over the summer months of our 19-year simulation period. Based on this strategy, the percentage of connections for which the absolute differences between the observation- and model-derived MWL differences are ≤ 1 cm is about 34% (46 out of 135 possible leveling connections). In this case, for each Wadden island we can find several connections that allow the transfer of NAP with (sub-)centimeter accuracy.

  5. Public housing for whom? Experiences in an era of mature neo-liberalism: The Netherlands and Amsterdam

    NARCIS (Netherlands)

    Musterd, S.

    2014-01-01

    Public housing in the Netherlands is rapidly changing. While it used to be an example of how government intervention could successfully contribute to create descent housing for all, and while public housing was seen as the instrument to get rid of inhumane housing conditions, currently the sector is

  6. Nieuwe vormen, nieuwe inkomsten: over schrijvershonoraria

    NARCIS (Netherlands)

    Kuitert, L.

    2012-01-01

    De opkomst van het digitale boek werd al vanaf het begin argwanend bekeken. E-books zouden het papieren boek verdringen en daarmee ook de boekhandels. Lisa Kuitert, hoogleraar Boekwetenschap aan de Universiteit van Amsterdam, bespreekt niet de gevolgen voor de boekverkopers of uitgevers, maar voor

  7. Introduction: Towards a new architectonic critique

    NARCIS (Netherlands)

    Buijs, G.J.; Jongeneel, R.

    2013-01-01

    8-9 January 2013 at the Vrije Universiteit Amsterdam, a seminar took place bringing together people from various parts of the world, various disciplines, and various academic and non-academic professions — philosophers, economists, theologians, historians, social scientists as well as bankers,

  8. Esperanto: een taal van mij, een taal om van te houden = Esperanto: lingvo malfremda, lingvo amida

    NARCIS (Netherlands)

    Jansen, W.

    2010-01-01

    Onderstaande tekst vormt de artikelversie van mijn op 4 september 2009 gehouden oratie bij de aanvaarding van het bijzonder hoogleraarschap in de interlinguïstiek en het Esperanto aan de Universiteit van Amsterdam (Jansen, 2009). Ten opzichte van de oorspronkelijke oratie is de nu volgende tekst op

  9. Jan Lever: Challenging the Role of Typological Thinking in Reformational Views of Biology

    NARCIS (Netherlands)

    Cook, Harry; Flipse, A.C.

    2017-01-01

    This essay analyzes the view of evolution of Jan Lever (1922–2010), founder of the biology department at the Vrije Universiteit Amsterdam, and compares his view with those of J.H. Diemer and H. Dooyeweerd. Together with Dooyeweerd, Lever wrote a series of chapters on the species concept in

  10. SIC Industriemonitor najaar 2003

    NARCIS (Netherlands)

    Brouwer, N.; de Nooij, M.; Pomp, M.

    2003-01-01

    In juni 2000 publiceerde de Stichting voor Economisch Onderzoek (SEO) van de Universiteit van Amsterdam in opdracht van Stichting voor Industriebeleid en Communicatie (SIC) een ontwerp voor een SIC industriemonitor met een voorstel voor de inhoud en de structuur van een dergelijke monitor. Op dat

  11. Indirect Taxes and Public Debt in the 'World of Islam' before 1800

    NARCIS (Netherlands)

    Fritschy, W.; S. Cavaciocchi,

    2008-01-01

    Indirect taxes and public debt in the ‘world of Islam’ before 1800. A comparison of Western and Islamic public finance. Wantje Fritschy – Vrije Universiteit Amsterdam – June 2007 The ‘world of islam’ and ‘the West’ before 1800 seem to have displayed different ‘fiscal values’: not only was it

  12. Waarom wij studenten niet vertellen dat de Griekse cultuur uit ‘Zwart Afrika’ komt

    NARCIS (Netherlands)

    Boter, G.J.; Flinterman, J.J.

    2016-01-01

    The present contribution is an offshoot of a public debate on Afrocentric criticisms of the teaching of Ancient History, held at the Vrije Universiteit Amsterdam in June 2015 (for a video recording of this event see https://www.youtube.com/watch?v=WMu5lncT8OU). We argue that the central tenets of

  13. Computer-Assisted Linguistic Analysis of the Peshitta

    NARCIS (Netherlands)

    Roorda, D.; Talstra, Eep; Dyk, Janet; van Keulen, Percy; Sikkel, Constantijn; Bosman, H.J.; Jenner, K.D.; Bakker, Dirk; Volkmer, J.A.; Gutman, Ariel; van Peursen, Wido Th.

    2014-01-01

    CALAP (Computer-Assisted Linguistic Analysis of the Peshitta), a joint research project of the Peshitta Institute Leiden and the Werkgroep Informatica at the Vrije Universiteit Amsterdam (1999-2005) CALAP concerned the computer-assisted analysis of the Peshitta to Kings (Janet Dyk and Percy van

  14. Institutionele repositories: UvA maakt onderzoek beter zichtbaar en toegankelijk

    NARCIS (Netherlands)

    Woutersen-Windhouwer, S.

    2009-01-01

    De UB Amsterdam (UvA) zet zich in om de onderzoeksresultaten van de universiteit toegankelijk te maken. Dat vergroot de impact van het onderzoek en de zichtbaarheid van de wetenschappers. Hiervoor heeft de UB een nieuwe werkwijze opgezet, waarbij ze de wetenschapppers actief benadert. En met succes:

  15. 10 Bel 03.pmd

    African Journals Online (AJOL)

    Owner

    2 maart 2009 ... Congo, de missie en de literatuur: Over David van Reybrouck,. J. G. Schoup en Amaat Vyncke. Jacqueline Bel. Jacqueline Bel is als universitair hoofddocent moderne Nederlandse letterkunde verbonden aan de Vrije. Universiteit in Amsterdam. Zij is onder meer gespecialiseerd in Nederlandse en Vlaamse.

  16. Feelings of loneliness, but not social isolation, predict dementia onset: results from the Amsterdam Study of the Elderly (AMSTEL).

    Science.gov (United States)

    Holwerda, Tjalling Jan; Deeg, Dorly J H; Beekman, Aartjan T F; van Tilburg, Theo G; Stek, Max L; Jonker, Cees; Schoevers, Robert A

    2014-02-01

    Known risk factors for Alzheimer's disease and other dementias include medical conditions, genetic vulnerability, depression, demographic factors and mild cognitive impairment. The role of feelings of loneliness and social isolation in dementia is less well understood, and prospective studies including these risk factors are scarce. We tested the association between social isolation (living alone, unmarried, without social support), feelings of loneliness and incident dementia in a cohort study among 2173 non-demented community-living older persons. Participants were followed for 3 years when a diagnosis of dementia was assessed (Geriatric Mental State (GMS) Automated Geriatric Examination for Computer Assisted Taxonomy (AGECAT)). Logistic regression analysis was used to examine the association between social isolation and feelings of loneliness and the risk of dementia, controlling for sociodemographic factors, medical conditions, depression, cognitive functioning and functional status. After adjustment for other risk factors, older persons with feelings of loneliness were more likely to develop dementia (OR 1.64, 95% CI 1.05 to 2.56) than people without such feelings. Social isolation was not associated with a higher dementia risk in multivariate analysis. Feeling lonely rather than being alone is associated with an increased risk of clinical dementia in later life and can be considered a major risk factor that, independently of vascular disease, depression and other confounding factors, deserves clinical attention. Feelings of loneliness may signal a prodromal stage of dementia. A better understanding of the background of feeling lonely may help us to identify vulnerable persons and develop interventions to improve outcome in older persons at risk of dementia.

  17. Validation of the Amsterdam Dynamic Facial Expression Set--Bath Intensity Variations (ADFES-BIV: A Set of Videos Expressing Low, Intermediate, and High Intensity Emotions.

    Directory of Open Access Journals (Sweden)

    Tanja S H Wingenbach

    Full Text Available Most of the existing sets of facial expressions of emotion contain static photographs. While increasing demand for stimuli with enhanced ecological validity in facial emotion recognition research has led to the development of video stimuli, these typically involve full-blown (apex expressions. However, variations of intensity in emotional facial expressions occur in real life social interactions, with low intensity expressions of emotions frequently occurring. The current study therefore developed and validated a set of video stimuli portraying three levels of intensity of emotional expressions, from low to high intensity. The videos were adapted from the Amsterdam Dynamic Facial Expression Set (ADFES and termed the Bath Intensity Variations (ADFES-BIV. A healthy sample of 92 people recruited from the University of Bath community (41 male, 51 female completed a facial emotion recognition task including expressions of 6 basic emotions (anger, happiness, disgust, fear, surprise, sadness and 3 complex emotions (contempt, embarrassment, pride that were expressed at three different intensities of expression and neutral. Accuracy scores (raw and unbiased (Hu hit rates were calculated, as well as response times. Accuracy rates above chance level of responding were found for all emotion categories, producing an overall raw hit rate of 69% for the ADFES-BIV. The three intensity levels were validated as distinct categories, with higher accuracies and faster responses to high intensity expressions than intermediate intensity expressions, which had higher accuracies and faster responses than low intensity expressions. To further validate the intensities, a second study with standardised display times was conducted replicating this pattern. The ADFES-BIV has greater ecological validity than many other emotion stimulus sets and allows for versatile applications in emotion research. It can be retrieved free of charge for research purposes from the

  18. A Study on Mediation by Offspring BMI in the Association between Maternal Obesity and Child Respiratory Outcomes in the Amsterdam Born and Their Development Study Cohort.

    Science.gov (United States)

    Harskamp-van Ginkel, Margreet W; London, Stephanie J; Magnus, Maria C; Gademan, Maaike G; Vrijkotte, Tanja G

    2015-01-01

    A causal relationship between maternal obesity and offspring asthma is hypothesized to begin during early development, but no underlying mechanism for the found association is identified. We quantitatively examined mediation by offspring body mass index (BMI) in the association of maternal pre-pregnancy BMI on risk of asthma and wheezing during the first 7-8 years of life in a large Amsterdam born birth cohort. For 3185 mother-child pairs, mothers reported maternal pre-pregnancy BMI and offspring outcomes "ever being diagnosed with asthma" and "wheezing in the past 12 months" on questionnaires. We measured offspring height and weight at age 5-6 years. We performed a multivariate log linear regression comparing outcomes in offspring of mothers with different BMI categories. For each category we quantified and tested mediation by offspring BMI and also investigated interaction by parental asthma. At the age of 7-8 years, 8% of the offspring ever had asthma and 7% had current wheezing. Maternal pre-pregnancy obesity was associated with higher risks of asthma (adjusted RR 2.32 (95% CI: 1.49-3.61) and wheezing (adjusted RR 2.16 (95% CI: 1.28-3.64). Offspring BMI was a mediator in the association between maternal BMI and offspring wheezing, but not for asthma. There was no interaction by parental asthma. Maternal pre-pregnancy obesity was associated with higher risks of offspring asthma and wheezing. The association between maternal obesity and offspring wheezing was both direct and indirect (mediated) through the child's own BMI.

  19. Predicting Overall Survival After Stereotactic Ablative Radiation Therapy in Early-Stage Lung Cancer: Development and External Validation of the Amsterdam Prognostic Model

    Energy Technology Data Exchange (ETDEWEB)

    Louie, Alexander V., E-mail: Dr.alexlouie@gmail.com [Department of Radiation Oncology, VU University Medical Center, Amsterdam (Netherlands); Department of Radiation Oncology, London Regional Cancer Program, University of Western Ontario, London, Ontario (Canada); Department of Epidemiology, Harvard School of Public Health, Harvard University, Boston, Massachusetts (United States); Haasbeek, Cornelis J.A. [Department of Radiation Oncology, VU University Medical Center, Amsterdam (Netherlands); Mokhles, Sahar [Department of Cardio-Thoracic Surgery, Erasmus University Medical Center, Rotterdam (Netherlands); Rodrigues, George B. [Department of Radiation Oncology, London Regional Cancer Program, University of Western Ontario, London, Ontario (Canada); Stephans, Kevin L. [Department of Radiation Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, Ohio (United States); Lagerwaard, Frank J. [Department of Radiation Oncology, VU University Medical Center, Amsterdam (Netherlands); Palma, David A. [Department of Radiation Oncology, London Regional Cancer Program, University of Western Ontario, London, Ontario (Canada); Videtic, Gregory M.M. [Department of Radiation Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, Ohio (United States); Warner, Andrew [Department of Radiation Oncology, London Regional Cancer Program, University of Western Ontario, London, Ontario (Canada); Takkenberg, Johanna J.M. [Department of Cardio-Thoracic Surgery, Erasmus University Medical Center, Rotterdam (Netherlands); Reddy, Chandana A. [Department of Radiation Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, Ohio (United States); Maat, Alex P.W.M. [Department of Cardio-Thoracic Surgery, Erasmus University Medical Center, Rotterdam (Netherlands); Woody, Neil M. [Department of Radiation Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, Ohio (United States); Slotman, Ben J.; Senan, Suresh [Department of Radiation Oncology, VU University Medical Center, Amsterdam (Netherlands)

    2015-09-01

    Purpose: A prognostic model for 5-year overall survival (OS), consisting of recursive partitioning analysis (RPA) and a nomogram, was developed for patients with early-stage non-small cell lung cancer (ES-NSCLC) treated with stereotactic ablative radiation therapy (SABR). Methods and Materials: A primary dataset of 703 ES-NSCLC SABR patients was randomly divided into a training (67%) and an internal validation (33%) dataset. In the former group, 21 unique parameters consisting of patient, treatment, and tumor factors were entered into an RPA model to predict OS. Univariate and multivariate models were constructed for RPA-selected factors to evaluate their relationship with OS. A nomogram for OS was constructed based on factors significant in multivariate modeling and validated with calibration plots. Both the RPA and the nomogram were externally validated in independent surgical (n=193) and SABR (n=543) datasets. Results: RPA identified 2 distinct risk classes based on tumor diameter, age, World Health Organization performance status (PS) and Charlson comorbidity index. This RPA had moderate discrimination in SABR datasets (c-index range: 0.52-0.60) but was of limited value in the surgical validation cohort. The nomogram predicting OS included smoking history in addition to RPA-identified factors. In contrast to RPA, validation of the nomogram performed well in internal validation (r{sup 2}=0.97) and external SABR (r{sup 2}=0.79) and surgical cohorts (r{sup 2}=0.91). Conclusions: The Amsterdam prognostic model is the first externally validated prognostication tool for OS in ES-NSCLC treated with SABR available to individualize patient decision making. The nomogram retained strong performance across surgical and SABR external validation datasets. RPA performance was poor in surgical patients, suggesting that 2 different distinct patient populations are being treated with these 2 effective modalities.

  20. Ethnicity and socioeconomic status are related to dietary patterns at age 5 in the Amsterdam born children and their development (ABCD) cohort.

    Science.gov (United States)

    Rashid, Viyan; Engberink, Marielle F; van Eijsden, Manon; Nicolaou, Mary; Dekker, Louise H; Verhoeff, Arnoud P; Weijs, Peter J M

    2018-01-08

    Health inequalities are already present at young age and tend to vary with ethnicity and socioeconomic status (SES). Diet is a major determinant of overweight, and studying dietary patterns as a whole in relation to overweight rather than single nutrients or foods has been suggested. We derived dietary patterns at age 5 and determined whether ethnicity and SES were both related to these dietary patterns. We analysed 2769 validated Food Frequency Questionnaires filled in by mothers of children (5.7 ± 0.5y) in the Amsterdam Born Children and their Development (ABCD) cohort. Food items were reduced to 41 food groups. Energy adjusted intake per food group (g/d) was used to derive dietary patterns using Principal Component Analysis and children were given a pattern score for each dietary pattern. We defined 5 ethnic groups (Dutch, Surinamese, Turkish, Moroccan, other ethnicities) and 3 SES groups (low, middle, high, based on maternal education). Multivariate ANOVA, with adjustment for age, gender and maternal age, was used to test potential associations between ethnicity or SES and dietary pattern scores. Post-hoc analyses with Bonferroni adjustment were used to examine differences between groups. Principal Component Analysis identified 4 dietary patterns: a snacking, full-fat, meat and healthy dietary pattern, explaining 21% of the variation in dietary intake. Ethnicity was related to the dietary pattern scores (p pattern, whereas Turkish children scored high on full-fat and Surinamese children on the meat pattern. SES was related to the snacking, full-fat and meat patterns (p pattern and low on the full-fat pattern. This study indicates that both ethnicity and SES are relevant for dietary patterns at age 5 and may enable more specific nutrition education to specific ethnic and low socioeconomic status target groups.

  1. Validation of the Amsterdam Dynamic Facial Expression Set--Bath Intensity Variations (ADFES-BIV): A Set of Videos Expressing Low, Intermediate, and High Intensity Emotions.

    Science.gov (United States)

    Wingenbach, Tanja S H; Ashwin, Chris; Brosnan, Mark

    2016-01-01

    Most of the existing sets of facial expressions of emotion contain static photographs. While increasing demand for stimuli with enhanced ecological validity in facial emotion recognition research has led to the development of video stimuli, these typically involve full-blown (apex) expressions. However, variations of intensity in emotional facial expressions occur in real life social interactions, with low intensity expressions of emotions frequently occurring. The current study therefore developed and validated a set of video stimuli portraying three levels of intensity of emotional expressions, from low to high intensity. The videos were adapted from the Amsterdam Dynamic Facial Expression Set (ADFES) and termed the Bath Intensity Variations (ADFES-BIV). A healthy sample of 92 people recruited from the University of Bath community (41 male, 51 female) completed a facial emotion recognition task including expressions of 6 basic emotions (anger, happiness, disgust, fear, surprise, sadness) and 3 complex emotions (contempt, embarrassment, pride) that were expressed at three different intensities of expression and neutral. Accuracy scores (raw and unbiased (Hu) hit rates) were calculated, as well as response times. Accuracy rates above chance level of responding were found for all emotion categories, producing an overall raw hit rate of 69% for the ADFES-BIV. The three intensity levels were validated as distinct categories, with higher accuracies and faster responses to high intensity expressions than intermediate intensity expressions, which had higher accuracies and faster responses than low intensity expressions. To further validate the intensities, a second study with standardised display times was conducted replicating this pattern. The ADFES-BIV has greater ecological validity than many other emotion stimulus sets and allows for versatile applications in emotion research. It can be retrieved free of charge for research purposes from the corresponding author.

