WorldWideScience

Sample records for unit i1 zim-sci

  1. Intersection I-1

    CERN Multimedia

    CERN PhotoLab

    1971-01-01

    Intersection I-1 of the ISR in August 1971 showing the 90 degree large acceptance spectrometer of the Saclay-Strasbourg Collaboration which is studying the momentum spectra of electrons at large angles. On the left of the crossing region can be seen the track used by the CERN-Bucharest-Cracow-Tata Collaboration to bring nuclear emulsions into the ISR.

  2. A influência do método mãe-canguru na recuperação do recém-nascido em Unidade de Terapia Intensiva Neonatal: uma revisão de literatura - DOI: 10.4025/actascihealthsci.v25i1.2250 The influence of kangaroo-mother approach on the newborn recovery at neonatal intensive care unit: a literature review - DOI: 10.4025/actascihealthsci.v25i1.2250

    Directory of Open Access Journals (Sweden)

    Loide Ferreira

    2003-04-01

    Full Text Available A separação da mãe e recém-nascido (RN logo após o parto, decorrente da hospitalização, influencia na continuidade da formação do apego, podendo afetar RN e/ou sua mãe. Com isso, buscou-se, a partir do método mãe-canguru, identificar a influência deste na relação mãe-filho internado em Unidade de Terapia Intensiva (UTI Neonatal; conhecer como ocorre a formação do apego, mediante a utilização do método, e como o apego pode influenciar no prognóstico do RN internado e na atitude da mãe frente à hospitalização foram os objetivos. A pesquisa foi de cunho bibliográfico, realizada uma revisão no período de 1983 a 2002. Procurou-se observar a eficácia do método como facilitador do apego, promovendo um melhor prognóstico do RN internado e aumento da confiança e adaptação materna diante da situação. A indissolubilidade da relação de apego entre mãe e filho é de grande importância e as intervenções de enfermagem devem visar amenizar a separação da díade, prevenindo seqüelas imediatas e futuras para os envolvidos.The mother’s separation from the newborn after birth due to hospital admission influences in the continuity of the affectionate bond, affecting both, the newborn and the mother. The aim of this study is to identify this influence in the relation mother-son admitted in the neonatal intensive care unit; to know how the affectionate bond occurs by means of the utilization of the approach and how the attachment can influence in the prognostic of the newborn interned and the mother’s attitude facing the hospitalisation. This study used a bibliographical research in the period from 1983 to 2002. Observing the efficacy of the approach as a facilitator of the attachment, promoting a better prognostic of the newborn interned and increasing confidence and maternal adaptation facing the situation. The relation of attachment between mother and son is inseparable and very important and the nursing

  3. Prevalência de fatores de risco para doenças cardiovasculares em hipertensos cadastrados em unidade de saúde da família - DOI: 10.4025/actascihealthsci.v31i1.4492 Prevalence of risk factors for cardiovascular diseases among people with hypertension enrolled in a family health unit - DOI: 10.4025/actascihealthsci.v31i1.4492

    Directory of Open Access Journals (Sweden)

    Marcos Aparecido Sarriá Cabrera

    2009-05-01

    Full Text Available As doenças crônicas não-transmissíveis, em especial as doenças cardiovasculares, têm-se revelado como importante causa de morbimortalidade no Brasil, principalmente na área urbana. Estes agravos apresentam inúmeros fatores de risco, entre os quais são reconhecidos a hereditariedade, a idade, a raça, o sexo, a hipertensão arterial, o tabagismo, as dislipidemias, a diabetes, a obesidade e o sedentarismo. Este estudo buscou estimar a prevalência de alguns fatores de risco para doenças cardiovasculares em indivíduos hipertensos, de 20 a 79 anos, cadastrados em uma Unidade de Saúde da Família de Londrina, Estado do Paraná. Os dados foram coletados em entrevista domiciliar, com questões referentes a aspectos socioeconômicos e demográficos, estilo de vida e condição de saúde. Entre os 385 pacientes entrevistados, foram observadas as seguintes prevalências: 28,6% com colesterol elevado; 16,9% de tabagistas; 5,5% de consumidores regulares de bebidas alcoólicas; 70,4% que não praticavam atividade física; 22,9% com diabetes; e 30,9% com história familiar de doenças cardiovasculares. Observou-se elevada prevalência de fatores de risco cardiovasculares, especialmente a inatividade física. O manejo adequado destes fatores com medidas educativas e preventivas é fundamental para a redução das complicações cardiovasculares no grupo de pacientes hipertensos.Non-transmissible diseases, particularly cardiovascular diseases, have emerged as important causes of morbidity and mortality in Brazil, mainly in urban areas. Heredity, age, race, gender, high blood pressure and lipids, smoking, diabetes, obesity and physical inactivity are recognized risk factors for these events. This study aimed to estimate the prevalence of some risk factors for cardiovascular diseases among hypertensive patients aged 20 to 79 years who had been enrolled in a Health Family Unit in Londrina, Paraná State, Brazil. Data was collected during home

  4. Exploring Stephen Krashen's "i+1" Acquisition Model in the Classroom

    Science.gov (United States)

    Payne, Mark

    2011-01-01

    Stephen Krashen's theories can appear "seductive" to teachers of languages, in that they identify a seemingly clear way forward for language acquisition in the classroom. However, reification of Krashen's theories, in particular the notion of attaining "i+1" through comprehensible input, is demonstrated to be problematic. Based…

  5. Interesses e colaboração do Brasil e dos Estados Unidos com a ditadura de Stroessner (1954-63 - doi: 10.4025/dialogos.v11i1e2.62 Vested interests and collaboration between Brazil and the united states during the dictatorship of Stroessner (1954-63 - doi: 10.4025/dialogos.v11i1e2.62 Intereses y colaboración de Brasil y de EEUU con la dictadura de Stroessner (1954-1963

    Directory of Open Access Journals (Sweden)

    Ceres Moraes

    2010-05-01

    Full Text Available Neste artigo são abordados os interesses e a colaboração norte-americana e brasileira com a ditadura de Stroessner instalada no Paraguai a partir de meados de 1954. Esse regime, que durante cerca de 35 anos submeteu aquele país, foi um dos mais longos e violentos períodos de repressão do Mundo Ocidental contemporâneo. Sob a justificativa de combate ao avanço das idéias comunistas na América do Sul, os Estados Unidos colaboraram para a consolidação e permanência do regime através de ajuda econômica e da assistência técnica e militar, principalmente com a formação e treinamento de militares. O Brasil, que ainda disputava com a Argentina a supremacia regional, apesar de não mais manter a política de alinhamento incondicional com os Estados Unidos, buscava consolidar-se como parceiro preferencial e principal beneficiário de sua política na América do Sul. Na defesa de seus interesses, colaborou com o regime ditatorial de Stroessner tanto no campo econômico como no diplomático, cultural e militar. Ao contribuírem, especialmente, com assistência técnica e ajuda econômica, os Estados Unidos e o Brasil, este último de forma mais efetiva, colaboraram para a consolidação e longa permanência de Stroessner no poder.In this article are treated the interests and North American and Brazilian collaboration with the Stroessner’s dictatorship installed in Paraguay starting from1954. This regime which during about 35 years submitted that country was one of longest and violent periods of repression of the contemporary western world. Under the justification of combat to the progress of communist ideas in the South American, The United States collaborated for the consolidation and permanence of the regime through of economic help, technical assistance and military support, mainly with the formation and training of military, tend many of them studied in School of the Americas, in Panamá. The Brazil that still in this period fought

  6. Cytobiological mechanism of agmatine inhibitory effect on morphine dependence: role of I1-imidazoline receptor

    Institute of Scientific and Technical Information of China (English)

    SuRui-bin; WuNing; LiJin

    2004-01-01

    In our previous studies, agmatine was found to prevent substance dependence of morphine in mice, rats and monkeys,but the exact mechanism was not clear yet. In this study, for the first time rat μ opioid receptor (rMOR) and human I1-imidazoline receptor (hI1 R) were co-expressed stably in CHO cells (CHO-μ/I1) by means of lipofectamine transfection

  7. Cloning, expression, and purification of recombinant major mango allergen Man i 1 in Escherichia coli.

    Science.gov (United States)

    Tsai, Wen-Che; Wu, Tzee-Chung; Chiang, Bor-Luen; Wen, Hsiao-Wei

    2017-02-01

    In recent years, the number of people around the world who suffer from fruit allergies has increased. Mango can induce anaphylaxis, and two major mango allergens have been identified - Man i 1 and Man i 2. Apart from their molecular weights and pI values, no other information about them is known. This work identifies the DNA and amino acid sequences of Man i 1 and constructs an expression system for recombinant Man i 1 (rMan i 1). Firstly, 3' and 5' RACE assays were used to identify the cDNA fragment of Man i 1. Subsequently, the full length of Man i 1 cDNA was inserted into a pET-21a(+) vector, and the inserted plasmid was transformed to Escherichia coli BL21 (DE3) to express rMan i 1. The conditions for the expression of rMan i 1, including IPTG concentration, induction temperature, and induction time, were optimized. The highest amount of soluble rMan i 1 was obtained after induction with 0.1 mM IPTG at 16 °C for 20 h. The His-tagged rMan i 1 was purified using Ni-NTA agarose and its identity was verified using an anti-histidine antibody and the serum of a mango-allergic person. Additionally, rMan i 1 was identified as glyceraldehyde 3-phosphate dehydrogenase (GAPDH) and shared 86.2% identity in amino acid sequence of GAPDH from wheat. Finally, an E. coli expression system of rMan i 1 was established, with the potential to be used in immunotherapy against mango allergy or the development of assays for detecting the residues of mango allergens.

  8. 26 CFR 1.430(i)-1 - Special rules for plans in at-risk status.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false Special rules for plans in at-risk status. 1.430(i)-1 Section 1.430(i)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Certain Stock Options § 1.430(i)-1 Special rules for plans in at-risk status. (a) In general—(1)...

  9. Data of evolutionary structure change: 1JI4I-1JIGD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1JI4I-1JIGD 1JI4 1JIG I D ---MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNV...HKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA...VQTLVNDYSALIQELKEGMEVAGEAGDATSADMLLAIHTTLEQHVWMLSAFLK --- HHHHHHHHHH...0 1JIG D 1JIGD

  10. Arachidonic acid release from PC12 pheochromocytoma cells is regulated by I1-imidazoline receptors.

    Science.gov (United States)

    Ernsberger, P

    1998-10-15

    Rat PC 12 pheochromocytoma cells lack alpha2-adrenergic receptors but express plasma membrane I1-imidazoline receptors. In response to the I1-agonist moxonidine, diglycerides are generated via phosphatidylcholine-selective phospholipase C, and prostaglandin E2 is released. This report characterizes I-receptor-mediated release of arachidonic acid, the precursor to the prostaglandins. PC12 cells were incubated with [3H]arachidonic acid for 24 h and superfused with 0.01% bovine serum albumin in Krebs' physiological buffer at 1 ml/min. Calcium ionophore increased arachidonic acid release only marginally, implying that in PC12 cells arachidonic acid release is not driven by calcium. The I1-agonist moxonidine at concentrations between 10 nM and 1.0 microM rapidly elicited up to two-fold increases in [3H]arachidonic acid release. Guanabenz, a potent alpha2-agonist and I2-ligand, had no effect. The selective I1-antagonist efaroxan blocked the action of moxonidine. The phospholipase A2 inhibitor aristolochic acid had no effect, suggesting that arachidonic acid release may be through an indirect pathway, possibly involving diglycerides. Thus, I1-imidazoline receptors in PC12 cells are coupled to arachidonic acid release through an as yet unknown pathway.

  11. i+1理论与大学英语听力教学

    Institute of Scientific and Technical Information of China (English)

    朱翔

    2009-01-01

    美国著名的应用语言学家斯蒂芬·克拉申(Stephen D.Krashen)提出的"i+1"理论和语言输入假说是最有影响的外语学习理论之一,"i+1"理论对大学英语教学有着重要的指导意义,是外语教学的重要理论依据之一.该文讨论了Krashen的"i+1"理论和语言输入假说,并在大学英语听力教学中如何运用这一理论提出了自己的见解.

  12. Vygotsky's Zone of Proximal Development and Krashen's "i + 1": Incommensurable Constructs; Incommensurable Theories.

    Science.gov (United States)

    Dunn, William E.; Lantolf, James P.

    1998-01-01

    Second-language scholars have suggested that Krashen's construct of "i +1" is similar to Vygotsky's zone of proximal development and that it might therefore be feasible to integrate the two constructs in way that would be productive for second-language acquisition (SLA) research. Article argues that this is futile, not only because…

  13. 26 CFR 1.167(i)-1 - Depreciation of improvements in the case of mines, etc.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Depreciation of improvements in the case of... and Corporations § 1.167(i)-1 Depreciation of improvements in the case of mines, etc. Property used in... depreciation provided in section 611 shall be treated for all purposes of the Code as if it were...

  14. The ciliary inner dynein arm, I1 dynein, is assembled in the cytoplasm and transported by IFT before axonemal docking.

    Science.gov (United States)

    Viswanadha, Rasagnya; Hunter, Emily L; Yamamoto, Ryosuke; Wirschell, Maureen; Alford, Lea M; Dutcher, Susan K; Sale, Winfield S

    2014-10-01

    To determine mechanisms of assembly of ciliary dyneins, we focused on the Chlamydomonas inner dynein arm, I1 dynein, also known as dynein f. I1 dynein assembles in the cytoplasm as a 20S complex similar to the 20S I1 dynein complex isolated from the axoneme. The intermediate chain subunit, IC140 (IDA7), and heavy chains (IDA1, IDA2) are required for 20S I1 dynein preassembly in the cytoplasm. Unlike I1 dynein derived from the axoneme, the cytoplasmic 20S I1 complex will not rebind I1-deficient axonemes in vitro. To test the hypothesis that I1 dynein is transported to the distal tip of the cilia for assembly in the axoneme, we performed cytoplasmic complementation in dikaryons formed between wild-type and I1 dynein mutant cells. Rescue of I1 dynein assembly in mutant cilia occurred first at the distal tip and then proceeded toward the proximal axoneme. Notably, in contrast to other combinations, I1 dynein assembly was significantly delayed in dikaryons formed between ida7 and ida3. Furthermore, rescue of I1 dynein assembly required new protein synthesis in the ida7 × ida3 dikaryons. On the basis of the additional observations, we postulate that IDA3 is required for 20S I1 dynein transport. Cytoplasmic complementation in dikaryons using the conditional kinesin-2 mutant, fla10-1 revealed that transport of I1 dynein is dependent on kinesin-2 activity. Thus, I1 dynein complex assembly depends upon IFT for transport to the ciliary distal tip prior to docking in the axoneme.

  15. The Convergence of (i1i),(b2,1k0) and (i1i).(b3,1k0)%(i1i)*(b12k0)及(i1i)*(b31k0)在π*V(1)中的收敛性

    Institute of Scientific and Technical Information of China (English)

    白建侠

    2009-01-01

    对连通有限型谱X,y,存在Adams谱序列{Es,tr,dr},满足(1)dr:Es,t,r→Es+r,t+r-1,r是谱序列的微分, (2)Es,t,2≌Exts,t,A(H*X,H*y),(3)收敛到[∑t-sY,X].当X分别是球谱S,Moore谱M,Toda-smith谱V(1)时,(πt-X)p分别是S,M,V(1)的稳定同伦群.利用Adams 谱序列,证明了(i1i)*(62,1k0)及(i1i)*(b3,1k0)是永久循环但不是边缘,因此收敛到π*V(1)中的非零元,其中P为奇索数,q=2p-2.

  16. On the recurrence relation ααi-1,j-1 + βαi-1,j = αi,j%关于递推关系ααi-1,j-1+βαi-1,j=αi,j

    Institute of Scientific and Technical Information of China (English)

    谭明术

    2004-01-01

    研究了满足ααi-1,j-1+βαi-1,j=αi,j的序列{αi,j}.用发生函数法得到了n+1阶矩阵A=(αi,j)(n+1)×(n +1)的精确表达式.用数学归纳法证明(1-βx-αxy)-n中一般项xiyj(i≥j)的系数为αjβi-j(i+n-1/n-1)(i j).导出了一些有关二项式系数(n k)的新的组合恒等式.

  17. Multi-point quasi-rational approximants for the modified Bessel function I1(x)

    Science.gov (United States)

    Martin, P.; Olivares, J.; Cortés-Vega, L.; Sotomayor, A.

    2016-08-01

    Approximants for the modified Bessel function I1(x) has been found using the multi-point quasi-rational technique. The approximations here determined has good accuracy for any positive value of the variable, and it seems to be adequate for most of the works where this function are used. Furthermore, the approximants are simple to calculate numerically in a direct way or using any usual MAPLE or MATLAB software.

  18. Transport Properties of xAgI-(1-x)LiPO3 Composite Electrolytes

    Science.gov (United States)

    Singh, D. P.; Shahi, K.; Kar, K. K.

    2011-07-01

    xAgI-(1-x) LiPO3 composite glasses were made by quenching of molten mixture. XRD confirms that γ-AgI is stabilized in LiPO3 glass matrix. A room temperature conductivity of ˜10-3 S/cm is achieved in the composite glass. The ac conductivity follows Jonscher power law (JPL). Higher composition samples also obey time temperature superposition scaling.

  19. Band alignment of MAPb(I1-xBrx)3 thin films by vacuum deposition

    Science.gov (United States)

    Zhou, Xianzhong; Ye, Wang; Li, Xiaoli; Zheng, Wei; Lin, Richeng; Huang, Feng; Zhong, Dingyong

    2016-12-01

    In this work, the mixed bromide iodide lead perovskites CH3NH3Pb(I1-xBrx)3 (0 ≤ x ≤ 0.67) thin films were prepared by co-evaporation of CH3NH3I, PbI2, and PbBr2. The electronic properties of CH3NH3Pb(I1-xBrx)3 thin films were investigated by X-ray and ultraviolet photoelectron spectroscopy in-situ. The results of core level binding energy show that there is no chemical shift of the C1s, N1s, Br3d5, and I3d5 when the Br composition changes, while there is an approximately linear chemical shift of Pb4f7 to higher binding energy as the Br composition increases. The density functional theory calculation reveals that there is more charge transfer from Pb to Br than I, which results in the chemical shift of Pb4f states. On the other hand, the valence band maximum increases as the Br composition increases, while the work function shows no obvious change, because the conduction band is dominated by Pb 6p orbitals while the valence band is dominated by halide p orbitals. Our work demonstrates the adjustability of the energy level alignment of MAPb(I1-xBrx)3 by the Br composition.

  20. Antibacterial properties of the mammalian L-amino acid oxidase IL4I1.

    Directory of Open Access Journals (Sweden)

    Marie-Line Puiffe

    Full Text Available L-amino acid oxidases (LAAO are flavoproteins that catalyze the oxidative deamination of L-amino acids to a keto-acid along with the production of H₂O₂ and ammonia. Interleukin 4 induced gene 1 (IL4I1 is a secreted LAAO expressed by macrophages and dendritic cells stimulated by microbial derived products or interferons, which is endowed with immunoregulatory properties. It is the first LAAO described in mammalian innate immune cells. In this work, we show that this enzyme blocks the in vitro and in vivo growth of Gram negative and Gram positive bacteria. This antibiotic effect is primarily mediated by H₂O₂ production but is amplified by basification of the medium due to the accumulation of ammonia. The depletion of phenylalanine (the primary amino acid catabolized by IL4I1 may also participate in the in vivo inhibition of staphylococci growth. Thus, IL4I1 plays a distinct role compared to other antibacterial enzymes produced by mononuclear phagocytes.

  1. Assembly of PRR-containing receptors on scaffolds: a model for imidazoline I(1)-receptor action.

    Science.gov (United States)

    Musgrave, I F; Dehle, F C; Piletz, J

    2003-12-01

    IRAS, a putative clone of the I(1)-imidazoline receptor, possesses a proline-rich region (PRR) motif, which might interact with SH3 regions on tyrosine kinases, and an integrin-binding motif. Receptors with a PRR motif can generally assemble onto multi-element signaling complexes (eg., the beta(3)-receptor on the EGF receptor) and thereby modulate signal transduction. Integrins serve as scaffolds for multi-element signaling complexes, similar to that assembled with the EGF receptor. It is therefore possible that IRAS signals through a complex with other receptors.

  2. Draft Genome Sequences of Salmonella enterica Isolates Containing Incompatibility Group I1 Plasmids from Swine, Poultry, and Human Sources.

    Science.gov (United States)

    Kaldhone, Pravin R; Khajanchi, Bijay K; Han, Jing; Nayak, Rajesh; Ricke, Steven C; Foley, Steven L

    2017-09-28

    The draft genome sequences of eight Salmonella enterica isolates from various sources were evaluated for the influence of incompatibility group I1 (IncI1) plasmids on virulence. Strains SE142, SE143, SE144, and SE146 originated from swine, SE36N and SE89N from poultry-related sources, and SE991 and SE1148 from human patients.

  3. Characterization and Antibacterial Potential of Lactic Acid Bacterium Pediococcus pentosaceus 4I1 Isolated from Freshwater Fish Zacco koreanus

    Directory of Open Access Journals (Sweden)

    Vivek K. Bajpai

    2016-12-01

    Full Text Available This study was undertaken to characterize a lactic acid bacterium 4I1, isolated from the freshwater fish, Zacco koreanus. Morphological, biochemical and molecular characterization of 4I1 revealed it to be Pediococcus pentosaceus 4I1. The cell free supernatant (CFS of P. pentosaceus 4I1 exhibited significant (p<0.05 antibacterial effects (inhibition zone diameters: 16.5–20.4 mm against tested foodborne pathogenic bacteria with MIC and MBC values of 250-500 and 500-1,000 µg/mL, respectively. Further, antibacterial action of CFS of P. pentosaceus 4I1 against two selected bacteria Staphylococcus aureus KCTC-1621 and Escherichia coli O157:H7 was determined in subsequent assays. The CFS of P. pentosaceus 4I1 revealed its antibacterial action against S. aureus KCTC-1621 and E. coli O157:H7 on membrane integrity as confirmed by a reduction in cell viability, increased potassium ion release (900 and 800 mmol/L, reduced absorption at 260-nm (3.99 and 3.77 OD, and increased relative electrical conductivity (9.9 and 9.7%, respectively. Gas chromatography-mass spectrometry (GC-MS analysis of the CFS of P. pentosaceus 4I1 resulted in the identification of seven major compounds, which included amino acids, fatty acids and organic acids. SEM-based morphological analysis further confirmed the antibacterial effect of CFS of P. pentosaceus 4I1 against S. aureus KCTC-1621 and E. coli O157:H7. In addition, the CFS of P. Pentosaceus 4I1 displayed potent inhibitory effects on biofilms formation by S. aureus KCTC-1621 and E. coli O157:H7. The study indicates the CFS of P. pentosaceus 4I1 offers an alternative means of controlling foodborne pathogens.

  4. K {yields}{pi}{pi} and the {Delta}I=1/2 rule on GPUs

    Energy Technology Data Exchange (ETDEWEB)

    Walk, Bjoern [Institut fuer Kernphysik, Universitaet Mainz (Germany)

    2011-07-01

    Investigations on the non-leptonic decay K {yields}{pi}{pi} and the so-called {Delta}I=1/2 rule, which describes the enhancement of the isospin I=0 channel over the isospin I=2 channel require quite a substantial amount of care on the lattice. Ginsparg-Wilson fermions greatly facilitate such investigations but because they are an order of magnitude more expensive in terms of computing power special algorithms and techniques will be required. In my talk I report on the ongoing study on our GPU implementation of the Neuberger-Dirac operator including the calculation of zero-modes. I give an introduction to the theoretical background and discuss performance.

  5. Sodium excretion following central administration of an I1 imidazoline receptor agonist, moxonidine.

    Science.gov (United States)

    Penner, S. B.; Smyth, D. D.

    1994-01-01

    1. Previously we have shown that an intrarenal infusion of moxonidine, an I1-imidazoline receptor agonist, resulted in a natriuresis which was inhibited by intravenous idazoxan, a selective imidazoline receptor antagonist. Therefore we examined the effects of renal function of intracerebroventricular (i.c.v.) administration of moxonidine with or without i.c.v. idazoxan. 2. Seven days after unilateral nephrectomy, Sprague-Dawley rats had i.c.v. cannulae implanted. Three days later the rats were anaesthetized (pentobarbitone), followed by cannulation of the jugular vein (fluid and drug administration), carotid artery (blood pressure) and the ureter (urine collection). 3. After a 45 min stabilization period, the effect of moxonidine was investigated by the i.c.v. administration of either isotonic saline or moxonidine (0.1, 0.3 or 1 nmol in isotonic saline) administered in 5 microliters over 1 min. All doses of moxonidine resulted in an increase in urine flow with a concomitant increase in sodium excretion without affecting blood pressure. The highest dose of moxonidine (1 nmol) also increased free water clearance. 4. In a second series of experiments, the effects of idazoxan on the natriuretic response to i.c.v. moxonidine were determined. Moxonidine (0.3 nmol) again increased sodium and water excretion as compared to the i.c.v. saline control animals. Pretreatment with i.c.v. idazoxan (0.3 nmol), at a dose which alone failed to alter sodium and water excretion, completely attenuated the renal response to moxonidine. These results are consistent with central I1-imidazoline receptors mediating a moxonidine-induced increase in sodium and water excretion at doses that do not alter blood pressure. PMID:7952868

  6. Partial wave analysis of pbar-p annihilation channels in flight with I=1, C=+1

    CERN Document Server

    Anisovich, A V; Batty, C J; Bugg, D V; Nikonov, V A; Sarantsev, A V; Sarantsev, V V; Zou, B S

    2011-01-01

    A combined analysis is reported of 3pizero, pizero-eta and pizero-etaprime data in the mass range 1960 to 2410 MeV. This analysis is made consistent also with eta-eta-pizero data, reported separately. The analysis requires s-channel resonances with a spectrum close to that published earlier for C = +1 states with I = 0; masses for I=1 states are lower on average by 20 MeV. Two alternative solutions are found, differing only for J^P = 2^+ and 4^+ states by small amounts in masses and widths. Both 3pizero and eta-pizero data prefer one of these two solutions. For this preferred solution, observed states have J^PC, masses and widths (M,Gamma) in MeV as follows: 4^-+: (2250+-15, 215+-25), 4^++: (2255+-40, 330 ^{+110}_{-50}) and (2005 ^{+25}_{-45}, 180+-30), 3^++: (2275+-35, 350 ^{+100}_{-50}) and (2031+-12, 150 \\pm 18), 2^-+: (2245+-60, 320 ^{+100}_{-40}) and (2005+-15, 200+-40, 2^++: (2255+-20, 230+-15), (2175+-40, 310^{+90}_{-45}) and (2030+-20, 205+-30), and 1^++: (2270 ^{+55}_{-40}, 305 ^{+70}_{-35}). There a...

  7. Practical methods for a direct calculation of Delta I=1/2 K to pipi Decay

    Science.gov (United States)

    Liu, Q.

    A direct calculation of the complex $\\Delta I=1/2$ kaon decay amplitude is notoriously difficult because of the presence of disconnected graphs. Here we describe and demonstrate two practical methods to defeat this problem: the EigCG algorithm and the use of time-separated $\\pi-\\pi$ sources. With a fine tuned EigCG implementation for domain wall fermions, the calculation of light quark propagators is accelerated by a factor of 5-10 on a variety of lattices from small ($16^3\\times32\\times16$) to large ($32^3\\times64\\times32$). In addition, a substantial reduction in noise is achieved by separating each of the sources for the two pions in the time direction by 2-5 lattice spacings. These methods are combined in a calculation of $K$ to $\\pi\\pi$ threshold decay using a $24^3\\times64\\times16$ volume and 329 MeV pions. These methods result in non-zero signals for both Re($A_0$) and Im($A_0$) from 138 gauge configurations.

  8. Variance reduction techniques for a quantitative understanding of the \\Delta I = 1/2 rule

    CERN Document Server

    Endress, Eric

    2012-01-01

    The role of the charm quark in the dynamics underlying the \\Delta I = 1/2 rule for kaon decays can be understood by studying the dependence of kaon decay amplitudes on the charm quark mass using an effective \\Delta S = 1 weak Hamiltonian in which the charm is kept as an active degree of freedom. Overlap fermions are employed in order to avoid renormalization problems, as well as to allow access to the deep chiral regime. Quenched results in the GIM limit have shown that a significant part of the enhancement is purely due to low-energy QCD effects; variance reduction techniques based on low-mode averaging were instrumental in determining the relevant weak effective lowenergy couplings in this case. Moving away from the GIM limit requires the computation of diagrams containing closed quark loops. We report on our progress to employ a combination of low-mode averaging and stochastic volume sources in order to control these contributions. Results showing a significant improvement in the statistical signal are pre...

  9. Decrease of Obesity by Allantoin via Imidazoline I1-Receptor Activation in High Fat Diet-Fed Mice

    Directory of Open Access Journals (Sweden)

    Hsien-Hui Chung

    2013-01-01

    Full Text Available The activation of the imidazoline I1-receptor (I1R is known to regulate appetite. Allantoin, an active ingredient in the yam, has been reported to improve lipid metabolism in high fat diet- (HFD-fed mice. However, the effect of allantoin on obesity remains unclear. In the present study, we investigated the effects of allantoin on HFD-induced obesity. The chronic administration of allantoin to HFD-fed mice for 8 weeks significantly decreased their body weight, and this effect was reversed by efaroxan at a dose sufficient to block I1R. The epididymal white adipose tissue (eWAT cell size and weight in HFD-fed mice were also decreased by allantoin via the activation of I1R. In addition, allantoin significantly decreased the energy intake of HFD-fed mice, and this reduction was associated with a decrease in the NPY levels in the brain. However, no inhibitory effect of allantoin on energy intake was observed in db/db mice. Moreover, allantoin lowered HFD-induced hyperleptinemia, and this activity was abolished by I1R blockade with efaroxan. Taken together, these data suggest that allantoin can ameliorate energy intake and eWAT accumulation by activating I1R to improve HFD-induced obesity.

  10. Measurement of specific IgE antibodies to Ses i 1 improves the diagnosis of sesame allergy.

    Science.gov (United States)

    Maruyama, N; Nakagawa, T; Ito, K; Cabanos, C; Borres, M P; Movérare, R; Tanaka, A; Sato, S; Ebisawa, M

    2016-01-01

    The number of reported cases of allergic reactions to sesame seeds (Sesamum indicum) has increased significantly. The specific IgE tests and skin prick tests presently available for diagnosis of sesame allergy are all based on crude sesame extract and are limited by their low clinical specificity. Thus, oral food challenge (OFC) is still the gold standard in the diagnosis. The aim was to identify the allergen components useful to diagnose sesame-allergic children with the goal to reduce the number of OFCs needed. Ninety-two sesame-sensitized children were consecutively enrolled and diagnosed based on OFC or convincing history. Specific IgE to purified native 11S globulin (nSes i 11S), 7S globulin (nSes i 7S), 2S albumin (nSes i 2S), and two recombinant 2S albumins (rSes i 1 and rSes i 2) was measured by ELISA and/or ImmunoCAP (rSes i 1/streptavidin application). Based on area under curve (AUC) values from receiver operating characteristic (ROC) analysis, rSes i 1 was shown to have the best diagnostic performance of the allergen components in ELISA. The experimental rSes i 1 ImmunoCAP test had larger AUC (0.891; 95% CI, 0.826-0.955) compared to the commercially available sesame ImmunoCAP (0.697; 95% CI, 0.589-0.805). The clinical sensitivity and specificity for the rSes i 1 ImmunoCAP test at optimal cut-off (3.96 kUA /L) were 86.1% and 85.7%, respectively. Sensitization to Ses i 1 is strongly associated with clinical sesame allergy. Measurement of specific IgE to rSes i 1 could reduce the numbers of OFCs needed. © 2015 John Wiley & Sons Ltd.

  11. Comparative Proteomic Analysis of Proteins Expressed in the I-1 and I-2 Internodes of Strawberry Stolons

    Institute of Scientific and Technical Information of China (English)

    Xianping Fang; Huasheng Ma; Songlin Raun

    2012-01-01

    The strawberry (Fragaria ananassa) can reproduce asexually through stolons,including the proximal internode (I-1) and the distal internode (I-2),which has a strong tendency to form adventitious roots at the nodes.Understanding the different development mechanisms of I-1 and I-2 will facilitate nursery plant production.Here we report comparative internode proteomics of strawberry stolons.Proteins from I-1 and I-2 samples were extracted and separated by two-dimensional gel electrophoresis.A total of 164 protein spots from I-1 gels and 200 protein spots from I-2 gels were selected carefully.Out of these spots,a total of 38 and 52 proteins were identified by mass spectrometry in I-1 and I-2,respectively.All the identified proteins were categorized into 8 and 10 groups according to their cellular compartmentalization and biological functionality,respectively.Enzymes necessary for carbohydrate metabolism and photosynthesis dominated in the set of identified proteins.Analysis of protein expression patterns revealed that the ubiquitin-proteasome pathway and sugar-hormone connections may play important roles in the growth and development of I-2.Furthermore,protein-protein interactions studies revealed many proteins were involved in I-2 development mechanism as a dynamic network.Finally,based on our proteomic results,we brought forward a possible schematic representation of mechanism associated with the adventitious root formation of new clonal plants in I-2.

  12. Comparison of agmatine with moxonidine and rilmenidine in morphine dependence in vitro: role of imidazoline I(1) receptors.

    Science.gov (United States)

    Li, Fei; Wu, Ning; Su, Rui-Bin; Liu, Yin; Lu, Xin-Qiang; Li, Jin

    2009-06-10

    Moxonidine and rilmenidine are classical imidazoline I(1) receptor agonists, and used as anti-hypertension drugs in clinical practice. Agmatine is an imidazoline I(1) receptor endogenous ligand as well as its agonist, but more and more evidences suggest it has no influence on blood pressure. In the present study we compared the effects of moxonidine, rilmenidine and agmatine in the development of morphine dependence, and investigated the role of imidazoline I(1) receptor in the effects of these agents. Chinese hamster ovary cells co-expressing mu opioid receptor and imidazoline receptor antisera-selected protein (IRAS), the strong candidate for imidazoline I(1) receptor, were used as the cell line. cAMP overshoot, which represents an opioid dependent state in vitro, was measured to study the effects on morphine dependence. siRNA against IRAS was carried out to investigate the role of imidazoline I(1) receptor. Moxonidine and rilmenidine (0.01-10 microM) were ineffective on cAMP level in the cells when given alone, and failed to inhibit chronic morphine exposure, naloxone-precipitated cAMP overshoot when co-pretreated with morphine. Agmatine (0.01-10 microM) by itself was ineffective but co-pretreated with morphine concentration-dependently inhibited chronic morphine exposure, naloxone-precipitated cAMP overshoot in the cells. Furthermore, we found that the inhibitory effect of agmatine (100 nM and 1 microM) on cAMP overshoot was significantly reduced by siRNA against IRAS. This study indicates that agmatine can inhibit the development of morphine dependence in vitro, whereas moxonidine and rilmenidine have no the effect. Imidazoline I(1) receptor plays an important role in agmatine inhibiting morphine dependence.

  13. Analysing the effect of I1 imidazoline receptor ligands on DSS-induced acute colitis in mice.

    Science.gov (United States)

    Fehér, Ágnes; Tóth, Viktória E; Al-Khrasani, Mahmoud; Balogh, Mihály; Lázár, Bernadette; Helyes, Zsuzsanna; Gyires, Klára; Zádori, Zoltán S

    2017-02-01

    Imidazoline receptors (IRs) have been recognized as promising targets in the treatment of numerous diseases; and moxonidine and rilmenidine, agonists of I1-IRs, are widely used as antihypertensive agents. Some evidence suggests that IR ligands may induce anti-inflammatory effects acting on I1-IRs or other molecular targets, which could be beneficial in patients with inflammatory bowel disease (IBD). On the other hand, several IR ligands may stimulate also alpha2-adrenoceptors, which were earlier shown to inhibit, but in more recent studies to rather aggravate colitis. Hence, this study aimed to analyse for the first time the effect of various I1-IR ligands on intestinal inflammation. Colitis was induced in C57BL/6 mice by adding dextran sulphate sodium (DSS) to the drinking water for 7 days. Mice were treated daily with different IR ligands: moxonidine and rilmenidine (I1-IR agonists), AGN 192403 (highly selective I1-IR ligand, putative antagonist), efaroxan (I1-IR antagonist), as well as with the endogenous IR agonists agmatine and harmane. It was found that moxonidine and rilmenidine at clinically relevant doses, similarly to the other IR ligands, do not have a significant impact on the macroscopic and histological signs of DSS-evoked inflammation. Likewise, colonic myeloperoxidase and serum interleukin-6 levels remained unchanged in response to these agents. Thus, our study demonstrates that imidazoline ligands do not influence significantly the severity of DSS-colitis in mice and suggest that they probably neither affect the course of IBD in humans. However, the translational value of these findings needs to be verified with other experimental colitis models and human studies.

  14. i+1”理论对我国外语教学的启示%The Enlightenment of"i+1"Theory to Foreign Language Teaching in China

    Institute of Scientific and Technical Information of China (English)

    张孔凤; 杨福

    2016-01-01

    20世纪70年代末,美国语言学家克拉申提出第二语言习得理论,该理论主要包括五个部分,其中输入假说即“i+1”理论是该理论的核心部分。本文通过对“i+1”理论内涵和语言输入特点进行阐述和分析,同时指证了该理论存在的不足,进而总结出该理论对我国外语教学的相关启示。%At the end of 1970s, Krashen, an American, put forward the theory of second language acquisition. The theory ma-inly consists of five parts, the input hypothesis is"i+1"theory, which is the core part of the theory. Based on"i+1"theoretical connotation and language input characteristics are described and analyzed, also testified the existence of the theory, and then summed up the related enlightenment of theory to foreign language teaching in our country.

  15. On i+1 Theory in College English Teaching%i+1理论对民族地区高校大学外语教学的启示

    Institute of Scientific and Technical Information of China (English)

    覃晓琪

    2013-01-01

    20世纪70年代末美国著名的应用语言学家Krashen提出的i+1理论是当今二语习得理论中最重要的概念之一。该理论对我国的外语教学研究,尤其是大学外语教学提供了一个很好的理论框架。本文试图对i+1理论进行简单的阐述和分析,然后尝试将该理论与当前民族地区高校大学外语教学实践相结合,最后总结i+1理论对该地区大学外语教学的启示和意义。%The i+1 theory advanced by the American applied linguist Krashen S.D. is one of the most influential concepts in the research and study of contemporary Second Language Acquisition. The theory provides a theoretical framework for the teaching of College English in China. This paper introduces the major ideas of the theory and tries to apply it to the teaching of College English in China. Finally the author comes up with her suggestions on how to apply this theory in classroom teaching of College English in China.

  16. Sympathoexcitation of moxonidine in the caudal ventrolateral medulla is dependent on I1-imidazoline receptors in anesthetized rats.

    Science.gov (United States)

    Wang, Li-Gang; Gao, Lie; Wang, Wei; Yuan, Wen-Jun; Wang, Wei-Zhong

    2007-10-16

    Moxonidine is a second-generation centrally acting antihypertensive drug that has a high affinity for I(1)-imidazoline receptors (I(1)R). The caudal ventrolateral medulla (CVLM), an important region involved in cardiovascular activity, contains binding sites for centrally acting drugs. Our study aimed to determine the effects of moxonidine injected into the CVLM on cardiovascular activity in anesthetized rats. Unilateral microinjection of moxonidine (0.4 and 4 nmol) into the CVLM dose-dependently increased blood pressure (BP) by 8+/-2 and 18+/-2 mmHg and renal sympathetic nerve activity (RSNA) by 19+/-3 and 48+/-5% without modifying heart rate. Microinjection of the I(1)R/alpha(2)-adrenoceptor antagonist efaroxan (4 nmol) into the CVLM produced significant decreases in baseline BP and RSNA, but also completely abolished the increases in BP (2+/-1 versus 18+/-2 mmHg, P0.05) effect on the moxonidine-induced increase in BP (18+/-2 versus 17+/-3 mmHg) and RSNA (45+/-10 versus 42+/-7%). The current data suggest that moxonidine injection into the CVLM has an excitatory effect on cardiovascular activity, which is mediated by an I(1)R dependent mechanism.

  17. 26 CFR 301.6103(i)-1 - Disclosure of returns and return information (including taxpayer return information) to and by...

    Science.gov (United States)

    2010-04-01

    ... (including taxpayer return information) to and by officers and employees of the Department of Justice or... investigation, involving enforcement of Federal criminal statute not involving tax administration. 301.6103(i)-1...) PROCEDURE AND ADMINISTRATION PROCEDURE AND ADMINISTRATION Information and Returns Returns and Records §...

  18. On the contribution of new interactions to the. delta. I=1/2 rule and CP violation parameters

    Energy Technology Data Exchange (ETDEWEB)

    Papantonopoulos, E.; Zoupanos, G.; Tracas, N.D.

    1987-04-23

    New interactions which could appear as low-energy remnants of high-dimensional theories ar studied in connection with their contribution to the ..delta..I=1/2 rule and CP violation parameters. The study is done in the framework of a particular superstring-inspired model; however, similar results could be obtained in a large class of models.

  19. Facile preparation of BiOCl x I1- x composites with enhanced visible-light photocatalytic activity

    Science.gov (United States)

    Yang, Yifan; Zhou, Feng; Zhan, Su; Liu, Yujun; Tian, Yu; He, Qiuchen

    2017-01-01

    BiOCl x I1- x composites demonstrating enhanced visible-light photodegradation activity were prepared via a hydrothermal method. The as-prepared samples were characterized by X-ray diffraction, X-ray photoelectron spectroscopy, UV-Vis diffuse reflection spectroscopy, field emission scanning electron microscopy, fourier transform infrared spectroscopy, transmission electron microscopy, Brunauer-Emmett-Teller, and electrochemical impedance spectroscopy, to demonstrate the successful formation of heterojunction in BiOCl x I1- x . When BiOI content was 50% ( x = 0.5), BiOCl0.5I0.5 showed an absorption edge of up to 560 nm, a bandgap energy ( E g) of 2.21 eV, and an obvious red shift by approximately 190 nm compared with bare BiOCl. In contrast with pure BiOCl that shows nearly no photocatalytic activity, the BiOCl x I1- x hybrid photocatalyst exhibited higher enhanced visible-light photocatalytic activity for photodegradation of methylene blue. The superior photocatalytic activity of this hybrid photocatalyst is attributed to the large surface areas and pore volume, good oxidizing power and light utilization, and modified band structure resulting from the presence of BiOCl x I1- x heterostructure. This work could provide a facile method to obtain a BiOCl x I1- x visible-light photocatalyst and to enhance the photocatalytic performance of the catalyst for practical application, because this photocatalyst is low cost and can be easily scaled up.

  20. Generating Units

    Data.gov (United States)

    Department of Homeland Security — Generating Units are any combination of physically connected generators, reactors, boilers, combustion turbines, and other prime movers operated together to produce...

  1. Biphasic dose-dependent modulation of cardiac parasympathetic activity by moxonidine, an imidazoline I1-receptor agonist.

    Science.gov (United States)

    Turcani, Marian

    2008-12-01

    Peripheral beta-adrenergic blockade and activation of central alpha2-adrenergic receptors have parasympathomimetic effects. The impact of activation of central imidazoline I1-receptors on vagal activity is not yet clear, but there is some evidence that imidazoline I1-receptors agonists may inhibit the parasympathetic system. Parasympatholytic effects may represent a risk for patient with reduced parasympathetic activity. To clarify the effect of imidazoline I1-receptors stimulation on vagal activity, increasing doses of moxonidine were applied subcutaneously to rats with implanted telemetric transmitters. Heart rate and blood pressure variability and baroreflex sensitivity were analyzed. Both, low (0.04, 0.12, and 0.36 mg/kg) and high (1.08 and 3.24 mg/kg), doses of moxonidine reduced the low-frequency power of systolic pressure variability, an index of sympathetic vascular modulation. Despite this reduction, low moxonidine doses neither reduced heart rate nor increased baroreflex gain. A decline of very low frequency power of heart rate variability, a sign of parasympatholysis, was observed with low doses of moxonidine, which can explain the absence of change in heart rate. High doses of moxonidine profoundly augmented very low and high-frequency power of heart rate variability and baroreflex sensitivity. These data suggest that the stimulation of imidazoline I1-receptors is not only sympatholytic but also seems to have as well a weak parasympatholytic effect. However, high doses of moxonidine are strongly parasympathomimetic through the activation of central alpha2-adrenoceptors. Recruitment of alpha2-adrenoceptors also results in manifestation of several side effects.

  2. Effects of adding different surfactants on antibiotic resistance genes and intI1 during chicken manure composting.

    Science.gov (United States)

    Zhang, Yajun; Li, Haichao; Gu, Jie; Qian, Xun; Yin, Yanan; Li, Yang; Zhang, Ranran; Wang, Xiaojuan

    2016-11-01

    Aerobic composting is usually employed to treat livestock manure. In this study, a bio-surfactant (rhamnolipid, RL) and chemical surfactant (Tween 80, Tw) were added to chicken manure during composting and their effects were determined on the variations in ARGs and intI1. After composting, the reductions in the RAs of ARGs and intI1 with the addition of Tw (1-4.7logs) were generally greater than that with the addition of RL (0.8-3.7logs) and the control (CK) (0.3-2.6logs), and the enrichment of ARGs was higher with CK (0.9-1.8logs). The ARG profiles were affected significantly by temperature and the water-soluble carbon contents. RL and Tw effectively reduced the concentrations of bio-available Cu and Zn, thereby hindering the co-selection of ARGs by heavy metals. The effects of RL and Tw on ARGs and intI1 indicate that the addition of Tw was slightly more effective than RL after composting.

  3. Crystal structure of Proteus mirabilis lipase, a novel lipase from the Proteus/psychrophilic subfamily of lipase family I.1.

    Directory of Open Access Journals (Sweden)

    Tyler P Korman

    Full Text Available Bacterial lipases from family I.1 and I.2 catalyze the hydrolysis of triacylglycerol between 25-45°C and are used extensively as biocatalysts. The lipase from Proteus mirabilis belongs to the Proteus/psychrophilic subfamily of lipase family I.1 and is a promising catalyst for biodiesel production because it can tolerate high amounts of water in the reaction. Here we present the crystal structure of the Proteus mirabilis lipase, a member of the Proteus/psychrophilic subfamily of I.1lipases. The structure of the Proteus mirabilis lipase was solved in the absence and presence of a bound phosphonate inhibitor. Unexpectedly, both the apo and inhibitor bound forms of P. mirabilis lipase were found to be in a closed conformation. The structure reveals a unique oxyanion hole and a wide active site that is solvent accessible even in the closed conformation. A distinct mechanism for Ca²⁺ coordination may explain how these lipases can fold without specific chaperones.

  4. Does The $\\triangle I ={1/2}$ Rule Hold In D And B $\\to \\pi \\pi$ Decays

    CERN Document Server

    Guo, Peng; Li, Xue-Qian; Guo, Peng; He, Xiao-Gang; Li, Xue-Qian

    2004-01-01

    Although two pion decays of $K$,$D$ and $B$ have similar isospin structures, there are dramatic differences in the ratios $R_K$ and $R_{D,B}$ of amplitudes from $\\Delta I =3/2$ and $\\Delta I =1/2$ interactions. In $K\\to \\pi\\pi$ decays there is the famous $\\Delta I =1/2$ rule with $R_K = 1/22$, whereas in $B(D) \\to \\pi\\pi$ decays the ratios $R_{D,B}$ are of order one and therefore there is no such a rule. In this work we study isospin decay amplitudes in $B (D)\\to \\pi\\pi$ using the QCD factorization. The results are consistent with observations that there is no $\\Delta I =1/2$ rule. We show that the effects of re-scattering between the two pions produced via the weak transition can play a crucial rule in understanding the differences between $B(D)\\to \\pi\\pi$ and $K\\to \\pi\\pi$ decays.

  5. UNIT, TIBET.

    Science.gov (United States)

    Louisiana Arts and Science Center, Baton Rouge.

    THE UNIT OF STUDY DESCRIBED IN THIS BOOKLET DEALS WITH THE GEOGRAPHY AND HISTORY OF TIBET. THE UNIT COVERS SOME OF THE GENERAL FEATURES OF THE COUNTRY AND THEIR EFFECT UPON THE LIVES OF THE TIBETAN PEOPLE. DISCUSSION QUESTIONS ARE INSERTED TO STIMULATE THOUGHT. THE RELIGION OF TIBET IS DISCUSSED IN RELATION TO ITS INFLUENCE ON THE ART AND CULTURE…

  6. Environmental perturbations at the early Eocene ETM2, H2, and I1 events as inferred by Tethyan calcareous plankton (Terche section, northeastern Italy)

    Science.gov (United States)

    D'Onofrio, Roberta; Luciani, Valeria; Fornaciari, Eliana; Giusberti, Luca; Boscolo Galazzo, Flavia; Dallanave, Edoardo; Westerhold, Thomas; Sprovieri, Mario; Telch, Sonia

    2016-09-01

    Several early Eocene hyperthermals have been recently investigated and characterized in terms of temperature anomalies and oceanographic changes. The effects of these climatic perturbations on biotic communities are much less constrained. Here we present new records from the Terche section (northeastern Italy) that, for the first time, integrates data on planktic foraminifera and calcareous nannofossils across three post-Paleocene-Eocene Thermal Maximum negative carbon isotope excursions (CIEs). The biomagnetostratigraphic framework generated at Terche allows us to confidently relate such CIEs to the Eocene Thermal Maximum 2 (ETM2), H2, and I1 events. Each of these events coincides with lithological anomalies characterized by significantly lower calcium carbonate content (marly units, MUs). We interpret these MUs as mainly linked to an effect of increased terrigenous dilution, as dissolution proxies do not display significant variations. Calcareous plankton assemblages change significantly across these events and radiolarians increase. Observed changes suggest that transient warming and environmental perturbations, though more intense during ETM2, occurred during each of the three investigated perturbations. Variations among calcareous plankton suggest increase in surface-water eutrophication with respect to the pre-event conditions, coupled with a weakening of the upper water-column thermal stratification. Higher nutrient discharge was related to intensification of the hydrological cycle as a consequence of the warmer climate. These conditions persisted during the early CIE recovery, implying slower recovery rates for the environment and biota than for the carbon cycle.

  7. Turnley Unit

    Data.gov (United States)

    Federal Laboratory Consortium — Facilities at this unit include cattle working pens, hydraulic squeeze chute and electronic scale, a maintenance building, and four hay storage sheds. There is one...

  8. Operable Units

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset consists of operable unit data from multiple Superfund sites in U.S. EPA Region 8. These data were acquired from multiple sources at different times and...

  9. Detector Unit

    CERN Multimedia

    1960-01-01

    Original detector unit of the Instituut voor Kernfysisch Onderzoek (IKO) BOL project. This detector unit shows that silicon detectors for nuclear physics particle detection were already developed and in use in the 1960's in Amsterdam. Also the idea of putting 'strips' onto the silicon for high spatial resolution of a particle's impact on the detector were implemented in the BOL project which used 64 of these detector units. The IKO BOL project with its silicon particle detectors was designed, built and operated from 1965 to roughly 1977. Detector Unit of the BOL project: These detectors, notably the ‘checkerboard detector’, were developed during the years 1964-1968 in Amsterdam, The Netherlands, by the Natuurkundig Laboratorium of the N.V. Philips Gloeilampen Fabrieken. This was done in close collaboration with the Instituut voor Kernfysisch Onderzoek (IKO) where the read-out electronics for their use in the BOL Project was developed and produced.

  10. Kaon to Two Pions decays from Lattice QCD: Delta I = 1/2 rule and CP violation

    Science.gov (United States)

    Liu, Qi

    We report a direct lattice calculation of the K to pipi decay matrix elements for both the DeltaI=1/2 and 3/2 amplitudes A0 and A2 on a 2+1 flavor, domain wall fermion, 163x32x16 lattice ensemble and a 243x64x16 lattice ensemble. This is a complete calculation in which all contractions for the required ten, four-quark operators are evaluated, including the disconnected graphs in which no quark line connects the initial kaon and final two-pion states. These lattice operators are non-perturbatively renormalized using the Rome-Southampton method and the quadratic divergences are studied and removed. This is an important but notoriously difficult calculation, requiring high statistics on a large volume. In this work we take a major step towards the computation of the physicalK→pipi amplitudes by performing a complete calculation at unphysical kinematics with pions of mass 422 MeV and 329 MeV at rest in the kaon rest frame. With this simplification we are able to resolve Re(A0) from zero for the first time, with a 25% statistical error on the 163 lattice and 15% on the 243 lattice. The complex amplitude A2 is calculated with small statistical errors. We obtain the DeltaI=1/2 rule with an enhancement factor of 9.1(21) and 12.0(17) on these two ensembles. From the detailed analysis of the results we gain a deeper understanding of the origin of the DeltaI=1/2 rule. We also calculate the complex amplitude A0, a calculation central to understanding and testing the standard model of CP violation in the kaon system. The final result for the measure of direct CP violation, epsilon', calculated at unphysical kinematics has an order of 100% statistical error, so this only serves as an order of magnitude check.

  11. Citrinal A, a novel tricyclic derivative of citrinin,from an algicolous fungus Penicillium sp. i-1-1

    Institute of Scientific and Technical Information of China (English)

    Tian Jiao Zhu; Lin Du; Peng Fei Hao; Zhen Jian Lin; Qian Qun Gu

    2009-01-01

    Citrinal A (1), a novel tricyclic compound with a rare tetrahydro-2H-benzofuro[7-b] [1,4]dioxin-9(3H)-one skeleton, along with two known related compounds, citrinin (2) and 2,3,4-trimethyl-5,7-dihydroxy-2,3-dihydrobenzofuran (3) were isolated from an algicolous fungus Penicillium sp. i-1-1. The structure and stereochemistry of 1 were determined by comprehensive spectral and biogenic analysis. Its cytotoxic effects on the A-549 and HL-60 cell lines were evaluated.

  12. Preliminary results of Delta I=1/2 and 3/2, K to pipi Decay Amplitudes from Lattice QCD

    Science.gov (United States)

    Liu, Q.

    We report a direct lattice calculation of the $K$ to $\\pi\\pi$ decay matrix elements for both $\\Delta I=1/2$ and $3/2$ channels on 2+1 flavor, domain wall fermion, $16^3\\times32$ lattices with zero $\\pi\\pi$ relative momentum and $m_\\pi=420$ MeV. All $K^0$ to $\\pi\\pi$ contractions are carefully listed and calculated. The decay into the isospin zero $\\pi\\pi$ final state, which receives contributions from the disconnected graphs, is very difficult to calculate, but a clear signal in the similar disconnected $\\pi\\pi$ correlator can be seen. Preliminary results, some with large errors, will be presented for the various contributions to the renormalized weak matrix elements $A_0$ and $A_2$. We obtain Re$(A_0)$ with $25%$ error in the case of zero momentum on shell decay, and find a factor of 6 enhancement for the $\\Delta I=1/2$ rule in the $420$ MeV pion system.

  13. Characterization of epidemic IncI1-Iγ plasmids harboring ambler class A and C genes in Escherichia coli and Salmonella enterica from animals and humans

    NARCIS (Netherlands)

    Smith, Hilde; Bossers, Alex; Harders, Frank; Wu, Guanghui; Woodford, Neil; Schwarz, Stefan; Guerra, Beatriz; Rodríguez, Irene; Essen-Zandbergen, Van Alieda; Brouwer, Michael; Mevius, Dik

    2015-01-01

    The aim of the study was to identify the plasmid-encoded factors contributing to the emergence and spread of epidemic IncI1-Iγ plasmids obtained from Escherichia coli and Salmonella enterica isolates from animal and human reservoirs. For this, 251 IncI1-Iγ plasmids carrying various extended-spect

  14. Characterization of epidemic IncI1-Iγ plasmids harboring ambler class A and C genes in Escherichia coli and Salmonella enterica from animals and humans

    NARCIS (Netherlands)

    Smith, Hilde; Bossers, Alex; Harders, Frank; Wu, Guanghui; Woodford, Neil; Schwarz, Stefan; Guerra, Beatriz; Rodríguez, Irene; van Essen-Zandbergen, Alieda; Brouwer, Michael; Mevius, Dik

    2015-01-01

    The aim of the study was to identify the plasmid-encoded factors contributing to the emergence and spread of epidemic IncI1-Iγ plasmids obtained from Escherichia coli and Salmonella enterica isolates from animal and human reservoirs. For this, 251 IncI1-Iγ plasmids carrying various extended-spectrum

  15. Thermostability and Photocatalytic Performance of BiOClxI1-xComposite Semiconductor%BiOClxI1-x 复合半导体的热稳定性及光催化性能

    Institute of Scientific and Technical Information of China (English)

    方稳; 何洪波; 薛霜霜; 余长林; 周晚琴

    2016-01-01

    BiOClxI1-x composite semiconductor photocatalysts were synthesized by a solvothermal method. The thermostability of the materials and the relationships among their phase, morphology, light absorption and photocatalytic performance in degradation acid orangeⅡwere investigated by X-ray diffraction, scanning electron microscopy, N2-physical adsorption, thermal gravity analysis, Fourier transform infrared spectroscopy, and ultraviolet-visible diffusion reflectance spectroscopy, respectively. The results show that the thermostability of the BiOCl0.25I0.75 is much weaker than that of BiOCl and stronger than that of BiOI. In the calcination, a Bi5O7I phase appears with the gradual release of I element. After calcination at 500 ℃, the compound is mainly composed of bismuth oxychloride. Moreover, the spherical structure is destroyed and the surface area and the surface OH groups are lost. The photocatalytic activity of BiOCl0.25I0.75 and BiOCl0.50I0.50 are greater than that of BiOCl and BiOI. After high-temperature calcination, the photocatalytic activity decreases. The destruction of texture and the loss of surface area and I element can lead to the reduction in photocatalytic activity.%通过溶剂热法合成了 BiOClxI1-x 系列复合半导体。采用 X 射线粉末衍射、扫描电子显微镜、氮气物理吸附、热重、Fourier 变换红外光谱和紫外–可见漫反射等技术对 BiOClxI1–x 的热稳定性、物相组成、形貌、光吸收性能和光催化活性因受热而发生的变化规律进行了考察。结果表明:BiOClxI1–x 复合样品的热稳定性优于 BiOI 而远弱于 BiOCl;热处理导致复合物中碘元素逐渐释放而转变为 Bi5O7I,至500℃以后,复合物组成主要为氯氧铋化合物;高温煅烧对复合物的整体形貌造成很大程度破坏;BiOCl0.25I0.75、BiOCl0.50I0.50的光催化性能优于纯 BiOCl 与 BiOI;经过不同温度煅烧后,催化剂的光催化活性均呈现了不同程度

  16. [Conservation Units.

    Science.gov (United States)

    Texas Education Agency, Austin.

    Each of the six instructional units deals with one aspect of conservation: forests, water, rangeland, minerals (petroleum), and soil. The area of the elementary school curriculum with which each correlates is indicated. Lists of general and specific objectives are followed by suggested teaching procedures, including ideas for introducing the…

  17. [Conservation Units.

    Science.gov (United States)

    Texas Education Agency, Austin.

    Instructional units deal with each aspect of conservation: forests, wildlife, rangelands, water, minerals, and soil. The area of the secondary school curriculum with which each is correlated is indicated. Lists of general and specific objectives are followed by suggested teaching procedures, including ideas for introducing the topic, questions to…

  18. IBM powerPC 405 SEU mitigation using processor voting techniques in Xilinx Virtex-I1 pro FPGA

    Science.gov (United States)

    Wang, Mandy W.; Bolotin, Gary S.

    2004-01-01

    Not until recently, Xilinx has developed a new field programmable gate array (FPGA) device family, Virtex-I1 Pro. In this single device, not only dies it have density logic cells (3K to125K), gigabit connectivity, on chip memory, digital clock management, but also it can have up to four IBM PowerPC 405 Processor hard cores, running up to 400MHz and 633 Mbps. To utilize this cutting edge device in space applications, a few Single Event Upset (SEU) mitigation techniques need to be implemented to a design for the device. At Jet Propulsion Laboratory (JPL), we have successfully demonstrated the feasibility of running multiple processors running in a lock step fashion to accomplish SEU mitigation and fault tolerance.

  19. On the duality between long-run relations and common trends in the I(1) versus I(2) model

    DEFF Research Database (Denmark)

    Juselius, Katarina

    1994-01-01

    Long-run relations and common trends are discussed in terms of the multivariate cointegration model given in the autoregressive and the moving average form. The basic results needed for the analysis of I(1) and 1(2)processes are reviewed and the results applied to Danish monetary data. The test p......, "excess money" is estimated and its effect on the other determinants of the system is investigated. In particular, it is found that "excess money" has no effect on price inflation...... procedures reveal that nominal money stock is essentially I(2). Long-run price homogeneity is supported by the data and imposed on the system. It is found that the bond rate is weakly exogenous for the long-run parameters and therefore act as a driving trend. Using the nonstationarity property of the data...

  20. Microbial Diversity in a Venezuelan Orthoquartzite Cave is Dominated by the Chloroflexi (Class Ktedonobacterales and Thaumarchaeota Group I.1c.

    Directory of Open Access Journals (Sweden)

    Hazel A Barton

    2014-11-01

    Full Text Available The majority of caves are formed within limestone rock and hence our understanding of cave microbiology comes from carbonate-buffered systems. In this paper, we describe the microbial diversity of Roraima Sur Cave, an orthoquartzite (SiO4 cave within Roraima Tepui, Venezuela. The cave contains a high level of microbial activity when compared with other cave systems, as determined by an ATP-based luminescence assay and cell counting. Molecular phylogenetic analysis of microbial diversity within the cave demonstrate the dominance of Actinomycetales and Alphaproteobacteria in endolithic bacterial communities close to the entrance, while communities from deeper in the cave are dominated (82-84% by a unique clade of Ktedonobacterales within the Chloroflexi. While members of this phylum are commonly found in caves, this is the first identification of members of the Class Ktedonobacterales. An assessment of archaeal species demonstrates the dominance of phylotypes from the Thaumarchaeota Group I.1c (100%, which have previously been associated with acidic environments. While the Thaumarchaeota have been seen in numerous cave systems, the dominance of Group I.1c in Roraima Sur Cave is unique and a departure from the traditional archaeal community structure. Geochemical analysis of the cave environment suggests that water entering the cave, rather than the nutrient-limited orthoquartzite rock, provides the carbon and energy necessary for microbial community growth and subsistence, while the poor buffering capacity of quartzite or the low pH of the environment may be selecting for this unusual community structure. Together these data suggest that pH, imparted by the geochemistry of the host rock, can play as important a role in niche-differentiation in caves as in other environmental systems.

  1. A Conserved Hydrophobic Core in Gαi1 Regulates G Protein Activation and Release from Activated Receptor.

    Science.gov (United States)

    Kaya, Ali I; Lokits, Alyssa D; Gilbert, James A; Iverson, T M; Meiler, Jens; Hamm, Heidi E

    2016-09-09

    G protein-coupled receptor-mediated heterotrimeric G protein activation is a major mode of signal transduction in the cell. Previously, we and other groups reported that the α5 helix of Gαi1, especially the hydrophobic interactions in this region, plays a key role during nucleotide release and G protein activation. To further investigate the effect of this hydrophobic core, we disrupted it in Gαi1 by inserting 4 alanine amino acids into the α5 helix between residues Gln(333) and Phe(334) (Ins4A). This extends the length of the α5 helix without disturbing the β6-α5 loop interactions. This mutant has high basal nucleotide exchange activity yet no receptor-mediated activation of nucleotide exchange. By using structural approaches, we show that this mutant loses critical hydrophobic interactions, leading to significant rearrangements of side chain residues His(57), Phe(189), Phe(191), and Phe(336); it also disturbs the rotation of the α5 helix and the π-π interaction between His(57) and Phe(189) In addition, the insertion mutant abolishes G protein release from the activated receptor after nucleotide binding. Our biochemical and computational data indicate that the interactions between α5, α1, and β2-β3 are not only vital for GDP release during G protein activation, but they are also necessary for proper GTP binding (or GDP rebinding). Thus, our studies suggest that this hydrophobic interface is critical for accurate rearrangement of the α5 helix for G protein release from the receptor after GTP binding.

  2. FLYING UNITED

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Apart from selling hundreds of airplanes to China, Boeing buys locally made aircraft parts and transfers technology, in the true spirit of partnership Whenever Boeing's senior manager hear of a visit by one of China's state leaders, it's no doubt cause for celebration. Since China and the United States established diplomatic ties in 1978, every official trip by China's top statesmen has included a meeting with Boeing that

  3. The vacA i1 genotype of Helicobacter pylori is associated with peptic ulcer and gastric cancer:A meta-analysis

    Institute of Scientific and Technical Information of China (English)

    Juping Rui; Guochang Chen; Boneng Mao; Qi Pan

    2014-01-01

    There are two genotypes of the vacA intermediate region, i1 and i2; however, the association between the genotypes and gastroduodenal disease remains to be elucidated. The aim of this article was to investigate the interaction between the genotypes andH. pylori-associated diseases such as chronic gastritis, peptic ulcer disease (PUD) and gastric cancer.Methods: The meta-analysis was performed in Review Manager 4.2.2.Results: Eleven (ten articles and one abstract) met the inclusion criteria and were included. The i1 genotype increased the risk of PUD (OR = 1.70, 95% CI: 1.24-2.33,P <0.001) and gastric cancer (OR = 3.90, 95% CI: 2.64-5.78,P < 0.001). Sub-analysis showed that the i1 genotype was signifi-cantly associated with gastric ulcers (OR = 2.59, 95% CI: 1.05-6.35,P = 0.040), but not with duodenal ulcers (OR = 1.04, 95%CI: 0.61-1.76,P = 0.90). In addition, the association between the i1 genotype and PUD and GC existed in studies not only from Europe but also Asia, except for the association between the i1 genotype and PUD in Asian population.Conclusion: The vacA i1 genotype is associated with an increased risk of the development of peptic ulcer disease (mainly gastric ulcer) and gastric cancer. In geographical distribution, the association between the i1 genotype and PUD and GC existed in studies not only from Europe but also Asia, except for the association between the i1 genotype and PUD in Asian population.

  4. First-principle calculations of the fundamental properties of CuBrxI1-x ternary alloy

    Science.gov (United States)

    Touam, S.; Boukhtouta, M.; Hamioud, L.; Ghemid, S.; Meradji, H.; El Haj Hassan, F.

    2015-11-01

    Ab initio full-potential linearised augmented plane wave (FP-LAPW) method within density functional theory is applied to study the effect of composition on the structural, electronic and thermodynamic properties of CuBrxI1-x ternary alloy. The structural properties at equilibrium are investigated by using the new form of generalised gradient approximations that are based on the optimisation of total energy. For band structure calculations, both Engel-Vosko and modified Becke-Johnson of the exchange-correlation energy and potential, respectively, are used. Deviation of the lattice constants from Vegard's law and the bulk modulus from linear concentration dependence are observed. The microscopic origins of the gap bowing were explained by using the approach of Zunger and co-workers. On the other hand, the thermodynamic stability of this alloy was investigated by calculating the excess enthalpy of mixing ∆Hm as well as the phase diagram by calculating the critical temperatures. A numerical first-principle calculations of the elastic constants as function of pressure is used to calculate C11, C12 and C44.