  2. Vaginal high-risk human papillomavirus infection in a cross-sectional study among women of six different ethnicities in Amsterdam, the Netherlands: the HELIUS study.

    Science.gov (United States)

    Alberts, C J; Vos, R A; Borgdorff, H; Vermeulen, W; van Bergen, J; Bruisten, S M; Geerlings, S E; Snijder, M B; van Houdt, R; Morré, S A; de Vries, H J C; van de Wijgert, J H H M; Prins, M; Schim van der Loeff, M F

    2016-12-01

    In the Netherlands the incidence of cervical cancer is higher among ethnic minority populations compared with the general Dutch population. We investigated the prevalence of, and risk factors associated with, vaginal high-risk human papillomavirus (hrHPV) infection in women of six different ethnicities living in Amsterdam. For this cross-sectional study we selected women aged 18-34 years old of six ethnicities from the large-scale multiethnic HEalthy LIfe in an Urban Setting study. Self-collected vaginal swabs were tested for HPV DNA and genotyped using a highly sensitive PCR and reverse line blot assay (short PCR fragment (SPF)10-PCR DNA enzyme immunoassay/LiPA25-system version-1, delft diagnostic laboratory (DDL)). Participants completed a questionnaire regarding demographics and sexual behaviour. Logistic regression using generalised estimating equations was used to assess risk factors of hrHPV, and to investigate whether prevalence of hrHPV differed among ethnicities. The study population consisted of 592 women with a median age of 27 (IQR: 23-31) years. Dutch and African Surinamese women reported the highest sexual risk behaviour. HrHPV prevalence was highest in the Dutch (40%) followed by the African Surinamese (32%), Turkish (29%), Ghanaian (26%), Moroccan (26%) and South-Asian Surinamese (18%). When correcting for sexual risk behaviour, the odds to be hrHPV-positive were similar for all non-Dutch groups when compared with that of the Dutch group. We found an overall higher hrHPV prevalence and higher sexual risk behaviour in the native Dutch population. Further research is needed to unravel the complex problem concerning cervical cancer disparities, such as differences in participation in the cervical cancer screening programme, or differences in clearance and persistence of hrHPV. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  3. Microplastics en route: Field measurements in the Dutch river delta and Amsterdam canals, wastewater treatment plants, North Sea sediments and biota.

    Science.gov (United States)

    Leslie, H A; Brandsma, S H; van Velzen, M J M; Vethaak, A D

    2017-04-01

    Environmental contamination by plastic particles, also known as 'microplastics', brings synthetic materials that are non-degradable and biologically incompatible into contact with ecosystems. In this paper we present concentration data for this emerging contaminant in wastewater treatment plants (WWTPs) and freshwater and marine systems, reflecting the routes via which these particles can travel and the ecosystems they potentially impact along their path. Raw sewage influents, effluents and sewage sludge from seven municipal WWTPs in the Netherlands contained mean particle concentrations of 68-910L -1 , 51-81L -1 and 510-760kg -1 wet weight (ww), respectively (particle sizes between 10 and 5000μm). Even after treatment, wastewater constitutes a source of microplastic pollution of surface waters, and via biosolids applications in farming and forestry, plastic retained in sewage sludge can be transferred to terrestrial environments. The WWTPs investigated here had a mean microplastics retention efficiency of 72% (s.d. 61%) in the sewage sludge. In the receiving waters of treated and untreated wastewaters, we detected high microplastic levels in riverine suspended particulate matter (1400-4900kg -1 dry weight (dw)) from the Rhine and Meuse rivers. Amsterdam canal water sampled at different urban locations contained microplastic concentrations (48-187L -1 ), similar to those observed in wastewater that is emitted from sewage treatment facilities in the area. At least partial settling of the particles occurs in freshwater as well, as indicated by microplastics in urban canal sediments (species are heavily exposed to plastic particles. Body residues between 10 and 100particlesg -1 dw were measured in benthic macroinvertebrate species inhabiting the Dutch North Sea coast: filter-feeding mussels and oysters (species for human consumption) as well as other consumers in the marine food chain. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Persistence after treatment of pharyngeal gonococcal infections in patients of the STI clinic, Amsterdam, the Netherlands, 2012-2015: a retrospective cohort study.

    Science.gov (United States)

    Hananta, I Putu Yuda; De Vries, Henry John Christiaan; van Dam, Alje P; van Rooijen, Martijn Sebastiaan; Soebono, Hardyanto; Schim van der Loeff, Maarten Franciscus

    2017-11-01

    Infection of Neisseria gonorrhoeae in the pharynx (pharyngeal Ng) is associated with gonococcal transmission and development of antimicrobial resistance. We assessed proportion of and determinants for persistence after treatment of pharyngeal Ng. At the STI clinic of Amsterdam, the Netherlands, females-at-risk and men who have sex with men are routinely screened for pharyngeal Ng using an RNA-based nucleic acid amplification test (NAAT; Aptima Combo 2). Patients with pharyngeal Ng were invited for a test-of-cure (TOC) 7 days after treatment with a 500 mg ceftriaxone intramuscularly. We retrospectively examined medical records of patients with pharyngeal Ng (January 2012-August 2015) who returned for a TOC 7-28 days after treatment. Persistence was defined as a positive NAAT at TOC. Out of 2204 pharyngeal Ng cases recorded in the study period, 781 cases (median time between first treatment and TOC of 8 (IQR 7-12) days) were included in the analysis. Persistence after treatment was found in 36 (4.6%) and was less likely among patients who received ceftriaxone in combination with other antibiotics (vs monotherapy) (adjusted OR (aOR) 0.36, 95% CI 0.12 to 1.04) and with longer time from treatment to TOC (aOR 0.74, 95% CI 0.60 to 0.90, per extra day). In those with a TOC 15-28 days after treatment, Ng persisted in only 1.0% (1/105 cases). A small proportion of pharyngeal Ng persists despite appropriate treatment. Combining ceftriaxone with other antibiotics appears to lead to faster clearance. A TOC for pharyngeal Ng 7 days after treatment may be too soon. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  5. Persistence after treatment of pharyngeal gonococcal infections in patients of the STI clinic, Amsterdam, the Netherlands, 2012–2015: a retrospective cohort study

    Science.gov (United States)

    De Vries, Henry John Christiaan; van Dam, Alje P; van Rooijen, Martijn Sebastiaan; Soebono, Hardyanto; Schim van der Loeff, Maarten Franciscus

    2017-01-01

    Introduction Infection of Neisseria gonorrhoeae in the pharynx (pharyngeal Ng) is associated with gonococcal transmission and development of antimicrobial resistance. We assessed proportion of and determinants for persistence after treatment of pharyngeal Ng. Methods At the STI clinic of Amsterdam, the Netherlands, females-at-risk and men who have sex with men are routinely screened for pharyngeal Ng using an RNA-based nucleic acid amplification test (NAAT; Aptima Combo 2). Patients with pharyngeal Ng were invited for a test-of-cure (TOC) 7 days after treatment with a 500 mg ceftriaxone intramuscularly. We retrospectively examined medical records of patients with pharyngeal Ng (January 2012–August 2015) who returned for a TOC 7–28 days after treatment. Persistence was defined as a positive NAAT at TOC. Results Out of 2204 pharyngeal Ng cases recorded in the study period, 781 cases (median time between first treatment and TOC of 8 (IQR 7–12) days) were included in the analysis. Persistence after treatment was found in 36 (4.6%) and was less likely among patients who received ceftriaxone in combination with other antibiotics (vs monotherapy) (adjusted OR (aOR) 0.36, 95% CI 0.12 to 1.04) and with longer time from treatment to TOC (aOR 0.74, 95% CI 0.60 to 0.90, per extra day). In those with a TOC 15–28 days after treatment, Ng persisted in only 1.0% (1/105 cases). Conclusion A small proportion of pharyngeal Ng persists despite appropriate treatment. Combining ceftriaxone with other antibiotics appears to lead to faster clearance. A TOC for pharyngeal Ng 7 days after treatment may be too soon. PMID:28822976

  6. Validation of the Amsterdam Dynamic Facial Expression Set – Bath Intensity Variations (ADFES-BIV): A Set of Videos Expressing Low, Intermediate, and High Intensity Emotions

    Science.gov (United States)

    Wingenbach, Tanja S. H.

    2016-01-01

    Most of the existing sets of facial expressions of emotion contain static photographs. While increasing demand for stimuli with enhanced ecological validity in facial emotion recognition research has led to the development of video stimuli, these typically involve full-blown (apex) expressions. However, variations of intensity in emotional facial expressions occur in real life social interactions, with low intensity expressions of emotions frequently occurring. The current study therefore developed and validated a set of video stimuli portraying three levels of intensity of emotional expressions, from low to high intensity. The videos were adapted from the Amsterdam Dynamic Facial Expression Set (ADFES) and termed the Bath Intensity Variations (ADFES-BIV). A healthy sample of 92 people recruited from the University of Bath community (41 male, 51 female) completed a facial emotion recognition task including expressions of 6 basic emotions (anger, happiness, disgust, fear, surprise, sadness) and 3 complex emotions (contempt, embarrassment, pride) that were expressed at three different intensities of expression and neutral. Accuracy scores (raw and unbiased (Hu) hit rates) were calculated, as well as response times. Accuracy rates above chance level of responding were found for all emotion categories, producing an overall raw hit rate of 69% for the ADFES-BIV. The three intensity levels were validated as distinct categories, with higher accuracies and faster responses to high intensity expressions than intermediate intensity expressions, which had higher accuracies and faster responses than low intensity expressions. To further validate the intensities, a second study with standardised display times was conducted replicating this pattern. The ADFES-BIV has greater ecological validity than many other emotion stimulus sets and allows for versatile applications in emotion research. It can be retrieved free of charge for research purposes from the corresponding author

  7. Usage of purchased self-tests for HIV and sexually transmitted infections in Amsterdam, the Netherlands: results of population-based and serial cross-sectional studies among the general population and sexual risk groups.

    Science.gov (United States)

    Bil, Janneke P; Prins, Maria; Stolte, Ineke G; Dijkshoorn, Henriëtte; Heijman, Titia; Snijder, Marieke B; Davidovich, Udi; Zuure, Freke R

    2017-09-21

    There are limited data on the usage of commercially bought self-tests for HIV and other sexually transmitted infections (STIs). Therefore, we studied HIV/STI self-test usage and its determinants among the general population and sexual risk groups between 2007 and 2015 in Amsterdam, the Netherlands. Data were collected in four different studies among the general population (S1 - 2) and sexual risk groups (S3 - 4). S1 - Amsterdam residents participating in representative population-based surveys (2008 and 2012; n=6044) drawn from the municipality register; S2 - Participants of a population-based study stratified by ethnicity drawn from the municipality register of Amsterdam (2011-2015; n=17 603); S3 - Men having sex with men (MSM) participating in an HIV observational cohort study (2008 and 2013; n=597) and S4 - STI clinic clients participating in a cross-sectional survey (2007-2012; n=5655). Prevalence of HIV/STI self-test usage and its determinants. The prevalence of HIV/STI self-test usage in the preceding 6-12 months varied between 1% and 2% across studies. Chlamydia self-tests were most commonly used, except among MSM in S3. Chlamydia and syphilis self-test usage increased over time among the representative sample of Amsterdam residents (S1) and chlamydia self-test usage increased over time among STI clinic clients (S4). Self-test usage was associated with African Surinamese or Ghanaian ethnic origin (S2), being woman or MSM (S1 and 4) and having had a higher number of sexual partners (S1-2). Among those in the general population who tested for HIV/STI in the preceding 12 months, 5-9% used a self-test. Despite low HIV/STI self-test usage, we observed increases over time in chlamydia and syphilis self-test usage. Furthermore, self-test usage was higher among high-risk individuals in the general population. It is important to continue monitoring self-test usage and informing the public about the unknown quality of available self-tests in the Netherlands and

  8. PREFACE: Proceedings of the 25th International Conference on Low Temperature Physics (LT25) (Amsterdam, The Netherlands, 6-13 August 2008) Proceedings of the 25th International Conference on Low Temperature Physics (LT25) (Amsterdam, The Netherlands, 6-13 August 2008)

    Science.gov (United States)

    Kes, Peter; Jochemsen, Reijer

    2009-04-01

    This issue forms part I of the Proceedings of the 25th International Conference on Low Temperature Physics (LT25) (Amsterdam, The Netherlands, 67-13 August 2008). The majority of the special invited lectures, such as the London prize lectures, the international union of pure and applied physics (IUPAP) young scientist award lectures, the plenary, half-plenary and public lectures, and the historical lectures presented at the LT25 conference, are included. The papers relating to the oral and poster presentations will appear in part II of the proceedings in a dedicated open access issue of Journal of Physics: Conference Series (2009 J. Phys.: Conf. Ser. 150). In addition to the organizer's report and a summary of the new developments in low temperature physics, which can also be found in this issue, part II provides useful information about LT25, such as an overview of committees, sponsors, exhibitors, and some conference statistics. To ensure the high publication standard mandated by Journal of Physics: Condensed Matter and Journal of Physics: Conference Series every paper was reviewed by at least one referee before it was accepted for publication. The editors are indebted to many colleagues for invaluable assistance in the preparation and review of 900 papers appearing in both parts I and II of these proceedings. In particular, we would like to thank Carlo Beenakker, Jeroen van den Brink, Hans Brom, Jos de Jongh, Horst Rogalla, Fons de Waele, and Jan Zaanen.

  9. Results of the implementation of a new screening protocol for child maltreatment at the Emergency Department of the Academic Medical Center in Amsterdam.

    Science.gov (United States)

    Teeuw, Arianne H; Sieswerda-Hoogendoorn, Tessa; Sangers, Esmée J; Heymans, Hugo S A; van Rijn, Rick R

    2016-01-01

    This study examines the results of the implementation of a new screening protocol for child maltreatment (CM) at the Emergency Department (ED) of the Academic Medical Center in Amsterdam, The Netherlands. This protocol consists of adding a so called 'top-toe' inspection (TTI), an inspection of the fully undressed child, to the screening checklist for child maltreatment, the SPUTOVAMO. We collected data from all patients 0-18 years old directly after introduction (February 2010) and 9 months later. Outcome measures were: completion of the screening and reasons for non-adherence. Data were collected on age, gender, reason for visiting the ED (defined by International Classification of Disease, ICD), presence of a chronic illness, type of professional performing the TTI and admission during week or weekend days. In February 560 and in November 529 paediatric patients were admitted. In February the complete screening protocol was performed in 42% of all children, in November in 17%. A correlation between completion of the SPUTOVAMO and having a TTI performed was found. Older age and presence of a chronic illness influenced the chance of having both SPUTOVAMO and TTI performed negatively. The completion rate of SPUTOVAMO was influenced by ICD code. Completion of TTI was influenced by type of investigator. The best performing professional was the ED physician followed by the paediatrician followed by the ED nurse. The reasons for not performing a TTI were not documented. Refusal of the TTI by a patient or parent was reported three times. Implementation of this new screening protocol for CM was only mildly successful and declined in time. A negative correlation between older child age and having a chronic illness and completion of the screening was found. A practical recommendation resulting from this study could be that, if CM screening protocols prove to be effective in detecting CM, regular training sessions have to be held. Filling out the checklist is something that

  10. Associations Between Statin Use and Physical Function in Older Adults from The Netherlands and Australia: Longitudinal Aging Study Amsterdam and Australian Longitudinal Study on Women's Health.

    Science.gov (United States)

    van Boheemen, Laurette; Tett, Susan E; Sohl, Evelien; Hugtenburg, Jacqueline G; van Schoor, Natasja M; Peeters, G M E E

    2016-06-01

    Statin therapy may cause myopathy, but long-term effects on physical function are unclear. We investigated whether statin use is associated with poorer physical function in two population-based cohorts of older adults. Data were from 691 men and women (aged 69-102 years in 2005/2006) in the LASA (Longitudinal Aging Study Amsterdam) and 5912 women (aged 79-84 years in 2005) in the ALSWH (Australian Longitudinal Study on Women's Health). Statin use and dose were sourced from containers (LASA) and administrative databases (ALSWH). Physical function was assessed using performance tests, questionnaires on functional limitations and the SF-12 (LASA) and SF-36 (ALSWH) questionnaires. Cross-sectional (both studies) and 3-year prospective associations (ALSWH) were analysed for different statin dosage using linear and logistic regression. In total, 25 % of participants in LASA and 61 % in ALSWH used statins. In the cross-sectional models in LASA, statin users were less likely to have functional limitations (percentage of subjects with at least 1 limitation 63.9 vs. 64.2; odds ratio [OR] 0.6; 95 % confidence interval [CI] 0.3-0.9) and had better SF-12 physical component scores (mean [adjusted] 47.3 vs. 44.5; beta [B] = 2.8; 95 % CI 1.1-4.5); in ALSWH, statin users had better SF-36 physical component scores (mean [adjusted] 37.4 vs. 36.5; B = 0.9; 95 % CI 0.3-1.5) and physical functioning subscale scores (mean [adjusted] 55.1 vs. 52.6; B = 2.4; 95 % CI 1.1-3.8) than non-users. Similar associations were found for low- and high-dose users and in the prospective models. In contrast, no significant associations were found with performance tests. Two databases from longitudinal population studies in older adults gave comparable results, even though different outcome measures were used. In these two large cohorts, statin use was associated with better self-perceived physical function.