  5. I = 1 and I = 2 π-π scattering phase shifts from Nf = 2 + 1 lattice QCD

    Science.gov (United States)

    Bulava, John; Fahy, Brendan; Hörz, Ben; Juge, Keisuke J.; Morningstar, Colin; Wong, Chik Him

    2016-09-01

    The I = 1 p-wave and I = 2 s-wave elastic π-π scattering amplitudes are calculated from a first-principles lattice QCD simulation using a single ensemble of gauge field configurations with Nf = 2 + 1 dynamical flavors of anisotropic clover-improved Wilson fermions. This ensemble has a large spatial volume V =(3.7 fm) 3, pion mass mπ = 230 MeV, and spatial lattice spacing as = 0.11 fm. Calculation of the necessary temporal correlation matrices is efficiently performed using the stochastic LapH method, while the large volume enables an improved energy resolution compared to previous work. For this single ensemble we obtain mρ /mπ = 3.350 (24), gρππ = 5.99 (26), and a clear signal for the I = 2 s-wave. The success of the stochastic LapH method in this proof-of-principle large-volume calculation paves the way for quantitative study of the lattice spacing effects and quark mass dependence of scattering amplitudes using state-of-the-art ensembles.

  6. Endoglucanase production with the newly isolated Myceliophtora sp. i-1d3b in a packed bed solid state fermentor

    Directory of Open Access Journals (Sweden)

    A. I. Zanelato

    2012-12-01

    Full Text Available This work is aimed to produce endoglucanase through solid state fermentation in a packed bed bioreactor with the use of the fungus Myceliophtora sp. I-1D3busing a mixture of wheat bran (WB and sugar cane bagasse (SCB as culture medium. Preliminary tests were performed in polypropylene plastic bags, controlling the variables temperature (40, 45, and 50ºC, initial moisture content (75, 80, and 85%, w.b., and weight proportion SCB/WB (1:1, 7:3, and 9:1. The highest enzyme activities in plastic bags were obtained using the substrate proportion of 7:3, 50ºC temperature, and 80% initial moisture content (878 U/grams of dry solid. High activities of filter-paper cellulase and xylanase were also obtained in plastic bags and some results are reported. For the packed bed experiments, the temperature (45 and 50ºC and the air flow rate (80, 100 and 120L/h were the controlled variables. Activity of endoglucanase was similar to plastic bag tests. A longitudinal gradient of moisture content, was observed increasing from the bottom to the top of the reactor, even though the longitudinal enzyme activity profile was flat for almost the whole bed. Air flow rate did not affect enzyme activity, while experiments carried out at 50ºC showed higher enzyme activities. The maximum temperature peak observed was at about 6ºC above the process temperature.

  7. United States

    Directory of Open Access Journals (Sweden)

    Stephen Bernow

    1998-12-01

    Full Text Available This paper presents and discusses an integrated set of policies designed to reduce U.S. carbon emissions over the next four decades. This innovation path also aims to promote environmental quality, particularly by reducing emissions of criteria air pollutants, to reduce U.S. dependence on imported oil, and to induce technological innovation and diffusion in energy production and consumption. The innovation path would reduce economy-wide carbon emissions by 26% below baseline projections for 2010 and by 62% below baseline projections for 2030; this translates into 10% below 1990 levels in 2010 and 45% below 1990 levels in 2030. Emissions of criteria pollutants also would be significantly reduced, as would petroleum imports by the United States. Moreover, the innovation path would yield cumulative net savings for the United States of $218 billion (1993 dollars through 2010, or $19 billion on a leveled annual basis, and would result in 800,000 additional jobs nationwide by 2010. Although the overall findings from the innovation path analysis are robust, the results should be taken as indicative, rather than precisely predictive, owing to uncertainties in future costs, prices, technology performance, and consumer behavior.

  8. Effects of the selective I1 imidazoline receptor agonist, moxonidine, on gastric secretion and gastric mucosal injury in rats.

    Science.gov (United States)

    Glavin, G B; Smyth, D D

    1995-01-01

    1. Previous reports of the effects of alpha 2-adrenoceptor stimulation on gastric secretion are inconsistent because it was not clear whether the compounds were activating alpha 2-adrenoceptors and/or newly described imidazoline receptors. In the present experiments, the effects of moxonidine, an I1-imidazoline receptor agonist and antihypertensive agent, on gastric secretion and on experimental gastric mucosal injury were examined. 2. Moxonidine (0.01, 0.1 and 1.0 mg kg-1, i.p.) potently inhibited basal (non-stimulated) gastric acid secretion in conscious rats with an ED50 of 0.04 mg kg-1. Two hours following administration of the highest dose of moxonidine (1.0 mg kg-1), gastric acid output was completely suppressed. Moxonidine also significantly increased intragastric pH, at the two highest doses. 3. The alpha 2-adrenoceptor agonist, clonidine (0.01, 0.1 and 1.0 mg kg-1, i.p.) decreased basal acid secretion at the lowest dose (37%) and at the highest dose (46%), while the intermediate dose did not affect gastric acid output. 4. In an ethanol-induced model of gastric mucosal injury, moxonidine decreased the length of lesions at the lowest and highest doses (0.01 and 1.0 mg kg-1) as well as the number of the lesions, at the highest dose (1.0 mg kg-1). 5. In pylorus-ligated rats, moxonidine significantly decreased acid secretion (all doses), total secretory volume (1.0 mg kg-1) as well as pepsin output (1.0 mg kg-1). 6. In comparison to clonidine, moxonidine appears to be a more potent anti-secretory and gastric-protective compound.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:7773534

  9. Genome sequence of Candidatus Nitrososphaera evergladensis from group I.1b enriched from Everglades soil reveals novel genomic features of the ammonia-oxidizing archaea.

    Directory of Open Access Journals (Sweden)

    Kateryna V Zhalnina

    Full Text Available The activity of ammonia-oxidizing archaea (AOA leads to the loss of nitrogen from soil, pollution of water sources and elevated emissions of greenhouse gas. To date, eight AOA genomes are available in the public databases, seven are from the group I.1a of the Thaumarchaeota and only one is from the group I.1b, isolated from hot springs. Many soils are dominated by AOA from the group I.1b, but the genomes of soil representatives of this group have not been sequenced and functionally characterized. The lack of knowledge of metabolic pathways of soil AOA presents a critical gap in understanding their role in biogeochemical cycles. Here, we describe the first complete genome of soil archaeon Candidatus Nitrososphaera evergladensis, which has been reconstructed from metagenomic sequencing of a highly enriched culture obtained from an agricultural soil. The AOA enrichment was sequenced with the high throughput next generation sequencing platforms from Pacific Biosciences and Ion Torrent. The de novo assembly of sequences resulted in one 2.95 Mb contig. Annotation of the reconstructed genome revealed many similarities of the basic metabolism with the rest of sequenced AOA. Ca. N. evergladensis belongs to the group I.1b and shares only 40% of whole-genome homology with the closest sequenced relative Ca. N. gargensis. Detailed analysis of the genome revealed coding sequences that were completely absent from the group I.1a. These unique sequences code for proteins involved in control of DNA integrity, transporters, two-component systems and versatile CRISPR defense system. Notably, genomes from the group I.1b have more gene duplications compared to the genomes from the group I.1a. We suggest that the presence of these unique genes and gene duplications may be associated with the environmental versatility of this group.

  10. Transformation of inorganic P fractions of soil and plant growth promotion by phosphate-solubilizing ability of Penicillium oxalicum I1.

    Science.gov (United States)

    Gong, Mingbo; Du, Peng; Liu, Xue; Zhu, Changxiong

    2014-12-01

    The solubilization of tricalcium phosphate is often considered as the standard for screening of most phosphate-solubilizing microorganisms (PSMs). However, usually the effect of large-scale application of PSM on the promotion of crop growth varies. This study presents an efficient method for screening and testing phosphate-solubilizing fungus that enhance plant growth. A fungus Penicillium oxalicum I1 (P-I1) was isolated and identified that had high ability of phosphate-solubilization and could utilize maize root exudates as sources, and propagate well in vitro and in soil. P-I1 excreted oxalic acid and reached 593.9 μg/ml, and the pH value was decreased from 6.90 to 1.65 in 26 h. The amount of P-I1 increased by 48-fold in 28 d and was maintained for 49 d in soil. PSM showed selectivity on the transformation of the different forms of phosphorus, a wide range of insoluble phosphates, such as Ca₈H₂(PO₄)₆·5H₂O, AlPO₄, FePO₄, and Ca10(PO₄)₆(OH)₂, were converted to soluble CaHPO₄in soil, and CaHPO₄was also inhibited from being converted into insoluble phosphate by P-I1. The Ca₂-P content reached 27.11 μg/g soil on day 28 at 20°C, which increased by 110.32%, and plant growth promotion was tested and verified, the results showed that maize yield increased remarkably than control after inoculated P-I1, maize yield increased maximum by 14.47%. The data presented that P-I1 appear attractive for exploring their plant growth-promoting activity and potential field application.

  11. Termination unit

    Energy Technology Data Exchange (ETDEWEB)

    Traeholt, Chresten; Willen, Dag; Roden, Mark; Tolbert, Jerry C.; Lindsay, David; Fisher, Paul W.; Nielsen, Carsten Thidemann

    2016-05-03

    Cable end section comprises end-parts of N electrical phases/neutral, and a thermally-insulation envelope comprising cooling fluid. The end-parts each comprises a conductor and are arranged with phase 1 innermost, N outermost surrounded by the neutral, electrical insulation being between phases and N and neutral. The end-parts comprise contacting surfaces located sequentially along the longitudinal extension of the end-section. A termination unit has an insulating envelope connected to a cryostat, special parts at both ends comprising an adapter piece at the cable interface and a closing end-piece terminating the envelope in the end-section. The special parts houses an inlet and/or outlet for cooling fluid. The space between an inner wall of the envelope and a central opening of the cable is filled with cooling fluid. The special part at the end connecting to the cryostat houses an inlet or outlet, splitting cooling flow into cable annular flow and termination annular flow.

  12. [The role of alpha2-adrenergic and I1-imidazoline receptors in the effects of clonidine and moxonidine on isolated large intestine of mice].

    Science.gov (United States)

    Kozaeva, L P; Korobov, N V; Medvedev, O S

    2005-01-01

    The ability of clonidine and moxonidine to interact with alpha2-adreno- and I1-imidazoline receptors was studied on isolated segments of large intestine of mice. Both drugs induced dose-dependent contractions in longitudinal muscles of the intestine segments. In both cases, the drug action was almost equally decreased by pretreatment with of yohimbine (alpha2-adrenoreceptor agonist with low affinity to I1-imidazoline receptors) and efaroxan (I1-imidazoline receptor agonist with low affinity to alpha2-adrenoreceptors). Analysis of the ratios of the antagonist activities (pA2) of yohimbine and efaroxan with respect to clonidine and moxonidine, as well as the relative selectivity of the two antagonists suggested that the action of both drugs on the large intestine is realized predominantly via alpha2-adrenoreceptors.

  13. 17 CFR 274.302 - Form N-27I-1, notice of right of withdrawal and refund for variable life insurance...

    Science.gov (United States)

    2010-04-01

    ... of withdrawal and refund for variable life insurance contractholders required pursuant to Rule 6e-2... for Exemptions § 274.302 Form N-27I-1, notice of right of withdrawal and refund for variable life insurance contractholders required pursuant to Rule 6e-2 (§ 270.6e-2 of this chapter). Editorial Note:...

  14. The IncI1 plasmid carrying the bla CTX-M-1 gene persists in in vitro culture of a Escherichia coli strain from broilers

    NARCIS (Netherlands)

    Fischer, E.A.J.; Dierikx, C.M.; Essen-Zandbergen, van A.; Roermund, van H.J.W.; Mevius, D.J.; Stegeman, A.; Klinkenberg, D.

    2014-01-01

    Commensal bacteria are a reservoir for antimicrobial-resistance genes. In the Netherlands, bacteria producing Extended Spectrum Beta-Lactamases (ESBL) are found on chicken-meat and in the gut of broilers at a high prevalence and the predominant ESBL-gene is the blaCTX-M-1 located on IncI1 plasmids.

  15. In vitro recombination catalyzed by bacterial class 1 integron integrase IntI1 involves cooperative binding and specific oligomeric intermediates.

    Directory of Open Access Journals (Sweden)

    Véronique Dubois

    Full Text Available Gene transfer via bacterial integrons is a major pathway for facilitating the spread of antibiotic resistance genes across bacteria. Recently the mechanism underlying the recombination catalyzed by class 1 integron recombinase (IntI1 between attC and attI1 was highlighted demonstrating the involvement of a single-stranded intermediary on the attC site. However, the process allowing the generation of this single-stranded substrate has not been determined, nor have the active IntI1*DNA complexes been identified. Using the in vitro strand transfer assay and a crosslink strategy we previously described we demonstrated that the single-stranded attC sequences could be generated in the absence of other bacterial proteins in addition to IntI. This suggests a possible role for this protein in stabilizing and/or generating this structure. The mechanism of folding of the active IntI*DNA complexes was further analyzed and we show here that it involves a cooperative binding of the protein to each recombination site and the emergence of different oligomeric species specific for each DNA substrate. These findings provide further insight into the recombination reaction catalyzed by IntI1.

  16. Promoting health: action in infant nutrition - doi: 10.4025/actascihealthsci.v35i1.14045

    Directory of Open Access Journals (Sweden)

    Cintia Freitas Casimiro

    2013-03-01

    Full Text Available Thousands of children under five die from preventable diseases. Community interventions that emphasize primary care on health and nutrition have been identified as one of the solutions to overcome this problem. This study aimed to develop educational workshops to improve the perception of mothers about infant nutrition, using a qualitative approach with technical educational workshops, in a Health Unit of the City of Fortaleza, during the period from February to June 2008. The seven participants were mothers accompanying their children in childcare consultation. The analysis of data was made through a survey and saturation of responses, from where the thematic categories emerged: the contribution of educational workshops, breastfeeding and introduction of complementary feeding. The educational activities allowed a better awareness of mothers in relation to child nutrition and development of critical awareness of their essential role on children nutrition. In conclusion, the professional should emphasize the importance and benefits of adequate diet, and for this is necessary educational strategies in health, offering exchanges of knowledge, since they are different experiences in which the learning is significant.  

  17. Early Eocene hyperthermal events ETM2, H2 and I1 as recorded by Tethyan planktic foraminifera in the Terche section (northernastern Italy)

    Science.gov (United States)

    D'Onofrio, Roberta; Luciani, Valeria; Giusberti, Luca; Fornaciari, Eliana; Sprovieri, Mario

    2014-05-01

    In the last years, several transient episodes of extreme warming, the so-called hyperthermals, have been recognized in addition to the well-know Paleocene-Eocene Thermal Maximum (PETM; ~55.5 Ma), superimposed on the long-term Paleocene-early Eocene warming trend peaking in the Early Eocene Climatic Optimum (EECO). To the present, perturbations produced by hyperthermals are well documented in terms of isotopic variations whereas their influence on the biota is still largely unexplored. The Terche section, located in the Venetian Pre-Alps (northeastern Italy), is an expanded latest Paleocene-lower Eocene succession deposited in a bathyal setting of a continental margin of the central-western Tethys. This section is particularly suitable to study post-PETM hyperthermals because it contains three well-exposed and expanded marly-clayey units (MUs) corresponding to intervals of negative carbon isotope excursions (CIEs). Calcareous plankton biostratigraphy allow us to refer them to the hyperthermals ETM2 (or H1; ~53.7 Ma), H2 (~53.6 Ma) and I1(~53.3 Ma). Here we present the first detailed quantitative analysis of planktic foraminiferal assemblages across these early Eocene hyperthermals events. Quantitative analysis of planktic foraminiferal genera shows a long-term trend of variation upon which higher frequency variations are superimposed. We interpret such long-term variation as the response to the long-term warming trend since it highlights a slight increase of the warm indicators, such as the acarininids, and decrease of the cold form subbotinids. The high frequency variations, instead, closely related to the CIEs and to the MUs, record a pronounced increase in acarininids (up to 68%) and a parallel marked decline in the abundances of subbotinids and other component of planktic foraminiferal assemblages. The MUs are also associated with an increase of the eutrophic radiolarians. This aspect, together with the dominance of acarininids, can be interpreted as a

  18. In situ formed Bi/BiOBrxI1-x heterojunction of hierarchical microspheres for efficient visible-light photocatalytic activity.

    Science.gov (United States)

    Zheng, Chunrui; Cao, Chuanbao; Ali, Zulfiqar

    2015-05-28

    Bi nanoparticles deposited in situ in BiOBrxI1-x hierarchical microspheres (Bi/BiOBrxI1-x heterojunction) were synthesized by a facile one-step solvothermal method. The as-prepared samples were characterized via XRD, SEM, TEM, XPS, UV-vis absorption spectroscopy and N2 adsorption-desorption. The hierarchical microspheres were composed of numerous nanosheets aggregated together compactly to form a spherical geometry. Results indicated that Bi nanoparticles were generated on the surface of BiOBrxI1-x microspheres via the in situ reduction of Bi(3+) by ethylene glycol. BiOBrxI1-x microspheres with deposited Bi nanoparticles were employed for the degradation of RhB under visible-light irradiation and the samples exhibited exceptionally enhanced photocatalytic activity. This immense enhancement in photocatalytic activity was attributed to the contribution of Bi nanoparticles to the efficient separation of electron-hole pairs and prolongation of the lifetime of charge carriers. The behavior of Bi nanoparticles as a cocatalyst for enhancing photocatalytic activity is similar to that of noble metals in photocatalysis. The as-prepared Bi/BiOBr0.266I0.734 sample exhibited highest photocatalytic activity, which exceeded those of other types of visible-light photocatalysts such as N-TiO2, Eu(3+)-BiOI, BiOBr, BiOBr0.2I0.8/graphene and even Ag/AgBr/BiOBr. The Bi/BiOBr0.266I0.734 sample displayed high photochemical stability under repeated visible-light irradiation, which is especially important for its practical application. The active species produced from Bi/BiOBrxI1-x under visible light were hydroxyl radicals. Bi/BiOBrxI1-x could generate more hydroxyl radicals due to the Bi nanoparticles, contributing to the enhance oxidation ability. This study demonstrated the high feasibility of utilizing low-cost Bi nanoparticles as a substitute for noble metals to enhance visible-light photocatalysis.

  19. X-ray production cross sections at incident photon energies across the M{sub i} (i=1-5) edges of {sub 90}Th

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Rajnish; Shehla,; Kumar, Anil; Puri, Sanjiv, E-mail: sanjivpurichd@yahoo.com [Department of Basic and Applied Sciences, Punjabi University, Patiala, Punjab, India-147002 (India)

    2015-08-28

    The X-ray production cross sections for the M{sub k} (k= ξ, δ, α, β, ζ, γ, m{sub 1}, m{sub 2}) groups of X-rays have been evaluated at incident photon energies across the M{sub i} (i =1-5) edges of {sub 90}Th using the relativistic Hartree-Fock-Slater model based photoionisation cross sections and recently reported values of the M-shell X-ray emission rates, fluorescence and Coster Kronig yields. Further, the energies of the prominent (M{sub i}-S{sub j}) (S{sub j}=N{sub j}, O{sub j} and i =1-3, j =1-7) resonant Raman scattered (RRS) peaks at different incident photon energies have also been evaluated using the neutral-atom electron binding energies (E{sub sj}) based on the relaxed orbital relativistic Hartree-Fock-Slater model.

  20. Theoretical X-ray production cross sections at incident photon energies across Li (i=1-3) absorption edges of Br

    Science.gov (United States)

    Puri, Sanjiv

    2015-08-01

    The X-ray production (XRP) cross sections, σLk (k = l, η, α, β6, β1, β3, β4, β9,10, γ1,5, γ2,3) have been evaluated at incident photon energies across the Li(i=1-3) absorption edge energies of 35Br using theoretical data sets of different physical parameters, namely, the Li(i=1-3) sub-shell the X-ray emission rates based on the Dirac-Fock (DF) model, the fluorescence and Coster Kronig yields based on the Dirac-Hartree-Slater (DHS) model, and two sets of the photoionisation cross sections based on the relativistic Hartree-Fock-Slater (RHFS) model and the Dirac-Fock (DF) model, in order to highlight the importance of electron exchange effects at photon energies in vicinity of absorption edge energies.

  1. X-ray production cross sections at incident photon energies across the Mi (i=1-5) edges of 90Th

    Science.gov (United States)

    Kaur, Rajnish; Shehla, Kumar, Anil; Puri, Sanjiv

    2015-08-01

    The X-ray production cross sections for the Mk (k= ξ, δ, α, β, ζ, γ, m1, m2) groups of X-rays have been evaluated at incident photon energies across the Mi (i =1-5) edges of 90Th using the relativistic Hartree-Fock-Slater model based photoionisation cross sections and recently reported values of the M-shell X-ray emission rates, fluorescence and Coster Kronig yields. Further, the energies of the prominent (Mi-Sj) (Sj=Nj, Oj and i =1-3, j =1-7) resonant Raman scattered (RRS) peaks at different incident photon energies have also been evaluated using the neutral-atom electron binding energies (Esj) based on the relaxed orbital relativistic Hartree-Fock-Slater model.

  2. Cellular model of neuronal atrophy induced by DYNC1I1 deficiency reveals protective roles of RAS-RAF-MEK signaling

    Directory of Open Access Journals (Sweden)

    Zhi-Dong Liu

    2016-08-01

    Full Text Available Abstract Neuronal atrophy is a common pathological feature occurred in aging and neurodegenerative diseases. A variety of abnormalities including motor protein malfunction and mitochondrial dysfunction contribute to the loss of neuronal architecture; however, less is known about the intracellular signaling pathways that can protect against or delay this pathogenic process. Here, we show that the DYNC1I1 deficiency, a neuron-specific dynein intermediate chain, causes neuronal atrophy in primary hippocampal neurons. With this cellular model, we are able to find that activation of RAS-RAF-MEK signaling protects against neuronal atrophy induced by DYNC1I1 deficiency, which relies on MEK-dependent autophagy in neuron. Moreover, we further reveal that BRAF also protects against neuronal atrophy induced by mitochondrial impairment. These findings demonstrate protective roles of the RAS-RAF-MEK axis against neuronal atrophy, and imply a new therapeutic target for clinical intervention.

  3. Hepatitis B virus candidate subgenotype I1 varies in distribution throughout Guangxi, China and may have originated in Long An county, Guangxi.

    Science.gov (United States)

    Li, Guo-Jian; Hue, Stéphane; Harrison, Tim J; Yang, Jin-Ye; Chen, Qin-Yan; Wang, Xue-Yan; Fang, Zhong-Liao

    2013-05-01

    Sequencing of the complete hepatitis B virus (HBV) genomes from Vietnam, China and Laos led to the identification of a complex recombinant, referred to initially as an aberrant genotype and later proposed to be a new genotype, I. However, epidemiological data regarding this new genotype are lacking. A cross-sectional study was carried out to investigate the epidemiology of HBV candidate genotype I in Guangxi, China using stratified, random cluster sampling. Four thousand five hundred thirteen subjects were recruited from five counties within Guangxi. Three genotypes, B, C, and I, were identified with a prevalence of 32.6% (114/350), 64% (224/350), and 3.4% (12/350), respectively. All the genotype I isolates belong to candidate subgenotype I1 and were found in Bing Yang (15.3%, 9/59) and Na Po (5.0%, 3/60) counties only. The prevalence of this subgenotype is significantly higher in males (5.1%, 10/195) than in females (1.3%, 2/155; X(2)  = 3.959, P HBV serological markers. Phylogeographic analysis revealed that genotype I1 likely arose in Long An county, then spread later to Bing Yang, Na Po counties and elsewhere in southeast Asia. In conclusion, the distribution of candidate genotype I within Guangxi is not even and it is highly endemic in some counties. Its prevalence is associated with gender and ethnicity. Subgenotype I1 likely originated in Long An county.

  4. Final State Interactions in $K\\to\\pi\\pi$ Decays: $\\Delta I=1/2$ Rule vs. $\\varepsilon^\\prime/\\varepsilon$

    CERN Document Server

    Buras, Andrzej J

    2016-01-01

    Dispersive effects from strong $\\pi\\pi$ rescattering in the final state (FSI) of weak $K\\to\\pi\\pi$ decays are revisited with the goal to have a global view on their {\\it relative} importance for the $\\Delta I=1/2$ rule and the ratio $\\varepsilon^\\prime/\\varepsilon$ in the Standard Model (SM). We point out that this goal cannot be reached within a pure effective (meson) field approach like chiral perturbation theory in which the dominant current-current operators governing the $\\Delta I=1/2$ rule and the dominant density-density (four-quark) operators governing $\\varepsilon^\\prime/\\varepsilon$ cannot be disentangled from each other. But in the context of a dual QCD approach, which includes both long distance dynamics and the UV completion, that is QCD at short distance scales, such a distinction is possible. We find then that beyond the strict large $N$ limit, $N$ being the number of colours, FSI are likely to be important for the $\\Delta I=1/2$ rule but much less relevant for $\\varepsilon^\\prime/\\varepsilon$....

  5. 1-[(Imidazolidin-2-yl)imino]indazole. Highly alpha 2/I1 selective agonist: synthesis, X-ray structure, and biological activity.

    Science.gov (United States)

    Saczewski, Franciszek; Kornicka, Anita; Rybczyńska, Apolonia; Hudson, Alan L; Miao, Shu Sean; Gdaniec, Maria; Boblewski, Konrad; Lehmann, Artur

    2008-06-26

    Novel benzazole derivatives bearing a (imidazolidin-2-yl)imino moiety at position 1 or 2 were synthesized by reacting 1-amino- or 2-aminobenzazoles with N, N'-bis( tert-butoxycarbonyl)imidazolidine-2-thione in the presence of HgCl 2. Structures of 1-[(imidazolidin-2-yl)imino]indazole (marsanidine, 13a) and free base of the 4-Cl derivative 12e were confirmed by X-ray single crystal structure analysis. Compound 13a was found to be the selective alpha 2-adrenoceptor ligand with alpha 2-adrenoceptor/imidazoline I 1 receptor selectivity ratio of 3879, while 1-[(imidazolidin-2-yl)imino]-7-methylindazole ( 13k) proved to be a mixed alpha 2-adrenoceptor/imidazoline I 1 receptor agonist with alpha 2/I 1 selectivity ratio of 7.2. Compound 13k when administered intravenously to male Wistar rats induced a dose-dependent decrease in mean arterial blood pressure (ED50 = 0.6 microg/kg) and heart rate, which was attenuated following pretreatment with alpha 2A-adrenoceptor antagonist RX821002. Compound 13a may find a variety of medical uses ascribed to alpha 2-adrenoceptor agonists, and its 7-methyl derivative 13k is a good candidate for development as a centrally acting antihypertensive drug.

  6. Using SI Units in Astronomy

    Science.gov (United States)

    Dodd, Richard

    2011-12-01

    1. Introduction; 2. An introduction to SI units; 3. Dimensional analysis; 4. Unit of angular measure (radian); 5. Unit of time (second); 6. Unit of length (metre); 7. Unit of mass (kilogram); 8. Unit of luminous intensity (candela); 9. Unit of thermodynamic temperature (kelvin); 10. Unit of electric current (ampere); 11. Unit of amount of substance (mole); 12. Astronomical taxonomy; Index.

  7. IL4I1 Is a Novel Regulator of M2 Macrophage Polarization That Can Inhibit T Cell Activation via L-Tryptophan and Arginine Depletion and IL-10 Production.

    Directory of Open Access Journals (Sweden)

    Yinpu Yue

    Full Text Available Interleukin 4-induced gene-1 (IL4I1 was initially described as an early IL-4-inducible gene in B cells. IL4I1 protein can inhibit T cell proliferation by releasing its enzymatic catabolite, H2O2, and this effect is associated with transient down-regulation of T cell CD3 receptor-zeta (TCRζ expression. Herein, we show that IL4I1 contributes to the regulation of macrophage programming. We found that expression of IL4I1 increased during bone marrow-derived macrophage (BMDM differentiation, expression of IL4I1 is much higher in primary macrophages than monocytes, and IL4I1 expression in BMDMs could be induced by Th1 and Th2 cytokines in two different patterns. Gene expression analysis revealed that overexpression of IL4I1 drove the expression of M2 markers (Fizz1, Arg1, YM-1, MR and inhibited the expression of M1-associated cytokines. Conversely, knockdown of IL4I1 by siRNA resulted in opposite effects, and also attenuated STAT-3 and STAT-6 phosphorylation. Furthermore, IL4I1 produced by macrophages catalyzed L-tryptophan degradation, while levo-1-methyl-tryptophan (L-1-MT, but not dextro-1-methyl-tryptophan, partially rescued IL4I1-dependent inhibition of T cell activation. Other inhibitors, such as diphenylene iodonium (DPI, an anti-IL-10Rα blocking antibody, and a nitric oxide synthase inhibitor, NG-monomethyl-L-arginine, also had this effect. Overall, our findings indicate that IL4I1 promotes an enhanced M2 functional phenotype, which is most likely associated with the phosphorylation of STAT-6 and STAT-3. Moreover, DPI, L-1-MT, NG-monomethyl-L-arginine, and anti-IL-10Rα blocking antibody were all found to be effective IL4I1 inhibitors in vitro.

  8. L{sub i} (i=1,2,3) subshell X-ray production cross-sections and fluorescence yields for Ir, Pt, Pb and Bi

    Energy Technology Data Exchange (ETDEWEB)

    Singh, P.; Sharma, M.; Shahi, J.S.; Mehta, D.; Singh, N. E-mail: nsingh@pu.ac.in

    2003-09-01

    The L{sub i} (i=1,2,3) subshell X-ray production (XRP) cross-sections were measured for {sub 77}Ir, {sub 78}Pt, {sub 82}Pb and {sub 83}Bi following direct ionization in the L{sub i} (i=1,2,3) subshells by the 59.54 keV {gamma}-rays and the L{sub 3} subshell by the Br/Rb/Sr/Y K X-rays. The photon sources consisting of an {sup 241}Am source in (i) the direct excitation mode and (ii) the secondary excitation mode together with the KBr/RbNO{sub 3}/SrCO{sub 3} /Y secondary exciter and an Si(Li) detector were used. The L{sub i} (i=1,2,3) subshell fluorescence yields ({omega}{sub i}) for these elements were deduced using the measured XRP cross-sections and the L{sub i} subshell photoionization cross-sections based on the Hartree-Fock-Slater model. The measured {omega}{sub 1} values are found to be higher upto 50% than those based on the relativistic Dirac-Hartree-Slater (RDHS) calculations, while the {omega}{sub 2} and {omega}{sub 3} values exhibit good agreement. The predicted jump in the RDHS based {omega}{sub 1} values from {sub 77}Ir to {sub 78}Pt due to onset of intense L{sub 1}-L{sub 3}M{sub 4} CK transition is not observed.

  9. Magnetic rotation phenomenon in the dipole (ΔI = 1) bands of transitional strontium (Sr) isotopes near N = 50 shell closure

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Naveen; Kumar, S.; Mandal, S.K. [University of Delhi, Department of Physics and Astrophysics, Delhi (India); Saha, S.; Sethi, J.; Palit, R. [Tata Institute of Fundamental Research, Department of Nuclear and Atomic Physics, Mumbai (India)

    2017-02-15

    The lifetime measurements were done for the transitions of the dipole (ΔI = 1) bands in {sup 85,86}Sr nuclei using the Doppler Shift Attenuation Method (DSAM). The high-spin states in these nuclei were populated in the {sup 76}Ge({sup 13}C, 4n){sup 85}Sr and {sup 76}Ge({sup 13}C, 3n){sup 86}Sr reactions. The B(M1) transition rates have been obtained for the states of two positive-parity dipole (Δ I = 1) bands in the {sup 85}Sr nucleus and one positive-parity dipole (ΔI = 1) band in the {sup 86} Sr nucleus. The present results on the transition rates are important to know whether these dipole (ΔI = 1) bands have the signatures of Magnetic Rotation (MR). In order to investigate their magnetic character, the experimental results have been compared with the calculations within the framework of hybrid Tilted-Axis-Cranking (TAC) model. On the basis of the TAC calculations, band 2 of the {sup 85}Sr nucleus is assigned the π(g{sub 9/2}){sup 2} x ν(g{sub 9/2}){sup -1} configuration and shows the MR character, while for band 3, the π[(g{sub 9/2}){sup 2}(f{sub 5/2}){sup 2}] x ν(g{sub 9/2}){sup -1} configuration is suggested. In the case of {sup 86}Sr nucleus, band 3 has the π(g{sub 9/2}){sup 2} x ν(g{sub 9/2}){sup -2} configuration below the spin I{sup π} = 16{sup +} and above this spin the π[(g{sub 9/2}){sup 2}(f{sub 5/2}){sup 1}(p{sub 1/2}/p{sub 3/2}){sup 1}] x ν(g{sub 9/2}){sup -2} configuration plays an important role. The experimental B(M1) transition rates show a decreasing trend with the increase in spin and are comparable with the TAC calculations before the I{sup π} = 16{sup +}. (orig.)

  10. 苜蓿中华根瘤菌烯脂酰ACP还原酶基因fabI1功能研究%The enoyl-ACP reductase gene,fabI1, of Sinorhizobium meliloti is involved in salt tolerance, swarming mobility and nodulation efficiency

    Institute of Scientific and Technical Information of China (English)

    刘影; 朱家璧; 俞冠翘; 邹华松

    2009-01-01

    我们先前的工作表明,苜蓿中华根瘤菌的烯脂酰ACP还原酶基因fabI1在nifA突变根瘤中表达水平降低.本研究构建了fabI1的定点插入突变体.与野生型相比,突变菌株的生长速度变慢,在高浓度NaCl培养基上的生长能力降低.在半固体培养基上,该突变体的涌动能力完全丧失.在共生过程中,突变菌株在宿主植物上延迟结瘤,形成根瘤的能力下降.虽然苜蓿中华根瘤菌中的烯脂酰ACP还原酶基因fabI2的序列与fabI1有66%的一致性,但fabI2不能恢复fabI1突变体的表型,揭示了这两个基因在功能上的差异.

  11. Theoretical X-ray production cross sections at incident photon energies across L{sub i} (i=1-3) absorption edges of Br

    Energy Technology Data Exchange (ETDEWEB)

    Puri, Sanjiv [Department of Basic & Applied Sciences, Punjabi University, Patiala-147002, Punjab, India. E-mail address: sanjivpurichd@yahoo.com (India)

    2015-08-28

    The X-ray production (XRP) cross sections, σ{sub Lk} (k = l, η, α, β{sub 6}, β{sub 1}, β{sub 3}, β{sub 4}, β{sub 9,10}, γ{sub 1,5}, γ{sub 2,3}) have been evaluated at incident photon energies across the L{sub i}(i=1-3) absorption edge energies of {sub 35}Br using theoretical data sets of different physical parameters, namely, the L{sub i}(i=1-3) sub-shell the X-ray emission rates based on the Dirac-Fock (DF) model, the fluorescence and Coster Kronig yields based on the Dirac-Hartree-Slater (DHS) model, and two sets of the photoionisation cross sections based on the relativistic Hartree-Fock-Slater (RHFS) model and the Dirac-Fock (DF) model, in order to highlight the importance of electron exchange effects at photon energies in vicinity of absorption edge energies.

  12. Effects of selective Imidazolin-1 (I1 receptor agonists vs ACE-Is/ARBs on metabolic parameters in patients of hypertension: A Meta-analysis of RCTs

    Directory of Open Access Journals (Sweden)

    Sharan Hiremath

    2016-05-01

    Full Text Available Objectives:  Co-existence of metabolic syndrome in hypertensive patients is associated with the higher risk for development of various complications including type 2 diabetes mellitus and hence highlights the need for selecting an anti-hypertensive with favorable effect on metabolic parameters. Present study aims at analyzing the efficacies of selective imidazolin-1 (I1 receptor agonists vs ACE-Is/ARBs on blood pressure, indicators of insulin resistance and plasma lipids concentration.Methods: Electronic data search in PUBMED, Cochrane library and EMBASE was conducted. Eligible studies were analyzed by random and fixed effects model for the effect size measures. RevMan 5.2 software was used for statistical analysisResults: There was significant difference in the level of decrease in total cholesterol and triglyceride in imidazolins group. However, the decrease in systolic and diastolic blood pressure was significantly more in ACE-Is/ARBs. However among these significant findings found in fixed effect model, the only significant change present in random effect model was the decrease in triglycerides by imidazolins.Conclusion: Efficacy of I1-agonists on plasma lipids and decreasing blood pressure appears to be non-inferior to ACE-Is/ARBs at short term treatment.  

  13. Malaria Treatment (United States)

    Science.gov (United States)

    ... a CDC Malaria Branch clinician. malaria@cdc.gov Malaria Treatment (United States) Recommend on Facebook Tweet Share Compartir Treatment of Malaria: Guidelines For Clinicians (United States) Download PDF version ...

  14. United Cerebral Palsy

    Science.gov (United States)

    ... be sure to follow us on Twitter . United Cerebral Palsy UCP educates, advocates and provides support services to ... Partners Merz Logo Sprint Relay Copyright © 2015 United Cerebral Palsy 1825 K Street NW Suite 600 Washington, DC ...

  15. Unit Cost Compendium Calculations

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Unit Cost Compendium (UCC) Calculations raw data set was designed to provide for greater accuracy and consistency in the use of unit costs across the USEPA...

  16. Study of some properties of 's' neutron resonance parameters for target nuclei I = 1/2 and I = 3/2 in function of spin value J = I + 1/2 in the energy range 1 {yields} 5000 eV; Etude de quelques proprietes des parametres de resonances des neutrons ''s'' pour des noyaux cibles I = 1/2 et I = 3/2 en fonction de la valeur du spin J = I + 1/2 dans le domaine d'energie 1 eV {yields} 5000 eV

    Energy Technology Data Exchange (ETDEWEB)

    Julien, J. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1967-05-15

    Different kinds of experiments and analysis methods allowing to achieve neutron resonances parameters in the low energy range (1 eV {yields} 5000 eV) are described. A great deal of effort to improve experimental conditions and data processing in order to know the spin value J = I {+-} 1/2 has been spent. The time of flight method was used. A few target nuclei I = 3/2 and 1 = 1/2 have been studied. For I = 3/2 (Ga, As, 3r, Au) we find S{sub o} J = 2 {approx_equal} 2 S{sub o} J = 1 and S{sub o} J = 1 {approx_equal} S{sub o} J = 0 for I = 1/2 (Tm, Pt) but {sup 77}Se. Fluctuations of the total radiative width {gamma}{sub {gamma}} depend on the spin value I = I {+-} 1/2 when E1 transition, are enhanced for one of the both spin states. The magnitude of these fluctuations can be explained of the strength of E1 transitions (E{sub {gamma}} {approx} 7 MeV) is supposed to be proportional to E{sup 5}{sub {gamma}} instead of E{sup 3}{sub {gamma}}. The distribution of levels spacings against spin value J are considered and are compared to theoretical predictions. (author) [French] On decrit les differentes methodes d'analyse permettant d'obtenir les parametres des resonances de neutron dans le domaine d'energie 1 eV {yields} 5000 eV. Un effort particulier a ete fait pour connaitre la valeur du spin J = I {+-} 1/2. Les types d'experience et les analyses des donnees, developpes et ameliores pour determiner J sont decrits. Les resultats obtenus ont permis l'etude de differentes proprietes en fonction du spin J. On trouve: S{sub o} J 2 {approx_equal} 2 S{sub o} J = 1 pour les noyaux I = 3/2 etudies (Ga, As, Br, Au) et S{sub o} J = 1 {approx_equal} S{sub o} J = 0 Pour le Tm et {sup 195}Pt de spin I = 1/2. On constate que les largeurs radiatives totales {gamma}{sub {gamma}} fluctuent si des transitions E1 aux premiers etats excites sont favorisees. Ces fluctuations peuvent etre expliquees si on suppose que les intensites de ces transitions sont

  17. High Heterogeneity of Escherichia coli Sequence Types Harbouring ESBL/AmpC Genes on IncI1 Plasmids in the Colombian Poultry Chain

    Science.gov (United States)

    Donado-Godoy, Pilar; León, Maribel; Clavijo, Viviana; Arevalo, Alejandra; Bernal, Johan F.; Timmerman, Arjen J.; Mevius, Dik J.; Wagenaar, Jaap A.; Hordijk, Joost

    2017-01-01

    on IncI1 plasmids. These IncI1 plasmids harboured predominantly blaCMY-2 (16/22), and to a lesser extend blaSHV-12 (5/22) and blaCTX-M-8 (1/22). Other plasmid families associated with ESBL/AmpC-genes were IncK (4/33), IncHI2 (3/33), IncA/C (2/33), IncΒ/O (1/33) and a non-typeable replicon (1/33). Subtyping of IncI1 and IncHI2 demonstrated IncI1/ST12 was predominantly associated with blaCMY-2 (12/16) and IncHI2/ST7 with blaCTX-M-2 (2/3). Finally, 31 different STs were detected among the 39 selected isolates. Conclusions Resistance to extended spectrum cephalosporins in E. coli from Colombian poultry is mainly caused by blaCMY-2 and blaSHV-12. The high diversity of strain Sequence Types and the dissemination of homogeneous IncI1/ST12 plasmids suggest that spread of the resistance is mainly mediated by horizontal gene transfer. PMID:28125687

  18. High Heterogeneity of Escherichia coli Sequence Types Harbouring ESBL/AmpC Genes on IncI1 Plasmids in the Colombian Poultry Chain.

    Science.gov (United States)

    Castellanos, Luis Ricardo; Donado-Godoy, Pilar; León, Maribel; Clavijo, Viviana; Arevalo, Alejandra; Bernal, Johan F; Timmerman, Arjen J; Mevius, Dik J; Wagenaar, Jaap A; Hordijk, Joost

    2017-01-01

    Escherichia coli producing ESBL/AmpC enzymes are unwanted in animal production chains as they may pose a risk to human and animal health. Molecular characterization of plasmids and strains carrying genes that encode these enzymes is essential to understand their local and global spread. To investigate the diversity of genes, plasmids and strains in ESBL/AmpC-producing E. coli from the Colombian poultry chain isolated within the Colombian Integrated Program for Antimicrobial Resistance Surveillance (Coipars). A total of 541 non-clinical E. coli strains from epidemiologically independent samples and randomly isolated between 2008 and 2013 within the Coipars program were tested for antimicrobial susceptibility. Poultry isolates resistant to cefotaxime (MIC ≥ 4 mg/L) were screened for ESBL/AmpC genes including blaCTX-M, blaSHV, blaTEM, blaCMY and blaOXA. Plasmid and strain characterization was performed for a selection of the ESBL/AmpC-producing isolates. Plasmids were purified and transformed into E. coli DH10B cells or transferred by conjugation to E. coli W3110. When applicable, PCR Based Replicon Typing (PBRT), plasmid Multi Locus Sequence Typing (pMLST), plasmid Double Locus Sequence Typing (pDLST) and/or plasmid Replicon Sequence Typing (pRST) was performed on resulting transformants and conjugants. Multi Locus Sequence Typing (MLST) was used for strain characterization. In total, 132 of 541 isolates were resistant to cefotaxime and 122 were found to carry ESBL/AmpC genes. Ninety-two harboured blaCMY-2 (75%), fourteen blaSHV-12 (11%), three blaSHV-5 (2%), five blaCTX-M-2 (4%), one blaCTX-M-15 (1%), one blaCTX-M-8 (1%), four a combination of blaCMY-2 and blaSHV-12 (4%) and two a combination of blaCMY-2 and blaSHV-5 (2%). A selection of 39 ESBL/AmpC-producing isolates was characterized at the plasmid and strain level. ESBL/AmpC genes from 36 isolates were transferable by transformation or conjugation of which 22 were located on IncI1 plasmids. These IncI1

  19. Establishing the Intermediate Unit.

    Science.gov (United States)

    Pennsylvania State Dept. of Education, Harrisburg.

    The State of Pennsylvania Act 102 establishes a system of 29 intermediate units, creates intermediate unit boards of directors, spells out their duties and functions, and provides a system of financing their operations. This handbook has been prepared by the Pennsylvania Department of Education to provide intermediate unit boards of directors,…

  20. Unitals in Projective Planes

    CERN Document Server

    Barwick, Susan

    2008-01-01

    Unitals are key structures in projective planes, and have connections with other structures in algebra. This book presents a monograph on unitals embedded in finite projective planes. It offers a survey of the research literature on embedded unitals. It is suitable for graduate students and researchers who want to learn about this topic

  1. I(+1) transfer from diiodomalonic acid to malonic acid and a complete inhibition of the CO and CO2 evolution in the Briggs-Rauscher reaction by resorcinol.

    Science.gov (United States)

    Onel, Lavinia; Bourceanu, Gelu; Wittmann, Maria; Noszticzius, Zoltán; Szabó, Gabriella

    2008-11-20

    A recent report on an intense CO 2 and CO evolution in the Briggs-Rauscher (BR) reaction revealed that iodination of malonic acid (MA) is not the only important organic reaction in the classical BR oscillator. To disclose the source of the gas evolution, iodomalonic (IMA) and diiodomalonic (I2MA) acids were prepared by iodinating MA with nascent iodine in a semibatch reactor. The nascent iodine was generated by an iodide inflow into the reactor, which contained a mixture of MA and acidic iodate. Some CO2 and a minor CO production was observed during these iodinations. It was found that in an aqueous acidic medium the produced I2MA is not stable but decomposes slowly to diiodoacetic acid and CO2. The first-order rate constant of the I 2MA decarboxylation at 20 degrees C was found to be k1 = 9 x 10(-5) s(-1), which is rather close to the rate constant of the analogous decarboxylation of dibromomalonic acid under similar conditions (7 x 10(-5)s(-1)). From the rate of the CO2 evolution, the I2MA concentration can be calculated in a MA-IMA-I2MA mixture as only I2MA decarboxylates spontaneously but MA and IMA are stable. Following CO2 evolution rates, it was proven that I2MA can react with MA in the reversible reaction I2MA + MA 2 IMA. The equilibrium constant of this reaction was calculated as K = 380 together with the rate constants of the forward k 2 = 6.2 x 10 (-2) M (-1)s(-1) and backward k-2 = 1.6 x 10(-4) M(-1)s(-1) reactions. The probable mechanism of the reaction is I(+1) transfer from I2MA to MA. The presence of I(+1) in a I2MA solution is demonstrated by its reduction with ascorbic acid. To estimate the fraction of CO2 coming from the decarboxylation of I2MA in an oscillatory BR reaction, the oscillations were inhibited by resorcinol. Unexpectedly, all CO2 and CO evolution was interrupted for more than one hour after injecting a small amount of resorcinol (10(-5) M initial concentration in the reactor). Finally, some implications of the newly found I(+1

  2. Coupling of Airway Smooth Muscle Bitter Taste Receptors to Intracellular Signaling and Relaxation Is via Gαi1,2,3.

    Science.gov (United States)

    Kim, Donghwa; Woo, Jung A; Geffken, Ezekiel; An, Steven S; Liggett, Stephen B

    2017-06-01

    Bitter taste receptors (TAS2Rs) are expressed on human airway smooth muscle (HASM) and evoke marked relaxation. Agonist interaction with TAS2Rs activates phospholipase C and increases compartmentalized intracellular Ca(2+) ([Ca(2+)]i) via inositol 1,4,5 triphosphate. In taste cells, the G protein gustducin couples TAS2R to phospholipase C; however, we find very low levels of Gαgust mRNA or protein in HASM. We hypothesized that another G protein in HASM transmits TAS2R function. TAS2R signaling to [Ca(2+)]i, extracellular signal-regulated kinase (ERK) 1/2, and physiologic relaxation was sensitive to pertussis toxin, confirming a role for a member of the Gi family. α subunit expression in HASM was Gαi2 > Gαi1 = Gαi3 > Gαtrans1 ≈ Gαtrans2, with Gαgust and Gαo at the limits of detection (>100-fold lower than Gαi2). Small interfering RNA knockdowns in HASM showed losses of [Ca(2+)]i and ERK1/2 signaling when Gαi1, Gαi2, or Gαi3 were reduced. Gαtrans1 and Gαtrans2 knockdowns had no effect on [Ca(2+)]i and a minimal, transient effect on ERK1/2 phosphorylation. Furthermore, Gαgust and Gαo knockdowns did not affect any TAS2R signaling. In overexpression experiments in human embryonic kidney-293T cells, we confirmed an agonist-dependent physical interaction between TAS2R14 and Gαi2. ASM cells from transgenic mice expressing a peptide inhibitor of Gαi2 had attenuated relaxation to TAS2R agonist. These data indicate that, unlike in taste cells, TAS2Rs couple to the prevalent G proteins, Gαi1, Gαi2, and Gαi3, with no evidence for functional coupling to Gαgust. This absence of function for the "canonical" TAS2R G protein in HASM may be due to the very low expression of Gαgust, indicating that TAS2Rs can optionally couple to several G proteins in a cell type-dependent manner contingent upon G protein expression.

  3. Identification of the t Complex–encoded Cytoplasmic Dynein Light Chain Tctex1 in Inner Arm I1 Supports the Involvement of Flagellar Dyneins in Meiotic Drive

    Science.gov (United States)

    Harrison, Alistair; Olds-Clarke, Patricia; King, Stephen M.

    1998-01-01

    The cytoplasmic dynein light chain Tctex1 is a candidate for one of the distorter products involved in the non-Mendelian transmission of mouse t haplotypes. It has been unclear, however, how the t-specific mutations in this protein, which is found associated with cytoplasmic dynein in many tissues, could result in a male germ cell–specific phenotype. Here, we demonstrate that Tctex1 is not only a cytoplasmic dynein component, but is also present both in mouse sperm and Chlamydomonas flagella. Genetic and biochemical dissection of the Chlamydomonas flagellum reveal that Tctex1 is a previously undescribed component of inner dynein arm I1. Combined with the recent identification of another putative t complex distorter, Tctex2, within the outer dynein arm, these results support the hypothesis that transmission ratio distortion (meiotic drive) of mouse t haplotypes involves dysfunction of both flagellar inner and outer dynein arms but does not require the cytoplasmic isozyme. PMID:9490726

  4. Trapping charges at grain boundaries and degradation of CH3NH3Pb(I1-x Br x )3 perovskite solar cells

    Science.gov (United States)

    Phuong Nguyen, Bich; Kim, Gee Yeong; Jo, William; Kim, Byeong Jo; Jung, Hyun Suk

    2017-08-01

    The electrical properties of CH3NH3Pb(I1-x Br x )3 (x = 0.13) perovskite materials were investigated under ambient conditions. The local work function and the local current were measured using Kelvin probe force microscopy and conductive atomic force microscopy, respectively. The degradation of the perovskite layers depends on their grain size. As the material degrades, an additional peak in the surface potential appears simultaneously with a sudden increase and subsequent relaxation of the local current. The potential bending at the grain boundaries and the intragrains is the most likely reason for the change of the local current surface of the perovskite layers. The improved understanding of the degradation mechanism garnered from this study helps pave the way toward an improved photo-conversion efficiency in perovskite solar cells.

  5. Site-resolved neutralization of slow singly and multiply charged ions during large-angle backscattering collisions with RbI(1 0 0)

    CERN Document Server

    Meyer, F W; Vane, C R

    2003-01-01

    Preliminary results are reported of projectile neutralization during 120 deg. backscattering from RbI[1 0 0] of singly and multiply charged incident ions in the keV energy range. Scattered charge fractions are reported for 4.4 keV Ne sup 8 sup + and 4.2 keV F sup + normally incident on the ionic crystal. Collisions associated with scattering from a Rb or I site can be clearly distinguished for each scattered final charge state. Significant differences are observed in the intensities of the higher scattered charge states resulting from collisions with Rb and I sites. In contrast, at the target azimuth orientation of the present measurement, only minor differences in F sup - yield are observed for hard scattering from the two lattice sites.

  6. Measurement of the Yb I $^1S_0 - ^1P_1$ transition frequency at 399 nm using an optical frequency comb

    CERN Document Server

    Kleinert, Michaela; Bergeson, Scott D

    2016-01-01

    We determine the frequency of the Yb I $^1S_0 - ^1P_1$ transition at 399 nm using an optical frequency comb. Although this transition was measured previously using an optical transfer cavity [D. Das et al., Phys. Rev. A 72, 032506 (2005)], recent work has uncovered significant errors in that method. We compare our result of 750 526 533.49 $\\pm$ 0.33 MHz for the Yb-174 isotope with those from the literature and discuss observed differences. We verify the correctness of our method by measuring the frequencies of well-known transitions in Rb and Cs, and by demonstrating proper control of systematic errors in both laser metrology and atomic spectroscopy. We also demonstrate the effect of quantum interference due to hyperfine structure in a divalent atomic system.

  7. Influence of agricultural practice on mobile bla genes: IncI1-bearing CTX-M, SHV, CMY and TEM in Escherichia coli from intensive farming soils.

    Science.gov (United States)

    Jones-Dias, Daniela; Manageiro, Vera; Caniça, Manuela

    2016-01-01

    Many calls have been made to address antibiotic resistance in an environmental perspective. With this study, we showed the widespread presence of high-level antibiotic resistant isolates on a collection of non-susceptible Gram-negative bacteria (n = 232) recovered from soils. Bacteria were selected using amoxicillin, cefotaxime and imipenem, from sites representing different agricultural practices (extensive, intensive and organic). Striking levels of non-susceptibility were noticed in intensive soils for norfloxacin (74%), streptomycin (50.7%) and tetracycline (46.6%); indeed, the exposure to intensive agricultural practices constituted a risk factor for non-susceptibility to many antibiotics, multidrug resistance and production of extended-spectrum β-lactamases (ESBL). Analyses of non-susceptibility highlighted that environmental and clinical bacteria from the same species might not share the same intrinsic resistance patterns, raising concerns for therapy choices in environment-borne infections. The multiple sequence-type IncI1-driven spread of penicillinases (blaTEM-1, blaTEM-135), ESBL (blaSHV-12 and blaCTX-M-1) and plasmid-mediated AmpC β-lactamases (blaCMY-2), produced by isolates that share their molecular features with isolates from humans and animals, suggests contamination of agricultural soils. This is also the first appearance of IncI1/ST28-harbouring blaCTX-M-1, which should be monitored to prevent their establishment as successfully dispersed plasmids. This research may help disclose paths of contamination by mobile antibiotic resistance determinants and the risks for their dissemination.

  8. A New Generation of FRET Sensors for Robust Measurement of Gαi1, Gαi2 and Gαi3 Activation Kinetics in Single Cells.

    Directory of Open Access Journals (Sweden)

    Jakobus van Unen

    Full Text Available G-protein coupled receptors (GPCRs can activate a heterotrimeric G-protein complex with subsecond kinetics. Genetically encoded biosensors based on Förster resonance energy transfer (FRET are ideally suited for the study of such fast signaling events in single living cells. Here we report on the construction and characterization of three FRET biosensors for the measurement of Gαi1, Gαi2 and Gαi3 activation. To enable quantitative long-term imaging of FRET biosensors with high dynamic range, fluorescent proteins with enhanced photophysical properties are required. Therefore, we use the currently brightest and most photostable CFP variant, mTurquoise2, as donor fused to Gαi subunit, and cp173Venus fused to the Gγ2 subunit as acceptor. The Gαi FRET biosensors constructs are expressed together with Gβ1 from a single plasmid, providing preferred relative expression levels with reduced variation in mammalian cells. The Gαi FRET sensors showed a robust response to activation of endogenous or over-expressed alpha-2A-adrenergic receptors, which was inhibited by pertussis toxin. Moreover, we observed activation of the Gαi FRET sensor in single cells upon stimulation of several GPCRs, including the LPA2, M3 and BK2 receptor. Furthermore, we show that the sensors are well suited to extract kinetic parameters from fast measurements in the millisecond time range. This new generation of FRET biosensors for Gαi1, Gαi2 and Gαi3 activation will be valuable for live-cell measurements that probe Gαi activation.

  9. Freestanding midwifery units versus obstetric units

    DEFF Research Database (Denmark)

    Overgaard, Charlotte; Fenger-Grøn, Morten; Sandall, Jane

    2012-01-01

    women intending to give birth in two freestanding midwifery units (FMU) versus two obstetric units in Denmark differed by level of social disadvantage Methods The study was designed as a cohort study with a matched control group. It included 839 lowrisk women intending to give birth in an FMU, who were...... prospectively and individually matched on nine selected obstetric/socio-economic factors to 839 low-risk women intending OU birth. Educational level was chosen as a proxy for social position. Analysis was by intention-to-treat. Results Women intending to give birth in an FMU had a significantly higher...

  10. ENERGY STAR Unit Reports

    Data.gov (United States)

    Department of Housing and Urban Development — These quarterly Federal Fiscal Year performance reports track the ENERGY STAR qualified HOME units that Participating Jurisdictions record in HUD's Integrated...

  11. Activation of the Regulator of G protein Signaling 14 (RGS14):Gαi1-GDP signaling complex is regulated by Resistance to Inhibitors of Cholinesterase-8A (Ric-8A)

    Science.gov (United States)

    Vellano, Christopher P.; Shu, Feng-jue; Ramineni, Suneela; Yates, Cindee K.; Tall, Gregory G.; Hepler, John R.

    2011-01-01

    RGS14 is a brain scaffolding protein that integrates G protein and MAP kinase signaling pathways. Like other RGS proteins, RGS14 is a GTPase activating protein (GAP) that terminates Gαi/o signaling. Unlike other RGS proteins, RGS14 also contains a G protein regulatory (also known as GoLoco) domain that binds Gαi1/3-GDP in cells and in vitro. Here we report that Ric-8A, a non-receptor guanine nucleotide exchange factor (GEF), functionally interacts with the RGS14:Gαi1-GDP signaling complex to regulate its activation state. RGS14 and Ric-8A are recruited from the cytosol to the plasma membrane in the presence of co-expressed Gαi1 in cells, suggesting formation of a functional protein complex with Gαi1. Consistent with this idea, Ric-8A stimulates dissociation of the RGS14:Gαi1-GDP complex in cells and in vitro using purified proteins. Purified Ric-8A stimulates dissociation of the RGS14:Gαi1-GDP complex to form a stable Ric-8A:Gαi complex in the absence of GTP. In the presence of activating nucleotide, Ric-8A interacts with the RGS14:Gαi1-GDP complex to stimulate both the steady-state GTPase activity of Gαi1 and GTP binding to Gαi1. However, sufficiently high concentrations of RGS14 competitively reverse these stimulatory effects of Ric-8A on Gαi1 nucleotide binding and GTPase activity. This observation correlates with findings that show RGS14 and Ric-8A share an overlapping binding region within the last 11 amino acids of Gαi1. As further evidence that these proteins are functionally linked, native RGS14 and Ric-8A co-exist within the same hippocampal neurons. These findings demonstrate that RGS14 is a newly appreciated integrator of unconventional Ric-8A and Gαi1 signaling. PMID:21158412

  12. 31 CFR 535.321 - United States; continental United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States; continental United... General Definitions § 535.321 United States; continental United States. The term United States means the United States and all areas under the jurisdiction or authority thereof including the Trust Territory...

  13. 31 CFR 515.321 - United States; continental United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States; continental United... General Definitions § 515.321 United States; continental United States. The term United States means the United States and all areas under the jurisdiction or authority thereof, including the Trust Territory...

  14. 31 CFR 500.321 - United States; continental United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States; continental United... General Definitions § 500.321 United States; continental United States. The term United States means the United States and all areas under the jurisdiction or authority thereof, including U.S. trust...

  15. REACH. Air Conditioning Units.

    Science.gov (United States)

    Garrison, Joe; And Others

    As a part of the REACH (Refrigeration, Electro-Mechanical, Air-Conditioning, Heating) electromechanical cluster, this student manual contains individualized instructional units in the area of air conditioning. The instructional units focus on air conditioning fundamentals, window air conditioning, system and installation, troubleshooting and…

  16. REACH. Air Conditioning Units.

    Science.gov (United States)

    Garrison, Joe; And Others

    As a part of the REACH (Refrigeration, Electro-Mechanical, Air-Conditioning, Heating) electromechanical cluster, this student manual contains individualized instructional units in the area of air conditioning. The instructional units focus on air conditioning fundamentals, window air conditioning, system and installation, troubleshooting and…

  17. Conflict Resolution Unit.

    Science.gov (United States)

    Busselle, Tish

    This 7-day unit, intended for use with secondary students, contains a statement of rationale and objectives, lesson plans, class assignments, teacher and student bibliographies, and suggestions for instructional materials on conflict resolution between individuals, groups, and nations. Among the six objectives listed for the unit are: 1) explain…

  18. REACH. Refrigeration Units.

    Science.gov (United States)

    Snow, Rufus; And Others

    As a part of the REACH (Refrigeration, Electro-Mechanical, Air-Conditioning, Heating) electromechanical cluster, this student manual contains individualized instructional units in the area of refrigeration. The instructional units focus on refrigeration fundamentals, tubing and pipe, refrigerants, troubleshooting, window air conditioning, and…

  19. Unit on Existentialism.

    Science.gov (United States)

    Rowell, Bobby

    1971-01-01

    A unit on existentialism is suggested to counteract the indifferent attitude that students have toward much of the literature with which they are presented. The key to a successful literature unit is immediate and total student involvement. Topics, authors, and works which may be used to arouse student interest are presented. (CK)

  20. Large N Approach to Kaon Decays and Mixing 28 Years Later: Delta I = 1/2 Rule, \\hat B_K and Delta M_K

    CERN Document Server

    Buras, Andrzej J; Bardeen, William A

    2014-01-01

    We review and update our results for K-> pipi decays and K^0-\\bar K^0 mixing obtained by us in the 1980s within an approach based on the dual representation of QCD as a theory of weakly interacting mesons for large N colours. In our analytic approach the dynamics behind the enhancement of ReA_0 and suppression of ReA_2, the so-called Delta I = 1/2 rule for K-> pi pi decays, has a simple structure: the usual octet enhancement through quark-gluon renormalization group evolution down to the scales O(1 GeV) is continued as a meson evolution down to zero momentum scales at which the factorization of hadronic matrix elements is at work. The inclusion of lowest-lying vector meson contributions in addition to the pseudoscalar ones and of Wilson coefficients in a momentum scheme improves significantly the matching between quark-gluon and meson evolutions. In particular, the anomalous dimension matrix governing the meson evolution exhibits the structure of the known anomalous dimension matrix in the quark-gluon evoluti...

  1. Enrichment and genome sequence of the group I.1a ammonia-oxidizing Archaeon "Ca. Nitrosotenuis uzonensis" representing a clade globally distributed in thermal habitats.

    Directory of Open Access Journals (Sweden)

    Elena V Lebedeva

    Full Text Available The discovery of ammonia-oxidizing archaea (AOA of the phylum Thaumarchaeota and the high abundance of archaeal ammonia monooxygenase subunit A encoding gene sequences in many environments have extended our perception of nitrifying microbial communities. Moreover, AOA are the only aerobic ammonia oxidizers known to be active in geothermal environments. Molecular data indicate that in many globally distributed terrestrial high-temperature habits a thaumarchaeotal lineage within the Nitrosopumilus cluster (also called "marine" group I.1a thrives, but these microbes have neither been isolated from these systems nor functionally characterized in situ yet. In this study, we report on the enrichment and genomic characterization of a representative of this lineage from a thermal spring in Kamchatka. This thaumarchaeote, provisionally classified as "Candidatus Nitrosotenuis uzonensis", is a moderately thermophilic, non-halophilic, chemolithoautotrophic ammonia oxidizer. The nearly complete genome sequence (assembled into a single scaffold of this AOA confirmed the presence of the typical thaumarchaeotal pathways for ammonia oxidation and carbon fixation, and indicated its ability to produce coenzyme F420 and to chemotactically react to its environment. Interestingly, like members of the genus Nitrosoarchaeum, "Candidatus N. uzonensis" also possesses a putative artubulin-encoding gene. Genome comparisons to related AOA with available genome sequences confirmed that the newly cultured AOA has an average nucleotide identity far below the species threshold and revealed a substantial degree of genomic plasticity with unique genomic regions in "Ca. N. uzonensis", which potentially include genetic determinants of ecological niche differentiation.

  2. Fluorinated analogues of marsanidine, a highly α2-AR/imidazoline I1 binding site-selective hypotensive agent. Synthesis and biological activities.

    Science.gov (United States)

    Wasilewska, Aleksandra; Sączewski, Franciszek; Hudson, Alan L; Ferdousi, Mehnaz; Scheinin, Mika; Laurila, Jonne M; Rybczyńska, Apolonia; Boblewski, Konrad; Lehmann, Artur

    2014-11-24

    The aim of these studies was to establish the influence of fluorination of the indazole ring on the pharmacological properties of two selective α2-adrenoceptor (α2-AR) agonists: 1-[(imidazolidin-2-yl)imino]-1H-indazole (marsanidine, A) and its methylene analogue 1-[(4,5-dihydro-1H-imidazol-2-yl)methyl]-1H-indazole (B). Introduction of fluorine into the indazole ring of A and B reduced both binding affinity and α2-AR/I1 imidazoline binding site selectivity. The most α2-AR-selective ligands were 6-fluoro-1-[(imidazolidin-2-yl)imino]-1H-indazole (6c) and 7-fluoro-1-[(imidazolidin-2-yl)imino]-1H-indazole (6d). The in vivo cardiovascular properties of fluorinated derivatives of A and B revealed that in both cases the C-7 fluorination leads to compounds with the highest hypotensive and bradycardic activities. The α2-AR partial agonist 6c was prepared as a potential lead compound for development of a radiotracer for PET imaging of brain α2-ARs.

  3. 公式R=△U/△I、△P=(U1+U2)△I、△P=(I1+I2)△U的推导与应用

    Institute of Scientific and Technical Information of China (English)

    王晓强

    2005-01-01

    @@ 1推导 设定值电阻R上加电压U1时流过的电流为I1,加电压U2时流过的电流为I2,则R=U1/I1=U2/I2=U2-U1/I2-I1=△U/△I(设U2>U1). 功率变化:△P=P2-P1= U22/R-U21/R=(U1+U2)(U2-U1)/R=(U1+U2)(U2/R-U1/R)=(U1+U2)(I2-I1)=(U1+U2)△I或△P=P2-P1=U22/R-U21/R=(U1+U2)(U2-U1)/R=(U2/R-U1/R)(U2-U1)=(I2+I1)(U2-U1)=(I1+I2)△U.

  4. United nations Orchestra

    CERN Multimedia

    MusiClub

    MusiClub United nations Orchestra www.ungenevaorchestra.ch An organizing committee has taken the initiative to create an Orchestra of the united nations at Geneva. In the context of this initiative, musicians in the following categories are invited to become members of the Orchestra and the Association: Active or retired staff of International organizations in Geneva; Active or retired employees of Permanent Missions to the United Nations at Geneva; as well as children and spouses of the above persons. For enrolment or for additional information, please contact: un.orchestra@yahoo.com

  5. Does size matter? Animal units and animal unit months

    Science.gov (United States)

    Lamar Smith; Joe Hicks; Scott Lusk; Mike Hemmovich; Shane Green; Sarah McCord; Mike Pellant; John Mitchell; Judith Dyess; Jim Sprinkle; Amanda Gearhart; Sherm Karl; Mike Hannemann; Ken Spaeth; Jason Karl; Matt Reeves; Dave Pyke; Jordan Spaak; Andrew Brischke; Del Despain; Matt Phillippi; Dave Weixelmann; Alan Bass; Jessie Page; Lori Metz; David Toledo; Emily Kachergis

    2017-01-01

    The concepts of animal units, animal unit months, and animal unit equivalents have long been used as standards for range management planning, estimating stocking rates, reporting actual use, assessing grazing fees, ranch appraisal, and other purposes. Increasing size of cattle on rangelands has led some to suggest that the definition of animal units and animal unit...