  11. A longitudinal study on determinants of HPV vaccination uptake in parents/guardians from different ethnic backgrounds in Amsterdam, the Netherlands

    Directory of Open Access Journals (Sweden)

    Catharina J. Alberts

    2017-02-01

    Full Text Available Abstract Background Human papillomavirus (HPV vaccination coverage in the Netherlands is low (~60% compared to other childhood vaccinations (>90%, and even lower among ethnic minorities. The aim of this study was to explore the possible impact of ethnicity on the determinants of both HPV vaccination intention and HPV vaccination uptake among parents/guardians having a daughter that is invited for the HPV vaccination. Methods In February 2014, parents/guardians living in Amsterdam were invited to complete a questionnaire about social-psychological determinants of their decision making process regarding the HPV vaccination of their daughter and socio-demographic characteristics. This questionnaire was sent approximately one month before the daughter was scheduled to receive her first HPV vaccine dose. Their daughters’ HPV vaccination status was retrieved from the national vaccination database. We distinguished four ethnic groups: Dutch (NL, Surinamese, Netherlands Antillean, and Aruban (SNA, Middle-Eastern and North-African (MENA, and Other. To assess the impact of determinants on both intention and uptake, linear and logistic regression analyses were used respectively. Missing data were imputed using multiple imputation by chained equation. Results In total 1,309 parents/guardians participated (33% participation rate. In all groups we found the mothers’ intention to be the strongest predictor of their daughters’ HPV vaccination uptake. Explained variance of uptake was highest in the NL-group (pseudo-R2:0.56 and lower in the other ethnic groups (pseudo-R2 varied between 0.23 and 0.29. The lower explained variance can be attributed to the relative large proportion of participants with a positive intention that finally did not go for vaccination in the SNA-group (11% and MENA-group (30%. Explained variance (R2 of intention varied between 0.66 and 0.77 across ethnic groups, and was best explained by the proximal social

  12. Chromosomal Conditions

    Science.gov (United States)

    ... and more. Stony Point, NY 10980 Close X Home > Complications & Loss > Birth defects & other health conditions > Chromosomal conditions Chromosomal conditions ... Disorders See also: Genetic counseling , Your family health history Last reviewed: February, 2013 ... labor & premature birth The newborn intensive care unit (NICU) Birth defects & ...

  13. The upgraded Amsterdam nuclear microprobe

    International Nuclear Information System (INIS)

    Vis, R.D.; Kramer, J.L.A.M.; Tros, G.H.J.; Langevelde, F. van; Mars, L.

    1993-01-01

    The improvement of the facilities at our University consists of three phases. In phase 1, a 1.7 MV NEC tandem-Pelletron accelerator has been installed. The accelerator serves as injector for two beam lines, subsequently for macro- and micro-analysis. Moreover, an interconnection has been made with a beam line from our 400 kV high voltage Van de Graaff accelerator in order to enable injection of these very intense low energy beams in these two lines. Apart from new vacuum equipment and conventional beam steering and focussing elements, the experimental facilities are replaced from the cyclotron experimental hall to the newly organised experimental hall. In the phases 2 and 3, which are not yet completed, a second ion source for the Pelletron and a new or extended focussing unit for the microprobe will complete the overall operation. (orig.)

  14. Die Fakulteit Teologie (Afd A) aan die Universiteit van Pretoria; Vrae ...

    African Journals Online (AJOL)

    definition is called for and some relevant issues are indicated; an honest evaluation in respect of the political and social context which is reflected in positions adopted, a pastoral compassion which takes note of human misery, cognisance of the

  15. Die Departement Godsdiens- en Sendingwetenskap (Afd A, Universiteit van Pretoria, 1917-1978

    Directory of Open Access Journals (Sweden)

    P. J. van der Merwe

    1992-01-01

    Full Text Available The Department of Science of Religion and Missiology (Sec A, University of Pretoria, 1917-1978 The Transvaal University College began its Faculty of Theology in 1917 in co-operation with the Presbyterian Church and the Nederduitsch Hervormde Kerk. A Presbyterian minister, Prof E MacMillan, lectured from 1917 till 1934. This marked the end of Presbyterian participation. In the next period, 1935-1937, the Department suffered from a controversy between the Nederduitsch Hervormde Kerk and its new partner, the Nederduitsch Hervormde of Gereformeerde Kerk. The issue was solved when the Faculty divided into two sections, Section A for the Nederduitsch Hervormde Kerk and Section B for the Nederduitsch Hervormde of G ereformeerde Kerk. Prof H P Wolmarans was appointed to the chair of Science of Religion (Sec A in 1938 and served as head of the Department till 1959. He was succeeded by Prof F J van Zyl in 1960, who served till 1978.

  16. Verkeersveiligheidseffecten van het Haagse verkeerscirculatieplan. In opdracht van Universiteit Utrecht, Institute for Risk Assessment Sciences.

    NARCIS (Netherlands)

    Reurings, M.C.B.

    2010-01-01

    The Hague municipality's traffic circulation plan: its road safety effects. The purpose of the European 6th framework project INTARESE is to develop a methodology for assessing the health risks of policy options. One of the policy areas for which some case studies will be performed is traffic and

  17. MijnOU.nl (proef met een sociale netwerkdienst binnen de Open Universiteit)

    NARCIS (Netherlands)

    Eshuis, Jannes; Hermans, Henry

    2010-01-01

    Doel van het project Mijnou.nl Het ideaal van een volledig gepersonaliseerd startportaal, waarin studenten via een Single Sign On (SSO) toegang vinden tot al het leermateriaal waarop zij rechten hebben verworven, relevante informatie vinden over activiteiten op studiecentra, contacten kunnen

  18. Die verhouding tussen vertroue en diversiteitsklimaat by 'n Suid-Afrikaanse universiteit

    OpenAIRE

    McCallaghan, Sean; Heyns, Marita

    2016-01-01

    Hierdie studie stel ondersoek in na die verwantskap tussen vertroue en die diversiteitsklimaat binne 'n Suid-Afrikaanse tersiêre inrigting. 'n Kwantitatiewe benadering met behulp van 'n nie-waarskynlikheidsgerieflikheidsteekproef (N=350) is gevolg. Die vraelys wat in die studie gebruik is, maak gebruik van 'n kombinasie van drie vooraf-gevalideerde instrumente. Die resultate dui aan dat die werknemers saamstem dat die instelling bereid is tot diversiteitsbestuur en die uitskakeling van diskri...

  19. A safer road environment for cyclists. Proefschrift Technische Universiteit Delft TUD.

    NARCIS (Netherlands)

    Schepers, P.

    2013-01-01

    This thesis focuses on the question of how the road environment (road design and network characteristics) affects road safety for cyclists through effects on risk and exposure to risk. In this thesis, the term ‘road design’ is used to denote the location level (e.g. intersection design) while the

  20. Die sentrale openbaring in die Ou Testament en die Christelike grondslag van die Potchefstroomse Universiteit

    Directory of Open Access Journals (Sweden)

    F.N. Lion-Cachet

    1995-03-01

    Full Text Available The central revelation in the Old Testament and the Christian foundation of the Potchefstoom University. The PU for CHE acknowledges the revelation of God in creation and his Word as its foundation. The issue concerning the focus of the revelation in Scripture is answered in different ways. Looking at the Old Testament from a revelatory-cognitive approach, the LORD’S own disclosure as “I am who I am” (Exodus 3:14 may be a meaningful response. The concept “I am who I am” has a incomprehensible as well as a comprehensible meaning which reveals our knowledge of the LORD in a great diversity (He is God, the Creator, the Saviour, the Holy One, etc.. In addition, Christ proclaimed Himself in the New Testament as "I am ... ”. This central concept opens up the opportunity for a Christian university to do scientific work with the full reality of creation as its object.

  1. Miscellaneous conditions

    International Nuclear Information System (INIS)

    Berquist, T.H.; Hoffman, A.D.

    1989-01-01

    This paper reports on numerous conditions (systemic diseases, metabolic diseases, etc.) that may also affect the foot and ankle. In many cases, imaging of the foot and ankle is not performed for primary diagnostic purposes. However, radiographic changes do occur with these conditions. Therefore, it is important to be aware of radiographic abnormalities that these diseases may cause in the foot and ankle

  2. Carel Breytspraak Sr., Purveyor to his Majesty King Louis Napoleon. Breytspraak furniture from the collection of the Royal Palace in Amsterdam

    Directory of Open Access Journals (Sweden)

    Paul van Duin

    2013-06-01

    Full Text Available In 1808, King Louis Napoleon had the town hall of Amsterdam converted to Royal Palace. Besides making the necessary architectural alterations, he ordered hundreds of pieces of furniture and other ornamental objects from local furniture makers, upholsterers, decorators and other suppliers. This collection of Empire furniture, which is still preserved in the palace, is today the largest of its kind outside France. Between 2005 and 2009, these pieces of furniture were restored as part of the wider restoration of the entire palace, a gigantic operation that involved hundreds of restoration experts. A furniture committee made sure that quality and looks remained uniform. During the process the restoration experts and researchers made a full study of the furniture, documenting finds and findings, supplemented with research into the origins, the makers, use, techniques and material. This is unique for the Netherlands. The data, recorded in documentation and restoration reports, offer fresh insights in especially the construction and manufacturing process of Dutch Empire furniture. The discoveries are illustrated by a number of purveyances by Carel Breytspraak Sr. (1769-1810, the best paid furniture maker of the king. The 100 chairs he made for the Grand dining room of the palace are an example of pre-modern serial production. This may be inferred from the varying quality of the wood that was used and from the varying thickness of the seat stretchers, among other things. Furthermore, it turned out that the chairs still had the original stuffing, which was reused after having been restored. One chair still had the original upholstery from the days of Louis Napoleon and this was used as the basis for the current upholstery. The chairs are typical examples of furniture made after French decoration prints, which were undoubtedly provided by the king’s architects. The roll-top desk that Breytspraak made for the king’s bedroom is one of the most unique

  3. Aquatic conditions

    Science.gov (United States)

    Warren E. Heilman

    1999-01-01

    This publication provides citizens, private and public organizations, scientists, and others with information about the aquatic conditions in or near national forests in the Ozark-Ouachita Highlands: the Mark Twain in Missouri, the Ouachita in Arkansas and Oklahoma, and the Ozark-St. Francis National Forests in Arkansas. This report includes water quality analyses...

  4. Classical conditioning for preserving the effects of short melatonin treatment in children with delayed sleep: a pilot study

    Directory of Open Access Journals (Sweden)

    van Maanen A

    2017-03-01

    Full Text Available Annette van Maanen,1 Anne Marie Meijer,1 Marcel G Smits,2 Frans J Oort1 1Research Institute Child Development and Education, University of Amsterdam, Amsterdam, 2Centre for Sleep-Wake Disorders and Chronobiology, Hospital Gelderse Vallei, Ede, the Netherlands Abstract: Melatonin treatment is effective in treating sleep onset problems in children with delayed melatonin onset, but effects usually disappear when treatment is discontinued. In this pilot study, we investigated whether classical conditioning might help in preserving treatment effects of melatonin in children with sleep onset problems, with and without comorbid attention deficit hyperactivity disorder (ADHD or autism. After a baseline week, 16 children (mean age: 9.92 years, 31% ADHD/autism received melatonin treatment for 3 weeks and then gradually discontinued the treatment. Classical conditioning was applied by having children drink organic lemonade while taking melatonin and by using a dim red light lamp that was turned on when children went to bed. Results were compared with a group of 41 children (mean age: 9.43 years, 34% ADHD/autism who received melatonin without classical conditioning. Melatonin treatment was effective in advancing dim light melatonin onset and reducing sleep onset problems, and positive effects were found on health and behavior problems. After stopping melatonin, sleep returned to baseline levels. We found that for children without comorbidity in the experimental group, sleep latency and sleep start delayed less in the stop week, which suggests an effect of classical conditioning. However, classical conditioning seems counterproductive in children with ADHD or autism. Further research is needed to establish these results and to examine other ways to preserve melatonin treatment effects, for example, by applying morning light. Keywords: melatonin, classical conditioning, children, delayed sleep

  5. Le problème de la discrimination raciale dans les établissements scolaires américains The racial discrimination problem in American schools(about a book by Anthony Amsterdam and Jerome Bruner

    Directory of Open Access Journals (Sweden)

    Remi Clignet

    2009-06-01

    Full Text Available Le présent article, réalisé à partir de l’ouvrage d’Amsterdam et Bruner Minding the law a pour objet le problème de la discrimination raciale aux Etats-Unis à partir de l’analyse des différents arrêts rendus par la Cour Suprême, afin de déterminer leur valeur objective ainsi que leur portée juridique. L’ouvrage concerné consiste à analyser, d’une part, le contenu des arrêts et, d’autre part, leur application dans la société américaine afin d’évaluer la mise en œuvre du programme mettant fin à la discrimination raciale dans les établissements scolaires. Or l’analyse par les auteurs de tous les arrêts rendus de 1896 à 1977 révèle une anomalie dans l’application du programme, tant sur le plan théorique que pratique.

  6. Reseña de Bybee, J. and S. Fleischman (1995, Modality in Grammar and Discourse, (TypologicalStudies in Language 32, Amsterdam/Philadelphia, John Benjamins Publishing Company.

    Directory of Open Access Journals (Sweden)

    José Luis Berbeira Gardón

    2011-04-01

    Full Text Available Normal 0 21 false false false ES X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabla normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Se trata de una reseña de Bybee, J. and S. Fleischman (1995, Modality in Grammar and Discourse, (TypologicalStudies in Language 32, Amsterdam/Philadelphia, John Benjamins Publishing Company.

  7. Outbreak of Bacillus cereus Infections in a Neonatal Intensive Care Unit Traced to Balloons Used in Manual Ventilation

    OpenAIRE

    Van Der Zwet, Wil C.; Parlevliet, Gerard A.; Savelkoul, Paul H.; Stoof, Jeroen; Kaiser, Annie M.; Van Furth, A. Marceline; Vandenbroucke-Grauls, Christina M.

    2000-01-01

    In 1998, an outbreak of systemic infections caused by Bacillus cereus occurred in the Neonatal Intensive Care Unit of the University Hospital Vrije Universiteit, Amsterdam, The Netherlands. Three neonates developed sepsis with positive blood cultures. One neonate died, and the other two neonates recovered. An environmental survey, a prospective surveillance study of neonates, and a case control study were performed, in combination with molecular typing, in order to identify potential sources ...

  8. The Impact of Anti-Immigration Parties on Mainstream Parties' Immigration Positions in the Netherlands, Flanders and the UK 1987-2010: Divided electorates, left-right politics and the pull towards restrictionism

    OpenAIRE

    DAVIS, Amber

    2012-01-01

    Defence date: 20 April 2012; Examining Board: Professor Rainer Bauböck, EUI, for Professor Peter Mair (†), EUI (supervisor); Professor Virginie Guiraudon, National Center for Scientific Research, Paris; Professor Meindert Fennema, Universiteit van Amsterdam; Professor Dirk Jacobs, Université Libre de Bruxelles The rise of anti-immigration parties across Western Europe has put enormous pressure on mainstream parties to adapt their competitive strategies. This thesis tests the hypothesis tha...

  9. Risk Factors Associated with Colorectal Cancer in a Subset of Patients with Mutations in MLH1 and MSH2 in Taiwan Fulfilling the Amsterdam II Criteria for Lynch Syndrome.

    Directory of Open Access Journals (Sweden)

    Abram Bunya Kamiza

    Full Text Available Lynch syndrome, caused by germline mutations in mismatch repair genes, is a predisposing factor for colorectal cancer (CRC. This retrospective cohort study investigated the risk factors associated with the development of CRC in patients with MLH1 and MSH2 germline mutations.In total, 301 MLH1 and MSH2 germline mutation carriers were identified from the Amsterdam criteria family registry provided by the Taiwan Hereditary Nonpolyposis Colorectal Cancer Consortium. A Cox proportional hazard model was used to calculate the hazard ratios (HRs and 95% confidence intervals (CIs to determine the association between the risk factors and CRC development. A robust sandwich covariance estimation model was used to evaluate family dependence.Among the total cohort, subjects of the Hakka ethnicity exhibited an increased CRC risk (HR = 1.62, 95% CI = 1.09-2.34; however, those who performed regular physical activity exhibited a decreased CRC risk (HR = 0.62, 95% CI = 0.41-0.88. The CRC risk was enhanced in MLH1 germline mutation carriers, with corresponding HRs of 1.72 (95% CI = 1.16-2.55 and 0.54 (95% CI = 0.34-0.83 among subjects of the Hakka ethnicity and those who performed regular physical activity, respectively. In addition, the total cohort with a manual occupation had a 1.56 times higher CRC risk (95% CI = 1.07-2.27 than did that with a skilled occupation. Moreover, MSH2 germline mutation carriers with blood group type B exhibited an increased risk of CRC development (HR = 2.64, 95% CI = 1.06-6.58 compared with those with blood group type O.The present study revealed that Hakka ethnicity, manual occupation, and blood group type B were associated with an increased CRC risk, whereas regular physical activity was associated with a decreased CRC risk in MLH1 and MSH2 germline mutation carriers.

  10. Die organisatoriese werking van Suid-Afrikaanse universiteite : 'n teoretiese en empiriese ondersoek na doelwitformulering, organisasiestruktuur en interne koördinasie by sekere Suid-Afrikaanse universiteite / Simon Geertsema

    OpenAIRE

    Geertsema, Simon

    1981-01-01

    The Aim of the Study - The study aims at describing the organizational functioning of certain South African Universities, mainly in terms of a) The processes of goal formulation, b) The structure of the universities, as well as the relationships between the main structural components, c) The nature of the communication and control processes in the Universities. By doing this the study could be of use in promoting a better understanding of the university as an organizat...

  11. Condition Indicators for Gearbox Condition Monitoring Systems

    Directory of Open Access Journals (Sweden)

    P. Večeř

    2005-01-01

    Full Text Available Condition monitoring systems for manual transmissions based on vibration diagnostics are widely applied in industry. The systems deal with various condition indicators, most of which are focused on a specific type of gearbox fault. Frequently used condition indicators (CIs are described in this paper. The ability of a selected condition indicator to describe the degree of gearing wear was tested using vibration signals acquired during durability testing of manual transmission with helical gears. 

  12. Tenigblikke op die Fakulteit Teologie (Afd A, Universiteit van Pretoria, en sy lede - ’n literatuurverkenning

    Directory of Open Access Journals (Sweden)

    J. P. Oberholzer

    1992-01-01

    Full Text Available Retrospection on the Faculty of Theology (Sec A, University of Pretoria, and its members - a survey of literature A short, selective survey of literature on the motives for the founding of the Faculty of Theology (Sec A, University of Pretoria, and its history is given. Special attention is given to the typification of the theology of Faculty members by recent writers.