  6. Tax Unit Boundaries

    Data.gov (United States)

    Kansas Data Access and Support Center — The Statewide GIS Tax Unit boundary file was created through a collaborative partnership between the State of Kansas Department of Revenue Property Valuation...

  7. United Mitochondrial Disease Foundation

    Science.gov (United States)

    ... Other Ways to Give Matching Gifts Donate Your Car Online Options United Way Close About UMDF Our ... Rights Reserved | UMDF Donor Privacy Policy Facebook Twitter Google+ Youtube Vimeo Instagram Email STAY UPDATED! Join the ...

  8. Voltage verification unit

    Science.gov (United States)

    Martin, Edward J.

    2008-01-15

    A voltage verification unit and method for determining the absence of potentially dangerous potentials within a power supply enclosure without Mode 2 work is disclosed. With this device and method, a qualified worker, following a relatively simple protocol that involves a function test (hot, cold, hot) of the voltage verification unit before Lock Out/Tag Out and, and once the Lock Out/Tag Out is completed, testing or "trying" by simply reading a display on the voltage verification unit can be accomplished without exposure of the operator to the interior of the voltage supply enclosure. According to a preferred embodiment, the voltage verification unit includes test leads to allow diagnostics with other meters, without the necessity of accessing potentially dangerous bus bars or the like.

  9. Cereal Crops Research Unit

    Data.gov (United States)

    Federal Laboratory Consortium — The mission of the Cereal Crops Research Unit is to 1) conduct basic research to identify and understand the biological processes affecting the growth, development...

  10. Cereal Crops Research Unit

    Data.gov (United States)

    Federal Laboratory Consortium — The mission of the Cereal Crops Research Unit is to 1) conduct basic research to identify and understand the biological processes affecting the growth, development...

  11. Operable Unit Boundaries

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset consists of operable unit data from multiple Superfund sites in U.S. EPA Region 8. These data were acquired from multiple sources at different times and...

  12. Insects: An Interdisciplinary Unit

    Science.gov (United States)

    Leger, Heather

    2007-01-01

    The author talks about an interdisciplinary unit on insects, and presents activities that can help students practice communication skills (interpersonal, interpretive, and presentational) and learn about insects with hands-on activities.

  13. The role of the peripheral sympathetic nervous system in the natriuresis following central administration of an I1 imidazoline agonist, moxonidine.

    Science.gov (United States)

    Penner, S. B.; Smyth, D. D.

    1995-01-01

    1. Central administration of the I1-imidazoline receptor agonist moxonidine increases sodium excretion without alteration of blood pressure. In the present study we determined whether this natriuretic action was mediated through a decrease in activity of the sympathetic nervous system, as has been reported for the antihypertensive action of this compound. Interruption of the sympathetic nervous system was achieved with prazosin (alpha 1-adrenoceptor antagonist) and renal denervation. 2. In pentobarbitone-anaesthetized Sprague-Dawley rats, intracerebroventricular (i.c.v.) injection of moxonidine alone increased urine volume and sodium excretion. Prazosin (0.15 mg kg-1, i.v.) alone decreased urine flow rate and sodium excretion as compared to the vehicle controls. In the presence of prazosin, i.c.v. injection of moxonidine failed to increase sodium excretion or urine volume as compared to animals which received the prazosin alone. 3. The administration of moxonide (i.c.v.) to sham renal-denervated animals caused an increase in urine flow rate, urine sodium excretion, osmolar clearance and free water clearance. The increase in sodium excretion and osmolar clearance were completely attenuated in renal denervated rats, however, urine flow rate was still increased and this was secondary to the increase in free water clearance which remained intact. 4. These results indicate the importance of an intact sympathetic nervous system in the renal response to i.c.v. moxonidine. Moreover, the differential antagonism of these interventions on solute and water excretion indicate that they may be mediated at two separate sites and/or receptors following i.c.v. moxonidine. PMID:8590981

  14. Molecular evolution of the nif gene cluster carrying nifI1 and nifI2 genes in the Gram-positive phototrophic bacterium Heliobacterium chlorum.

    Science.gov (United States)

    Enkh-Amgalan, Jigjiddorj; Kawasaki, Hiroko; Seki, Tatsuji

    2006-01-01

    A major nif cluster was detected in the strictly anaerobic, Gram-positive phototrophic bacterium Heliobacterium chlorum. The cluster consisted of 11 genes arranged within a 10 kb region in the order nifI1, nifI2, nifH, nifD, nifK, nifE, nifN, nifX, fdx, nifB and nifV. The phylogenetic position of Hbt. chlorum was the same in the NifH, NifD, NifK, NifE and NifN trees; Hbt. chlorum formed a cluster with Desulfitobacterium hafniense, the closest neighbour of heliobacteria based on the 16S rRNA phylogeny, and two species of the genus Geobacter belonging to the Deltaproteobacteria. Two nifI genes, known to occur in the nif clusters of methanogenic archaea between nifH and nifD, were found upstream of the nifH gene of Hbt. chlorum. The organization of the nif operon and the phylogeny of individual and concatenated gene products showed that the Hbt. chlorum nif operon carrying nifI genes upstream of the nifH gene was an intermediate between the nif operon with nifI downstream of nifH (group II and III of the nitrogenase classification) and the nif operon lacking nifI (group I). Thus, the phylogenetic position of Hbt. chlorum nitrogenase may reflect an evolutionary stage of a divergence of the two nitrogenase groups, with group I consisting of the aerobic diazotrophs and group II consisting of strictly anaerobic prokaryotes.

  15. Factors that affect transfer of the IncI1 β-lactam resistance plasmid pESBL-283 between E. coli strains.

    Directory of Open Access Journals (Sweden)

    Nadine Händel

    Full Text Available The spread of antibiotic resistant bacteria worldwide presents a major health threat to human health care that results in therapy failure and increasing costs. The transfer of resistance conferring plasmids by conjugation is a major route by which resistance genes disseminate at the intra- and interspecies level. High similarities between resistance genes identified in foodborne and hospital-acquired pathogens suggest transmission of resistance conferring and transferrable mobile elements through the food chain, either as part of intact strains, or through transfer of plasmids from foodborne to human strains. To study the factors that affect the rate of plasmid transfer, the transmission of an extended-spectrum β-lactamase (ESBL plasmid from a foodborne Escherichia coli strain to the β-lactam sensitive E. coli MG1655 strain was documented as a function of simulated environmental factors. The foodborne E. coli isolate used as donor carried a CTX-M-1 harboring IncI1 plasmid that confers resistance to β-lactam antibiotics. Cell density, energy availability and growth rate were identified as factors that affect plasmid transfer efficiency. Transfer rates were highest in the absence of the antibiotic, with almost every acceptor cell picking up the plasmid. Raising the antibiotic concentrations above the minimum inhibitory concentration (MIC resulted in reduced transfer rates, but also selected for the plasmid carrying donor and recombinant strains. Based on the mutational pattern of transconjugant cells, a common mechanism is proposed which compensates for fitness costs due to plasmid carriage by reducing other cell functions. Reducing potential fitness costs due to maintenance and expression of the plasmid could contribute to persistence of resistance genes in the environment even without antibiotic pressure. Taken together, the results identify factors that drive the spread and persistence of resistance conferring plasmids in natural isolates

  16. Factors that affect transfer of the IncI1 β-lactam resistance plasmid pESBL-283 between E. coli strains.

    Science.gov (United States)

    Händel, Nadine; Otte, Sarah; Jonker, Martijs; Brul, Stanley; ter Kuile, Benno H

    2015-01-01

    The spread of antibiotic resistant bacteria worldwide presents a major health threat to human health care that results in therapy failure and increasing costs. The transfer of resistance conferring plasmids by conjugation is a major route by which resistance genes disseminate at the intra- and interspecies level. High similarities between resistance genes identified in foodborne and hospital-acquired pathogens suggest transmission of resistance conferring and transferrable mobile elements through the food chain, either as part of intact strains, or through transfer of plasmids from foodborne to human strains. To study the factors that affect the rate of plasmid transfer, the transmission of an extended-spectrum β-lactamase (ESBL) plasmid from a foodborne Escherichia coli strain to the β-lactam sensitive E. coli MG1655 strain was documented as a function of simulated environmental factors. The foodborne E. coli isolate used as donor carried a CTX-M-1 harboring IncI1 plasmid that confers resistance to β-lactam antibiotics. Cell density, energy availability and growth rate were identified as factors that affect plasmid transfer efficiency. Transfer rates were highest in the absence of the antibiotic, with almost every acceptor cell picking up the plasmid. Raising the antibiotic concentrations above the minimum inhibitory concentration (MIC) resulted in reduced transfer rates, but also selected for the plasmid carrying donor and recombinant strains. Based on the mutational pattern of transconjugant cells, a common mechanism is proposed which compensates for fitness costs due to plasmid carriage by reducing other cell functions. Reducing potential fitness costs due to maintenance and expression of the plasmid could contribute to persistence of resistance genes in the environment even without antibiotic pressure. Taken together, the results identify factors that drive the spread and persistence of resistance conferring plasmids in natural isolates and shows how these

  17. Dimensionless Units in the SI

    CERN Document Server

    Mohr, Peter J

    2014-01-01

    The International System of Units (SI) is supposed to be coherent. That is, when a combination of units is replaced by an equivalent unit, there is no additional numerical factor. Here we consider dimensionless units as defined in the SI, {\\it e.g.} angular units like radians or steradians and counting units like radioactive decays or molecules. We show that an incoherence may arise when different units of this type are replaced by a single dimensionless unit, the unit "one", and suggest how to properly include such units into the SI in order to remove the incoherence. In particular, we argue that the radian is the appropriate coherent unit for angles and that hertz is not a coherent unit in the SI. We also discuss how including angular and counting units affects the fundamental constants.

  18. Battery thermal management unit

    Science.gov (United States)

    Sanders, Nicholas A.

    1989-03-01

    A battery warming device has been designed which uses waste heat from an operating internal combustion engine to warm a battery. A portion of the waste heat is stored in the sensible and latent heat of a phase change type material for use in maintaining the battery temperature after the engine is shut off. The basic design of the device consists of a Phase Change Material (PCM) reservoir and a simple heat exchanger connected to the engineer's cooling system. Two types of units were built, tested and field trialed. A strap-on type which was strapped to the side of an automotive battery and was intended for the automotive after-market and a tray type on which a battery or batteries sat. This unit was intended for the heavy duty truck market. It was determined that both types of units increased the average cranking power of the batteries they were applied to. Although there were several design problems with the units such as the need for an automatic thermostatically controlled bypass valve, the overall feeling is that there is a market opportunity for both the strap-on and tray type battery warming units.

  19. Coherence for weak units

    CERN Document Server

    Joyal, André

    2009-01-01

    We define weak units in a semi-monoidal 2-category $\\CC$ as cancellable pseudo-idempotents: they are pairs $(I,\\alpha)$ where $I$ is an object such that tensoring with $I$ from either side constitutes a biequivalence of $\\CC$, and $\\alpha: I \\tensor I \\to I$ is an equivalence in $\\CC$. We show that this notion of weak unit has coherence built in: Theorem A: $\\alpha$ has a canonical associator 2-cell, which automatically satisfies the pentagon equation. Theorem B: every morphism of weak units is automatically compatible with those associators. Theorem C: the 2-category of weak units is contractible if non-empty. Finally we show (Theorem E) that the notion of weak unit is equivalent to the notion obtained from the definition of tricategory: $\\alpha$ alone induces the whole family of left and right maps (indexed by the objects), as well as the whole family of Kelly 2-cells (one for each pair of objects), satisfying the relevant coherence axioms.

  20. Dispersion in unit disks

    CERN Document Server

    Dumitrescu, Adrian

    2009-01-01

    We present two new approximation algorithms with (improved) constant ratios for selecting $n$ points in $n$ unit disks such that the minimum pairwise distance among the points is maximized. (I) A very simple $O(n \\log{n})$-time algorithm with ratio 0.5110 for disjoint unit disks. In combination with an algorithm of Cabello \\cite{Ca07}, it yields a $O(n^2)$-time algorithm with ratio of 0.4487 for dispersion in $n$ not necessarily disjoint unit disks. (II) A more sophisticated LP-based algorithm with ratio 0.6495 for disjoint unit disks that uses a linear number of variables and constraints, and runs in polynomial time. The algorithm introduces a novel technique which combines linear programming and projections for approximating distances. The previous best approximation ratio for disjoint unit disks was 1/2. Our results give a partial answer to an open question raised by Cabello \\cite{Ca07}, who asked whether 1/2 could be improved.

  1. Signal processing unit

    Energy Technology Data Exchange (ETDEWEB)

    Boswell, J.

    1983-01-01

    The architecture of the signal processing unit (SPU) comprises an ROM connected to a program bus, and an input-output bus connected to a data bus and register through a pipeline multiplier accumulator (pmac) and a pipeline arithmetic logic unit (palu), each associated with a random access memory (ram1,2). The system pulse frequency is from 20 mhz. The pmac is further detailed, and has a capability of 20 mega operations per second. There is also a block diagram for the palu, showing interconnections between the register block (rbl), separator for bus (bs), register (reg), shifter (sh) and combination unit. The first and second rams have formats 64*16 and 32*32 bits, respectively. Further data are a 5-v power supply and 2.5 micron n-channel silicon gate mos technology with about 50000 transistors.

  2. Moxonidine-induced transient pressor response is mediated by both I1-imidazoline receptors and α2-adrenoceptors in anesthetized spontaneously hypertensive rats%I1-咪唑啉受体和α2受体介导大鼠静脉注射莫索尼定的瞬时升压作用

    Institute of Scientific and Technical Information of China (English)

    马秀娟; 刘爱军; 沈甫明; 吴明月; 吴英良; 苏定冯

    2007-01-01

    目的:考察哪些受体参与了莫索尼定的瞬时升压作用.方法:雌性自发性高血压大鼠(SHR)采用乌拉坦麻醉.分别经静脉给予可乐定(3、10、30 μg/kg)和莫索尼定(0.1、0.3、1.0mg/kg),经侧脑室给予莫索尼定或经胃管给予莫索尼定(1.0、10.0mg/kg),观察瞬时升压现象的发生情况;莫索尼定(0.3mg/kg)静脉注射前预注射哌唑嗪(10.0μg/kg)、育亨宾(2.0mg/kg)、酚妥拉明(0.2mg/kg)、咪唑克生(1.0mg/kg)或育亨宾+咪唑克生(2.0mg/kg+1.0mg/kg),观察莫索尼定瞬时升压作用的变化情况,确定α1受体、α2受体和I1-味唑啉受体在莫索尼定瞬时升压中的作用.结果:在降压程度相当的情况下,静脉注射莫索尼定的瞬时升压作用比可乐定强大得多.莫索尼定的瞬时升压作用不受哌唑嗪的影响,但可被育亨宾、酚妥拉明或咪唑克生部分阻断,而被育亨宾+咪唑克生完全阻断.莫索尼定侧脑室和胃管给药不产生瞬时升压现象.结论:静脉注射莫索尼定引起的瞬时升压作用是由外周α2受体和I1-咪唑啉受体共同介导的.%Objective:Clonidine,by activating peripheral α-sbrenoceptors, produces transient pressor response after i.v.injection in anesthetized animals.Moxonidine, with at least 40-fold higher affinity to I1-imidazoline receptors than to α2-adrenoceptors,produces also a transient pressor response. This work was designed to investigate whether I1-imidazoline receptors are involved in this pressor effect of moxonidine. Methods:Female spontaneously hypertensive rats(SHRs,aged 14-16 weeks)were anesthetized with urethane.To observe the transient pressor responses,moxonidine 0.1,0.3,1.0mg/kg(intravenous,i.v),2.0μg(intracerebroventricular,i.c.v.)and 1.0,10.0mg/kg(intragastric,i.g.)were administrated in different groups of rats.To evaluate the roles of α1-adrenoceptors,α2-adrenoceptors and I1-imidazoline receptors in the transient pressor responses to moxonidine, prazosin(10.0

  3. Allocating multiple units

    DEFF Research Database (Denmark)

    Tranæs, Torben; Krishna, Kala

    2002-01-01

    This paper studies the allocation and rent distribution in multi-unit, combinatorial-bid auctions under complete information. We focus on the natural multi-unit analogue of the first-price auction, where buyers bid total payments, pay their bids, and where the seller allocates goods to maximize his...... revenue. While there are many equilibria in this auction, only efficient equilibria remain when the truthful equilibrium restriction of the menu-auction literature is used. Focusing on these equilibria we first show that the first-price auction just described is revenue and outcome equivalent to a Vickrey...

  4. United States Attorney Prosecutions

    Science.gov (United States)

    1993-10-01

    Berceda, 572 F.2d 630 (9th Cir. 1978).. A mere request, such as that made by the defendant, is not sufficient; United States v. Trejo- Zambrano , 582 F.2d...a mere request and more than mere speculation that disclosure will be helpful. United States v. Trejo- Zambrano , 582 F.2d 460 (9th Cir. 1978), eect. dt...both known and unknown to the Grand Jury, including Lane Boudreau, Scott Willard Holland, James Allen Halperin, Maria Ximena Erlandsen, Derek Adrian

  5. Complete sequencing of IncI1 sequence type 2 plasmid pJIE512b indicates mobilization of blaCMY-2 from an IncA/C plasmid.

    Science.gov (United States)

    Tagg, Kaitlin A; Iredell, Jonathan R; Partridge, Sally R

    2014-08-01

    Sequencing of pJIE512b, a 92.3-kb IncI1 sequence type 2 (ST2) plasmid carrying bla(CMY-2), revealed a bla(CMY-2) context that appeared to have been mobilized from an IncA/C plasmid by the insertion sequence IS1294. A comparison with published plasmids suggests that bla(CMY-2) has been mobilized from IncA/C to IncI1 plasmids more than once by IS1294-like elements. Alignment of pJIE512b with the only other available IncI1 ST2 plasmid revealed differences across the backbones, indicating variability within this sequence type. Copyright © 2014, American Society for Microbiology. All Rights Reserved.

  6. Integration of Fourier Transform Infrared Spectroscopy, Fluorescence Spectroscopy, Steady-state Kinetics and Molecular Dynamics Simulations of Gαi1 Distinguishes between the GTP Hydrolysis and GDP Release Mechanism.

    Science.gov (United States)

    Schröter, Grit; Mann, Daniel; Kötting, Carsten; Gerwert, Klaus

    2015-07-10

    Gα subunits are central molecular switches in cells. They are activated by G protein-coupled receptors that exchange GDP for GTP, similar to small GTPase activation mechanisms. Gα subunits are turned off by GTP hydrolysis. For the first time we employed time-resolved FTIR difference spectroscopy to investigate the molecular reaction mechanisms of Gαi1. FTIR spectroscopy is a powerful tool that monitors reactions label free with high spatio-temporal resolution. In contrast to common multiple turnover assays, FTIR spectroscopy depicts the single turnover GTPase reaction without nucleotide exchange/Mg(2+) binding bias. Global fit analysis resulted in one apparent rate constant of 0.02 s(-1) at 15 °C. Isotopic labeling was applied to assign the individual phosphate vibrations for α-, β-, and γ-GTP (1243, 1224, and 1156 cm(-1), respectively), α- and β-GDP (1214 and 1134/1103 cm(-1), respectively), and free phosphate (1078/991 cm(-1)). In contrast to Ras · GAP catalysis, the bond breakage of the β-γ-phosphate but not the Pi release is rate-limiting in the GTPase reaction. Complementary common GTPase assays were used. Reversed phase HPLC provided multiple turnover rates and tryptophan fluorescence provided nucleotide exchange rates. Experiments were complemented by molecular dynamics simulations. This broad approach provided detailed insights at atomic resolution and allows now to identify key residues of Gαi1 in GTP hydrolysis and nucleotide exchange. Mutants of the intrinsic arginine finger (Gαi1-R178S) affected exclusively the hydrolysis reaction. The effect of nucleotide binding (Gαi1-D272N) and Ras-like/all-α interface coordination (Gαi1-D229N/Gαi1-D231N) on the nucleotide exchange reaction was furthermore elucidated.

  7. AmyI-1-18, a cationic α-helical antimicrobial octadecapeptide derived from α-amylase in rice, inhibits the translation and folding processes in a protein synthesis system.

    Science.gov (United States)

    Taniguchi, Masayuki; Ochiai, Akihito; Fukuda, Shun; Sato, Teppei; Saitoh, Eiichi; Kato, Tetsuo; Tanaka, Takaaki

    2016-10-01

    In our previous study, we used a cell-free rapid translation system (RTS), which is an in vitro protein synthesis system based on Escherichia coli lysate, for evaluating the inhibition of green fluorescent protein (GFP) synthesis by pyrrhocoricin. In this study, using an RTS, we evaluated the inhibition of GFP synthesis by AmyI-1-18, an antimicrobial octadecapeptide. We found that, similarly to pyrrhocoricin, AmyI-1-18 inhibited GFP synthesis in the RTS in a concentration-dependent manner. In addition, the blockage of transcription and translation steps in the RTS was individually estimated using RT-PCR after gene expression to determine the mRNA products and using sodium dodecyl sulfate-polyacrylamide gel electrophoresis to determine the amounts of GFP expressed from purified mRNA, respectively. The results demonstrated that the inhibition of GFP synthesis by AmyI-1-18 did not occur at the transcription step but rather at the translation step. Furthermore, we assessed the inhibition of DnaK-mediated refolding of chemically denatured luciferase by AmyI-1-18; AmyI-1-18 inhibited the protein folding activity of the ATP-dependent DnaK/DnaJ molecular chaperone system in a concentration-dependent manner. Surface plasmon resonance (SPR) analysis showed that AmyI-1-18 strongly bound to RNA with a KD value of 1.4 × 10(-8) M but not to DNA and that AmyI-1-18 specifically bound to DnaK with a KD value of 4.4 × 10(-6) M. These SPR analysis results supported the results obtained in both the RTS and the molecular chaperone system. These results demonstrated that both RNA and DnaK are most likely the target of AmyI-1-18 in the protein synthesis system. Copyright © 2016 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  8. Women's Rights Unit.

    Science.gov (United States)

    Weiss, Helen; Weigel, Margaret

    Designed for use in the intermediate grades, this interdisciplinary unit helps students examine traditional and modern roles of women. Fourteen lessons focus on women's activities in colonial America, reasons for women's discontent, the women's rights movement of the 1800's, changes in the roles of women, enfranchisement of women, women's role…

  9. Consumer Mathematics. Teaching Units.

    Science.gov (United States)

    North Carolina State Dept. of Public Instruction, Raleigh.

    GRADES OR AGES: Secondary school. SUBJECT MATTER: Consumer mathematics including--money management, transportation, probability, swindles and gyps, insurance, housing, taxes, consumer credit, banks, savings, and investments. ORGANIZATION AND PHYSICAL APPEARANCE: The guide is divided into ten parallel units, one for each of the above areas, which…

  10. United in change

    NARCIS (Netherlands)

    Hanneke Posthumus; Josje den Ridder; Joep de Hart

    2014-01-01

    Original title: Verenigd in verandering The importance of citizens who unite in civil society organisations is broadly recognised. Organisations bind people to each other, to the community and to the political system. How are civil-society organisations in the Netherlands faring? Is there

  11. Outdoorsman, Unit III.

    Science.gov (United States)

    Alberta Dept. of Agriculture, Edmonton.

    The third and final unit of the 4-H Outdoorsman Program covers the most advanced and challenging campcraft skills for 4-H members in British Columbia, Alberta, Saskatchewan and Manitoba. Survival camping (including building shelters and finding food), in-depth map-reading and orienteering, game management, hiking themes and recordkeeping are all…

  12. Sickle Cell Unit.

    Science.gov (United States)

    Canipe, Stephen L.

    Included in this high school biology unit on sickle cell anemia are the following materials: a synopsis of the history of the discovery and the genetic qualities of the disease; electrophoresis diagrams comparing normal, homozygous and heterozygous conditions of the disease; and biochemical characteristics and population genetics of the disease. A…

  13. Whale Teaching Unit.

    Science.gov (United States)

    Peninsula Humane Society, San Mateo, CA.

    Materials in this teaching unit are designed to foster an interest in whale preservation among intermediate grade and junior high school students. Several readings provide background information on various types of whales and the economic value of whales. Student activities include a true and false game, a crossword, and a mobile. A resource list…

  14. Whale Teaching Unit.

    Science.gov (United States)

    Peninsula Humane Society, San Mateo, CA.

    Materials in this teaching unit are designed to foster an interest in whale preservation among intermediate grade and junior high school students. Several readings provide background information on various types of whales and the economic value of whales. Student activities include a true and false game, a crossword, and a mobile. A resource list…

  15. Transfer of manufacturing units

    DEFF Research Database (Denmark)

    Madsen, Erik Skov; Riis, Jens Ove; Sørensen, Brian Vejrum

    2008-01-01

    The ongoing and unfolding relocation of activities is one of the major trends, that calls for attention in the domain of operations management. In particular, prescriptive models outlining: stages of the process, where to locate, and how to establish the new facilities have been studied, while...... and dilemmas to be addressed when transferring manufacturing units....

  16. Laser color recording unit

    Science.gov (United States)

    Jung, E.

    1984-05-01

    A color recording unit was designed for output and control of digitized picture data within computer controlled reproduction and picture processing systems. In order to get a color proof picture of high quality similar to a color print, together with reduced time and material consumption, a photographic color film material was exposed pixelwise by modulated laser beams of three wavelengths for red, green and blue light. Components of different manufacturers for lasers, acousto-optic modulators and polygon mirrors were tested, also different recording methods as (continuous tone mode or screened mode and with a drum or flatbed recording principle). Besides the application for the graphic arts - the proof recorder CPR 403 with continuous tone color recording with a drum scanner - such a color hardcopy peripheral unit with large picture formats and high resolution can be used in medicine, communication, and satellite picture processing.

  17. LIDAR COMBINED SCANNING UNIT

    Directory of Open Access Journals (Sweden)

    V. V. Elizarov

    2016-11-01

    Full Text Available Subject of Research. The results of lidar combined scanning unit development for locating leaks of hydrocarbons are presented The unit enables to perform high-speed scanning of the investigated space in wide and narrow angle fields. Method. Scanning in a wide angular field is produced by one-line scanning path by means of the movable aluminum mirror with a frequency of 20Hz and amplitude of 20 degrees of swing. Narrowband scanning is performed along a spiral path by the deflector. The deflection of the beam is done by rotation of the optical wedges forming part of the deflector at an angle of ±50. The control function of the scanning node is performed by a specialized software product written in C# programming language. Main Results. This scanning unit allows scanning the investigated area at a distance of 50-100 m with spatial resolution at the level of 3 cm. The positioning accuracy of the laser beam in space is 15'. The developed scanning unit gives the possibility to browse the entire investigated area for the time not more than 1 ms at a rotation frequency of each wedge from 50 to 200 Hz. The problem of unambiguous definition of the beam geographical coordinates in space is solved at the software level according to the rotation angles of the mirrors and optical wedges. Lidar system coordinates are determined by means of GPS. Practical Relevance. Development results open the possibility for increasing the spatial resolution of scanning systems of a wide range of lidars and can provide high positioning accuracy of the laser beam in space.

  18. Unit 5. Thermodynamics (Summary)

    OpenAIRE

    Beléndez Vázquez, Augusto

    2012-01-01

    Summary of the "Unit 5. Thermodynamics" of course "Physical Foundations of Engineering I". Degree in Sound and Image Engineering, in Telecommunications. Polytechnic School of the University of Alicante Resumen del "Tema 5. Termodinámica" de la asignatura "Fundamentos Físicos de la Ingeniería I". Grado en Ingeniería en Sonido e Imagen en Telecomunicaciones. Escuela Politécnica Superior. Universidad de Alicante.

  19. Analysis of the use of drugs in cardiovascular and antidiabetic primary health care according to age - doi: 10.4025/actascihealthsci.v35i1.10694

    Directory of Open Access Journals (Sweden)

    Marcos Aparecido Sarria Cabrera

    2013-03-01

    Full Text Available The population of elderly and non-elderly users of a Basic Health Unit (UBS was interviewed regarding the use of cardiovascular and anti-diabetic medications, as well as the adverse effects that were noted. Hypertension and diabetes mellitus are conditions involving complications and compromise the quality of life of patients. The objective was to build a profile of these users. The cross-sectional study was carried out on patients older than 18 years of age and users of cardiovascular or anti-diabetic drugs in Centro Social Urbano UBS, located in Londrina – PR, Brazil. The result revealed the following statistically significant variables: lower use of beta blockers (p = 0.012 and metformin (p = 0.05 among the elderly compared to the overall average, and higher acetylsalicylic acid (ASA (p = 0.006 use in people over 64 years of age. Reported adverse symptoms were lower among those over 64 years old (p = 0.03. Angiotensin-converting enzyme (ACE inhibitors are the most used (63.5%, followed by diuretics (54.9% and beta-blockers (27.7%. Among diabetic patients, 23.2% were using biguanides and 15.9% sulfonylureas; only 6.6% were insulin-dependent. The conclusion is that drug therapies within the sample were mostly in accordance with current guidelines.  

  20. Benzo[ di> ][1,2,3]thiadiazole (isoBT): Synthesis, Structural Analysis, and Implementation in Semiconducting Polymers

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Zhihua; Brown, Jennifer; Drees, Martin; Seger, Mark; Hu, Yan; Xia, Yu; Boudinet, Damien; McCray, Meko; Delferro, Massimiliano; Marks, Tobin J.; Liao, Chuang-Yi; Ko, Chung-Wen; Chang, Yi-Ming; Facchetti, Antonio

    2016-09-13

    Benzo[d][2,1,3]thiadiazole (BT) is a markedly electron-deficient heterocycle widely employed in the realization of organic semiconductors for applications spanning transistors, solar cells, photodetectors, and thermoelectrics. In this contribution, we implement the corresponding isomer, benzo[d][1,2,3]thiadiazole (isoBT), along with new 6-fluoroisoBT and 5,6-difluoro-isoBT units as synthons for constructing alternating copolymers with tetrathiophene (P1-P3). New isoBT-based small molecules as well as the corresponding BTquaterthiophene based polymers (P4-P6) are synthesized and characterized to probe architectural, electronic structural, and device performance differences between the two families. The results demonstrate that isoBT complements BT in enabling highperformance optoelectronic semiconductors with P3 exhibiting hole mobilities surpassing 0.7 cm2/(V s) in field-effect transistors and power conversion efficiencies of 9% in bulk-heterojunction solar cells.

  1. Prevalence of ST1193 clone and IncI1/ST16 plasmid in E-coli isolates carrying blaCTX-M-55 gene from urinary tract infections patients in China.

    Science.gov (United States)

    Xia, Liang; Liu, Yang; Xia, Shu; Kudinha, Timothy; Xiao, Shu-Nian; Zhong, Nan-Shan; Ren, Guo-Sheng; Zhuo, Chao

    2017-03-24

    To study molecular epidemiology of CTX-M-55-carrying Escherichia coli isolates from urinary tract infections (UTIs) in China. 111 blaCTX-M-55-positive E.coli isolates from UTIs patients in China were studied. Pulsed-field gel electrophoresis (PFGE) and multilocus sequence typing (MLST) were used to analyze the homologies among the strains. Conjugation experiments, S1nuclease PFGE and PCR analysis were performed to characterize plasmids harboring blaCTX-M-55 and their genetic environment. 111 isolates were clustered into 86 individual pulsotypes and three clusters by PFGE. Fifty-five (49.5%) of the isolates belonged to 8 STs. Most of the ST1193 isolates belonged to one PFGE cluster. Transconjugants (n = 45) derived from randomly selected blaCTX-M-55 donors (n = 58), were found to contain a single 90-kb conjugative plasmid, which mainly belonged to the IncI1 groups (34, 76%). Among the IncI1 plasmids, the blaCTX-M-55/IncI1/ST16 predominated (23/34, 68%). The blaTEM-1 and aac (3')-II genes were frequently detected on the IncI1 plasmids, and the insertion of ISEcp1 or IS26 was observed at the 48 bp or 45 bp upstream of the start codon of blaCTX-M-55 gene. The dissemination of blaCTX-M-55 gene among E. coli UTI isolates, appeared to be due to both the major clonal lineage of ST1193 and the horizontal transfer of epidemic plasmid IncI1/ST16.

  2. Prevalence of ST1193 clone and IncI1/ST16 plasmid in E-coli isolates carrying blaCTX-M-55 gene from urinary tract infections patients in China

    Science.gov (United States)

    Xia, Liang; Liu, Yang; Xia, Shu; Kudinha, Timothy; Xiao, Shu-nian; Zhong, Nan-shan; Ren, Guo-sheng; Zhuo, Chao

    2017-01-01

    To study molecular epidemiology of CTX-M-55-carrying Escherichia coli isolates from urinary tract infections (UTIs) in China. 111 blaCTX-M-55-positive E.coli isolates from UTIs patients in China were studied. Pulsed-field gel electrophoresis (PFGE) and multilocus sequence typing (MLST) were used to analyze the homologies among the strains. Conjugation experiments, S1nuclease PFGE and PCR analysis were performed to characterize plasmids harboring blaCTX-M-55 and their genetic environment. 111 isolates were clustered into 86 individual pulsotypes and three clusters by PFGE. Fifty-five (49.5%) of the isolates belonged to 8 STs. Most of the ST1193 isolates belonged to one PFGE cluster. Transconjugants (n = 45) derived from randomly selected blaCTX-M-55 donors (n = 58), were found to contain a single 90-kb conjugative plasmid, which mainly belonged to the IncI1 groups (34, 76%). Among the IncI1 plasmids, the blaCTX-M-55/IncI1/ST16 predominated (23/34, 68%). The blaTEM-1 and aac (3′)-II genes were frequently detected on the IncI1 plasmids, and the insertion of ISEcp1 or IS26 was observed at the 48 bp or 45 bp upstream of the start codon of blaCTX-M-55 gene. The dissemination of blaCTX-M-55 gene among E. coli UTI isolates, appeared to be due to both the major clonal lineage of ST1193 and the horizontal transfer of epidemic plasmid IncI1/ST16. PMID:28338012

  3. UNIT COMMITMENT: A NEW TRUNCATED METHOD OF UNIT ...

    African Journals Online (AJOL)

    NIJOTECH

    limits, minimum up/down times. Other ... incremental heat rate in ₦/hour for unit i ... approaches to treating thermal unit during its ... (d) Load Balance: During each interval of time, k, the .... The unit information and initial conditions are shown in.

  4. Dynamic Torque Calibration Unit

    Science.gov (United States)

    Agronin, Michael L.; Marchetto, Carl A.

    1989-01-01

    Proposed dynamic torque calibration unit (DTCU) measures torque in rotary actuator components such as motors, bearings, gear trains, and flex couplings. Unique because designed specifically for testing components under low rates. Measures torque in device under test during controlled steady rotation or oscillation. Rotor oriented vertically, supported by upper angular-contact bearing and lower radial-contact bearing that floats axially to prevent thermal expansion from loading bearings. High-load capacity air bearing available to replace ball bearings when higher load capacity or reduction in rate noise required.

  5. Small Unit Operations

    Science.gov (United States)

    2007-11-02

    best demonstrated value for small (< AA size) lithium - thionyl - chloride batteries (Halpert 1993). Equation (2-3) shows that the solar power...However, this energy den- sity this is only ~ 3 times larger than the demonstrated performance of the best lithium batteries , and the fuel cells are...Units 13 2.2.2 ASIC Capability 15 2.2.3 Power and Size 17 2.2.4 Cost 19 2.3 Power Sources 20 2.3.1 Batteries 21 2.3.2 Solar Augmentation

  6. Order Units in a *-Algebra

    Indian Academy of Sciences (India)

    Anil K Karn

    2003-02-01

    Order unit property of a positive element in a *-algebra is defined. It is proved that precisely projections satisfy this order theoretic property. This way, unital hereditary *-subalgebras of a *-algebra are characterized.

  7. DS796 California Groundwater Units

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The California Groundwater Units dataset classifies and delineates the State into one of three groundwater based polygon units: (1) those areas defined as alluvial...

  8. Trend of hydraulic units

    Energy Technology Data Exchange (ETDEWEB)

    Deshimaru, Jun' ichi

    1988-11-01

    The gear, vane and piston pumps occupy a more then 90% share in the hydraulic pumps. Comparatively large pumps are mainly variable delivery piston pumps. The piston pumps are comparatively high in output density (output per unit weight), indicating the hydraulic pump in performance, and tend to become higher and higher in it. Though they are mainly 210 to 350kgf/cm/sup 2/ in rated pressure, some of them come to surpass 400kgf/cm/sup 3/ in it. While the progress in computation also requires the high speed operation, high accuracy and other severe conditions for the hydraulic units, which accordingly and increasingly intensify the requirement for hydraulic oil in abrasion resistibility, oxidation stability and response characteristics. While cavitation comes to easily occur, which considerably and disadvantageously influences hydraulic oil in life through degradation, noise level and respondingness. From now on, the development of high performance oil and study of mechanical structure are important. 19 references, 9 figures, 2 tables.

  9. An ISOLDE target unit

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    A good dozen different targets are available for ISOLDE, made of different materials and equipped with different kinds of ion-sources, according to the needs of the experiments. Each separator (GPS: general purpose; HRS: high resolution) has its own target. Because of the high radiation levels, robots effect the target changes, about 80 times per year. In the standard unit shown in picture _01, the target is the cylindrical object in the front. It contains uranium-carbide kept at a temperature of 2200 deg C, necessary for the isotopes to be able to escape. At either end, one sees the heater current leads, carrying 700 A. The Booster beam, some 3E13 protons per pulse, enters the target from left. The evaporated isotope atoms enter a hot-plasma ion source (the black object behind the target). The whole unit sits at 60 kV potential (pulsed in synchronism with the arrival of the Booster beam) which accelerates the ions (away from the viewer) towards one of the 2 separators.

  10. Snakes: An Integrated Unit Plan.

    Science.gov (United States)

    Lawrence, Lisa

    This document presents an integrated unit plan on snakes targeting second grade students. Objectives of the unit include developing concepts of living things, understanding the contribution and importance of snakes to the environment, and making connections between different disciplines. The unit integrates the topic of snakes into the areas of…

  11. Design of hydraulic recuperation unit

    Directory of Open Access Journals (Sweden)

    Jandourek Pavel

    2016-01-01

    Full Text Available This article deals with design and measurement of hydraulic recuperation unit. Recuperation unit consist of radial turbine and axial pump, which are coupled on the same shaft. Speed of shaft with impellers are 6000 1/min. For economic reasons, is design of recuperation unit performed using commercially manufactured propellers.

  12. United Arab Emirates.

    Science.gov (United States)

    1985-02-01

    This discussion of the United Arab Emirates focuses on the following: the people; geography; history; government; political conditions; defense; the economy; foreign relations; and relations between the US and the United Arab Emirates. In 1983 the population was estimated at 1,194,000. In 1984 the annual growth rate was negative. Life expectancy is about 60 years. Fewer than 20% of the population are UAE citizens. Indigenous Emiris are Arab; the rest of the population includes significant numbers of other Arabs -- Palestinians, Egyptians, Jordanians, Yemenis, Omanis, as well as many Iranians, Pakistanis, Indians, and West Europeans, especially in Dubai. The UAE is in the eastern Arabian Peninsula, bounded on the north by the Persian Gulf. European and Arab pirates roamed the Trucial Coast area from the 17th century into the 19th century. Early British expeditions against the pirates led to further campaigns against their headquarters. Piracy continued intermittently until 1835, when the shaikhs agreed not to engage in hostilities at sea. Primarily in reaction to the ambitions of other European countries, the UK and the Trucial States established closer bonds in an 1892 treaty. In 1968 the British government announced its decision, reaffirmed in March 1971, to end the treaty relationship with the gulf shaikhdoms. When the British protective treaty with the Trucial Shaikhdoms ended on December 1, they became fully independent. On December 2, 1971, 6 of them entered into a union called the United Arab Emirates. The 7th, Ras al-Khaimah, joined in early 1972. Administratively, the UAE is a loose federation of 7 emirates, each with its own ruler. The pace at which local government in each emirate is evolving, from traditional to modern, is set primarily by the ruler. Under the provisional constitution of 1971, each emirate reserves considerable powers, including control over mineral rights, taxation, and police powers. In this milieu, the growth of federal powers has

  13. Learning unit: Thin lenses

    Science.gov (United States)

    Nita, L.-S.

    2012-04-01

    Learning unit: Thin lenses "Why objects seen through lenses are sometimes upright and sometimes reversed" Nita Laura Simona National College of Arts and Crafts "Constantin Brancusi", Craiova, Romania 1. GEOMETRIC OPTICS. 13 hours Introduction (models, axioms, principles, conventions) 1. Thin lenses (Types of lenses. Defining elements. Path of light rays through lenses. Image formation. Required physical quantities. Lens formulas). 2. Lens systems (Non-collated lenses. Focalless systems). 3. Human eye (Functioning as an optical system. Sight defects and their corrections). 4. Optical instruments (Characteristics exemplified by a magnifying glass. Paths of light rays through a simplified photo camera. Path of light rays through a classical microscope) (Physics curriculum for the IXth grade/ 2011). This scenario exposes a learning unit based on experimental sequences (defining specific competencies), as a succession of lessons started by noticing a problem whose solution assumes the setup of an experiment under laboratory conditions. Progressive learning of theme objectives are realised with sequential experimental steps. The central cognitive process is the induction or the generalization (development of new knowledge based on observation of examples or counterexamples of the concept to be learnt). Pupil interest in theme objectives is triggered by problem-situations, for example: "In order to better see small objects I need a magnifying glass. But when using a magnifier, small object images are sometimes seen upright and sometimes seen reversed!" Along the way, pupils' reasoning will converge to the idea: "The image of an object through a lens depends on the relative distances among object, lens, and observer". Associated learning model: EXPERIMENT Specific competencies: derived from the experiment model, in agreement with the following learning unit steps I. Evoking - Anticipation: Size of the problem, formulation of hypotheses and planning of experiment. II

  14. Dahlia-shaped BiOClxI1-x structures prepared by a facile solid-state method: Evidence and mechanism of improved photocatalytic degradation of rhodamine B dye.

    Science.gov (United States)

    Xie, Jing; Cao, Yali; Jia, Dianzeng; Li, Yizhao

    2017-10-01

    A rapid and cheap solid-state chemical process was employed to synthesize BiOClxI1-x (x=1.0, 0.75, 0.5, 0.25, 0) solid solutions with dahlia-shaped hierarchitectures. The dahlia-shaped BiOClxI1-x hierarchitectures were effectively constructed by nanoplates with a thickness about 5-13nm. The band gap structure of the solid solutions can be modulated by adjusting the composition ratio of Cl and I, which has a significant effect on the photocatalytic activity of the solid solutions. The dahlia-shaped BiOClxI1-x (x=0.75) solid solution exhibits excellent adsorption and effective photocatalytic performances for rhodamine B (RhB) under visible light irradiation, which degraded more than 98% of RhB within 60min under the visible light irradiation, it is higher than the reported bismuth oxyhalides materials. The trapping experiments confirmed that O(2-) and h(+) played the major role in the photocatalytic process and the possible photocatalytic reaction mechanism was illustrated. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. Last call for units

    Science.gov (United States)

    Randall, Stuart; Rosen, Ronald; Jones, Clifford; Bean, Leonard W.; Lane, Frank

    2009-09-01

    I am writing with regard to Kevin McGuigan's definition of the darwin unit, Dw, as "the mathematical probability of one undergraduate (or faculty) fatality per practical if the person in question is left to their own devices" (July p60). Although it is clear how the loss of genitals in a laboratory accident would result in a student's removal from the gene pool, McGuigan does not explain how the loss of finger (a 1 mDw event, he suggests) might impede procreation in the slightest. Perhaps McGuigan is confusing Darwin's evolution by natural selection with Lamarck's discredited theory of evolution by the inheritance of acquired characteristics. If so, the gulf between physicists and biologists seems as wide as ever.

  16. Forward Deployed Robotic Unit

    Science.gov (United States)

    Brendle, Bruce E., Jr.; Bornstein, Jonathan A.

    2000-07-01

    Forward Deployed Robotic Unit (FDRU) is a core science and technology objective of the US Army, which will demonstrate the impact of autonomous systems on all phases of future land warfare. It will develop, integrate and demonstrate technology required to achieve robotic and fire control capabilities for future land combat vehicles, e.g., Future Combat Systems, using a system of systems approach that culminates in a field demonstration in 2005. It will also provide the required unmanned assets and conduct the demonstration. Battle Lab Warfighting Experiments and data analysis required to understand the effects of unmanned assets on combat operations. The US Army Tank- Automotive & Armaments Command and the US Army Research Laboratory are teaming in an effort to leverage prior technology achievements in the areas of autonomous mobility, architecture, sensor and robotics system integration; advance the state-of-the-art in these areas; and to provide field demonstration/application of the technologies.

  17. The Geography of the Provincial Administration of the Byzantine Empire (ca 600-1200: I.1. The Apothekai of Asia Minor (7th-8th c.

    Directory of Open Access Journals (Sweden)

    Efi RAGIA

    2010-05-01

    Full Text Available Η ΓΕΩΓΡΑΦΙΑ ΤΗΣ ΕΠΑΡΧΙΑΚΗΣ ΔΙΟΙΚΗΣΗΣ ΤΗΣ ΒΥΖΑΝΤΙΝΗΣ ΑΥΤΟΚΡΑΤΟΡΙΑΣ (περ. 600-1200: I.1. ΟΙ ΑΠΟΘΗΚΕΣ ΤΗΣ ΜΙΚΡΑΣ ΑΣΙΑΣ (7ος-8ος αι.Η μετάβαση από το πρωτοβυζαντινό σύστημα διοίκησης των επαρχιών της αυτοκρατορίας στο μεσοβυζαντινό σύστημα των θεμάτων συνέβη σε μια εποχή κατά την οποία οι πληροφορίες που παρέχουν οι πηγές είναι ελάχιστες. Ο θεσμός των θεμάτων είναι γνωστός κυρίως από τον 10ο αι., εποχή κατά την οποία ήταν πλήρως ανεπτυγμένος. Το κενό λοιπόν στην πληροφόρηση όσον αφορά στην μεταμόρφωση της επαρχιακής διοίκησης μπορούν να καλύψουν μόνο οι σφραγίδες των αποθηκών και των βασιλικών κομμερκίων, ενός θεσμού που εμφανίστηκε και αναπτύχθηκε από τα μέσα του 7ου αι. ώς τα μέσα του 8ου αι. Σε καμία πηγή της μέσης βυζαντινής εποχής δεν γίνεται λόγος για το περιεχόμενο του θεσμού αυτού, δηλαδή για τον τρόπο λειτουργίας και για τους σκοπούς που εξυπηρετούσε, γεγονός που έχει δώσει λαβή για τη διατύπωση θεωριών που τον συνδέουν είτε με το εμπόριο, είτε με την εξυπηρέτηση αναγκών των στρατιωτικών σωμάτων της αυτοκρατορίας. Σκοπός της συγκεκριμένης μελέτης ωστόσο δεν είναι η ε

  18. [United theory of aging].

    Science.gov (United States)

    Trubitsyn, A G

    2012-01-01

    In attempts to develop a means of life prolongation the humankind has created more than three hundred theories of the aging; each of them offers the original cause of aging. However, none of them has given practical result by now. The majority of the theories have now only historical interest. There are several different theories that are mainly under consideration currently. They are based on reliable, proven evidence: the free radical theory, the protein error theory, the replicative senescence theory, the theory of reparation weakening, the immunological theory, several versions of neuroendocrinal theories, and programmed aging theory. The theory presented here is based on conception that the life as the phenomenon represents many of the interconnected physical and chemical processes propelled by energy of the mitochondrial bioenergetical machine. Gradual degradation of all vital processes is caused by the programmed decrease in level of bioenergetics. This theory unites all existing theories of aging constructed on authentic facts: it is shown, that such fundamental phenomena accompanying aging process as the increase in level of reactive oxygen species (ROS), the decrease in the general level of protein synthesis, the limitation of cellular dividing (Haiflick limit), decrease in efficiency of reparation mechanisms are caused by bioenergetics attenuation. Each of these phenomena in turn generates a number of harmful secondary processes. Any of the theories bases on one of these destructive phenomena or their combination. Hence, each of them describes one of sides of process of the aging initially caused by programmed decrease of level of bioenergetics. This united theory gives the chance to understand the nature of aging clock and explains a phenomenon of increase in longevity at the condition of food restriction. Failures of attempts to develop means from aging are explained by that the manipulations with the separate secondary phenomena of attenuation of

  19. Friendly units for coldness

    CERN Document Server

    Fraundorf, P

    2006-01-01

    Measures of temperature that center around human experience get lots of use. Of course thermal physics insights of the last century have shown that reciprocal temperature (1/kT) has applications that temperature addresses less well. In addition to taking on negative absolute values under population inversion (e.g. of magnetic spins), bits and bytes turn 1/kT into an informatic measure of the thermal ambient for developing correlations within any complex system. We show here that, in the human-friendly units of bytes and food Calories, water freezes when 1/kT ~200 ZB/Cal or kT ~5 Cal/YB. Casting familiar benchmarks into these terms shows that habitable human space requires coldness values (part of the time, at least) between 0 and 40 ZB/Cal with respect body temperature ~100 degrees F, a range in kT of ~1 Cal/YB. Insight into these physical quantities underlying thermal equilibration may prove useful for budding scientists, as well as the general public, in years ahead.

  20. Mobile contingency unit

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Sergio O. da; Magalhaes, Milton P. de [Petroleo Brasileiro S.A. (PETROBRAS), Rio de Janeiro, RJ (Brazil); Junqueira, Rodrigo A.; Torres, Carlos A.R. [PETROBRAS Transporte S/A (TRANSPETRO), Rio de Janeiro, RJ (Brazil)

    2009-07-01

    This paper is aimed at presenting what is already a reality in TRANSPETRO in the area covered by OSBRA, a pipeline that carries by-products to the Mid-West region of Brazil. In order to meet the needs of covering occasional accidents, TRANSPETRO counts on a standardized system of emergency management. It is a great challenge to secure an efficient communication along the 964 km of extension, considering that there are shadow zones where it is not possible to use conventional means of communication such as mobile telephony and internet. It was in this context that the Mobile Contingency Unit Via Satellite - MCU was developed, to extend the communication facilities existing in fixed installations to remote places, mainly the pipeline right of ways. In case of emergency, simulation and work in the pipeline right of way, MCU is fully able to provide the same data, voice, closed-circuit TV and satellite video conference facilities that are available in any internal area of the PETROBRAS system. (author)

  1. Portable Virtual Training Units

    Science.gov (United States)

    Malone, Reagan; Johnston, Alan

    2015-01-01

    The Mission Operations Lab initiated a project to design, develop, deliver, test, and validate a unique training system for astronaut and ground support personnel. In an effort to keep training costs low, virtual training units (VTUs) have been designed based on images of actual hardware and manipulated by a touch screen style interface for ground support personnel training. This project helped modernized the training system and materials by integrating them with mobile devices for training when operators or crew are unavailable to physically train in the facility. This project also tested the concept of a handheld remote device to control integrated trainers using International Space Station (ISS) training simulators as a platform. The portable VTU can interface with the full-sized VTU, allowing a trainer co-located with a trainee to remotely manipulate a VTU and evaluate a trainee's response. This project helped determine if it is useful, cost effective, and beneficial for the instructor to have a portable handheld device to control the behavior of the models during training. This project has advanced NASA Marshall Space Flight Center's (MSFC's) VTU capabilities with modern and relevant technology to support space flight training needs of today and tomorrow.

  2. Cohesion in Multinational Military Units

    Science.gov (United States)

    2010-12-10

    He openly admitted his homosexual orientation at a staff meeting; by doing that he clearly stated his guidelines toward gays . He had developed a...of units and consequentially unit effectiveness (Dupuy 1993, 2948). Some nations permit openly gay and lesbian personnel and others may not. Social...may cause less tension. However, for some nations involvement of gays and lesbians in multinational units may be offensive, while other nations are

  3. Inlet Geomorphology Evolution Work Unit

    Science.gov (United States)

    2015-10-30

    the expected behavior and benefits of nearshore placement. Nearshore placement studies have been documented in two journal papers, one technical...Coastal Inlets Research Program Inlet Geomorphology Evolution Work Unit The Inlet Geomorphology Evolution work unit of the CIRP develops methods...sensing measurements, and USACE projects to create valuable guidance that address geomorphic questions. The present focus of the work unit is a common

  4. From stroke unit care to stroke care unit

    NARCIS (Netherlands)

    De Keyser, J; Sulter, G.

    1999-01-01

    In some stroke units continuous monitoring of blood pressure, electrocardiogram, body temperature, and oxygen saturation has become an integral part of the management of acute stroke. In addition, regular measurements of blood glucose are performed. Stroke units equipped with such monitoring facilit

  5. From stroke unit care to stroke care unit

    NARCIS (Netherlands)

    De Keyser, J; Sulter, G.

    1999-01-01

    In some stroke units continuous monitoring of blood pressure, electrocardiogram, body temperature, and oxygen saturation has become an integral part of the management of acute stroke. In addition, regular measurements of blood glucose are performed. Stroke units equipped with such monitoring

  6. GPS Metric Tracking Unit

    Science.gov (United States)

    2008-01-01

    As Global Positioning Satellite (GPS) applications become more prevalent for land- and air-based vehicles, GPS applications for space vehicles will also increase. The Applied Technology Directorate of Kennedy Space Center (KSC) has developed a lightweight, low-cost GPS Metric Tracking Unit (GMTU), the first of two steps in developing a lightweight, low-cost Space-Based Tracking and Command Subsystem (STACS) designed to meet Range Safety's link margin and latency requirements for vehicle command and telemetry data. The goals of STACS are to improve Range Safety operations and expand tracking capabilities for space vehicles. STACS will track the vehicle, receive commands, and send telemetry data through the space-based asset, which will dramatically reduce dependence on ground-based assets. The other step was the Low-Cost Tracking and Data Relay Satellite System (TDRSS) Transceiver (LCT2), developed by the Wallops Flight Facility (WFF), which allows the vehicle to communicate with a geosynchronous relay satellite. Although the GMTU and LCT2 were independently implemented and tested, the design collaboration of KSC and WFF engineers allowed GMTU and LCT2 to be integrated into one enclosure, leading to the final STACS. In operation, GMTU needs only a radio frequency (RF) input from a GPS antenna and outputs position and velocity data to the vehicle through a serial or pulse code modulation (PCM) interface. GMTU includes one commercial GPS receiver board and a custom board, the Command and Telemetry Processor (CTP) developed by KSC. The CTP design is based on a field-programmable gate array (FPGA) with embedded processors to support GPS functions.

  7. Histologia da pele do pacu (Piaractus mesopotamicus e testes de resistência do couro - DOI: 10.4025/actascianimsci.v25i1.2071 Histology of skin of Piaractus mesopotamicus and leather resistance tests - DOI: 10.4025/actascianimsci.v25i1.2071

    Directory of Open Access Journals (Sweden)

    Petra Maria Wagner

    2003-04-01

    Full Text Available Este trabalho analisou a morfologia da pele do pacu, Piaractus mesopotamicus (Holmberg, 1887, e, após curtimento, a resistência do couro. Observou-se que a derme apresenta uma camada superficial com fibras finas, juntas e entrelaçadas, sem diferenciação quanto à disposição das mesmas e uma camada profunda, com fibras mais finas e espaçadas; e à medida que se distanciam da epiderme, os feixes de fibras tornam-se mais espessos, juntos e entrelaçados. A resistência à tração foi significativamente menor no sentido longitudinal (5,93 N/mm2 comparada ao transversal (13,81 N/mm2 em relação ao comprimento do corpo. O valor de alongamento até a ruptura foi superior (p0,05 para rasgamento progressivo. A resistência do couro à tração e alongamento foi superior no sentido transversal ao comprimento do corpo do peixe e não houve diferença para o rasgamento progressivo entre os cortes analisados (transversal e longitudinal. Sendo assim, a média da tração foi 9,87 N/mm2 e 64,59% de elongação, estando dentro dos padrões exigidos para ser utilizado na confecção de vestuário.This work study the histology of skin of Piaractus mesopotamicus (Holmberg, 1887, and after tanning, the leather resistance. Dermis showed a superficial layer with thin, united and interlaced fibers and a inner layer with thinner and spacer fibers. When this layer keeped away from epidermis, the sheaf fibers became thicker, uniter and interlacer. The resistance to tension of body length was significatively inferior in longitudinal sense (5.93 N/mm when compared with transversal sense (13.81 N/mm. The extension value until the rupture was superior (P0.05 to progressive tearing. The leather resistance to tension and extension was higher in transversal sense to body lenght of fish and there wasn’t difference to progressive tearing between the section analysed. Thus, the tension was 9.87 N/mm and 64.59% of elongation that are inside the standard require to

  8. Ad valorem versus unit taxes

    DEFF Research Database (Denmark)

    Schröder, Philipp J.H.; Sørensen, Allan

    2010-01-01

    a general equilibrium monopolistic competition model with heterogeneous firms and intra-industry reallocations. We show that the welfare superiority of ad valorem over unit taxes under imperfect competition is not only preserved but amplified. The additional difference between the tools arises because unit...

  9. Fatigue of Concrete Armour Units

    DEFF Research Database (Denmark)

    Sørensen, N. B.; Burcharth, H. F.; Liu, Z.

    1995-01-01

    In the present article fatigue as a possible reason for failure of Dolosse armour units made of plain concrete is discussed.......In the present article fatigue as a possible reason for failure of Dolosse armour units made of plain concrete is discussed....

  10. Multicultural Mini-Units. Elementary.

    Science.gov (United States)

    Flora, Sherrill B.

    The teaching mini-units in this teacher's guide are designed for use with elementary level students. Thematic study units are given for each of the following countries or continents: Africa, Australia, Brazil, Canada, China, England, France, Germany, Greece, India, Israel, Italy, Japan, Mexico, Netherlands, Russia, Spain, Sweden, Thailand, and the…

  11. Studying in the United Kingdom

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    The United Kingdom is among the world leaders in recruiting international students.Joanna Burke,Cultural Counselor in the Cultural and Education Section of the British Embassy in China,recently spoke about international students,especially Chinese students in the United Kingdom,with Beijing Review reporter Wang Hairong.

  12. Fatigue of Concrete Armour Units

    DEFF Research Database (Denmark)

    Sørensen, N. B.; Burcharth, H. F.; Liu, Z.

    1995-01-01

    In the present article fatigue as a possible reason for failure of Dolosse armour units made of plain concrete is discussed.......In the present article fatigue as a possible reason for failure of Dolosse armour units made of plain concrete is discussed....

  13. Unit 03 - Introduction to Computers

    OpenAIRE

    Unit 74, CC in GIS; National Center for Geographic Information and Analysis

    1990-01-01

    This unit provides a brief introduction to computer hardware and software. It discusses binary notation, the ASCII coding system and hardware components including the central processing unit (CPU), memory, peripherals and storage media. Software including operating systems, word processors database packages, spreadsheets and statistical packages are briefly described.

  14. Multicultural Mini-Units. Elementary.

    Science.gov (United States)

    Flora, Sherrill B.

    The teaching mini-units in this teacher's guide are designed for use with elementary level students. Thematic study units are given for each of the following countries or continents: Africa, Australia, Brazil, Canada, China, England, France, Germany, Greece, India, Israel, Italy, Japan, Mexico, Netherlands, Russia, Spain, Sweden, Thailand, and the…

  15. Edison Home Community Study Unit.

    Science.gov (United States)

    Lee County School District, Ft. Myers, FL. Dept. of Environmental Education and Instructional Development Services.

    History is not merely events that occurred in the past. The past has influenced the present, as the present will influence the future. The purpose of this community study unit is to provide fourth grade students with an opportunity to investigate some of the history of Lee County, Florida. The unit's focus is on Thomas Edison, who built a home in…

  16. Views of Appalachia: Resource Unit.

    Science.gov (United States)

    Chafin, Shirley R.

    Designed to teach twelfth grade English honors students in Kentucky to think critically, to write creatively, to develop a better self-concept, and to stimulate appreciation and pride for Appalachian literature and culture, this 9-week resource unit features mini-units on (1) Man and His Values; (2) Death; (3) Prejudice; (4) Strip Mining; and (5)…

  17. 7 CFR 1160.104 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true United States. 1160.104 Section 1160.104 Agriculture... Definitions § 1160.104 United States. United States means the 48 contiguous states in the continental United States and the District of Columbia, except that United States means the 50 states of the United......

  18. Ultrafast carrier relaxation through Auger recombination in the topological insulator B i1.5S b0.5T e1.7S e1.3

    Science.gov (United States)

    Onishi, Yoshito; Ren, Zhi; Segawa, Kouji; Kaszub, Wawrzyniec; Lorenc, Maciej; Ando, Yoichi; Tanaka, Koichiro

    2015-02-01

    Ultrafast carrier dynamics have great significance for our understanding of the transport properties of the surface state in topological insulator (TI) materials. We report midinfrared pump-probe measurements on the intrinsic TI material B i1.5S b0.5T e1.7S e1.3 and show that the change in photoinduced reflectivity can be decomposed into a fast negative part and a slow positive part. Calculations of the dielectric function made at various carrier temperatures and densities reveal that the fast negative component corresponds to the disappearance of the phase-space filling effect due to hot carriers around the probe energy and the decay component corresponds to the recombination of carriers near the band edge. The ratio of the fast negative component to the slow positive component is larger in the excitations conducted at the higher carrier densities, which suggests that the carrier temperature increases through Auger recombination. A qualitative analysis using rate equations reinforces this assumption, so we conclude that Auger recombination is the main cause of the population relaxation at carrier densities higher than 1018c m-3 and that we determined the Auger coefficient for B i1.5S b0.5T e1.7S e1.3 as C =0.4 ×10-26c m6/s .

  19. Inhibition of auxin transport and auxin signaling and treatment with far red light induces root coiling in the phospholipase-A mutant ppla-I-1. Significance for surface penetration?

    Science.gov (United States)

    Perrineau, F; Wimalasekera, R; Effendi, Y; Scherer, G F E

    2016-06-01

    When grown on a non-penetretable at a surface angle of 45°, Arabidopsis roots form wave-like structures and, in wild type rarely, but in certain mutants the tip root even may form circles. These circles are called coils. The formation of coils depends on the complex interaction of circumnutation, gravitropism and negative thigmotropism where - at least - gravitropism is intimately linked to auxin transport and signaling. The knockout mutant of patatin-related phospholipase-AI-1 (pplaI-1) is an auxin-signaling mutant which forms moderately increased numbers of coils on tilted agar plates. We tested the effects of the auxin efflux transport inhibitor NPA (1-naphthylphtalamic acid) and of the influx transport inhibitor 1-NOA (1-naphthoxyacetic acid) which both further increased root coil formation. The pPLAI-1 inhibitors HELSS (haloenol lactone suicide substrate=E-6-(bromomethylene)tetrahydro-3-(1-naphthalenyl)-2H-pyran-2-one) and ETYA (eicosatetraynoic acid) which are auxin signaling inhibitors also increased coil formation. In addition, far red light treatment increased coil formation. The results point out that a disturbance of auxin transport and signaling is one potential cause for root coils. As we show that the mutant pplaI-1 penetrates horizontal agar plates better than wild type plants root movements may help penetrating the soil.

  20. Design of Dolos Armour Units

    DEFF Research Database (Denmark)

    Burcharth, H. F.; Liu, Zhou

    1993-01-01

    The slender, complex types of armour units, such as Tetrapods and Dolosse are widely used. Many of the recent failures are such rubble mound breakwaters revealed that there is an imbalance between strength (structural integrity) of the units and the hydraulic stability (resistance to displacements......) of the armour layers. The paper deals only with dolos armour and presents the first design diagrammes and formulae where stresses from static, quasistatic and impact loads are implemented as well as the hydraulic stability. The dolos is treated as a multi shape unit where the thickness can be adjusted...

  1. Geysers Unit 18

    Energy Technology Data Exchange (ETDEWEB)

    Finney, John P.

    1980-12-01

    likely. For all of its risk aversion, SDG&E still remains one of the best potential markets for any energy producer. A recent article in FORBES MAGAZINE found that SDG&E had the third highest price per kilowatt of any utility in the country--5.9{cents} per kilowatt hour for commercial customers. That was in March, 1980. Energy cost adjustment clause increases resulted in an average commercial price per kilowatt hour of 7.2{cents} in May. In July it is expected to climb to 9.2{cents}. SDG&E's rate territory continues to expand at the rate of 5% annually and it is located just over 100 miles from a major source of geothermal heat in the Imperial Valley. But today, SDG&E has no commercial geothermal heat or power purchase contracts with domestic producers. You may ask, ''Why not?'' With no incentive to spend its own money and with a high growth rate, what is SDG&E doing to obtain capacity for its existing and future customers? At the present time, most of SDG&E's capital expenditure for generation is going to the construction of San Onofre Units 2 and 3 , a nuclear project which has been under way for ten years and which is expected to start generating commercial power in 1982 and 1983. San Onofre 2 and 3 will add 440 MW of capacity from a reliable, proven generating technology to SDG&E's system.