  13. Graad 12-punte as voorspeller van sukses in wiskunde by 'n universiteit van tegnologie / I.D. Mulder

    OpenAIRE

    Mulder, Isabella Dorothea

    2011-01-01

    Problems with students’ performance in Mathematics at tertiary level are common in South Africa − as it is worldwide. Pass rates at the university of technology where the researcher is a lecturer, are only about 50%. At many universities it has become common practice to refer students who do not have a reasonable chance to succeed at university level, for additional support to try to rectify this situation. However, the question is which students need such support? Because the Grade 12 marks ...

  14. Die Fakulteit Teologie (Afd A aan die Universiteit van Pretoria: Vrae oor sy identiteit en sy problematiek

    Directory of Open Access Journals (Sweden)

    J. P. Oberholzer

    1992-01-01

    Full Text Available The Faculty of Theology (Sec A at the University of Pretoria: Inquiry into its identity and problem areas This article is a short survey of theological viewpoints on the character and task of the church, as reflected in church literature during the past 75 years. It is shown that political history after World War II had a marked effect on thinking in the Nederduitsch Hervormde Kerk and that recent changes on the political scene pose penetrating questions to theologians. A full inquiry into the contours of self-definition is called for and some relevant issues are indicated; an honest evaluation in respect of the political and social context which is reflected in positions adopted, a pastoral compassion which takes note of human misery, cognisance of the ecumenical character of the church, and ethical and academic responsibility.

  15. Leucocyte esterase dip-stick test as a point-of-care diagnostic for urogenital chlamydia in male patients: A multi-center evaluation in two STI outpatient clinics in Paramaribo and Amsterdam

    Directory of Open Access Journals (Sweden)

    Menne Bartelsman

    2016-11-01

    Full Text Available Abstract Background Point-of-care (POC tests are an important strategy to address the epidemic of sexually transmitted infections (STIs. The leucocyte esterase test (LET can be used as a POC test for chlamydia. The aim of this study was to determine the diagnostic accuracy of the LET to detect urogenital chlamydia among men at STI clinics in Paramaribo, Suriname and Amsterdam, the Netherlands. Methods Recruitment of patients took place in 2008–2010 in Suriname and in 2009–2010 in the Netherlands. Urine of patients was examined with the LET. The reference test was a nucleic acid amplification test (NAAT. Results We included 412 patients in Suriname and 645 in the Netherlands. Prevalence of chlamydia in Suriname and the Netherlands was respectively 22.8 and 13.6 %. The sensitivity of the LET was 92.6 % (95 % CI = 85.3–97.0 and 77.3 % (95 % CI = 67.1–85.5 respectively, the specificity was 38.1 % (95 % CI = 32.7–43.6 % and 58.1 % (95 % CI = 53.9–62.3 respectively. The positive predictive value was 30.6 % (95 % CI = 27.3–36.4 and 22.6 % (95 % CI = 18.0–27.7 respectively and the negative predictive value was 94.5 % (95 % CI = 89.1–97.8 and 94.2 % (95 % CI = 91.1–96.4 respectively. The kappa was respectively 0.179 and 0.176. Conclusions To diagnose urogenital chlamydia in men the LET performs poorly. It has a high negative but low positive predictive value. If the LET result is negative, chlamydia is accurately excluded, yet a positive result has a low predictive value. Whether the advantages of direct management based on LET outweigh the disadvantages of overtreatment is a subject for further studies.

  16. Face recognition's grand challenge: uncontrolled conditions under control

    NARCIS (Netherlands)

    Boom, B.J.

    2010-01-01

    The number of cameras increases rapidly in squares, shopping centers, railway stations and airport halls. There are hundreds of cameras in the city center of Amsterdam. This is still modest compared to the tens of thousands of cameras in London, where citizens are expected to be filmed by more than

  17. The fast Amsterdam multiprocessor (FAMP) system hardware

    International Nuclear Information System (INIS)

    Hertzberger, L.O.; Kieft, G.; Kisielewski, B.; Wiggers, L.W.; Engster, C.; Koningsveld, L. van

    1981-01-01

    The architecture of a multiprocessor system is described that will be used for on-line filter and second stage trigger applications. The system is based on the MC 68000 microprocessor from Motorola. Emphasis is paid to hardware aspects, in particular the modularity, processor communication and interfacing, whereas the system software and the applications will be described in separate articles. (orig.)

  18. The University of Amsterdam at TREC 2012

    Science.gov (United States)

    2012-11-01

    lady , weight, ap, loss, major, insurance, rate, role, response, plays, atlanta, rising, oprah, childhood, crescent Table 5: Example topics and their...by the CLARIN-nl program, the Dutch national program COMMIT, the ESF Research Net- work Program ELIAS, the Elite Network Shifts project funded by the...Royal Dutch Academy of Sciences (KNAW), and the Netherlands eScience Center under project number 027.012.105. 6 References [1] Balasubramanian, N. and

  19. (1899–1902). Vincent Kuitenbrouwer. Amsterdam

    African Journals Online (AJOL)

    over de ontwikkelingen in Zuid-Afrika Ne- derland via Nederlands-Indië konden berei- ken. Het media-offensief van de Nederlandse pro-Boerorganisaties had dan ook wel iets weg van een guerrilla-oorlog, net als de strijd van de Boeren tegen het Britse leger. De kern van Kuitenbrouwers proefschrift bestaat uit drie delen.

  20. Skin Condition Finder

    Science.gov (United States)

    ... SKIN CONDITIONS HEALTH TOPICS FOR PROFESSIONALS Rash and Skin Condition Finder 1 Select Age Group Infant Child ... Toe Toe Webspace Toe Nail CLOSE About the Skin Condition Finder Have a health question or concern? ...

  1. Betting on conditionals

    OpenAIRE

    Politzer , Guy; Over , David P; Baratgin , Jean

    2010-01-01

    A study is reported testing two hypotheses about a close parallel relation between indicative conditionals, if A then B, and conditional bets, I bet you that if A then B. The first is that both the indicative conditional and the conditional bet are related to the conditional probability, P(B|A). The second is that de Finetti's three-valued truth table has psychological reality for both types of conditional – true, false, or void for indicative conditionals and win, lose or void for conditiona...

  2. Conditional Aid Effectiveness

    DEFF Research Database (Denmark)

    Doucouliagos, Hristos; Paldam, Martin

    of the differences in results between studies. Taking all available studies in consideration, we find no support for conditionality with respect to policy, while conditionality regarding aid itself is dubious. However, the results differ depending on the authors’ institutional affiliation....

  3. Energetics Conditioning Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Energetics Conditioning Facility is used for long term and short term aging studies of energetic materials. The facility has 10 conditioning chambers of which 2...

  4. Modelling classroom conditions with different boundary conditions

    DEFF Research Database (Denmark)

    Marbjerg, Gerd Høy; Jeong, Cheol-Ho; Brunskog, Jonas

    2014-01-01

    A model that combines image source modelling and acoustical radiosity with complex boundary condition, thus including phase shifts on reflection has been developed. The model is called PARISM (Phased Acoustical Radiosity and Image Source Model). It has been developed in order to be able to model...

  5. Watershed condition [Chapter 4

    Science.gov (United States)

    Daniel G. Neary; Jonathan W. Long; Malchus B. Baker

    2012-01-01

    Managers of the Prescott National Forest are obliged to evaluate the conditions of watersheds under their jurisdiction in order to guide informed decisions concerning grazing allotments, forest and woodland management, restoration treatments, and other management initiatives. Watershed condition has been delineated by contrasts between “good” and “poor” conditions (...

  6. Conditional uncertainty principle

    Science.gov (United States)

    Gour, Gilad; Grudka, Andrzej; Horodecki, Michał; Kłobus, Waldemar; Łodyga, Justyna; Narasimhachar, Varun

    2018-04-01

    We develop a general operational framework that formalizes the concept of conditional uncertainty in a measure-independent fashion. Our formalism is built upon a mathematical relation which we call conditional majorization. We define conditional majorization and, for the case of classical memory, we provide its thorough characterization in terms of monotones, i.e., functions that preserve the partial order under conditional majorization. We demonstrate the application of this framework by deriving two types of memory-assisted uncertainty relations, (1) a monotone-based conditional uncertainty relation and (2) a universal measure-independent conditional uncertainty relation, both of which set a lower bound on the minimal uncertainty that Bob has about Alice's pair of incompatible measurements, conditioned on arbitrary measurement that Bob makes on his own system. We next compare the obtained relations with their existing entropic counterparts and find that they are at least independent.

  7. Qualification of conditioning process

    International Nuclear Information System (INIS)

    Wolf, J.

    1989-01-01

    A conditioning process is qualified by the PTB if the execution of pre-treatment and conditioning occurs so that a safe and orderly final storage of the products and waste containers produced can be assumed. All the relevant operating conditions for the plant are laid down by the producer/conditioner of the waste in a handbook. The elements of product inspection by process qualification are shown in tabular form. (DG) [de

  8. Irreversibility and conditional probability

    International Nuclear Information System (INIS)

    Stuart, C.I.J.M.

    1989-01-01

    The mathematical entropy - unlike physical entropy - is simply a measure of uniformity for probability distributions in general. So understood, conditional entropies have the same logical structure as conditional probabilities. If, as is sometimes supposed, conditional probabilities are time-reversible, then so are conditional entropies and, paradoxically, both then share this symmetry with physical equations of motion. The paradox is, of course that probabilities yield a direction to time both in statistical mechanics and quantum mechanics, while the equations of motion do not. The supposed time-reversibility of both conditionals seems also to involve a form of retrocausality that is related to, but possibly not the same as, that described by Costa de Beaurgard. The retrocausality is paradoxically at odds with the generally presumed irreversibility of the quantum mechanical measurement process. Further paradox emerges if the supposed time-reversibility of the conditionals is linked with the idea that the thermodynamic entropy is the same thing as 'missing information' since this confounds the thermodynamic and mathematical entropies. However, it is shown that irreversibility is a formal consequence of conditional entropies and, hence, of conditional probabilities also. 8 refs. (Author)

  9. Robert Amsterdam : Hodorkovski on geenius ja seetõttu ohtlik / Robert R. Amsterdam ; interv. Krister Paris

    Index Scriptorium Estoniae

    Amsterdam, Robert R.

    2006-01-01

    Mihhail Hodorkovski advokaat, kes on Venemaalt välja saadetud, vastab M. Hodorkovski kohtuprotsessiga seotud küsimustele. Advokaadi väitel pole ta Jukose juures näinud mingeid tõendeid väärtegudest, Hodorkovski pole sooritanud ühtki neist kuritegudest, mis talle süüks pandi. Lisad: Jukos likvideeritakse täna: Perekonda ootab väljatõstmine

  10. Lossless Conditional Schema Evolution

    DEFF Research Database (Denmark)

    Jensen, Ole Guttorm; Bøhlen, Michael Hanspeter

    2003-01-01

    The paper considers conditional schema evolution, where schema changes change the schema of the tuples that satisfy the change condition. When the schema of a relation change some tuples may no longer fit the current schema. Handling the mismatch between the intended schema of tuples and the reco......The paper considers conditional schema evolution, where schema changes change the schema of the tuples that satisfy the change condition. When the schema of a relation change some tuples may no longer fit the current schema. Handling the mismatch between the intended schema of tuples...... and the recorded schema of tuples is at the core of a DBMS that supports schema evolution. We propose to keep track of schema mismatches at the level of individual tuples, and prove that conditionally evolving schemas, in contrast to current commercial database systems, are lossless when the schema evolves...

  11. Evaporation under vacuum condition

    International Nuclear Information System (INIS)

    Mizuta, Satoshi; Shibata, Yuki; Yuki, Kazuhisa; Hashizume, Hidetoshi; Toda, Saburo; Takase, Kazuyuki; Akimoto, Hajime

    2000-01-01

    In nuclear fusion reactor design, an event of water coolant ingress into its vacuum vessel is now being considered as one of the most probable accidents. In this report, the evaporation under vacuum condition is evaluated by using the evaporation model we have developed. The results show that shock-wave by the evaporation occurs whose behavior strongly depends on the initial conditions of vacuum. And in the case of lower initial pressure and temperature, the surface temp finally becomes higher than other conditions. (author)

  12. Chronic Conditions Dashboard

    Data.gov (United States)

    U.S. Department of Health & Human Services — The CMS Chronic Conditions Dashboard presents statistical views of information on the prevalence, utilization and Medicare spending for Medicare beneficiaries with...

  13. Chronic Condition Data Warehouse

    Data.gov (United States)

    U.S. Department of Health & Human Services — The CMS Chronic Condition Data Warehouse (CCW) provides researchers with Medicare and Medicaid beneficiary, claims, and assessment data linked by beneficiary across...

  14. Chronic Conditions PUF

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Chronic Conditions PUFs are aggregated files in which each record is a profile or cell defined by the characteristics of Medicare beneficiaries. A profile is...

  15. National Coastal Condition Assessment

    Science.gov (United States)

    The NCCA is a collaborative, statistical survey of the nation's coastal waters and the Great Lakes. It is one of four national surveys that EPA and its partners conduct to assess the condition and health of the nation's water resources.

  16. Operant Conditioning and Education.

    Science.gov (United States)

    de Noronha, Mario

    A case study of a learning disabled 8-year-old with behavior disturbancs is presented to highlight the use of operant conditioning in cutting down educational costs and easing the teacher's class management problems. (CL)

  17. Multidimensional HAM-conditions

    DEFF Research Database (Denmark)

    Hansen, Ernst Jan de Place

    Heat, Air and Moisture (HAM) conditions, experimental data are needed. Tests were performed in the large climate simulator at SBi involving full-scale wall elements. The elements were exposed for steady-state conditions, and temperature cycles simulating April and September climate in Denmark....... The effect on the moisture and temperature conditions of the addition of a vapour barrier and an outer cladding on timber frame walls was studied. The report contains comprehensive appendices documenting the full-scale tests. The tests were performed as a part of the project 'Model for Multidimensional Heat......, Air and Moisture Conditions in Building Envelope Components' carried out as a co-project between DTU Byg and SBi....

  18. Common Childhood Orthopedic Conditions

    Science.gov (United States)

    ... Parents Parents site Sitio para padres General Health Growth & Development Infections Diseases & Conditions Pregnancy & Baby Nutrition & Fitness Emotions & ... pain. Toe Walking Toe walking is common among toddlers as they learn to walk, especially during the ...

  19. Conditional Probabilistic Population Forecasting

    OpenAIRE

    Sanderson, W.C.; Scherbov, S.; O'Neill, B.C.; Lutz, W.

    2003-01-01

    Since policy makers often prefer to think in terms of scenarios, the question has arisen as to whether it is possible to make conditional population forecasts in a probabilistic context. This paper shows that it is both possible and useful to make these forecasts. We do this with two different kinds of examples. The first is the probabilistic analog of deterministic scenario analysis. Conditional probabilistic scenario analysis is essential for policy makers it allows them to answer "what if"...

  20. Conditional probabilistic population forecasting

    OpenAIRE

    Sanderson, Warren; Scherbov, Sergei; O'Neill, Brian; Lutz, Wolfgang

    2003-01-01

    Since policy-makers often prefer to think in terms of alternative scenarios, the question has arisen as to whether it is possible to make conditional population forecasts in a probabilistic context. This paper shows that it is both possible and useful to make these forecasts. We do this with two different kinds of examples. The first is the probabilistic analog of deterministic scenario analysis. Conditional probabilistic scenario analysis is essential for policy-makers because it allows them...

  1. Conditional Probabilistic Population Forecasting

    OpenAIRE

    Sanderson, Warren C.; Scherbov, Sergei; O'Neill, Brian C.; Lutz, Wolfgang

    2004-01-01

    Since policy-makers often prefer to think in terms of alternative scenarios, the question has arisen as to whether it is possible to make conditional population forecasts in a probabilistic context. This paper shows that it is both possible and useful to make these forecasts. We do this with two different kinds of examples. The first is the probabilistic analog of deterministic scenario analysis. Conditional probabilistic scenario analysis is essential for policy-makers because...

  2. Conditional data watchpoint management

    Science.gov (United States)

    Burdick, Dean Joseph; Vaidyanathan, Basu

    2010-08-24

    A method, system and computer program product for managing a conditional data watchpoint in a set of instructions being traced is shown in accordance with illustrative embodiments. In one particular embodiment, the method comprises initializing a conditional data watchpoint and determining the watchpoint has been encountered. Upon that determination, examining a current instruction context associated with the encountered watchpoint prior to completion of the current instruction execution, further determining a first action responsive to a positive context examination; otherwise, determining a second action.

  3. LHCb distributed conditions database

    International Nuclear Information System (INIS)

    Clemencic, M

    2008-01-01

    The LHCb Conditions Database project provides the necessary tools to handle non-event time-varying data. The main users of conditions are reconstruction and analysis processes, which are running on the Grid. To allow efficient access to the data, we need to use a synchronized replica of the content of the database located at the same site as the event data file, i.e. the LHCb Tier1. The replica to be accessed is selected from information stored on LFC (LCG File Catalog) and managed with the interface provided by the LCG developed library CORAL. The plan to limit the submission of jobs to those sites where the required conditions are available will also be presented. LHCb applications are using the Conditions Database framework on a production basis since March 2007. We have been able to collect statistics on the performance and effectiveness of both the LCG library COOL (the library providing conditions handling functionalities) and the distribution framework itself. Stress tests on the CNAF hosted replica of the Conditions Database have been performed and the results will be summarized here

  4. Conditions precedent and indemnities

    International Nuclear Information System (INIS)

    Nielsen, A.D.