  2. Efeitos da utilização de ração autoclavada para ratos em crescimento: digestibilidade e desempenho - DOI: 10.4025/actascibiolsci.v26i1.1668 Effect of autoclaving diets use for growing rats: digestibility and performance - DOI: 10.4025/actascibiolsci.v26i1.1668

    Directory of Open Access Journals (Sweden)

    Valdeci Aparecido Mota

    2004-04-01

    Full Text Available Foram conduzidos experimentos para avaliar o fornecimento de ração autoclavada ou não para ratos em crescimento. Para analisar o desempenho, ratos nascidos de fêmeas recebendo ração autoclavada ou não durante a gestação, foram distribuídos em um delineamento experimental casualizado com dois tratamentos e unidade experimental de um animal. A ração fornecida para ratas em gestação não influenciou o peso dos ratos ao nascer nem ao desmame. Nos ensaios de digestibilidade e desempenho utilizaram-se ratos oriundos de fêmeas que receberam ração autoclavada ou não na gestação distribuídos em um esquema fatorial 2x2 (ração normal ou autoclavada até a desmama versus ração normal ou autoclavada após a desmama. Evidenciou-se redução no aproveitamento digestivo da energia bruta da ração autoclavada fornecida após a desmama e piora na conversão alimentar no período até 42 dias. O teste de solubilidade da proteína em KOH é um bom indicador da redução da qualidade nutricional da raçãoExperiments were carried out to evaluate the use of autoclaving diets for growing rats. To evaluate the performance, rats born from females receiving or not autoclaving diets during the gestation were distributed in a randomized experimental design, with two treatments and a one-animal experimental unit. The diet used for female rats in gestation did not influence the weight of the rats either at birth or during the weaning period. As for digestibility and performance assays, rats from both kinds of females (with and without autoclaving diets during gestation were distributed in a 2x2 factorial outline (normal or autoclaving diets until weaning versus normal or autoclaving diets after weaning. There was a reduction in the digestive use of the autoclaving diet gross energy after weaning and a worsening in the alimentary conversion in the period up to 42 days. The protein solubility in KOH test is a good indicative of the diet's nutritional

  3. Julgar e compreender: contradições da abordagem da equipe multiprofissional à família da criança envenenada - DOI: 10.4025/actascihealthsci.v26i1.1621 Judge and understand: contradictions of multiprofessional team approach to the poisoned child’s family - DOI: 10.4025/actascihealthsci.v26i1.1621

    Directory of Open Access Journals (Sweden)

    Luiza Jane Eyre de Souza Vieira

    2004-04-01

    Full Text Available Trata-se de um estudo etnográfico para compreender como os profissionais de saúde – enfermeira, médica, fisioterapeuta e assistente social – vivenciam a abordagem à família da criança envenenada e quais as implicações na prática do cuidado de saúde. Conduzido pelo método da etnoenfermagem, participaram da pesquisa 19 profissionais de uma UTI-Pediátrica, no Município de Fortaleza, Estado do Ceará, Brasil. Os resultados evidenciaram que a equipe multiprofissional tem uma abordagem contraditória, emergindo categorias como culpa, desinformação, pré-juízo, humanização, educação, conscientização, interdisciplinaridade e envolvimento institucional que convergiram para o tema cultural - Julgar e Compreender: contradições da abordagem da equipe multiprofissional à família da criança Envenenada. Conclui-se que a construção e a repercussão dessa abordagem na prática perpassa pela formação acadêmica e pela índole pessoal; no entanto, nas preleções dos participantes estava presente a vontade de refletir as contradições de suas respectivas abordagens e de enfrentar a construção de uma abordagem cuidadosa, fundamentada na aproximação da coerência cultural.It is an ethnographic study that aims to understand how the professionals of health – nurse, doctor, physiotherapist and social worker experience the approach to the poisoned child’s family and which the implications for their practice in the health care are. Using the ethno nursing method, 19 professionals of the Pediatric Intensive Care Unit, in Fortaleza, state of Ceará, Brazil, took part in the study. The results showed that the multiprofessional team has a contradictory approach, some categories were emerged such as: guilt, lack of information, prejudice, humanization, education, understanding, interdisciplinarity and institutional involvement that originated the cultural theme - to judge and to understand - contradictions of the approach of the

  4. Medicação de alto custo para portador de sofrimento psíquico: um estudo preliminar dos custos - DOI: 10.4025/actascihealthsci.v29i1.118 Cost Drugs for carrier of psychic suffering: a preliminary study of costs- DOI: 10.4025/actascihealthsci.v29i1.118

    Directory of Open Access Journals (Sweden)

    Wilza Carla Spiri

    2007-12-01

    Full Text Available O presente trabalho teve como objetivo identificar os valores dos medicamentos de alto custo utilizados por portadores de Esquizofrenia Refratária atendidos em unidade ambulatorial. O estudo foi realizado através de uma análise de documentos em um Centro de Apoio Psicossocial, no período de junho de 2005 a maio de 2006, com 33 usuários que faziam uso da medicação. A análise dos dados revelou que os medicamentos mais utilizados para os portadores de Esquizofrenia Refratária foram: clozapina de 100 mg e risperidona de 2 mg. Observou-se que o tratamento com o medicamento olanzapina 10 mg tem um custo mais alto e com o medicamento risperidona de 2 mg apresenta um custo mais baixo. Verificou-se que é necessário o monitoramento do consumo e dos custos dos medicamentos de alto custo, uma vez que fornece subsídios para melhor gerenciamento dos gastos e novos investimentos no serviço. Além disso, identificou-se também a necessidade de mais estudos na área para contribuir com o controle de custos.The present work aims to raise the costs of high-cost drugs used to treat patients of Refractory Schizophrenia in ambulatory unit. The study was carried out in the Psychosocial Support Center, which treated 33 patients with these medications, during the period of June, 2005 to May, 2006. Data analysis disclosed that the mostly used drugs to treat the carriers of Refractory Schizophrenia were: clozapina and risperidona. It was observed that the treatment with olanzapina is more expensive than that with risperidona. The study concluded that the analysis of the consumption and costs of drugs of high cost is necessary to subside better management of the expenses and new investments in the service. Moreover, the necessity of more studies in the area was also identified to contribute with the control of costs.

  5. Tax_Units_2011_Final

    Data.gov (United States)

    Kansas Data Access and Support Center — The Statewide GIS Tax Unit boundary file was created through a collaborative partnership between the State of Kansas Department of Revenue Property Valuation...

  6. Fundamental units: physics and metrology

    CERN Document Server

    Okun, Lev Borisovich

    2003-01-01

    The problem of fundamental units is discussed in the context of achievements of both theoretical physics and modern metrology. On one hand, due to fascinating accuracy of atomic clocks, the traditional macroscopic standards of metrology (second, metre, kilogram) are giving way to standards based on fundamental units of nature: velocity of light $c$ and quantum of action $h$. On the other hand, the poor precision of gravitational constant $G$, which is widely believed to define the ``cube of theories'' and the units of the future ``theory of everything'', does not allow to use $G$ as a fundamental dimensional constant in metrology. The electromagnetic units in SI are actually based on concepts of prerelativistic classical electrodynamics such as ether, electric permitivity and magnetic permeability of vacuum. Concluding remarks are devoted to terminological confusion which accompanies the progress in basic physics and metrology.

  7. Studying in the United Kingdom

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    @@ Beijing Review:The United Kingdom has many top universities in the world. Could you please tell us how many inter-national students are enrolled in UK institutes of higher learning and how many are from China?

  8. Environmental Control Unit Harness Project

    Science.gov (United States)

    Oliva-Buisson, Yvette J.

    2014-01-01

    Testing four new Environmental Control Unit Harnesses for improved user comfort during SCAPE operations. Phase I, testing in a lab environment, Phase II will continue testing the best candidates in a field environment.

  9. Electronegativity Equalization with Pauling Units.

    Science.gov (United States)

    Bratsch, Steven G.

    1984-01-01

    Discusses electronegativity equalization using Pauling units. Although Pauling has qualitatively defined electronegativity as the power of an atom in a molecule to attract electrons to itself, Pauling electronegativities are treated in this paper as prebonded, isolated-atom quantities. (JN)

  10. X-ray relative intensities at incident photon energies across the L{sub i} (i=1–3) absorption edges of elements with 35≤Z≤92

    Energy Technology Data Exchange (ETDEWEB)

    Puri, Sanjiv, E-mail: sanjivpurichd@yahoo.com

    2014-07-15

    The intensity ratios, I{sub Lk}/I{sub Lα1} (k=l,η,α{sub 2},β{sub 1},β{sub 2,15},β{sub 3},β{sub 4},β{sub 5,7},β{sub 6},β{sub 9,10},γ{sub 1,5},γ{sub 6,8},γ{sub 2,3},γ{sub 4}) and I{sub Lj}/I{sub Lα} (j=β,γ), have been evaluated at incident photon energies across the L{sub i} (i=1–3) absorption edge energies of all the elements with 35≤Z≤92. Use is made of what are currently considered to be more reliable theoretical data sets of different physical parameters, namely, the L{sub i} (i=1–3) sub-shell photoionization cross sections based on the relativistic Hartree–Fock–Slater (RHFS) model, the X-ray emission rates based on the Dirac–Fock model, and the fluorescence and Coster–Kronig yields based on the Dirac–Hartree–Slater model. In addition, the Lα{sub 1} X-ray production cross sections for different elements at various incident photon energies have been tabulated so as to facilitate the evaluation of production cross sections for different resolved L X-ray components from the tabulated intensity ratios. Further, to assist evaluation of the prominent (L{sub i}−S{sub j}) (S{sub j}=M{sub j}, N{sub j} and i=1–3, j=1–7) resonant Raman scattered (RRS) peak energies for an element at a given incident photon energy (below the L{sub i} sub-shell absorption edge), the neutral-atom electron binding energies based on the relaxed orbital RHFS calculations are also listed so as to enable identification of the RRS peaks, which can overlap with the fluorescent X-ray lines. -- Highlights: •The L X-ray relative intensities and Lα{sub 1} XRP cross sections are evaluated using physical parameters based on the IPA models. •Comparison of the intensity ratios evaluated using the DHS and DF models based photoionization cross sections is presented. •Importance of many body effects including electron exchange effects is highlighted.

  11. Sequences and structural organization of phospholipase A2 genes from Vipera aspis aspis, V. aspis zinnikeri and Vipera berus berus venom. Identification of the origin of a new viper population based on ammodytin I1 heterogeneity.

    Science.gov (United States)

    Guillemin, Isabelle; Bouchier, Christiane; Garrigues, Thomas; Wisner, Anne; Choumet, Valérie

    2003-07-01

    We used a PCR-based method to determine the genomic DNA sequences encoding phospholipases A2 (PLA2s) from the venoms of Vipera aspis aspis (V. a. aspis), Vipera aspis zinnikeri (V. a. zinnikeri), Vipera berus berus (V. b. berus) and a neurotoxic V. a. aspis snake (neurotoxic V. a. aspis) from a population responsible for unusual neurotoxic envenomations in south-east France. We sequenced five groups of genes, each corresponding to a different PLA2. The genes encoding the A and B chains of vaspin from the neurotoxic V. a. aspis, PLA2-I from V. a. zinnikeri, and the anticoagulant PLA2 from V. b. berus are described here. Single nucleotide differences leading to amino-acid substitutions were observed both between genes encoding the same PLA2 and between genes encoding different PLA2s. These differences were clustered in exons 3 and 5, potentially altering the biological activities of PLA2. The distribution and characteristics of the PLA2 genes differed according to the species or subspecies. We characterized for the first time genes encoding neurotoxins from the V. a. aspis and V. b. berus snakes of central France. Genes encoding ammodytins I1 and I2, described previously in Vipera ammodytes ammodytes (V. am. ammodytes), were also present in V. a. aspis and V. b. berus. Three different ammodytin I1 gene sequences were characterized: one from V. b. berus, the second from V. a. aspis, V. a. zinnikeri and the neurotoxic V. a. aspis, and the third from the neurotoxic V. a. aspis. This third sequence was identical with the reported sequence of the V. am. ammodytes ammodytin I1 gene. Genes encoding monomeric neurotoxins of V. am. ammodytes venom, ammodytoxins A, B and C, and the Bov-B LINE retroposon, a phylogenetic marker found in V. am. ammodytes genome, were identified in the genome of the neurotoxic V. a. aspis. These results suggest that the population of neurotoxic V. a. aspis snakes from south-east France may have resulted from interbreeding between V. a. aspis and V

  12. Decommissioning of an irradiation unit

    Energy Technology Data Exchange (ETDEWEB)

    Richards, A.G. [Radiation Protection and Safety Services, Univ. of Leeds, Leeds (United Kingdom)

    2000-05-01

    Distributed throughout hospital, research establishments in the United Kingdom and many other countries are Irradiation Units and Teletherapy machines used for either research purposes or treatment of patients for radiotherapy. These Irradiation Units and Teletherapy machines are loaded with radioactive sources of either Cobalt 60 or Caesium 137. The activity of these sources can range from 1 Terabecquerel up to 100 Terabecquerels or more. Where it is possible to load the radioactive sources without removal from the shielded container into a transport package which is suitable for transport decommissioning of a Teletherapy machine is not a major exercise. When the radioactive sources need to be unloaded from the Irradiation Unit or Teletherapy machine the potential exists for very high levels of radiation. The operation outlined in the paper involved the transfer from an Irradiation Unit to a transport package of two 3.25 Terabecquerel sources of Cobalt 60. The operation of the removal and transfer comes within the scope of the United Kingdom Ionising Radiation Regulations 1985 which were made following the Recommendations of the International Commission on Radiological Protection. This paper illustrates a safe method for this operation and how doses received can be kept within ALARA. (author)

  13. United Kingdom: Health System Review.

    Science.gov (United States)

    Cylus, Jonathan; Richardson, Erica; Findley, Lisa; Longley, Marcus; O'Neill, Ciaran; Steel, David

    2015-01-01

    This analysis of the United Kingdom health system reviews recent developments in organization and governance, health financing, health care provision, health reforms and health system performance. It provides an overview of how the national health services operate in the four nations that make up the United Kingdom, as responsibility for organizing health financing and services was devolved from 1997. With devolution, the health systems in the United Kingdom have diverged in the details of how services are organized and paid for, but all have maintained national health services which provide universal access to a comprehensive package of services that are mostly free at the point of use. These health services are predominantly financed from general taxation and 83.5% of total health expenditure in the United Kingdom came from public sources in 2013. Life expectancy has increased steadily across the United Kingdom, but health inequalities have proved stubbornly resistant to improvement, and the gap between the most deprived and the most privileged continues to widen, rather than close. The United Kingdom faces challenges going forward, including how to cope with the needs of an ageing population, how to manage populations with poor health behaviours and associated chronic conditions, how to meet patient expectations of access to the latest available medicines and technologies, and how to adapt a system that has limited resources to expand its workforce and infrastructural capacity so it can rise to these challenges.

  14. Produtos em filme – Inovação na tecnologia de cosméticos - DOI: 10.4025/actascihealthsci.v32i1.6987 Film products - Innovation in cosmetics technology. The cosmetics industry has invested heavily in the research and development of new products, to satisfy consumer demands - DOI: 10.4025/actascihealthsci.v32i1.6987

    Directory of Open Access Journals (Sweden)

    Maria da Conceição Torrado Truiti

    2009-12-01

    Full Text Available A indústria cosmética tem investido fortemente na pesquisa e no desenvolvimento de novos produtos, para melhor atender as exigências do consumidor. Como inovação neste segmento têm despontado os cosméticos em filme. A partir de uma fórmula inicial, contendo como formador de película um polissacarídeo constituído de maltotriose e como agente gelificante sodium polyacrylate, foram obtidos géis viscosos que foram espalhados em placas de vidro, de maneira a se obter filmes de 1 mm de espessura. Após secagem à temperatura ambiente, os mesmos foram recortados (1 cm2 e acondicionados. Várias alterações foram realizadas a fim de se obter um filme flexível, com rigidez adequada, ausência de rachaduras e de bolhas, fácil dissolução em água e sensorial agradável. As formulações foram submetidas a diferentes temperaturas para avaliação preliminar da estabilidade. Foram desenvolvidos dois produtos, um contendo extratos hidroglicólicos de Aloe Vera e de Rosa Branca, auxiliares no tratamento da acne, e outro contendo extratos hidroglicólicos de Camomila e de Pera, auxiliares no combate a olheiras. Pequenos, leves e finos, os cosméticos em filme representam inovação que pode ocupar o lugar de produtos tradicionais, por proporcionarem maior praticidade e facilidade de uso e de transporte, mantendo a eficácia e a segurança necessárias a um cosmético.As a result of the innovation in this sector, cosmetics have emerged in film format. Starting from an initial formula containing a polysaccharide consisting of maltotriose units as a film former and sodium polyacrylate as gelling agent, viscous gels were obtained and dispersed in glass plate, in order to obtain 1 mm thick films. After drying to room temperature, they were cut out (1 cm2 and conditioned. Various alterations were carried out in order to obtain a film with good flexibility, adequate rigidity, without cracks and bubbles, easy dissolution in water and a pleasant feel

  15. Exigências de cálcio para codornas japonesas fêmeas de um a 35 dias de idade - DOI: 10.4025/actascianimsci.v31i1.294 Calcium levels for 1 to 35-days-old female japanese quails - DOI: 10.4025/actascianimsci.v31i1.294

    Directory of Open Access Journals (Sweden)

    Cláudia de Castro Goulart

    2009-05-01

    Full Text Available Foram realizados dois experimentos para se determinar as exigências de cálcio para melhor desempenho e deposição de cálcio (Ca e fósforo (P na tíbia e no fêmur de codornas japonesas, no período de um a 35 dias de idade. Utilizaram-se, em cada experimento, 210 codornas fêmeas, distribuídas num delineamento experimental inteiramente casualizado, constituído de sete tratamentos, com três repetições e dez aves por unidade experimental. Os tratamentos consistiram numa ração basal suplementada com calcário calcítico para atingir os níveis de 0,85; 1,00; 1,15; 1,30; 1,45; 1,60 e 1,75% de Ca para a fase inicial (1 a 21 dias e de 0,53; 0,68; 0,83; 0,98; 1,13; 1,28 e 1,43% de Ca para a fase de crescimento (22 a 35 dias. Foi verificado efeito quadrático dos níveis de Ca da dieta sobre o consumo de ração, o ganho de peso e a conversão alimentar na fase inicial, bem como sobre o teor de Ca na tíbia e no fêmur das codornas aos 21 dias de idade. Na fase de crescimento, apenas a conversão alimentar foi influenciada pelos níveis de Ca da dieta. Recomendam-se 1,26 e 0,87% de Ca nas dietas para codornas nas fases inicial e de crescimento, respectivamente.Two trials were carried out to determine calcium requirements for better performance, and calcium (Ca and phosphorus (P deposition in the tibia and femur of Japanese quails aged 1 to 35 days. Two hundred and ten female quails were allocated in a completely randomized experimental design, with seven treatments, three repetitions and ten birds per experimental unit. The treatments consisted of a basal diet supplemented with limestone in order to produce the following Ca levels: 0.85; 1.00; 1.15; 1.30; 1.45; 1.60 and 1.75% in the initial phase (1 to 21 days and 0.53; 0.68; 0.83; 0.98; 1.13; 1.28 and 1.43% in the growing phase (22 to 35 days. In the initial phase, feed intake, weight gain and feed conversion showed quadratic response to dietary Ca levels, as well as on the content of Ca in

  16. Avaliação nutricional do trigo mourisco (Fagopyrum esculentum, Moench para coelhos em crescimento - DOI: 10.4025/actascianimsci.v28i1.660 Nutritional evaluation of buckwheat (Fagopyrum esculentum, Moench for growing rabbits - DOI: 10.4025/actascianimsci.v28i1.660

    Directory of Open Access Journals (Sweden)

    Cláudio Scapinello

    2006-01-01

    matter (DCDM, gross energy (DCGE, crude protein (DCCP and starch (DCS of the buckwheat were 83.95%, 76.64%, 75.04% and 98.01%, respectively. The values of digestible energy (DE, digestible protein (DP and digestible starch (DS, as fed basis, were: 2,914 kcal/kg, 8.63% and 36.84%. In the performance experiment, rations containing increased levels of buckwheat (0, 25, 50, 75 and 100% were used to replace the wheat meal. Seventy White New Zealand rabbits, 35 days old, 35 males and 35 females, were alloted in a completely randomized experimental design, with five treatments and 14 replications each, and the experimental unit constituted of one animal. No differences were observed (p < 0.05 in the performance of growing rabbits fed with ration containing increasing levels of buckwheat. Results show that the buckwheat has good nutritive value and it can replace the wheat meal in the growing rabbits rations, without damage to performance.

  17. Generation Strategies and Competitive Advantage in the Market for Off-Road Vehicles: Phenomenological Analysis of the Ford Model Release Ecosport In BrazilDOI:10.5585/remark.v10i1.2203l

    Directory of Open Access Journals (Sweden)

    Roberto Bazanini

    2011-05-01

    Full Text Available The central focus of this paper is to identify the innovations and entrepreneurship resulting from Ford Brazil main strategies, used in the Ford Ecosport launch in 2003. Using as a theoretical reference are the concepts of the RBV (Resource Based View complemented by Mintzberg el al schools, as follows: Entrepreneurship, Positioning and Environmental. The target was to identify resources generating competitive advantages using phenomenology method with qualitative research and pos-factum analysis through interviews with Off-Road specialists, Ford executives and car dealers. The research results showed the phenomenology methodology adequate, once it was able to identify the following resources being used by Ford: presence of an entrepreneur leader, targeted product positioning and production capacity accordingly to the environmental demand.DOI:10.5585/remark.v10i1.2203l

  18. 75 FR 5373 - United States Mint

    Science.gov (United States)

    2010-02-02

    ... United States Mint ACTION: Notification of Pricing for 2010 United States Mint Presidential $1 Coin Proof Set. \\TM\\ SUMMARY: The United States Mint is announcing the price of the 2010 United States Mint Presidential $1 Coin Proof Set. The 2010 United States Mint Presidential $1 Coin Proof Set, featuring $1...

  19. 31 CFR 800.225 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 800.225 Section 800... TAKEOVERS BY FOREIGN PERSONS Definitions § 800.225 United States. The term United States or U.S. means the United States of America, the States of the United States, the District of Columbia, and any...

  20. A BASIC CAMERA UNIT FOR MEDICAL PHOTOGRAPHY.

    Science.gov (United States)

    SMIALOWSKI, A; CURRIE, D J

    1964-08-22

    A camera unit suitable for most medical photographic purposes is described. The unit comprises a single-lens reflex camera, an electronic flash unit and supplementary lenses. Simple instructions for use of th's basic unit are presented. The unit is entirely suitable for taking fine-quality photographs of most medical subjects by persons who have had little photographic training.

  1. Influence of halide composition on the structural, electronic, and optical properties of mixed CH3NH3Pb (I1-xBrx) 3 perovskites calculated using the virtual crystal approximation method

    Science.gov (United States)

    Jong, Un-Gi; Yu, Chol-Jun; Ri, Jin-Song; Kim, Nam-Hyok; Ri, Guk-Chol

    2016-09-01

    Extensive studies have demonstrated the promising capability of the organic-inorganic hybrid halide perovskite CH3NH3PbI3 in solar cells with a high power conversion efficiency exceeding 20%. However, the intrinsic as well as extrinsic instabilities of this material remain the major challenge to the commercialization of perovskite-based solar cells. Mixing halides is expected to resolve this problem. Here, we investigate the effect of chemical substitution in the position of the halogen atom on the structural, electronic, and optical properties of mixed halide perovskites CH3NH3Pb (I1-xBrx) 3 with a pseudocubic phase using the virtual crystal approximation method within density functional theory. With an increase of Br content x from 0.0 to 1.0, the lattice constant decreases in proportion to x with the function of a (x )=6.420 -0.333 x (Å), while the band gap and the exciton binding energy increase with the quadratic function of Eg(x ) =1.542 +0.374 x +0.185 x2 (eV) and the linear function of Eb(x ) =0.045 +0.057 x (eV), respectively. The photoabsorption coefficients are also calculated, showing a blueshift of the absorption onsets for higher Br contents. We calculate the phase decomposition energy of these materials and analyze the electronic charge density difference to estimate the material stability. Based on the calculated results, we suggest that the best match between efficiency and stability can be achieved at x ≈0.2 in CH3NH3Pb (I1-xBrx) 3 perovskites.

  2. Some Relationships among Unit Subsystem Characteristics, Unit Task Characteristics, and Unit Effectiveness

    Science.gov (United States)

    1988-10-01

    C.J. (1980) The behavoiral antd affective consequences of performance- relevant situational variables. Organizational Behavior and Human Performance...cies, practices, and procedures facilitate and/or inhibit organizational work unit effectiveness. This dissertation introduces an additional variable...people in an organizational work unit perform rather than a person. Roberts, lulin, and Rousseau (1978) provided an adaptation of Lewin’s work that

  3. Global Units modulo Circular Units : descent without Iwasawa's Main Conjecture

    CERN Document Server

    Belliard, Jean-Robert

    2009-01-01

    Iwasawa's classical asymptotical formula relates the orders of the $p$-parts $X_n$ of the ideal class groups along a $\\ZM_p$-extension $F_\\infty/F$ of a number field $F$, to Iwasawa structural invariants $\\la$ and $\\mu$ attached to the inverse limit $X_\\infty=\\limpro X_n$. It relies on "good" descent properties satisfied by $X_n$. If $F$ is abelian and $F_\\infty$ is cyclotomic it is known that the $p$-parts of the orders of the global units modulo circular units $U_n/C_n$ are asymptotically equivalent to the $p$-parts of the ideal class numbers. This suggests that these quotients $U_n/C_n$, so to speak unit class groups, satisfy also good descent properties. We show this directly, i.e. without using Iwasawa's Main Conjecture.

  4. Unsupervised segmentation with dynamical units.

    Science.gov (United States)

    Rao, A Ravishankar; Cecchi, Guillermo A; Peck, Charles C; Kozloski, James R

    2008-01-01

    In this paper, we present a novel network to separate mixtures of inputs that have been previously learned. A significant capability of the network is that it segments the components of each input object that most contribute to its classification. The network consists of amplitude-phase units that can synchronize their dynamics, so that separation is determined by the amplitude of units in an output layer, and segmentation by phase similarity between input and output layer units. Learning is unsupervised and based on a Hebbian update, and the architecture is very simple. Moreover, efficient segmentation can be achieved even when there is considerable superposition of the inputs. The network dynamics are derived from an objective function that rewards sparse coding in the generalized amplitude-phase variables. We argue that this objective function can provide a possible formal interpretation of the binding problem and that the implementation of the network architecture and dynamics is biologically plausible.

  5. THOR Particle Processing Unit PPU

    Science.gov (United States)

    Federica Marcucci, Maria; Bruno, Roberto; Consolini, Giuseppe; D'Amicis, Raffaella; De Lauretis, Marcello; De Marco, Rossana; De Michelis, Paola; Francia, Patrizia; Laurenza, Monica; Materassi, Massimo; Vellante, Massimo; Valentini, Francesco

    2016-04-01

    Turbulence Heating ObserveR (THOR) is the first mission ever flown in space dedicated to plasma turbulence. On board THOR, data collected by the Turbulent Electron Analyser, the Ion Mass Spectrum analyser and the Cold Solar Wind ion analyser instruments will be processed by a common digital processor unit, the Particle Processing Unit (PPU). PPU architecture will be based on the state of the art space flight processors and will be fully redundant, in order to efficiently and safely handle the data from the numerous sensors of the instruments suite. The approach of a common processing unit for particle instruments is very important for the enabling of an efficient management for correlative plasma measurements, also facilitating interoperation with other instruments on the spacecraft. Moreover, it permits technical and programmatic synergies giving the possibility to optimize and save spacecraft resources.

  6. Ad valorem versus unit taxes

    DEFF Research Database (Denmark)

    Schröder, Philipp J.H.; Sørensen, Allan

    2010-01-01

    Real-world industries are composed from heterogeneous firms and substantial intra-industry reallocations take place, i.e. high productivity firms squeeze out low productivity firms. Previous tax-tool comparisons have not included these central forces of industry structure. This paper examines...... a general equilibrium monopolistic competition model with heterogeneous firms and intra-industry reallocations. We show that the welfare superiority of ad valorem over unit taxes under imperfect competition is not only preserved but amplified. The additional difference between the tools arises because unit...... taxes distort relative prices, which in turn reduces average industry productivity through reallocations (the survival and increased market share of lower productivity firms). Importantly, numerical solutions of the model reveal that the relative welfare loss from using the unit tax increases...

  7. Unit for cleaning drilling muds

    Energy Technology Data Exchange (ETDEWEB)

    Dorosh, M.M.; Dera, Ya.I.; Fesenko, M.M.; Makedonov, N.I.; Surkov, V.T.

    1983-01-01

    A design is proposed for a unit for cleaning drilling muds which includes a settling tank with input sleeve and a sleeve of the purified mud and hydrocyclones. In order to improve the effectiveness of the degree of purification, the unit is equipped with an ejector and sludge filter arranged under the settling tank in the form of a grid installed in the upper part of the settling tank and connected to the sleeve of purified mud, while the inlet sleeve is arranged tangentially. The proposed unit can operate during drilling with the use of muds on water and carbon bases. As a result of its use, the degree of purification of the drilling mud reaches 30-35%; there is an increase in mechanical drilling rate, the service life of the sand-separator and the silt separators and decrease in wear of the pump equipment.

  8. Unit Reconstitutions: Combat Stress as an Indicator of Unit Effectiveness

    Science.gov (United States)

    2014-06-13

    professional military education or writing for trade journals supplemented the brief “reconstitution renaissance ” with scholarly excursus. This literature...United Sates Army, neuropsychiatry in World War II, Vol. II, overseas theatres . Washington, DC: Government Printing Office. 60 Nash, William P. 2007

  9. Auto Body Repair. Supplementary Units. Instructor Key and Student Units.

    Science.gov (United States)

    Daniel, Linda; Muench, James F., Ed.

    These supplementary units are designed to help students with special needs learn and apply auto body repair skills. The material specifically supplements the Auto Body Repair Curriculum Guide (University of Missouri-Columbia 1988), and is intended for instructors serving the occupational needs of various categories of disadvantaged and handicapped…

  10. The Work Unit Information System

    Science.gov (United States)

    1990-03-01

    detl- il 𔃻’ 1hiLS. dIxam.rnt. no.y be- used in conjuctien with tlie video, or !sep1aTate’ly. 114. SUBJECT TERMS 1%. NUMLItH Of 01 AuLAS 12, yi N~I) I T...6145, (202) 274-6817, (AV) 284-6817. 1I 10. WINS AND INPUT WRAP-UP The Army Material Command has implemented its own PC-based work unit input system...extrusion and composite materials . An example of a contract search would be: Find all work units that relate to contract F33615-84-K-2458. An example

  11. AC410 Unit 9 Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  12. Comparison Of Digital Radiographic Units

    Science.gov (United States)

    Wang, Yen

    1986-06-01

    A total PACS will be inevitable for radiology practice within several years. To achieve a total PACS for radiology, a satisfactory digital radiographic unit is required, because approximately 65% of digital data for PACS comes from digital radiographs. There are several possibilities for producing digital radiographs, and 3 - 4 companies have been marketing digital radiographic devices. Some data regarding the digital radiographic units on the market are compared. It will aid in assessing the current status and availability of this aspect of development, as well as providing a summary of further development of digital radiographic technology.

  13. On the Unit of Translation

    Institute of Scientific and Technical Information of China (English)

    张曼

    2013-01-01

      The unit of translation has been the focus of debate through the history of translation. Barkhudarov suggests six levels of UT, each level could serve as unit of different levels of translation. Many Chinese translators also expressed their opinions on this issue, but there is no settled answer yet. This paper tends to make a distinction between different texts:ordinary and special. Ordinary ones can adopt the UT of paragraph, while special ones should adopt special UTs according to their own characteristics.

  14. Photovoltaic mounting/demounting unit

    DEFF Research Database (Denmark)

    2014-01-01

    The present invention relates to a photovoltaic arrangement comprising a photovoltaic assembly comprising a support structure defining a mounting surface onto which a photovoltaic module is detachably mounted; and a mounting/demounting unit comprising at least one mounting/demounting apparatus...... which when the mounting/demounting unit is moved along the mounting surface, causes the photovoltaic module to be mounted or demounted to the support structure; wherein the photovoltaic module comprises a carrier foil and wherein a total thickness of the photo voltaic module is below 500 muiotaeta....... The present invention further relates to an associated method for mounting/demounting photovoltaic modules....

  15. Desarmamento, Desmobilização e Reintegração dos ex-combatentes no âmbito das Nações Unidas - 10.5102/uri.v4i1.275

    Directory of Open Access Journals (Sweden)

    Aline Peixoto

    2007-08-01

    Full Text Available This article is about disarmament, demobilization and reintegration (DDR of ex-combatants – activities that have recently become part of the United Nations peace operations and that are progressively receiving more attention within the Organization. The DDR is essential for the stabilization of the region and to avoid the re-incidence of the conflict. Nevertheless, it is a very complex activity (with many institutions involved and it is difficult to coordinate and to execute. Therefore, it can be concluded that this subject demands greater efforts from the United Nations in order to overcome the problems and difficulties DDR has been facing.

  16. "Mexico in Transition." Curriculum Units.

    Science.gov (United States)

    Oregon Univ., Eugene. Foreign Language Resource Center.

    These curriculum units were developed in a National Endowment for the Humanities 1994 summer seminar "Mexico in Transition." The 23 lessons are written in Spanish. Lessons are entitled: (1) "La Migracion Mexicana Vista a Traves del Cuento 'Paso del Norte' de Juan Rulfo" (Jose Jorge Armendariz); (2) "Los Grupos Indigenas de…

  17. Dimensionality and the sample unit

    Science.gov (United States)

    Francis A. Roesch

    2009-01-01

    The sample unit and its implications for the Forest Service, U.S. Department of Agriculture's Forest Inventory and Analysis program are discussed in light of a generalized three-dimensional concept of continuous forest inventories. The concept views the sampled population as a spatial-temporal cube and the sample as a finite partitioning of the cube. The sample...

  18. Semasiological measurements of phraseological units

    Directory of Open Access Journals (Sweden)

    Khavpacheva Oksana Khautievna

    2015-06-01

    Full Text Available The article deals with semantic relations in phraseology in modern English. In particular, the authors attempt to analyze different perspectives on the problem of correlation of concepts such as phraseological variance and synonyms existing in Russian linguistics. In addition, the article reviews and analyzes the nature and mechanism of phraseological variance. Particular attention is paid to the criteria of a particular phraseological unit to variants or synonyms. It substantiates the idea that the most suitable for the modern English language seems the point of view that considers the variance of phraseological unit as a fixed rate of transformation of the language of this unit does not violate its semantic identity. The main content of the study is an analysis of the main types of options phraseological units of modern English language: the structural and grammatical (morphological, syntactic, lexical, lexical and stylistic and of quantitative. The article also examines the characteristics of phraseological synonyms that unlike phraseological variants are built on different images, different logical-conceptual and shades of meaning, scope and use of stylistic coloring.

  19. Compiler validates units and dimensions

    Science.gov (United States)

    Levine, F. E.