    1999-01-01

    The use of certain conditions which allow purchase and sale agreements to be voided without any liability to either the vendor or purchaser are discussed. The drafting issues that arise when preparing these conditions are described and some common types of conditions precedent found in oil and gas purchase and sale transactions are explained. A 'conditions precedent' was defined as being something which must happen before an interest can vest or grow or before an obligation can be performed. Vendors and purchasers use conditions precedent to provide protection against having to conclude a transaction in circumstances that are not acceptable to them. The manner in which indemnity provisions in an oil and gas purchase and sale agreement work, is also explained. These usually relate to breaches of the contract by either vendors or purchasers. Indemnity clauses are used to allocate risk between the vendor and the purchaser and to set out the mechanics by which either party may make a claim against the other. Ways in which to prepare indemnity clauses are described. 2 refs

  5. Nonprice terms and conditions

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    In this and the following chapter the authors review some of the more common provisions contained in wheeling contracts. Here they discuss nonprice terms and conditions. In the next chapter they look at the manner in which they address the pricing issue. At the outset one should note that there is a relationship between price and nonprice terms and condition. A couple of the provisions discussed here affect the risks incurred by the wheeling utility and the price it may charge for that service. These provisions include the length of the contract, the degree to which service can be interrupted and the ability to terminate the contract early, among others. These provisions are often characterized as nonprice terms and conditions. In reality, however, these factors have a direct bearing on the overall cost of wheeling services provided

  6. Lossless conditional schema evolution

    DEFF Research Database (Denmark)

    Jensen, Ole Guttorm; Böhlen, Michael

    2004-01-01

    is a precondition for a flexible semantics that allows to correctly answer general queries over evolving schemas. The key challenge is to handle attribute mismatches between the intended and recorded schema in a consistent way. We provide a parametric approach to resolve mismatches according to the needs......Conditional schema changes change the schema of the tuples that satisfy the change condition. When the schema of a relation changes some tuples may no longer fit the current schema. Handling the mismatch between the intended schema of tuples and the recorded schema of tuples is at the core...... of a DBMS that supports schema evolution. We propose to keep track of schema mismatches at the level of individual tuples, and prove that evolving schemas with conditional schema changes, in contrast to database systems relying on data migration, are lossless when the schema evolves. The lossless property...

  7. Stochastic conditional intensity processes

    DEFF Research Database (Denmark)

    Bauwens, Luc; Hautsch, Nikolaus

    2006-01-01

    model allows for a wide range of (cross-)autocorrelation structures in multivariate point processes. The model is estimated by simulated maximum likelihood (SML) using the efficient importance sampling (EIS) technique. By modeling price intensities based on NYSE trading, we provide significant evidence......In this article, we introduce the so-called stochastic conditional intensity (SCI) model by extending Russell’s (1999) autoregressive conditional intensity (ACI) model by a latent common dynamic factor that jointly drives the individual intensity components. We show by simulations that the proposed...... for a joint latent factor and show that its inclusion allows for an improved and more parsimonious specification of the multivariate intensity process...

  8. Electronic signal conditioning

    CERN Document Server

    NEWBY, BRUCE

    1994-01-01

    At technician level, brief references to signal conditioning crop up in a fragmented way in various textbooks, but there has been no single textbook, until now!More advanced texts do exist but they are more mathematical and presuppose a higher level of understanding of electronics and statistics. Electronic Signal Conditioning is designed for HNC/D students and City & Guilds Electronics Servicing 2240 Parts 2 & 3. It will also be useful for BTEC National, Advanced GNVQ, A-level electronics and introductory courses at degree level.

  9. Probabilistic conditional independence structures

    CERN Document Server

    Studeny, Milan

    2005-01-01

    Probabilistic Conditional Independence Structures provides the mathematical description of probabilistic conditional independence structures; the author uses non-graphical methods of their description, and takes an algebraic approach.The monograph presents the methods of structural imsets and supermodular functions, and deals with independence implication and equivalence of structural imsets.Motivation, mathematical foundations and areas of application are included, and a rough overview of graphical methods is also given.In particular, the author has been careful to use suitable terminology, and presents the work so that it will be understood by both statisticians, and by researchers in artificial intelligence.The necessary elementary mathematical notions are recalled in an appendix.

  10. Conditioning experiences and phobias

    NARCIS (Netherlands)

    Merckelbach, H.; de Ruiter, C.; van den Hout, M.A.; Hoekstra, R.

    1989-01-01

    A retrospective study was conducted to examine the extent to which phobias are associated with a conditioning pathway to fear. The Phobic Origin Questionnaire (Öst and Hugdahl, Behav. Res. Ther. 19, 439-477, 1981) was administered to a sample of 91 phobic outpatients (patients with panic disorder

  11. PERIODONTAL CONDITIONS IN EUROPE

    NARCIS (Netherlands)

    PILOT, T; MIYAZAKI, H

    The aim of the present overview is to evaluate the periodontal conditions in European populations. Study was made of a number of extensive surveys of periodontal diseases carried out in a number of European countries, primarily North West Europe. These surveys often provide considerable detail.

  12. Sufficiency of Bell's conditions

    Energy Technology Data Exchange (ETDEWEB)

    Gutkowski, D; Masotto, G [Istituto di Matematica della Universita di Palermo (Italy); Valdes, M V

    1979-04-11

    It is shown that, if the results of measurements of spin components of two-spin one-half particles coupled to a singlet state with respect to n=3 directions satisfy Bell's conditions, then these results are compatible with a local hidden-variable theory. The previous statement is extended to the case n=4.

  13. Benign Breast Conditions

    Science.gov (United States)

    ... breast condition refers to a lump, cyst, or nipple discharge (fluid) of the female or male breast that is not cancerous. There are numerous ... Intraductal papillomas. Small tumors can form in your nipple’s milk ducts. ... These are rare in men. Men do have undeveloped milk ducts. The most ...

  14. A Tourism Conditions Index

    NARCIS (Netherlands)

    C-L. Chang (Chia-Lin); H-K. Hsu (Hui-Kuang); M.J. McAleer (Michael)

    2014-01-01

    markdownabstract__Abstract__ This paper uses monthly data from April 2005 to August 2013 for Taiwan to propose a novel tourism indicator, namely the Tourism Conditions Index (TCI). TCI accounts for the spillover weights based on the Granger causality test and estimates of the multivariate BEKK

  15. Teachers and Operant Conditioning.

    Science.gov (United States)

    Frey, Sherman

    A survey was conducted of 406 elementary, middle, and secondary school teachers to determine their understanding, acceptance, and use of the principle of operant conditioning. The treatment of data was by percent and chi square analysis primarily according to sex, experience, degree, and position. Subjects reported that a) they believed that the…

  16. Operant Conditioning - Token Economy.

    Science.gov (United States)

    Montgomery, Jacqueline; McBurney, Raymond D.

    Described is an Operant Conditioning-Token Economy Program, teaching patients to be responsible for their own behavior, to make choices, and to be motivated to change. The program was instigated with mentally ill patients in a state hospital and was later used with institutionalized mentally handicapped groups. After two years, only four of the…

  17. International Workshop on Operator Theory and Applications

    CERN Document Server

    Jacob, Birgit; Ran, André; Zwart, Hans

    2016-01-01

    This volume collects a selected number of papers presented at the International Workshop on Operator Theory and its Applications (IWOTA) held in July 2014 at Vrije Universiteit in Amsterdam. Main developments in the broad area of operator theory are covered, with special emphasis on applications to science and engineering. The volume also presents papers dedicated to the eightieth birthday of Damir Arov and to the sixty-fifth birthday of Leiba Rodman, both leading figures in the area of operator theory and its applications, in particular, to systems theory.

  18. Towards the sustainable energy system. The future of the transition policy for energy and environment

    International Nuclear Information System (INIS)

    Bruggink, J.J.C.

    2006-11-01

    Inaugural speech at the occasion of the acceptance of the office for Energy Transition and Sustainable Development at the Faculty of Earth and Life Sciences of the Vrije Universiteit in Amsterdam, Netherlands, November 21, 2006. The transition policy in the Netherlands towards a sustainable energy supply system succeeded in creating a basis in the Dutch society, although at the cost of making clear choices with regard to concrete projects, new policy tools and financial means. In order to accelerate those choices the Dutch government needs to take decisive measures [nl

  19. On the Computation of Finite Invariant Sets of Mappings.

    Science.gov (United States)

    1988-02-01

    for the calculation of such invariant cycles. We refer here only to Doedel [1], looss et al [3], Kevrekidis et al [4], Van Veldhuizen ,[6], where further... van Veldhuizen , On Polygonal Approximations of an Invariant Curve, Dept.of Mathem. and Comp. Science, Vrije Universiteit Amsterdam, Techni- cal Report 1987, Math. Comp. to appear DATE Fl .LMED ...of van der Pol’s equation " x2) x - A(l - x ) X’ + x - 0 (16) As shown, for example in [2], the solution satisfies x - 2 cos(wt)+ A (0.75 sin(wt

  20. Cost effectiveness of the Dutch incentive for the environmental quality of power generation (MEP)

    International Nuclear Information System (INIS)

    Melgerd, R.

    2005-01-01

    This article relates to research on the cost effectiveness of the MEP scheme ('Milieukwaliteit Elektriciteitsproductie' or Environmental Quality of Electricity Generation), carried out as a graduation project at the Vrije Universiteit, Amsterdam, Netherlands. MEP subsidies are intended to promote investment in sustainable energy sources in the Netherlands by offering investors more certainty and a simpler structure than previous energy subsidies. The MEP also helps prevent Dutch taxpayers' money 'leaking' abroad to purchase sustainable electricity produced cheaper elsewhere. This makes the MEP measurably more effective than its predecessors. The scheme is moreover a step towards the effective deployment of state funds for the reduction of CO2 emission [nl

  1. Persistent facial pain conditions

    DEFF Research Database (Denmark)

    Forssell, Heli; Alstergren, Per; Bakke, Merete

    2016-01-01

    Persistent facial pains, especially temporomandibular disorders (TMD), are common conditions. As dentists are responsible for the treatment of most of these disorders, up-to date knowledge on the latest advances in the field is essential for successful diagnosis and management. The review covers...... TMD, and different neuropathic or putative neuropathic facial pains such as persistent idiopathic facial pain and atypical odontalgia, trigeminal neuralgia and painful posttraumatic trigeminal neuropathy. The article presents an overview of TMD pain as a biopsychosocial condition, its prevalence......, clinical features, consequences, central and peripheral mechanisms, diagnostic criteria (DC/TMD), and principles of management. For each of the neuropathic facial pain entities, the definitions, prevalence, clinical features, and diagnostics are described. The current understanding of the pathophysiology...

  2. Time, rate, and conditioning.

    Science.gov (United States)

    Gallistel, C R; Gibbon, J

    2000-04-01

    The authors draw together and develop previous timing models for a broad range of conditioning phenomena to reveal their common conceptual foundations: First, conditioning depends on the learning of the temporal intervals between events and the reciprocals of these intervals, the rates of event occurrence. Second, remembered intervals and rates translate into observed behavior through decision processes whose structure is adapted to noise in the decision variables. The noise and the uncertainties consequent on it have both subjective and objective origins. A third feature of these models is their timescale invariance, which the authors argue is a very important property evident in the available experimental data. This conceptual framework is similar to the psychophysical conceptual framework in which contemporary models of sensory processing are rooted. The authors contrast it with the associative conceptual framework.

  3. Children's proximal societal conditions

    DEFF Research Database (Denmark)

    Stanek, Anja Hvidtfeldt

    2018-01-01

    that is above or outside the institutional setting or the children’s everyday life, but something that is represented through societal structures and actual persons participating (in political ways) within the institutional settings, in ways that has meaning to children’s possibilities to participate, learn...... and develop. Understanding school or kindergarten as (part of) the children’s proximal societal conditions for development and learning, means for instance that considerations about an inclusive agenda are no longer simply thoughts about the school – for economic reasons – having space for as many pupils...... as possible (schools for all). Such thoughts can be supplemented by reflections about which version of ‘the societal’ we wish to present our children with, and which version of ‘the societal’ we wish to set up as the condition for children’s participation and development. The point is to clarify or sharpen...

  4. Baseline conditions at Olkiluoto

    International Nuclear Information System (INIS)

    2003-09-01

    The main purpose of this report is to establish a reference point - defined as the data collected up until the end of year 2002 - for the coming phases of the Finnish spent nuclear fuel disposal programme. The focus is: to define the current surface and underground conditions at the site, both as regards the properties for which a change is expected and for the properties which are of particular interest for long-term safety or environmental impact; to establish, as far as possible, the natural fluctuation of properties that are potentially affected by construction of the underground laboratory, the ONKALO, and to provide references to data on parameters or use in model development and testing and to use models to assist in understanding and interpreting the data. The emphasis of the baseline description is on bedrock characteristics that are relevant to the long-term safety of a spent fuel repository and, hence, to include the hydrogeological, hydrogeochemical, rock mechanical, tectonic and seismic conditions of the site. The construction of the ONKALO will also affect some conditions on the surface, and, therefore, a description of the main characteristics of the nature and the man-made constructions at Olkiluoto is also given. This report is primarily a road map to the available information on the prevailing conditions at the Olkiluoto site and a framework for understanding of data collected. Hence, it refers to numerous available background reports and other archived information produced over the past 20 years or more, and forms a recapitulation and revaluation of the characterisation data of the Olkiluoto site. (orig.)

  5. Retrocausality and conditional probability

    International Nuclear Information System (INIS)

    Stuart, C.I.J.M.

    1989-01-01

    Costa de Beauregard has proposed that physical causality be identified with conditional probability. The proposal is shown to be vulnerable on two accounts. The first, though mathematically trivial, seems to be decisive so far as the current formulation of the proposal is concerned. The second lies in a physical inconsistency which seems to have its source in a Copenhagenlike disavowal of realism in quantum mechanics. 6 refs. (Author)

  6. On conditional decomposability

    Czech Academy of Sciences Publication Activity Database

    Komenda, Jan; Masopust, Tomáš; van Schuppen, J. H.

    2012-01-01

    Roč. 61, č. 12 (2012), s. 1260-1268 ISSN 0167-6911 R&D Projects: GA ČR(CZ) GPP202/11/P028; GA ČR(CZ) GAP103/11/0517 Institutional support: RVO:67985840 Keywords : discrete-event system * coordination control * conditional decomposability Subject RIV: BA - General Mathematics Impact factor: 1.667, year: 2012 http://www.sciencedirect.com/science/article/pii/S0167691112001612

  7. Conditional Belief Types

    Science.gov (United States)

    2016-04-19

    Rationality of a player is determined by comparing her actual expected payoff to her expected payoff when her strategy is changed , while her beliefs —and...reduced strategies, and it is possible that under such conditions, beliefs about other players’ reduced strategies change as well. Thus, independence...assumptions, whether they concern observability of moves or subjective beliefs of any other kind, can be all accommodated by changing the informational

  8. Decontamination and winter conditions

    International Nuclear Information System (INIS)

    Quenild, C.; Tveten, U.

    1984-12-01

    The report deals with two decontamonation experiments under winter conditions. A snow-covered parking lot was contaminated, and the snow was subsequently removed using standard snow-moving equipment. The snow left behind was collected and the content of contaminant was determined. A non-radioactive contaminant was used. A decontamination factor exceeding 100 was obtained. Although the eksperimental conditions were close to ideal, it is reason to believe that extremely efficient removal of deposited materials on a snow surface is achivable. In another investigation, run-off from agricultural surface, contaminated while covered with snow, was measured A lycimeter was used in this experiment. A stable layer of ice and snow was allowed to form before contamination. The run-off water was collected at each thaw period until all snow and ice was gone. Cs-134 was used as contaminant. Roughly 30% of the Cs-134 with which the area was contaminated ran off with the melt water. Following a reactor accident situation, this would have given a corresponding reduction in the long term doses. Both of these experiments show that consequence calculation assumptions, as they are currently applied to large accident assessment, tend to overestimate the consequences resulting from accidents taking place under winter conditions

  9. Plasma focus matching conditions

    International Nuclear Information System (INIS)

    Soliman, H.M.; Masoud, M.M.; Elkhalafawy, T.A.

    1988-01-01

    A snow-plough and slug models have been used to obtain the optimum matching conditions of the plasma in the focus. The dimensions of the plasma focus device are, inner electrode radius = 2 cm, outer electrode radius = 5.5 cm, and its length = 8 cm. It was found that the maximum magnetic energy of 12.26 kJ has to be delivered to plasma focus whose density is 10 19 /cm 3 at focusing time of 2.55 μs and with total external inductance of 24.2 n H. The same method is used to evaluate the optimum matching conditions for the previous coaxial discharge system which had inner electrode radius = 1.6 cm, outer electrode radius = 3.3 cm and its length = 31.5 cm. These conditions are charging voltage = 12 kV, capacity of the condenser bank = 430 μf, plasma focus density = 10 19 /cm 3 focusing time = 8 μs and total external inductance = 60.32 n H.3 fig., 2 tab

  10. Pathologic conditions in pregnancy

    International Nuclear Information System (INIS)

    Beomonte Zobel, B.; Tella, S.; Innacoli, M.; D'Archivio, C.; Cardone, G.; Masciocchi, C.; Gallucci, M.; Passariello, R.; Cappa, F.

    1991-01-01

    Soma authors suggested that MR imaging could rapresent an effective diagnostic alternative in the study of pathologic conditions of mother and fetus during pregnancy. To verify the actual role of MR imaging, we examined 20 patients in the 2nd and 3rd trimester of gestation, after a preliminary US examination. Fifteen patients presented fetal or placental pathologies; in 4 patients the onset of the pathologic condition occurred during pregnancy; in 1 case of US diagnosis of fetal ascites, MR findings were nornal and the newborn was healty. As for placental pathologies, our series included a case of placental cyst, two hematomas between placenta and uterine wall, and two cases of partial placenta previa. As for fetal malformation, we evaluated a case of omphalocele, one of Prune-Belly syndrome, a case of femoral asimmetry, one of thanatophoric dwarfism, a case of thoracopagus twins with cardiovascular abnormalities, two fetal hydrocephali, and three cases of pyelo-ureteral stenosis. As for maternal pathologies during pregnancy, we observed a case of subserous uterine fibromyoma, one of of right hydronephrosis, one of protrusion of lumbar invertebral disk, and a large ovarian cyst. In our experience, MR imaging exhibited high sensitivity and a large field of view, which were both useful in the investigation of the different conditions occurring during pregnancy. In the evaluation of fetal and placental abnormalities, especially during the 3rd trimester, the diagnostic yieldof MR imaging suggested it as a complementary technique to US for the evaluation of fetal malformation and of intrauterine growth retardation

  11. Malformations of the axial skeleton in the museum Vrolik: II: craniosynostoses and suture-related conditions

    NARCIS (Netherlands)

    Oostra, Roelof-Jan; van der Wolk, Sander; Maas, Mario; Hennekam, Raoul C. M.

    2005-01-01

    The Museum Vrolik collection of anatomical specimens in Amsterdam, The Netherlands, comprises over 5,000 specimens of human and animal anatomy, embryology, pathology, and congenital anomalies. Recently, we rediagnosed a subset of the collection comprising dried infantile, juvenile, and adult human

  12. MRI of vaginal conditions

    International Nuclear Information System (INIS)

    Lopez, C.; Balogun, M.; Ganesan, R.; Olliff, J.F.

    2005-01-01

    Magnetic resonance imaging (MRI) has become an important part of the assessment of suspected vaginal pathology. This pictorial review demonstrates the MRI features and some of the histopathological findings of a variety of vaginal conditions. These may be congenital (total vaginal agenesis, partial vaginal agenesis, longitudinal vaginal septum, transverse vaginal septum), benign (Bartholin's cyst, diffuse vaginal inflammation, invasive endometriosis, ureterovaginal fistula, post-surgical appearances with the formation of a neovagina and adhesions) or malignant, usually due to extension or recurrence from another pelvic malignancy. In this paper, examples of the above are described and illustrated together with examples of the much rarer primary vaginal malignancies

  13. Learning conditional Gaussian networks

    DEFF Research Database (Denmark)

    Bøttcher, Susanne Gammelgaard

    This paper considers conditional Gaussian networks. The parameters in the network are learned by using conjugate Bayesian analysis. As conjugate local priors, we apply the Dirichlet distribution for discrete variables and the Gaussian-inverse gamma distribution for continuous variables, given...... a configuration of the discrete parents. We assume parameter independence and complete data. Further, to learn the structure of the network, the network score is deduced. We then develop a local master prior procedure, for deriving parameter priors in these networks. This procedure satisfies parameter...... independence, parameter modularity and likelihood equivalence. Bayes factors to be used in model search are introduced. Finally the methods derived are illustrated by a simple example....

  14. MRI of vaginal conditions

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, C. [Department of Radiology, Birmingham Women' s Hospital, Birmingham (United Kingdom)]. E-mail: carolina.lopez@bwhct.nhs.uk; Balogun, M. [Department of Radiology, Birmingham Women' s Hospital, Birmingham (United Kingdom); Ganesan, R. [Department of Histopathology, Birmingham Women' s Hospital, Birmingham (United Kingdom); Olliff, J.F. [University Hospital Birmingham, Birmingham (United Kingdom)

    2005-06-01

    Magnetic resonance imaging (MRI) has become an important part of the assessment of suspected vaginal pathology. This pictorial review demonstrates the MRI features and some of the histopathological findings of a variety of vaginal conditions. These may be congenital (total vaginal agenesis, partial vaginal agenesis, longitudinal vaginal septum, transverse vaginal septum), benign (Bartholin's cyst, diffuse vaginal inflammation, invasive endometriosis, ureterovaginal fistula, post-surgical appearances with the formation of a neovagina and adhesions) or malignant, usually due to extension or recurrence from another pelvic malignancy. In this paper, examples of the above are described and illustrated together with examples of the much rarer primary vaginal malignancies.

  15. Efficacy of Cognitive Behavioral Therapy for Insomnia in Adolescents: A Randomized Controlled Trial with Internet Therapy, Group Therapy and A Waiting List Condition.

    Science.gov (United States)

    de Bruin, Eduard J; Bögels, Susan M; Oort, Frans J; Meijer, Anne Marie

    2015-12-01

    To investigate the efficacy of cognitive behavioral therapy for insomnia (CBTI) in adolescents. A randomized controlled trial of CBTI in group therapy (GT), guided internet therapy (IT), and a waiting list (WL), with assessments at baseline, directly after treatment (post-test), and at 2 months follow-up. Diagnostic interviews were held at the laboratory of the Research Institute of Child Development and Education at the University of Amsterdam. Treatment for GT occurred at the mental health care center UvAMinds in Amsterdam, the Netherlands. One hundred sixteen adolescents (mean age = 15.6 y, SD = 1.6 y, 25% males) meeting DSM-IV criteria for insomnia, were randomized to IT, GT, or WL. CBTI of 6 weekly sessions, consisted of psychoeducation, sleep hygiene, restriction of time in bed, stimulus control, cognitive therapy, and relaxation techniques. GT was conducted in groups of 6 to 8 adolescents, guided by 2 trained sleep therapists. IT was applied through an online guided self-help website with programmed instructions and written feedback from a trained sleep therapist. Sleep was measured with actigraphy and sleep logs for 7 consecutive days. Symptoms of insomnia and chronic sleep reduction were measured with questionnaires. Results showed that adolescents in both IT and GT, compared to WL, improved significantly on sleep efficiency, sleep onset latency, wake after sleep onset, and total sleep time at post-test, and improvements were maintained at follow-up. Most of these improvements were found in both objective and subjective measures. Furthermore, insomnia complaints and symptoms of chronic sleep reduction also decreased significantly in both treatment conditions compared to WL. Effect sizes for improvements ranged from medium to large. A greater proportion of participants from the treatment conditions showed high end-state functioning and clinically significant improvement after treatment and at follow-up compared to WL. This study is the first randomized

  16. Conditional sterility in plants

    Science.gov (United States)

    Meagher, Richard B.; McKinney, Elizabeth; Kim, Tehryung

    2010-02-23

    The present disclosure provides methods, recombinant DNA molecules, recombinant host cells containing the DNA molecules, and transgenic plant cells, plant tissue and plants which contain and express at least one antisense or interference RNA specific for a thiamine biosynthetic coding sequence or a thiamine binding protein or a thiamine-degrading protein, wherein the RNA or thiamine binding protein is expressed under the regulatory control of a transcription regulatory sequence which directs expression in male and/or female reproductive tissue. These transgenic plants are conditionally sterile; i.e., they are fertile only in the presence of exogenous thiamine. Such plants are especially appropriate for use in the seed industry or in the environment, for example, for use in revegetation of contaminated soils or phytoremediation, especially when those transgenic plants also contain and express one or more chimeric genes which confer resistance to contaminants.

  17. Conditional Epistemic Planning

    DEFF Research Database (Denmark)

    Andersen, Mikkel Birkegaard; Bolander, Thomas; Jensen, Martin Holm

    2012-01-01

    Recent work has shown that Dynamic Epistemic Logic (DEL) offers a solid foundation for automated planning under partial observability and non-determinism. Under such circumstances, a plan must branch if it is to guarantee achieving the goal under all contingencies (strong planning). Without...... branching, plans can offer only the possibility of achieving the goal (weak planning). We show how to formulate planning in uncertain domains using DEL and give a language of conditional plans. Translating this language to standard DEL gives verification of both strong and weak plans via model checking....... In addition to plan verification, we provide a tableau-inspired algorithm for synthesising plans, and show this algorithm to be terminating, sound and complete....

  18. Remote Ischemic Conditioning

    Science.gov (United States)

    Heusch, Gerd; Bøtker, Hans Erik; Przyklenk, Karin; Redington, Andrew; Yellon, Derek

    2014-01-01

    In remote ischemic conditioning (RIC) brief, reversible episodes of ischemia with reperfusion in one vascular bed, tissue or organ confer a global protective phenotype and render remote tissues and organs resistant to ischemia/reperfusion injury. The peripheral stimulus can be chemical, mechanical or electrical and involves activation of peripheral sensory nerves. The signal transfer to the heart or other organs is through neuronal and humoral communications. Protection can be transferred, even across species, with plasma-derived dialysate and involves nitric oxide, stromal derived factor-1α, microRNA-144, but also other, not yet identified factors. Intracardiac signal transduction involves: adenosine, bradykinin, cytokines, and chemokines, which activate specific receptors; intracellular kinases; and mitochondrial function. RIC by repeated brief inflation/deflation of a blood pressure cuff protects against endothelial dysfunction and myocardial injury in percutaneous coronary interventions, coronary artery bypass grafting and reperfused acute myocardial infarction. RIC is safe and effective, noninvasive, easily feasible and inexpensive. PMID:25593060

  19. Initial Cladding Condition

    International Nuclear Information System (INIS)

    Siegmann, E.

    2000-01-01

    The purpose of this analysis is to describe the condition of commercial Zircaloy clad fuel as it is received at the Yucca Mountain Project (YMP) site. Most commercial nuclear fuel is encased in Zircaloy cladding. This analysis is developed to describe cladding degradation from the expected failure modes. This includes reactor operation impacts including incipient failures, potential degradation after reactor operation during spent fuel storage in pool and dry storage and impacts due to transportation. Degradation modes include cladding creep, and delayed hydride cracking during dry storage and transportation. Mechanical stresses from fuel handling and transportation vibrations are also included. This Analysis and Model Report (AMR) does not address any potential damage to assemblies that might occur at the YMP surface facilities. Ranges and uncertainties have been defined. This analysis will be the initial boundary condition for the analysis of cladding degradation inside the repository. In accordance with AP-2.13Q, ''Technical Product Development Planning'', a work plan (CRWMS M andO 2000c) was developed, issued, and utilized in the preparation of this document. There are constraints, caveats and limitations to this analysis. This cladding degradation analysis is based on commercial Pressurized Water Reactor (PWR) fuel with Zircaloy cladding but is applicable to Boiling Water Reactor (BWR) fuel. Reactor operating experience for both PWRs and BWRs is used to establish fuel reliability from reactor operation. It is limited to fuel exposed to normal operation and anticipated operational occurrences (i.e. events which are anticipated to occur within a reactor lifetime), and not to fuel that has been exposed to severe accidents. Fuel burnup projections have been limited to the current commercial reactor licensing environment with restrictions on fuel enrichment, oxide coating thickness and rod plenum pressures. The information provided in this analysis will be used in

  20. Magnetic conditioning in superfluid

    International Nuclear Information System (INIS)

    Caspi, S.

    1988-08-01

    Improvements in superconducting magnet technology have reduced to a handful the number of training quenches typical of dipole magnets. The number of training quenches in long (17 m) and short (1--2 m) SSC magnets are now about the same (operating at 6.6 tesla and 4.4 K). Yet the steps necessary to totally eliminate training are in the future RandD plans for magnet construction and conductor motion prevention. The accepted hypothesis is that Lorentz forces and poor mechanical properties of superconducting cables are the cause of conductor motion. Conductor motion reduces the stored energy in the cable by converting it into heat. The small amount of heat generated (millijoules) during motion is usually enough to quench the magnet when it is close to short sample. During training, the magnet performance normally improves with the number of quenches. It is not the quench itself that improves magnet performance but rather the fact that once conductor motion has occurred it will probably not repeat itself unless subjected to higher forces. Conditioning is a process that enables the magnet to reduce its stored energy without causing a premature quench. During the conditioning process the magnet is further cooled from its operating temperature of 4.4 K to 1.8 K by converting He I into He II. As a result the magnet is placed in a state where it has excess stability as well as excellent heat transfer capabilities. Although this does not eliminate motion, if the magnet is now cycled to /approximately/10% above its operating field at 4.4 K (which is above short sample) the excess stability should be enough to prevent quenching and reduce the probability of conductor motion and training once the magnet has been warmed back up to its operating temperature of 4.4 K. 3 refs., 5 figs

  1. Magnetic conditioning in superfluid

    Energy Technology Data Exchange (ETDEWEB)

    Caspi, S.

    1988-08-01

    Improvements in superconducting magnet technology have reduced to a handful the number of training quenches typical of dipole magnets. The number of training quenches in long (17 m) and short (1--2 m) SSC magnets are now about the same (operating at 6.6 tesla and 4.4 K). Yet the steps necessary to totally eliminate training are in the future RandD plans for magnet construction and conductor motion prevention. The accepted hypothesis is that Lorentz forces and poor mechanical properties of superconducting cables are the cause of conductor motion. Conductor motion reduces the stored energy in the cable by converting it into heat. The small amount of heat generated (millijoules) during motion is usually enough to quench the magnet when it is close to short sample. During training, the magnet performance normally improves with the number of quenches. It is not the quench itself that improves magnet performance but rather the fact that once conductor motion has occurred it will probably not repeat itself unless subjected to higher forces. Conditioning is a process that enables the magnet to reduce its stored energy without causing a premature quench. During the conditioning process the magnet is further cooled from its operating temperature of 4.4 K to 1.8 K by converting He I into He II. As a result the magnet is placed in a state where it has excess stability as well as excellent heat transfer capabilities. Although this does not eliminate motion, if the magnet is now cycled to /approximately/10% above its operating field at 4.4 K (which is above short sample) the excess stability should be enough to prevent quenching and reduce the probability of conductor motion and training once the magnet has been warmed back up to its operating temperature of 4.4 K. 3 refs., 5 figs.

  2. The Negated Conditional: A Litmus Test for the Suppositional Conditional?

    Science.gov (United States)

    Handley, Simon J.; Evans, Jonathan St. B. T.; Thompson, Valerie A.

    2006-01-01

    Under the suppositional account of conditionals, when people think about a conditional assertion, "if p then q," they engage in a mental simulation in which they imagine p holds and evaluate the probability that q holds under this supposition. One implication of this account is that belief in a conditional equates to conditional probability…

  3. Domotica Smart Living. Special issue; Domotica Slim Wonden. Themanummer

    Energy Technology Data Exchange (ETDEWEB)

    Lepelaars, L. [Stichting Smart Homes, eersel (Netherlands); Hamers, E. [Van Dorp Installaties, Zoetermeer (Netherlands); Van Mil, R.

    2011-10-15

    In a few articles (introduction, interview and 3 articles) attention is paid to domotica applications and smart living. The interview is with a professor 'ambient robotics' at the University of Amsterdam. The articles are about (1) the activities of the Smart Homes Foundation, (2) the use of domotica in the health and homecare sector, and (3) the use of domotica to improve comfort, safety and efficiency. [Dutch] In een paar artikelen (voorwoord, interview en 3 artikelen) wordt aandacht besteed aan domotica toepassingen en slim wonen. Het interview betreft een bijzonder hoogleraar 'ambient robotics aan de Universiteit van Amsterdam. De artikelen gaan over de activiteiten van de Stichting Smart Homes, (2) de toepassingen van domotica in de thuiszorg, en (3) het gebruik van domotica om het comfort, de veiligheid en energie efficiency te verbeteren.

  4. How Serious Do We Need to Be? Improving Information Literacy Skills through Gaming and Interactive Elements

    Directory of Open Access Journals (Sweden)

    Ana van Meegen

    2010-09-01

    Full Text Available Catching the attention of highly technologically and visually oriented students is a challenge for libraries. The number of students entering the universities is increasing and a face-to-face learning setting is an impossible mission for the few available subject librarians. This paper demonstrates how effective the use of serious game or other web-based interactive elements can be for teaching information literacy. By means of quasi-experimental research the impact that the game Saving Asia on students’ learning is analysed and compared to a web-based online tutorial of the Vrije Universiteit Amsterdam (Free University of Amsterdam. This research demonstrated that the game needs to be improved if it is to fit into the regular curriculum of the university, but interactive elements definitely improve learning results.

  5. Flue gas conditioning today

    Energy Technology Data Exchange (ETDEWEB)

    Southam, B.J.; Coe, E.L. Jr. [Wahlco Engineering International Ltd., Santa Ana, CA (United States)

    1995-12-01

    Many relatively small electrostatic precipitators (ESP`s) exist which collect fly ash at remarkably high efficiencies and have been tested consistently at correspondingly high migration velocities. But the majority of the world`s coal supplies produce ashes which are collected at much lower migration velocities for a given efficiency and therefore require correspondingly large specific collection areas to achieve acceptable results. Early trials of flue gas conditioning (FGC) showed benefits in maximizing ESP performance and minimizing expense which justified continued experimentation. Trials of several dozen ways of doing it wrong eventually developed a set of reliable rules for doing it right. One result is that the use of sulfur trioxide (SO{sub 3}) for adjustment of the resistivity of fly ash from low sulfur coal has been widely applied and has become an automatically accepted part of the option of burning low sulfur coal for compliance with the Clean Air Act of l990 in the U.S.A. Currently, over 100,000 MW of generating capacity is using FGC, and it is estimated that approximately 45,800 MW will utilize coal-switching with FGC for Clean Air Act emission compliance. Guarantees that this equipment will be available to operate at least 98 percent of the time it is called upon are routinely fulfilled.

  6. Design extension conditions

    Energy Technology Data Exchange (ETDEWEB)

    Bujor, A.; Harwood, C.; Lei, Q.; Viktorov, A., E-mail: christopher.harwood@cnsc-ccsn.gc.ca [Canadian Nuclear Safety Commission, Ottawa, Ontario (Canada)

    2013-07-01

    The CNSC has introduced the term Design Extension Conditions (DEC) in regulatory document RD-337 version 2, 'Design of New Nuclear Power Plants' which was issued for public consultation in July 2012. The primary drivers for this change compared with the earlier version of RD-337 are to maintain alignment with the equivalent International Atomic Energy Agency (IAEA) safety standard and to introduce changes resulting from lessons learned from the Fukushima Daiichi accident. RD-337 version 2 and the accompanying guidance document GD-337 establish high level design requirements and expectations for new Nuclear Power Plants (NPPs), including those pertaining to DEC. Other regulatory documents provide requirements for safety analysis and accident management as well as other aspect relevant to DEC. Nevertheless, the currently available guidance specific to DEC is not comprehensive, while the practices just begin to emerge. CNSC and industry stakeholders are actively discussing how the high level requirements and expectations will be applied in various fields. This paper is a summary of a CNSC discussion paper that is being developed to encourage substantive stakeholder discussions. The topic of DEC is being advanced rapidly both nationally and internationally. With this in mind, this paper does not intend to provide a final established position, but rather to stimulate discussion on the subject of DEC. This paper provides the definition of DEC, gives background information relating to the adoption of the term, describes the identification of DECs and the underlying principles associated with design, analysis, operational and procedural requirements. As described in this paper, DEC and associated requirements apply to new NPPs. Applicability to existing NPPs is also discussed. (author)

  7. Assessing the planet's condition.

    Science.gov (United States)

    Brown, L R

    1990-01-01

    The destruction of the environment has accelerated since the Earth Day of 1970, the world's population has increased by another 1.6 billion, and over 500 million acres of forest have been lost. Carbon dioxide levels, greenhouse gases, and chlorofluorocarbons have increased in the atmosphere with evidence that global warming has started. The ozone hole has appeared, acid rain has destroyed forests, air pollution in major northern hemisphere cities has worsened, and species are disappearing, while toxic chemicals have been dumped indiscriminately. World grain production has fallen while population has increased. In Europe 14 countries have stabilized their population, and Japan, France, and Finland are on the way to zero growth. Reduction of high fertility in 1/2 could halt the deterioration of living conditions. Japan and China achieved this within a decade. Energy efficiency has to be attained; US cars still consume too much gas. Solar energy with photovoltaic cells to provide power, fuel alcohol from plants, and solar thermal power plants have potential. Semiarid regions, such as northern Africa, could become major producers of solar energy. Various measures are mandatory to cut down on waste: to recycle paper bags, to use standardized glasses for beverages, and to utilize scrap metal in electric arc steel furnaces. Reforestation is also on the agenda, as major deforestation has occurred in the Brazilian Amazon region, in India, and in Europe because of acid rain. Australia's national plan envisions planting 1 billion trees, and the US project is of similar magnitude during the 1990s. Only the US has succeeded in erosion control and topsoil stabilization when it converted erodible cropland into grassland or woodland during 1986-90.

  8. Visualising Deteriorating Conditions

    Directory of Open Access Journals (Sweden)

    Tom Andrews, RN, B.Sc. (Hons, M.Sc., Ph.D.

    2005-03-01

    Full Text Available The research aims were to investigate the difficulties ward staff experienced in detecting deterioration and how these were resolved. The emphasis within the literature tends to be on identifying premonitory signs that may be useful in predicting deterioration. Changes in respiratory rate is the most consistent of these (Fieselmann et al. 1993; Sax and Charlson 1987; Schein et al. 1990; Smith and Wood 1998 but in common with other signs, it lacks sensitivity and specificity. The sample consisted of 44 nurses, doctors (Interns and health care support workers from a general medical and surgical ward. Data were collected by means of nonparticipant observations and interviews, using grounded theory as originated by (Glaser and Strauss 1967 and (Glaser 1978. As data were collected, the constant comparative method and theoretical sensitivity were used as outlined in grounded theory. A core category of “visualising deteriorating conditions” emerged, together with its sub-core categories of “intuitive knowing”, “baselining” and “grabbing attention”.The main concern in visualising deteriorating conditions is to ensure that patients suspected of deterioration are successfully referred to medical staff. The aim is to convince those who can treat or prevent further deterioration to intervene. Through intuitive knowing they pick up that patients have changed in a way that requires a medical assessment. To make the referral more credible, nurses attempt to contextualise any changes in patients by baselining (establishing baselines. Finally with the backup of colleagues, nurses refer patients by providing as much persuasive information as possible in a way that grabs attention. The whole process is facilitated by knowledge and experience, together with mutual trust and respect.

  9. Toward a Global Consensus on Outcome Measures for Clinical Trials in Tinnitus: Report From the First International Meeting of the COMiT Initiative, November 14, 2014, Amsterdam, The Netherlands

    Directory of Open Access Journals (Sweden)

    Deborah A. Hall

    2015-04-01

    Full Text Available In Europe alone, over 70 million people experience tinnitus; for seven million people, it creates a debilitating condition. Despite its enormous socioeconomic relevance, progress in successfully treating the condition is somewhat limited. The European Union has approved funding to create a pan-European tinnitus research collaboration network (2014–2018. The goal of one working group is to establish an international standard for outcome measurements in clinical trials of tinnitus. Importantly, this would enhance tinnitus research by informing sample-size calculations, enabling meta-analyses, and facilitating the identification of tinnitus subtypes, ultimately leading to improved treatments. The first meeting followed a workshop on “Agreed Standards for Measurement: An International Perspective” with invited talks on clinimetrics and existing international initiatives to define core sets for outcome measurements in hearing loss (International classification of functioning, disability, and health core sets for hearing loss and eczema (Harmonizing outcome measures for eczema. Both initiatives have taken an approach that clearly distinguishes the specification of what to measure from that of how to measure it. Meeting delegates agreed on taking a step-wise roadmap for which the first output would be a consensus on what outcome domains are essential for all trials. The working group seeks to embrace inclusivity and brings together clinicians, tinnitus researchers, experts on clinical research methodology, statisticians, and representatives of the health industry. People who experience tinnitus are another important participant group. This meeting report is a call to those stakeholders across the globe to actively participate in the initiative.

  10. ’n Veranderende benadering tot sosiale verantwoordelikheid: ’n histories-normatiewe gevallestudie oor die Noordwes-Universiteit (Potchefstroomkampus

    Directory of Open Access Journals (Sweden)

    E.M. Kloppers

    2009-07-01

    Full Text Available A changing approach to social responsibility: a historic-normative case study of the North-West University (Potchefstroom Campus As a direct consequence of its Christian character, the former Potchefstroom University for Christian Higher Education (PU for CHE engaged in local corporate responsibility programmes for a number of decades. When the PU for CHE was merged at the end of 2003 to become the North-West University (NWU (including the PU for CHE which emerged in 2004, these programmes continued at the Potchefstroom Campus, but were stripped of their Christian grounding. Now the University has a “value-driven” approach. This article tracks the changes to the normative character as well as the continued changes to the university’s position on social responsibility. It was found that the North-West University’s normative points of departure have yet to be linked clearly to its community activities, and that formal corporate social responsibility (CSR activities must be clearly differentiated from normal university business as well as student activities such as rag. It is argued that the problematic overlapping of profit-generating activities should be distinguished from all CSR programmes and the contribution of sponsors disclosed at all times. Developments late in 2008 seemed to indicate that some of the most important problem areas be addressed when a new approach to “community engagement” is fleshed out. This could result in the NWU achieving the CSR goals set by both government and the University itself regarding its so-called do-values and developing a guiding philosophy on “community en-gagement”.

  11. Technische universiteiten en duurzame ontwikkeling in Afrika : Een interfacultair studenten onderzoeksproject voor het 33e lustrumsymposium van de Technische Universiteit Delft

    NARCIS (Netherlands)

    Duijvestein, C.A.J.; de Vries, G.; Bos, M.; Cozijnse, K.; Findlater, J.W.; Fremouw, M.; Jonkman, J.; Oijevaar, K.; Peters, S.; van Rattinghe, K.; Sack-van Straaten, K.; De Vries, G.; Wessels, R.

    2007-01-01

    In 2007, Delft University of Technology celebrates its 165th birthday. This unique occasion is celebrated with several activities revolving around the subject "Sustainable Solutions, with a focus on Africa". For the interdisciplinary course "Technical Universities and Sustainable development of

  12. Epigenetics in adaptive evolution and development: the interplay between evolving species and epigenetic mechanisms: extract from Trygve Tollefsbol (ed.) (2011) Handbook of epigenetics--the new molecular and medical genetics. Chapter 26. Amsterdam, USA: Elsevier, pp. 423-446.

    Science.gov (United States)

    House, Simon H

    2013-04-01

    By comparing epigenetics of current species with fossil records across evolutionary transitions, we can gauge the moment of emergence of some novel mechanisms in evolution, and recognize that epigenetic mechanisms have a bearing on mutation. Understanding the complexity and changeability of these mechanisms, as well as the changes they can effect, is both fascinating and of vital practical benefit. Our most serious pandemics of so-called 'non-communicable' diseases - mental and cardiovascular disorders, obesity and diabetes, rooted in the 'metabolic syndrome' - are evidently related to effects on our evolutionary mechanisms of agricultural and food industrialization, modern lifestyle and diet. Pollution affects us directly as well as indirectly by its destruction of ecologically essential biosystems. Evidently such powerful conditions of existence have epigenetic effects on both our health and our continuing evolution. Such effects are most profound during reproductive and developmental processes, when levels of hormones, as affected by stress particularly, may be due to modern cultures in childbearing such as excessive intervention, separation, maternal distress and disruption of bonding. Mechanisms of genomic imprinting seem likely to throw light on problems in assisted reproductive technology, among other transgenerational effects. © The Author(s) 2014.

  13. Acute vs. chronic conditions (image)

    Science.gov (United States)

    ... describe anything from a broken bone to an asthma attack. A chronic condition, by contrast is a long- ... a broken bone, an acute condition. An acute asthma attack occurs in the midst of the chronic disease ...

  14. Klinefelter Syndrome (KS): Condition Information

    Science.gov (United States)

    ... Condition Information Share Facebook Twitter Pinterest Email Print Klinefelter Syndrome (KS): Condition Information What is KS? The term " ... such as XXYY. This is called poly-X Klinefelter syndrome, and it causes more severe symptoms. 1 Klinefelter, ...

  15. Energy conditions and spacetime singularities

    International Nuclear Information System (INIS)

    Tipler, F.J.

    1978-01-01

    In this paper, a number of theorems are proven which collectively show that singularities will occur in spacetime under weaker energy conditions than the strong energy condition. In particular, the Penrose theorem, which uses only the weak energy condition but which applies only to open universes, is extended to all closed universes which have a Cauchy surface whose universal covering manifold is not a three-sphere. Furthermore, it is shown that the strong energy condition in the Hawking-Penrose theorem can be replaced by the weak energy condition and the assumption that the strong energy condition holds only on the average. In addition, it is demonstrated that if the Universe is closed, then the existence of singularities follows from the averaged strong energy condition alone. It is argued that any globally hyperbolic spacetime which satisfies the weak energy condition and which contains a black hole must be null geodesically incomplete

  16. Petroleum investment conditions in Peru

    International Nuclear Information System (INIS)

    Garcia Schreck, M.

    1996-01-01

    This report focuses on the current petroleum investment conditions in Peru, and Peru's hydrocarbon potential. Investment conditions are examined, and political risk, internal security, the economic environment, and the legal framework for investment are considered. (UK)

  17. Reconstruction of boundary conditions from internal conditions using viability theory

    KAUST Repository

    Hofleitner, Aude; Claudel, Christian G.; Bayen, Alexandre M.

    2012-01-01

    This article presents a method for reconstructing downstream boundary conditions to a HamiltonJacobi partial differential equation for which initial and upstream boundary conditions are prescribed as piecewise affine functions and an internal condition is prescribed as an affine function. Based on viability theory, we reconstruct the downstream boundary condition such that the solution of the Hamilton-Jacobi equation with the prescribed initial and upstream conditions and reconstructed downstream boundary condition satisfies the internal value condition. This work has important applications for estimation in flow networks with unknown capacity reductions. It is applied to urban traffic, to reconstruct signal timings and temporary capacity reductions at intersections, using Lagrangian sensing such as GPS devices onboard vehicles.

  18. Reconstruction of boundary conditions from internal conditions using viability theory

    KAUST Repository

    Hofleitner, Aude

    2012-06-01

    This article presents a method for reconstructing downstream boundary conditions to a HamiltonJacobi partial differential equation for which initial and upstream boundary conditions are prescribed as piecewise affine functions and an internal condition is prescribed as an affine function. Based on viability theory, we reconstruct the downstream boundary condition such that the solution of the Hamilton-Jacobi equation with the prescribed initial and upstream conditions and reconstructed downstream boundary condition satisfies the internal value condition. This work has important applications for estimation in flow networks with unknown capacity reductions. It is applied to urban traffic, to reconstruct signal timings and temporary capacity reductions at intersections, using Lagrangian sensing such as GPS devices onboard vehicles.

  19. Conditional cooperation on three continents

    NARCIS (Netherlands)

    Kocher, M.G.; Cherry, T.; Kroll, S.; Netzer, R.; Sutter, M.

    2007-01-01

    We show in a public goods experiment on three continents that conditional cooperation is a universal behavioral regularity. Yet, the number of conditional cooperators and the extent of conditional cooperation are much higher in the U.S.A. than anywhere else.

  20. Some remarks on conditional entropy

    NARCIS (Netherlands)

    Nijst, A.G.P.M.

    1969-01-01

    Using a definition of conditional entropy given by Hanen and Neveu [5, 10, 11] we discuss in this paper some properties of conditional entropy and mean entropy, in particular an integral representation of conditional entropy (§ 2), and the decomposition theorem of the KolmogorovSina¯i invariant (§

  1. PBL and the Postmodern Condition

    DEFF Research Database (Denmark)

    Ravn, Ole; Jensen, Annie Aarup

    2016-01-01

    . Through discussions of this alleged condition for university curricula development we investigate its connections to the PBL-model. Some of the explored conditions highlight strong potentials for the PBL-model but the postmodern condition also raises a number of changes and challenges in relation...... to the original PBL-model as an educational setting....

  2. Operant Conditioning for Special Educators.

    Science.gov (United States)

    Pedrini, Bonnie C.; Pedrini, D. T.

    The paper briefly explains operant conditioning as it pertains to special educators. Operant conditioning is thought to be an efficient method for modifying student behavior. Using the B. F. Skinner frame of reference, operant conditioning is said to include behavior modification and therapy, programed instruction, and computer assisted and…

  3. Bayesian Sampling using Condition Indicators

    DEFF Research Database (Denmark)

    Faber, Michael H.; Sørensen, John Dalsgaard

    2002-01-01

    of condition indicators introduced by Benjamin and Cornell (1970) a Bayesian approach to quality control is formulated. The formulation is then extended to the case where the quality control is based on sampling of indirect information about the condition of the components, i.e. condition indicators...

  4. Serotonin and conditioning: focus on Pavlovian psychostimulant drug conditioning.

    Science.gov (United States)

    Carey, Robert J; Damianopoulos, Ernest N

    2015-04-01

    Serotonin containing neurons are located in nuclei deep in the brainstem and send axons throughout the central nervous system from the spinal cord to the cerebral cortex. The vast scope of these connections and interactions enable serotonin and serotonin analogs to have profound effects upon sensory/motor processes. In that conditioning represents a neuroplastic process that leads to new sensory/motor connections, it is apparent that the serotonin system has the potential for a critical role in conditioning. In this article we review the basics of conditioning as well as the serotonergic system and point up the number of non-associative ways in which manipulations of serotonin neurotransmission have an impact upon conditioning. We focus upon psychostimulant drug conditioning and review the contribution of drug stimuli in the use of serotonin drugs to investigate drug conditioning and the important impact drug stimuli can have on conditioning by introducing new sensory stimuli that can create or mask a CS. We also review the ways in which experimental manipulations of serotonin can disrupt conditioned behavioral effects but not the associative processes in conditioning. In addition, we propose the use of the recently developed memory re-consolidation model of conditioning as an approach to assess the possible role of serotonin in associative processes without the complexities of performance effects related to serotonin treatment induced alterations in sensory/motor systems. Copyright © 2014 Elsevier B.V. All rights reserved.

  5. Evaluative conditioning of food technologies

    DEFF Research Database (Denmark)

    Loebnitz, Natascha; Grunert, Klaus G

    2015-01-01

    Consumer attitudes play an important role in the acceptance of new technologies. The success of food innovations depends on understanding how consumers form and change attitudes toward food technologies. Earlier post hoc explanations suggest that evaluative conditioning can change consumer...... attitudes toward food technologies. The present study tests how evaluative conditioning can affect consumer acceptance of new food technologies. Furthermore, authors investigate whether evaluative conditioning is resistant to extinction after a two-month period and whether the evaluative conditioning effect...... prevails in a product-related context. Within an evaluative conditioning paradigm including between-subjects control groups in addition to standard within-subjects control conditions, participants were presented with three food technologies (conventional, enzyme, and genetic technology) paired...

  6. Evolutions of Yang Phase Under Cyclic Condition and Adiabatic Condition

    International Nuclear Information System (INIS)

    Qian Shangwu; Gu Zhiyu

    2005-01-01

    There are three non-integrable phases in literatures: Berry phase, Aharonov-Anandan phase, and Yang phase. This article discusses the evolutions of Yang phase under the cyclic condition and the adiabatic condition for the general time-dependent harmonic oscillator, thus reveals the intimate relations between these three non-integrable phases.

  7. Conditional Eddies in Plasma Turbulence

    DEFF Research Database (Denmark)

    Johnsen, H.; Pécseli, H.L.; Trulsen, J.

    1987-01-01

    Low‐frequency electrostatic turbulence generated by the ion–ion beam instability was investigated experimentally in a double‐plasma device. Real time signals were recorded and examined by a conditional statistical analysis. Conditionally averaged potential distributions reveal the formation...... and propagation of structures with a relatively long lifetime. Various methods for making a conditional analysis are discussed and compared. The results are discussed with reference to ion phase space vortices and clump formation in collisionless plasmas....

  8. Artificial changes of weather conditions

    International Nuclear Information System (INIS)

    Kozin, I.D.; Vasil'ev, I.V.; Fedulina, I.N.; Zakizhan, Z.Z.; Khalimov, R.A.

    2005-01-01

    Unfavorable weather conditions have undesirable ecological consequences, causes remarkable economical damage. In the paper authors consider physical factors and technical methods of influence on cloud formation. (author)

  9. Scaling of interfacial jump conditions

    International Nuclear Information System (INIS)

    Quezada G, S.; Vazquez R, A.; Espinosa P, G.

    2015-09-01

    To model the behavior of a nuclear reactor accurately is needed to have balance models that take into account the different phenomena occurring in the reactor. These balances have to be coupled together through boundary conditions. The boundary conditions have been studied and different treatments have been given to the interface. In this paper is a brief description of some of the interfacial jump conditions that have been proposed in recent years. Also, the scaling of an interfacial jump condition is proposed, for coupling the different materials that are in contact within a nuclear reactor. (Author)

  10. Improving World Agricultural Supply and Demand Estimates by Integrating NASA Remote Sensing Soil Moisture Data into USDA World Agricultural Outlook Board Decision Making Environment

    Science.gov (United States)

    Teng, W. L.; de Jeu, R. A.; Doraiswamy, P. C.; Kempler, S. J.; Shannon, H. D.

    2009-12-01

    A primary goal of the U.S. Department of Agriculture (USDA) is to expand markets for U.S. agricultural products and support global economic development. The USDA World Agricultural Outlook Board (WAOB) supports this goal by developing monthly World Agricultural Supply and Demand Estimates (WASDE) for the U.S. and major foreign producing countries. Because weather has a significant impact on crop progress, conditions, and production, WAOB prepares frequent agricultural weather assessments, in a GIS-based, Global Agricultural Decision Support Environment (GLADSE). The main objective of this project, thus, is to improve WAOB's estimates by integrating NASA remote sensing soil moisture observations and research results into GLADSE. Soil moisture is a primary data gap at WAOB. Soil moisture data, generated by the Land Parameter Retrieval Model (LPRM, developed by NASA GSFC and Vrije Universiteit Amsterdam) and customized to WAOB's requirements, will be directly integrated into GLADSE, as well as indirectly by first being integrated into USDA Agricultural Research Service (ARS)'s Environmental Policy Integrated Climate (EPIC) crop model. The LPRM-enhanced EPIC will be validated using three major agricultural regions important to WAOB and then integrated into GLADSE. Project benchmarking will be based on retrospective analyses of WAOB's analog year comparisons. The latter are between a given year and historical years with similar weather patterns. WAOB is the focal point for economic intelligence within the USDA. Thus, improving WAOB's agricultural estimates by integrating NASA satellite observations and model outputs will visibly demonstrate the value of NASA resources and maximize the societal benefits of NASA investments.

  11. Fixed or adapted conditioning intensity for repeated conditioned pain modulation.

    Science.gov (United States)

    Hoegh, M; Petersen, K K; Graven-Nielsen, T

    2017-12-29

    Aims Conditioned pain modulation (CPM) is used to assess descending pain modulation through a test stimulation (TS) and a conditioning stimulation (CS). Due to potential carry-over effects, sequential CPM paradigms might alter the intensity of the CS, which potentially can alter the CPM-effect. This study aimed to investigate the difference between a fixed and adaptive CS intensity on CPM-effect. Methods On the dominant leg of 20 healthy subjects the cuff pressure detection threshold (PDT) was recorded as TS and the pain tolerance threshold (PTT) was assessed on the non-dominant leg for estimating the CS. The difference in PDT before and during CS defined the CPM-effect. The CPM-effect was assessed four times using a CS with intensities of 70% of baseline PTT (fixed) or 70% of PTT measured throughout the session (adaptive). Pain intensity of the conditioning stimulus was assessed on a numeric rating scale (NRS). Data were analyzed with repeated-measures ANOVA. Results No difference was found comparing the four PDTs assessed before CSs for the fixed and the adaptive paradigms. The CS pressure intensity for the adaptive paradigm was increasing during the four repeated assessments (P CPM-effect was higher using the fixed condition compared with the adaptive condition (P CPM paradigms using a fixed conditioning stimulus produced an increased CPM-effect compared with adaptive and increasing conditioning intensities.

  12. 76 FR 14600 - Dental Conditions

    Science.gov (United States)

    2011-03-17

    ... qualify for VHA dental treatment, including any claim for treatment of periodontal disease or calculus... DEPARTMENT OF VETERANS AFFAIRS 38 CFR Part 3 RIN 2900-AN28 Dental Conditions AGENCY: Department of... its adjudication regulations regarding service connection of dental conditions for treatment purposes...

  13. Paranormal weighted conditional type operators

    OpenAIRE

    Estaremi, Yousef

    2014-01-01

    In this paper, some sub-classes of paranormal weighted conditional expectation type operators, such as *-paranormal, quasi-*-paranormal and (n; k)-quasi-*-paranormal weighted conditional expectation type opera- tors on $L^2(\\Sigma)$ are investigated. Also, some applications about the spectrum, point spectrum, joint point spectrum, approximate point spectrum and joint approximate point spectrum of these classes are presented.

  14. Loading Conditions and Longitudinal Strength

    DEFF Research Database (Denmark)

    Sørensen, Herman

    1995-01-01

    Methods for the calculation of the lightweight of the ship.Loading conditions satisfying draught, trim and intact stability requirements and analysis of the corresponding stillwater longitudinal strength.......Methods for the calculation of the lightweight of the ship.Loading conditions satisfying draught, trim and intact stability requirements and analysis of the corresponding stillwater longitudinal strength....

  15. 77 FR 4469 - Dental Conditions

    Science.gov (United States)

    2012-01-30

    ... DEPARTMENT OF VETERANS AFFAIRS 38 CFR Part 3 RIN 2900-AN28 Dental Conditions AGENCY: Department of... rule the proposal to amend its adjudication regulations regarding service connection of dental... Veterans Benefits Administration (VBA) for service connection of dental conditions for the purpose of...

  16. Conditional Eddies in Plasma Turbulence

    DEFF Research Database (Denmark)

    Johnsen, Helene; Pécseli, Hans; Trulsen, J.

    1986-01-01

    Conditional structures, or eddies, in turbulent flows are discussed with special attention to electrostatic turbulence in plasmas. The potential variation of these eddies is obtained by sampling the fluctuations only when a certain condition is satisfied in a reference point. The resulting...

  17. Sectoral profiles of working conditions

    NARCIS (Netherlands)

    Houtman, I.L.D.; Andries, F.; Berg, R. van den; Dhondt, S.

    2002-01-01

    This report looks at trends in working conditions across different sectors Over the period 1995-2000. Basing its findings on the Third European Survey on Working Conditions (2000) in the 15 EU Member States and Norway, it examines the quality of working life in eighteen different sectors. It

  18. Sectoral profiles of working conditions

    NARCIS (Netherlands)

    Houtman, I.L.D.; Parent-Thirion, A.

    2003-01-01

    This report looks at trends in working conditions across different sectors over a five-year period 1995-2000. Basing its findings on the Third European Survey on Working Conditions carried out by the Foundation in 2000 in the 15 EU Member States and Norway, it examines the quality of working life in

  19. Optimising Extinction of Conditioned Disgust

    NARCIS (Netherlands)

    Bosman, Renske C.; Borg, Charmaine; de Jong, Peter J.

    2016-01-01

    Maladaptive disgust responses are tenacious and resistant to exposure-based interventions. In a similar vein, laboratory studies have shown that conditioned disgust is relatively insensitive to Conditioned Stimulus (CS)-only extinction procedures. The relatively strong resistance to extinction might

  20. Condition based spare parts supply

    NARCIS (Netherlands)

    Lin, X.; Basten, Robertus Johannes Ida; Kranenburg, A.A.; van Houtum, Geert-Jan

    2012-01-01

    We consider a spare parts stock point that serves an installed base of machines. Each machine contains the same critical component, whose degradation behavior is described by a Markov process. We consider condition based spare parts supply, and show that an optimal, condition based inventory policy

  1. Initial conditions for chaotic inflation

    International Nuclear Information System (INIS)

    Brandenberger, R.; Kung, J.; Feldman, H.

    1991-01-01

    In contrast to many other inflationary Universe models, chaotic inflation does not depend on fine tuning initial conditions. Within the context of linear perturbation theory, it is shown that chaotic inflation is stable towards both metric and matter perturbations. Neglecting gravitational perturbations, it is shown that chaotic inflation is an attractor in initial condition space. (orig.)

  2. Jump conditions in transonic equilibria

    International Nuclear Information System (INIS)

    Guazzotto, L.; Betti, R.; Jardin, S. C.

    2013-01-01

    In the present paper, the numerical calculation of transonic equilibria, first introduced with the FLOW code in Guazzotto et al.[Phys. Plasmas 11, 604 (2004)], is critically reviewed. In particular, the necessity and effect of imposing explicit jump conditions at the transonic discontinuity are investigated. It is found that “standard” (low-β, large aspect ratio) transonic equilibria satisfy the correct jump condition with very good approximation even if the jump condition is not explicitly imposed. On the other hand, it is also found that high-β, low aspect ratio equilibria require the correct jump condition to be explicitly imposed. Various numerical approaches are described to modify FLOW to include the jump condition. It is proved that the new methods converge to the correct solution even in extreme cases of very large β, while they agree with the results obtained with the old implementation of FLOW in lower-β equilibria.

  3. Remark on Trautman's Radiation Condition

    International Nuclear Information System (INIS)

    Walker, M.

    1979-01-01

    The confusion about the boundary conditions for radiating systems formulated by Trautman are discussed. The confusion has mainly to do with where in space-time the conditions are to be imposed but also with what is it that the conditions are intended to guarantee. Imposing Trautman's conditions near future null infinity allows the existence of outgoing radiation; in order to exclude incoming radiation, they must be imposed near (or at) past null infinity. Since receding to infinity in spacelike directions means that one crosses all radiation, whether in- or outgoing, it makes no sense to impose the conditions at spatial infinity. If one were to impose fall-off of the electromagnetic field in flat space-time of 1/n at spatial infinity, then the field would contain finite energy. (Auth.)

  4. Rain sense : Sensors and citizens preparing Amsterdam for future weather

    NARCIS (Netherlands)

    Koole, W.; Overeem, A.; Van Riemsdijk, M.B.; Uijlenhoet, R.; Ten Veldhuis, J.A.E.

    2015-01-01

    Extreme rainfall is expected to occur more often in the future, as a result of climate change. To be able to react on this change, urban water managers need to accurately know vulnerable spots in the city, as well as the potential impact to society. Currently, detailed information about rainfall

  5. Optimizing Patient Care and Research: The Amsterdam Dementia Cohort

    NARCIS (Netherlands)

    van der Flier, W.M.; Pijnenburg, Y.A.L.; Prins, N.; Lemstra, A.W.; Bouwman, F.H.; Teunissen, C.E.; van Berckel, B.N.M.; Stam, C.J.; Barkhof, F.; Visser, P.J.; van Egmond, E.; Scheltens, P.

    2014-01-01

    Since its opening in 2000, patient care and research go hand in hand at the Alzheimer center of the VU University Medical Center, both organized in such a way that they mutually strengthen each other. Our mission is to give patients a voice by lifting the stigma on dementia, to find new diagnostic

  6. Gollandskaja KLM natshinajet poljotõ v Amsterdam / Diana King

    Index Scriptorium Estoniae

    King, Diana

    2005-01-01

    Tallinnast alustasid liinilende esmakordselt Eesti turule saabunud lennufirmad: Hollandi KML alustas regulaarlende Tallinn-Amsterdami liinil ning Rootsi tütarfirma Finnair-flyNordic Tallinn-Stockholmi ja Tallinn-Kopenhaageni liinil

  7. Puberty suppression in gender identity disorder: the Amsterdam experience

    NARCIS (Netherlands)

    Kreukels, B.P.C.; Cohen-Kettenis, P.T.

    2011-01-01

    The use of gonadotropin-releasing hormone analogs (GnRHa) to suppress puberty in adolescents with gender dysphoria is a fairly new intervention in the field of gender identity disorders or transsexualism. GnRHa are used to give adolescents time to make balanced decisions on any further treatment

  8. Puberty suppression in gender identity disorder: the Amsterdam experience.

    Science.gov (United States)

    Kreukels, Baudewijntje P C; Cohen-Kettenis, Peggy T

    2011-05-17

    The use of gonadotropin-releasing hormone analogs (GnRHa) to suppress puberty in adolescents with gender dysphoria is a fairly new intervention in the field of gender identity disorders or transsexualism. GnRHa are used to give adolescents time to make balanced decisions on any further treatment steps, and to obtain improved results in the physical appearance of those who opt to continue with sex reassignment. The effects of GnRHa are reversible. However, concerns have been raised about the risk of making the wrong treatment decisions, as gender identity could fluctuate during adolescence, adolescents in general might have poor decision-making abilities, and there are potential adverse effects on health and on psychological and psychosexual functioning. Proponents of puberty suppression emphasize the beneficial effects of GnRHa on the adolescents' mental health, quality of life and of having a physical appearance that makes it possible for the patients to live unobtrusively in their desired gender role. In this Review, we discuss the evidence pertaining to the debate on the effects of GnRHa treatment. From the studies that have been published thus far, it seems that the benefits outweigh the risks. However, more systematic research in this area is needed to determine the safety of this approach.

  9. Population increase in the Amsterdam Island fur seal Arctocephaius ...

    African Journals Online (AJOL)

    Population size of Arctocephalus tropicalis on Gough Island was determined by direct censuses of parts of the coast during the summers of 1974 - 1976 and 1977 - 1978 and correction factors for undercounting and seasonal cycles were applied. Present population size is approximately 200000, giving an intrinsic rate of ...

  10. Pilot remediation of sediment from the Petroleum harbour in Amsterdam

    International Nuclear Information System (INIS)

    Hakstege, A.L.; Geldermalsen, L.A. van

    1998-01-01

    The Petroleum Harbour project is the third pilot remediation, which was carried out within the framework of POSW (the national development programme for treatment processes of polluted sediments). The main objectives of the pilot remediation are: to demonstrate the biological treatment of dredged materials on a practical scale; and to gain knowledge and experience for the future remediation of the total Petroleum harbour. A strict tender procedure was carefully executed in order to select the most effective and 'state of the art' biodegradation technology. The selected remediation chain was a combination of 'standard' soil treatment technology and newly developed biotechnology. Dredging, biotechnological treatment and the effects of the remediation on the environment were monitored in detail. The quality of the treated sand fraction complied with the Dutch standards for re-use and was actually applied in a project of Rijkswaterstaat. Biodegradation resulted in a substantial decrease of the oil and PAH's contents, but due to the lack of breakdown of a few high-molecular PAH's, the quality requirements of the contract were not achieved. It is concluded that the two main objectives of the project have been attained. Finally some recommendations for the future clean-up of the Petroleum harbour are given. (author)

  11. Riia-Malmö-Amsterdam-Tallinn / Marge Liiske

    Index Scriptorium Estoniae

    Liiske, Marge

    2003-01-01

    Dokumentaalfilmide projektiturud. Eesti Acuba Filmi projekt "Buss" (produtsent Arko Okk, režissöör Laila Pakalnina) osales edukalt Malmös. Riias toimus 7. dokfilmifoorum "Baltic Sea and South East Europe"

  12. The Amsterdam Hip Protector Study: Compliance and determinants of compliance

    NARCIS (Netherlands)

    van Schoor, N.M.; Asma, G.; Smit, J.H.; Bouter, L.M.; Lips, P.T.A.M.

    2003-01-01

    Hip protectors appear to be effective in reducing the incidence of hip fractures. However, compliance is often poor. Therefore, the objective of this study was to examine the compliance and determinants of compliance with external hip protectors. A prospective study was performed in residents from

  13. Do neighborhood characteristics in Amsterdam influence adiposity at preschool age?

    NARCIS (Netherlands)

    Hrudey, E. Jessica; Kunst, Anton E.; Stronks, Karien; Vrijkotte, Tanja G. M.

    2015-01-01

    Neighborhood characteristics may contribute to adiposity in young children, but results in the current literature are inconsistent. This study aimed to investigate whether objective (socioeconomic status (SES)) and subjective (perceived safety, satisfaction with green spaces and perceived physical

  14. Planet Homeless : Governance arrangements in Amsterdam, Copenhagen and Glasgow

    NARCIS (Netherlands)

    Boesveldt, N.F.|info:eu-repo/dai/nl/162503199

    2015-01-01

    Homelessness is a complex policy issue that all local governments face. But, at the same time, local authorities often have very little influence on the causes of homelessness, such as de-institutionalization, drug addiction, and release from detention or evictions. Seen in a European context,

  15. The conditional in quantum logic

    International Nuclear Information System (INIS)

    Hardegree, G.M.

    1976-01-01

    In this article it is argued that orthodox quantum logic, which is represented by the lattice of projections on Hilbert space, does in fact admit an operation which possesses the essential properties of a material conditional. It is proposed that this connective can be interpreted as a Stalnaker (counter factual) conditional, where the nearness ordering among 'worlds' (in this case, QM pure states) derives in a natural way from the Hilbert space inner-product metric. It is a characteristic of the quantum logic conditional that the law of modus ponens is equivalent to the orthomodular law of conventional quantum logic. (B.R.H.)

  16. Systemic conditions affecting the breast

    International Nuclear Information System (INIS)

    Abbitt, P.L.; DeParedes, E.S.

    1987-01-01

    While the mammogram is most often used in the evaluation of diseases specific to the breast, manifestations of systemic conditions may also be recognized. Congenital systemic conditions such as neurofibromatosis and ectodermal dysplasia have graphic mammographic findings. The effects of diet, hormonal, and medication therapy can also have a dramatic impact on the appearance of the mammogram, as can common clinical states such as congestive heart failure or renal failure. Metastases to the breast from extramammary primaries may be seen mammographically as discrete masses, as causing diffusely increased density of the breast or as abnormal axillary adenopathy. The authors review a variety of conditions and their mammographic appearance

  17. National Coastal Condition Assessment (NCCA)

    Data.gov (United States)

    U.S. Environmental Protection Agency — During the summer of 2010, state and EPA crews conducted field sampling for the fifth National Coastal Condition Assessment (NCCA). The assessment is in the data...

  18. Chronic Conditions among Medicare Beneficiaries

    Data.gov (United States)

    U.S. Department of Health & Human Services — The data used in the chronic condition reports are based upon CMS administrative enrollment and claims data for Medicare beneficiaries enrolled in the...

  19. Inflation with generalized initial conditions

    International Nuclear Information System (INIS)

    Albrecht, A.; Brandenberger, R.; Matzner, R.

    1987-01-01

    In many current models of the early Universe a scalar field phi which is only very weakly coupled to other quantum fields is used to generate inflation. In such models there are no forces which could thermalize the scalar field, and previous assumptions about its preinflation ''initial'' conditions must be abandoned. In this paper the onset of inflation is studied classically for more general initial conditions of the scalar field configuration. In particular, initial conditions with a nonvanishing spatial average of phi, with phi chosen at random in each initial horizon volume, and with random initial momenta are considered. We identify and discuss several mechanisms that can drive these more general initial conditions toward an inflationary state. The analysis is done in one spatial dimension

  20. Benign Breast Problems and Conditions

    Science.gov (United States)

    ... Hyperplasia: A condition in which cells in the breast ducts or lobes are increasing in number and do not look normal under a microscope. Benign: Not cancer. Biopsy: A minor surgical procedure to remove a small ...