    1980-01-01

    Software added to compiler for automated test system for Space Shuttle decreases computer run errors by providing offline validation of engineering units used system command programs. Validation procedures are general, though originally written for GOAL, a free-form language that accepts "English-like" statements, and may be adapted to other programming languages.

  20. Education in the United States

    Institute of Scientific and Technical Information of China (English)

    钱富奎

    2009-01-01

    As might be expected,educational institutions in the United States reflect the nation's basic values,especially the ideal of equality of opportunity.From elementary school through college,Americans believe that everyone deserves an equal opportunity to get a good education.

  1. Unit 23 - History of GIS

    OpenAIRE

    Unit 55, CC in GIS; National Center for Geographic Information and Analysis

    1990-01-01

    This unit provides a very brief review of some important milestones in the development of GIS. It provides early examples of spatial analysis performed with multiple theme maps, then introduces people, applications and systems that were significant in the early days of computerized cartography and spatial analysis.

  2. Professional Cosmetology Practices. Instructional Units.

    Science.gov (United States)

    Hopcus, Sharron; Armstrong, Ivan J.

    This publication is designed to assist the instructor and students in understanding the latest concepts and techniques of the instructional phase of cosmetology programs. The instructional units are in five areas: (1) orientation, (2) professional practices: hair, (3) professional practices: skin and nails, (4) cosmetology science, and (5)…

  3. Tractor Safety. Unit A-9.

    Science.gov (United States)

    Luft, Vernon D.; Backlund, Paul

    This document is a teacher's guide for a unit in tractor and machinery safety for college freshmen. It is intended to be used for 10 hours of instruction for freshmen who are intending to work on or around machinery. Safety hazards directly and indirectly related to many types of machinery are covered in addition to tractors. The objectives of the…

  4. Solar Renewable Energy. Teaching Unit.

    Science.gov (United States)

    Buchanan, Marion; And Others

    This unit develops the concept of solar energy as a renewable resource. It includes: (1) an introductory section (developing understandings of photosynthesis and impact of solar energy); (2) information on solar energy use (including applications and geographic limitations of solar energy use); and (3) future considerations of solar energy…

  5. Trip Report United Arab Emirates

    Energy Technology Data Exchange (ETDEWEB)

    Nakanishi, K; Rodgers, A

    2004-10-06

    Keith Nakanishi and Arthur Rodgers traveled to the United Arab Emirates in February, 2004 to continue an on-going technical collaboration with UAE University and to service the two temporary LLNL seismic stations. Nakanishi and Rodgers then participated in the Gulf Seismic Forum, which was organized by LLNL and sponsored by the University of Sharjah.

  6. "Mexico in Transition." Curriculum Units.

    Science.gov (United States)

    Oregon Univ., Eugene. Foreign Language Resource Center.

    These curriculum units were developed in a National Endowment for the Humanities 1994 summer seminar "Mexico in Transition." The 23 lessons are written in Spanish. Lessons are entitled: (1) "La Migracion Mexicana Vista a Traves del Cuento 'Paso del Norte' de Juan Rulfo" (Jose Jorge Armendariz); (2) "Los Grupos Indigenas de Mexico: Condiciones…

  7. United States Navy DL Perspective

    Science.gov (United States)

    2010-08-10

    United States Navy DL Perspective CAPT Hank Reeves Navy eLearning Project Director 10 August 2010 Report Documentation Page Form ApprovedOMB No...Marine Corps (USMC) Navy eLearning Ongoing Shared with USMC, Coast Guard 9 NeL Help Site https://ile-help.nko.navy.mil/ile/ https://s-ile

  8. "Mexico in Transition." Curriculum Units.

    Science.gov (United States)

    Oregon Univ., Eugene. Foreign Language Resource Center.

    These curriculum units were developed in a National Endowment for the Humanities 1994 summer seminar "Mexico in Transition." The 23 lessons are written in Spanish. Lessons are entitled: (1) "La Migracion Mexicana Vista a Traves del Cuento 'Paso del Norte' de Juan Rulfo" (Jose Jorge Armendariz); (2) "Los Grupos Indigenas de…

  9. Norovirus in the United States

    Centers for Disease Control (CDC) Podcasts

    2013-09-09

    Dr. Aron Hall, a CDC epidemiologist specializing in norovirus, discusses the impact of norovirus in the United States.  Created: 9/9/2013 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 9/17/2013.

  10. Cholera in the United States

    Centers for Disease Control (CDC) Podcasts

    2011-11-08

    Anna Newton, Surveillance Epidemiologist at CDC, discusses cholera that was brought to the United States during an outbreak in Haiti and the Dominican Republic (Hispaniola).  Created: 11/8/2011 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 11/8/2011.

  11. 75 FR 25925 - United States Mint

    Science.gov (United States)

    2010-05-10

    ... United States Mint ACTION: Notification of Citizens Coinage Advisory Committee May 25, 2010 Public Meeting. SUMMARY: Pursuant to United States Code, Title 31, section 5135(b)(8)(C), the United States Mint...: May 25, 2010. Time: 9 a.m. to 12 p.m. Location: 8th Floor Board Room, United States Mint, 801...

  12. 31 CFR 560.307 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 560.307 Section 560.307 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... § 560.307 United States. The term United States means the United States, including its territories...

  13. 31 CFR 547.310 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 547.310 Section 547.310 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... General Definitions § 547.310 United States. The term United States means the United States,...

  14. 7 CFR 1250.308 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1250.308 Section 1250.308 Agriculture... Research and Promotion Order Definitions § 1250.308 United States. United States means the 48 contiguous States of the United States of America and the District of Columbia....

  15. 31 CFR 548.310 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 548.310 Section 548.310 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF....310 United States. The term United States means the United States, its territories and...

  16. 31 CFR 586.318 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 586.318 Section 586...) KOSOVO SANCTIONS REGULATIONS General Definitions § 586.318 United States. The term United States means the United States, its territories and possessions, and all areas under the jurisdiction or...

  17. 7 CFR 1212.31 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1212.31 Section 1212.31 Agriculture..., Consumer Education, and Industry Information Order Definitions § 1212.31 United States. “United States... territories and possessions of the United States....

  18. 31 CFR 543.310 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 543.310 Section 543.310 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... Definitions § 543.310 United States. The term United States means the United States, its territories...

  19. 31 CFR 592.311 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 592.311 Section 592... § 592.311 United States. The term United States, when used in the geographic sense, means the several States, the District of Columbia, and any commonwealth, territory, or possession of the United States....

  20. 31 CFR 546.310 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 546.310 Section 546.310 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF....310 United States. The term United States means the United States, its territories and...

  1. 31 CFR 538.314 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 538.314 Section 538.314 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... § 538.314 United States. The term United States means the United States, its territories and...

  2. 7 CFR 1205.23 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1205.23 Section 1205.23 Agriculture... Procedures for Conduct of Sign-up Period Definitions § 1205.23 United States. The term United States means the 50 states of the United States of America. Procedures...

  3. 31 CFR 594.313 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 594.313 Section 594.313 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... Definitions § 594.313 United States. The term United States means the United States, its territories...

  4. 31 CFR 588.310 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 588.310 Section 588.310 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... Definitions § 588.310 United States. The term United States means the United States, its territories...

  5. 7 CFR 1205.313 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1205.313 Section 1205.313 Agriculture... Research and Promotion Order Definitions § 1205.313 United States. United States means the 50 States of the United States of America....

  6. 31 CFR 593.311 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 593.311 Section 593.311 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... REGULATIONS General Definitions § 593.311 United States. The term United States means the United States,...

  7. 22 CFR 120.13 - United States.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false United States. 120.13 Section 120.13 Foreign... United States. United States, when used in the geographical sense, includes the several states, the Commonwealth of Puerto Rico, the insular possessions of the United States, the District of Columbia,...

  8. 31 CFR 537.318 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 537.318 Section 537.318 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF....318 United States. The term United States means the United States, its territories and...

  9. 31 CFR 575.319 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 575.319 Section 575.319 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF....319 United States. The term United States means the United States, its territories and...

  10. 31 CFR 595.314 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 595.314 Section 595.314 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... § 595.314 United States. The term United States means the United States, its territories and...

  11. 31 CFR 596.312 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 596.312 Section 596.312 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... General Definitions § 596.312 United States. The term United States means the United States, including...

  12. 31 CFR 587.310 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 587.310 Section 587...) MILOSEVIC SANCTIONS REGULATIONS General Definitions § 587.310 United States. The term United States means the United States, its territories and possessions, and all areas under the jurisdiction or...

  13. 31 CFR 542.310 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 542.310 Section 542.310 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF....310 United States. The term United States means the United States, its territories and...

  14. 31 CFR 540.313 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 540.313 Section 540.313 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... REGULATIONS General Definitions § 540.313 United States. The term United States means the United States,...

  15. 7 CFR 1219.26 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1219.26 Section 1219.26 Agriculture..., AND INFORMATION Hass Avocado Promotion, Research, and Information Order Definitions § 1219.26 United States. United States means collectively the several 50 States of the United States, the District...

  16. 31 CFR 597.318 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 597.318 Section 597.318 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... General Definitions § 597.318 United States. The term United States means the United States,...

  17. 31 CFR 544.310 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 544.310 Section 544.310 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... REGULATIONS General Definitions § 544.310 United States. The term United States means the United States,...

  18. 31 CFR 545.313 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 545.313 Section 545.313 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... Definitions § 545.313 United States. The term United States means the United States, its territories...

  19. 31 CFR 585.316 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 585.316 Section 585.316 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... General Definitions § 585.316 United States. The term United States means the United States,...

  20. 7 CFR 65.255 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false United States. 65.255 Section 65.255 Agriculture..., PEANUTS, AND GINSENG General Provisions Definitions § 65.255 United States. United States means the 50... United States....

  1. 31 CFR 536.315 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 536.315 Section 536.315 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... Definitions § 536.315 United States. The term United States means the United States, its territories...

  2. 7 CFR 1150.106 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true United States. 1150.106 Section 1150.106 Agriculture... Order Definitions § 1150.106 United States. United States means the 48 contiguous States in the continental United States....

  3. 7 CFR 1206.23 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1206.23 Section 1206.23 Agriculture... INFORMATION Mango Promotion, Research, and Information Order Definitions § 1206.23 United States. United... Rico, and the territories and possessions of the United States....

  4. 31 CFR 541.310 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 541.310 Section 541.310 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... § 541.310 United States. The term United States means the United States, its territories and...

  5. 31 CFR 598.317 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 598.317 Section 598.317 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... Definitions § 598.317 United States. The term United States means the United States, its territories...

  6. 31 CFR 551.309 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 551.309 Section 551.309 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF....309 United States. The term United States means the United States, its territories and...

  7. Detailed Analysis of Motor Unit Activity

    DEFF Research Database (Denmark)

    Nikolic, Mile; Sørensen, John Aasted; Dahl, Kristian

    1997-01-01

    System for decomposition of EMG signals intotheir constituent motor unit potentials and their firing patterns.The aim of the system is detailed analysis ofmotor unit variability.......System for decomposition of EMG signals intotheir constituent motor unit potentials and their firing patterns.The aim of the system is detailed analysis ofmotor unit variability....

  8. Bi-Cell Unit for Fuel Cell.

    Science.gov (United States)

    The patent concerns a bi-cell unit for a fuel cell . The bi-cell unit is comprised of two electrode packs. Each of the electrode packs includes an...invention relates in general to a bi-cell unit for a fuel cell and in particular, to a bi-cell unit for a hydrazine-air fuel cell .

  9. 78 FR 64385 - United Nations Day, 2013

    Science.gov (United States)

    2013-10-28

    ... October 28, 2013 Part V The President Proclamation 9045--United Nations Day, 2013 #0; #0; #0; Presidential... Documents#0;#0; #0; #0;Title 3-- #0;The President ] Proclamation 9045 of October 23, 2013 United Nations Day..., 68 years after the adoption of the United Nations Charter, we mark United Nations Day by...

  10. Detailed Analysis of Motor Unit Activity

    DEFF Research Database (Denmark)

    Nikolic, Mile; Sørensen, John Aasted; Dahl, Kristian

    1997-01-01

    System for decomposition of EMG signals intotheir constituent motor unit potentials and their firing patterns.The aim of the system is detailed analysis ofmotor unit variability.......System for decomposition of EMG signals intotheir constituent motor unit potentials and their firing patterns.The aim of the system is detailed analysis ofmotor unit variability....

  11. Measurement of the I =1 /2 K π S -wave amplitude from Dalitz plot analyses of ηc→K K ¯π in two-photon interactions

    Science.gov (United States)

    Lees, J. P.; Poireau, V.; Tisserand, V.; Grauges, E.; Palano, A.; Eigen, G.; Brown, D. N.; Kolomensky, Yu. G.; Koch, H.; Schroeder, T.; Hearty, C.; Mattison, T. S.; McKenna, J. A.; So, R. Y.; Blinov, V. E.; Buzykaev, A. R.; Druzhinin, V. P.; Golubev, V. B.; Kravchenko, E. A.; Onuchin, A. P.; Serednyakov, S. I.; Skovpen, Yu. I.; Solodov, E. P.; Todyshev, K. Yu.; Lankford, A. J.; Gary, J. W.; Long, O.; Eisner, A. M.; Lockman, W. S.; Panduro Vazquez, W.; Chao, D. S.; Cheng, C. H.; Echenard, B.; Flood, K. T.; Hitlin, D. G.; Kim, J.; Miyashita, T. S.; Ongmongkolkul, P.; Porter, F. C.; Röhrken, M.; Huard, Z.; Meadows, B. T.; Pushpawela, B. G.; Sokoloff, M. D.; Sun, L.; Smith, J. G.; Wagner, S. R.; Bernard, D.; Verderi, M.; Bettoni, D.; Bozzi, C.; Calabrese, R.; Cibinetto, G.; Fioravanti, E.; Garzia, I.; Luppi, E.; Santoro, V.; Calcaterra, A.; de Sangro, R.; Finocchiaro, G.; Martellotti, S.; Patteri, P.; Peruzzi, I. M.; Piccolo, M.; Zallo, A.; Passaggio, S.; Patrignani, C.; Bhuyan, B.; Mallik, U.; Chen, C.; Cochran, J.; Prell, S.; Ahmed, H.; Pennington, M. R.; Gritsan, A. V.; Arnaud, N.; Davier, M.; Le Diberder, F.; Lutz, A. M.; Wormser, G.; Lange, D. J.; Wright, D. M.; Coleman, J. P.; Gabathuler, E.; Hutchcroft, D. E.; Payne, D. J.; Touramanis, C.; Bevan, A. J.; Di Lodovico, F.; Sacco, R.; Cowan, G.; Banerjee, Sw.; Brown, D. N.; Davis, C. L.; Denig, A. G.; Fritsch, M.; Gradl, W.; Griessinger, K.; Hafner, A.; Schubert, K. R.; Barlow, R. J.; Lafferty, G. D.; Cenci, R.; Jawahery, A.; Roberts, D. A.; Cowan, R.; Cheaib, R.; Robertson, S. H.; Dey, B.; Neri, N.; Palombo, F.; Cremaldi, L.; Godang, R.; Summers, D. J.; Taras, P.; De Nardo, G.; Sciacca, C.; Raven, G.; Jessop, C. P.; LoSecco, J. M.; Honscheid, K.; Kass, R.; Gaz, A.; Margoni, M.; Posocco, M.; Rotondo, M.; Simi, G.; Simonetto, F.; Stroili, R.; Akar, S.; Ben-Haim, E.; Bomben, M.; Bonneaud, G. R.; Calderini, G.; Chauveau, J.; Marchiori, G.; Ocariz, J.; Biasini, M.; Manoni, E.; Rossi, A.; Batignani, G.; Bettarini, S.; Carpinelli, M.; Casarosa, G.; Chrzaszcz, M.; Forti, F.; Giorgi, M. A.; Lusiani, A.; Oberhof, B.; Paoloni, E.; Rama, M.; Rizzo, G.; Walsh, J. J.; Smith, A. J. S.; Anulli, F.; Faccini, R.; Ferrarotto, F.; Ferroni, F.; Pilloni, A.; Piredda, G.; Bünger, C.; Dittrich, S.; Grünberg, O.; Heß, M.; Leddig, T.; Voß, C.; Waldi, R.; Adye, T.; Wilson, F. F.; Emery, S.; Hamel de Monchenault, G.; Vasseur, G.; Aston, D.; Cartaro, C.; Convery, M. R.; Dorfan, J.; Dunwoodie, W.; Ebert, M.; Field, R. C.; Fulsom, B. G.; Graham, M. T.; Hast, C.; Innes, W. R.; Kim, P.; Leith, D. W. G. S.; Luitz, S.; Luth, V.; MacFarlane, D. B.; Muller, D. R.; Neal, H.; Ratcliff, B. N.; Roodman, A.; Sullivan, M. K.; Va'vra, J.; Wisniewski, W. J.; Purohit, M. V.; Wilson, J. R.; Randle-Conde, A.; Sekula, S. J.; Bellis, M.; Burchat, P. R.; Puccio, E. M. T.; Alam, M. S.; Ernst, J. A.; Gorodeisky, R.; Guttman, N.; Peimer, D. R.; Soffer, A.; Spanier, S. M.; Ritchie, J. L.; Schwitters, R. F.; Izen, J. M.; Lou, X. C.; Bianchi, F.; De Mori, F.; Filippi, A.; Gamba, D.; Lanceri, L.; Vitale, L.; Martinez-Vidal, F.; Oyanguren, A.; Albert, J.; Beaulieu, A.; Bernlochner, F. U.; King, G. J.; Kowalewski, R.; Lueck, T.; Nugent, I. M.; Roney, J. M.; Tasneem, N.; Gershon, T. J.; Harrison, P. F.; Latham, T. E.; Prepost, R.; Wu, S. L.; BaBar Collaboration

    2016-01-01

    We study the processes γ γ →KS0K±π∓ and γ γ →K+K-π0 using a data sample of 519 fb-1 recorded with the BABAR detector operating at the SLAC PEP-II asymmetric-energy e+e- collider at center-of-mass energies at and near the Υ (n S ) (n =2 , 3, 4) resonances. We observe ηc decays to both final states and perform Dalitz plot analyses using a model-independent partial wave analysis technique. This allows a model-independent measurement of the mass-dependence of the I =1 /2 K π S -wave amplitude and phase. A comparison between the present measurement and those from previous experiments indicates similar behavior for the phase up to a mass of 1.5 GeV /c2. In contrast, the amplitudes show very marked differences. The data require the presence of a new a0(1950 ) resonance with parameters m =1931 ±14 ±22 MeV /c2 and Γ =271 ±22 ±29 MeV .

  12. ISS EPS Orbital Replacement Unit Block Diagrams

    Science.gov (United States)

    Schmitz, Gregory V.

    2001-01-01

    The attached documents are being provided to Switching Power Magazine for information purposes. This magazine is writing a feature article on the International Space Station Electrical Power System, focusing on the switching power processors. These units include the DC-DC Converter Unit (DDCU), the Bi-directional Charge/Discharge Unit (BCDU), and the Sequential Shunt Unit (SSU). These diagrams are high-level schematics/block diagrams depicting the overall functionality of each unit.

  13. Masturbation in the United States.

    Science.gov (United States)

    Das, Aniruddha

    2007-01-01

    Using data from the nationally representative National Health and Social Life Survey, this study queried the correlates of masturbation in the United States in 1992. Among those aged 18-60, 38% (CI, 35-41) of women and 61% (CI, 57-65) of men reported any masturbation over the preceding year. The system of factors underlying masturbation was similar for both genders, consistent with a convergence in gender patterns of sexual expression in the United States. Among both women and men, masturbation responded to a stable sexualized personality pattern, catalyzed by early-life factors and manifested in current sexual traits. Strikingly, the masturbation-partnered sex linkage, often conceptualized either as compensating for unsatisfying sex or complementing a satisfactory sex life, appeared to be bimodal for both genders. For some, masturbation complemented an active and pleasurable sex life, while among others, it compensated for a lack of partnered sex or satisfaction in sex.

  14. Portable Presentation And Instruction Unit

    Science.gov (United States)

    Christman, L.; Hoang, N.

    1994-01-01

    Proposed electronic display unit reminiscent of kiosk serves as portable, interactive, multimedia information terminal. Used as traveling science exhibit, aid for teaching science in schools, or training and skill-refresher device for space flight crews. Provides interactive video and audio displays, including three-dimensional-appearing video simulations. Speeds learning and improves retention by applying principles of scientific visualization. Also helps previously trained but recently unpracticed personnel relearn special skills and procedures quickly.

  15. Drought in Southwestern United States

    Science.gov (United States)

    2007-01-01

    The southwestern United States pined for water in late March and early April 2007. This image is based on data collected by the Moderate Resolution Imaging Spectroradiometer (MODIS) on NASA's Terra satellite from March 22 through April 6, 2007, and it shows the Normalized Difference Vegetation Index, or NDVI, for the period. In this NDVI color scale, green indicates areas of healthier-than-usual vegetation, and only small patches of green appear in this image, near the California-Nevada border and in Utah. Larger areas of below-normal vegetation are more common, especially throughout California. Pale yellow indicates areas with generally average vegetation. Gray areas appear where no data were available, likely due to persistent clouds or snow cover. According to the April 10, 2007, update from the U.S. Drought Monitor, most of the southwestern United Sates, including Utah, Nevada, California, and Arizona, experienced moderate to extreme drought. The hardest hit areas were southeastern California and southwestern Arizona. Writing for the Drought Monitor, David Miskus of the Joint Agricultural Weather Facility reported that March 2007 had been unusually dry for the southwestern United States. While California's and Utah's reservoir storage was only slightly below normal, reservoir storage was well below normal for New Mexico and Arizona. In early April, an international research team published an online paper in Science noting that droughts could become more common for the southwestern United States and northern Mexico, as these areas were already showing signs of drying. Relying on the same computer models used in the Intergovernmental Panel on Climate Change (IPCC) report released in early 2007, the researchers who published in Science concluded that global warming could make droughts more common, not just in the American Southwest, but also in semiarid regions of southern Europe, Mediterranean northern Africa, and the Middle East.

  16. 77 FR 48542 - United States

    Science.gov (United States)

    2012-08-14

    ... outside of the `reaches of the public interest'''); see generally United States v. SBC Commc'ns, Inc., 489... judicial power.'' SBC ] Commc'ns, 489 F. Supp. 2d at 14-15 (citing Microsoft, 56 F.3d at 1462). With... effect of proposed remedies. See, e.g., KeySpan, 763 F. Supp. 2d at 642; SBC Commc'ns, 489 F. Supp. 2d...

  17. President of the United States

    Institute of Scientific and Technical Information of China (English)

    蔡东丽

    2005-01-01

    President of the United States is the chief executive officer of the federal government, the leader of the executive branch1, and the corn man der-in-chief of the armed forces2. The president has the power to make treaties with other nations, with the advice and consent of two-thirds of the Senate3. The president also appoints4, with Senate's consent, diplomatic representatives ,Supreme Court judges5, and many other officials.

  18. Environmental performance reviews: United States

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-01-15

    This book presents OECD assessments and recommendations regarding the United States' effort to manage its environment including air, water nature, and biodiversity to do this in a sustainable manner; and to do this in co-operation with its global neighbours. In particular, it assesses progress made since 1996, when OECD's previous review on the US was done. 40 figs., 21 tabs.

  19. Unit Performance Assessment System Development

    Science.gov (United States)

    1994-08-01

    Overview of the enhanced UPAS ...... . 57 xiv UNIT PERFORMANCE ASSESSMENT SYSTEM DEVELOPMENT Introduccion The networking of combat vehicle simulators...converting SIMNET terrain data from the UNIX format to a DOS format as part of their work on the development of Intelligent Semi-Automated Forces. The...and Social Sciences. (AD A226 956). LB&M Associates (1992). Phase I Small Business Innovative Research (SBIR) Program for Simulation Networkinc Training

  20. Agricultural Water Pricing: United States

    OpenAIRE

    2010-01-01

    In summary, irrigation costs and prices are rising in most regions of the United States, due to a combination of increasing scarcity, changes in public preferences regarding water allocation among competing uses, increasing budget scrutiny in the national and state legislatures, rising energy prices, and increasing awareness of climate change and the potential implications for rainfall and the availability of surface water resources. These issues likely will continue encouraging public offici...

  1. Strategic renewal for business units.

    Science.gov (United States)

    Whitney, J O

    1996-01-01

    Over the past decade, business units have increasingly taken the role of strategy formulation away from corporate headquarters. The change makes sense: business units are closer to customers, competitors, and costs. Nevertheless, business units can fail, just as headquarters once did, by losing their focus on the organization's priorities and capabilities. John Whitney--turnaround expert and professor of management at Columbia University--offers a method for refocusing companies that he calls the strategic-renewal process. The principles behind the process are straightforward, but its execution demands extensive data, rigorous analysis, and the judgment of key decision makers. However, when applied with diligence, it can produce a strategy that yields both growth and profit. To carry out the process, managers must analyze, one by one or in logical groupings, the company's customers, the products it sells, and the services it offers in light of three criteria: strategic importance, significance, and profitability. Does a given customer, product, or service mesh with the organization's goals? Is it significant in terms of current and future revenues? And is it truly profitable when all costs are care fully considered? Customers, products, and services that do not measure up, says the author, must be weeded out relentlessly. Although the process is a painstaking one, the article offers clear thinking on why-and how-to go about it. A series of exhibits takes managers through the questions they need to raise, and two matrices offer Whitney's concentrated wisdom on when to cultivate--and when to prune.

  2. Low cost balancing unit design

    Science.gov (United States)

    Golembiovsky, Matej; Dedek, Jan; Slanina, Zdenek

    2017-06-01

    This article deals with the design of a low-cost balancing system which consist of battery balancing units, accumulator pack units and coordinator unit with interface for higher level of battery management system. This solution allows decentralized mode of operation and the aim of this work is implementation of controlling and diagnostic mechanism into an electric scooter project realized at Technical university of Ostrava. In todays world which now fully enjoys the prime of electromobility, off-grid battery systems and other, it is important to seek the optimal balance between functionality and the economy side of BMS that being electronics which deals with secondary cells of batery packs. There were numerous sophisticated, but not too practical BMS models in the past, such as centralized system or standalone balance modules of individual cells. This article aims at development of standalone balance modules which are able to communicate with the coordinator, adjust their parameters and ensure their cells safety in case of a communication failure. With the current worldwide cutting cost trend in mind, the emphasis was put on the lowest price possible for individual component. The article is divided into two major categories, the first one being desing of power electronics with emphasis on quality, safety (cooling) and also cost. The second part describes development of a communication interface with reliability and cost in mind. The article contains numerous graphs from practical measurements. The outcome of the work and its possible future is defined in the conclusion.

  3. Graphemes are perceptual reading units.

    Science.gov (United States)

    Rey, A; Ziegler, J C; Jacobs, A M

    2000-04-14

    Graphemes are commonly defined as the written representation of phonemes. For example, the word 'BREAD' is composed of the four phonemes /b/, /r/, /e/ and /d/, and consequently, of the four graphemes 'B', 'R', 'EA', and 'D'. Graphemes can thus be considered the minimal 'functional bridges' in the mapping between orthography and phonology. In the present study, we investigated the hypothesis that graphemes are processed as perceptual units by the reading system. If the reading system processes graphemes as units, then detecting a letter in a word should be harder when this letter is embedded in a multi-letter grapheme than when it corresponds to a single-letter grapheme. In Experiment 1A, done in English, participants were slower to detect a target letter in a word when the target letter was embedded in multi-letter grapheme (i.e. 'A' in 'BEACH') than when it corresponded to a single-letter grapheme (i.e. 'A' in 'PLACE'). In Experiment 1B, this effect was replicated in French. In Experiment 2, done in English, this grapheme effect remained when phonemic similarity between the target letter alone and the target letter inside the word was controlled. Together, the results are consistent with the assumption that graphemes are processed as perceptual reading units in alphabetic writing systems such as English or French.

  4. Dixie Valley Bottoming Binary Unit

    Energy Technology Data Exchange (ETDEWEB)

    McDonald, Dale [Terra-Gen Sierra Holdings, LLC, Reno, NV (United States)

    2014-12-21

    This binary plant is the first air cooled, high-output refrigeration based waste heat recovery cycle in the industry. Its working fluid is environmentally friendly and as such, the permits that would be required with a hydrocarbon based cycle are not necessary. The unit is largely modularized, meaning that the unit’s individual skids were assembled in another location and were shipped via truck to the plant site. The Air Cooled Condensers (ACC), equipment piping, and Balance of Plant (BOP) piping were constructed at site. This project further demonstrates the technical feasibility of using low temperature brine for geothermal power utilization. The development of the unit led to the realization of low temperature, high output, and environmentally friendly heat recovery systems through domestic research and engineering. The project generates additional renewable energy, resulting in cleaner air and reduced carbon dioxide emissions. Royalty and tax payments to governmental agencies will increase, resulting in reduced financial pressure on local entities. The major components of the unit were sourced from American companies, resulting in increased economic activity throughout the country.

  5. The First Drinking Simulator Unit

    Directory of Open Access Journals (Sweden)

    Saied Mostafa Moazzami

    2014-03-01

    Full Text Available Introduction: Current Thermal cycling units fail to simulate the drinking behaviors, and oral balancing temperature. They cannot also simulate other oral conditions such as drink coloring, and chemicals like tea, coffee, carbonated and noncarbonated, citrus juices as well as alcoholic and nonalcoholic drinks and also saliva and milk itself. The main objective of this study is to introduce the designing and manufacturing the first Drinking Simulator Unit (DSU that reproduces the thermal, color and chemicalcycling as well as the drinking behavior and oral temperature in lab conditions uniquely. Methods: The invented system generally has two parts: the hardware and the software parts. The hardware consists of the mechanical and electronic parts. The software part is responsible for controlling the heating and cooling systems, electric valves, the pumps, and automatic filling systems of tanks as well as the sensors of the machine. Results: DSU is the first unit can reproduce the thermal, color and chemical cycling as well as the drinking behavior and oral temperature in lab conditions. Different kinds of colored and acidic drinks and also other chemical materials such as bleaching substances as well as detergents and antiseptics used for dentistry, industrial and medical purposes can be tested by DSU. DSU has also to be considered as an appliance performing in-vitro researches on dental structures. Conclusion: The invented system can greatly improve and validate the results of such researches.  

  6. Hipertensão arterial experimental e prenhez em ratas: uso do modelo Goldblatt I (1 rim - 1 clipe Experimental hypertension and pregnancy in rats: use of Goldblatt I (one kidney -- one clip model

    Directory of Open Access Journals (Sweden)

    Rogério Dias

    1999-05-01

    Full Text Available Objetivo: desenvolver o modelo experimental de hipertensão tipo Goldblatt I (1 rim - 1 clipe, em ratas, para estudar a interação entre hipertensão e prenhez. Métodos: o experimento foi dividido em 5 períodos: adaptação (2 semanas, cirúrgico (1 semana, desenvolvimento da hipertensão (6 semanas, acasalamento e estabilização da pressão arterial (6 semanas e prenhez (3 semanas. Foram utilizadas 82 ratas virgens da raça Wistar, pesando entre 180-240 gramas e com idade entre 3 e 4 meses. As ratas foram sorteadas para compor os 4 grupos experimentais (controle, manipulação, nefrectomia e hipertensão e estudadas em 15 momentos distintos (M1 a M15. A hipertensão foi induzida experimentalmente pela técnica de Goldblatt I (1 rim, 1 clipe, que consiste na constrição da artéria renal esquerda e nefrectomia contralateral. Posteriormente, foram realizadas medidas periódicas da pressão arterial pelo método da pletismografia de cauda (PAC. Resultados: os animais sem tratamento cirúrgico (controle e com manipulação não apresentaram alterações na PAC durante o experimento. A nefrectomia determinou discreta elevação da PAC. Nos grupos de ratas prenhes, observou-se tendência a discreta diminuição da PAC, que se acentuou no final da prenhez. Conclusões: o modelo experimental foi adequado para o objetivo de nosso estudo, pois permitiu a obtenção de animais hipertensos.Purpose: to develop an experimental model in rats to study the interaction between hypertension and pregnancy. Methods: the present experiment was divided into 5 periods: adaptation (2 weeks, surgical procedures (1 week, hypertension development (6 weeks, mating and blood pressure stabilization (6 weeks, and gestational period (3 weeks. A total of 82 animals in reproductive age, weighing from 180 to 240 g, were used. They were randomly assigned to the 4 different groups (control, handled, nephrectomy and hypertension and renal hypertension was produced by a

  7. Coin sorting unit; Koka ikkatsu tonyu shori unit

    Energy Technology Data Exchange (ETDEWEB)

    Oyabu, H.; Nishiyama, T.; Iijima, S. [Fuji Electric Co. Ltd., Tokyo (Japan)

    1999-08-10

    There are promising demands for barrier-free vending machines which can easily be used by the aged and the handicapped as well as ordinary people. Fuji Electric had developed an advanced unit for throwing in coins for the new hearty series that can smoothly be used by the aged and the handicapped. Its main advantages are (1) two or more coins can be thrown in together, (2) The port for putting in coins and the port for taking out change are of unified construction and simply adjoin each other, (3) Directional signs in braille are added. (author)

  8. Characterization of Novel Integrons, In1085 and In1086, and the Surrounding Genes in Plasmids from Enterobacteriaceae, and the Role for attCaadA16 Structural Features during attI1 × attC Integration

    Directory of Open Access Journals (Sweden)

    Dongguo Wang

    2017-06-01

    Full Text Available Novel class 1 integrons In1085 and In1086, containing the class D β-lactamase -encoding gene blaOXA, were identified in clinical enterobacterial strains. In this study, we aimed to characterize the genetic contexts of In1085 and In1086, with the goal of identifying putative mechanisms of integron mobilization. Four plasmids, approximately 5.3, 5.3, 5.7, and 6.6 kb, from 71 clinical Enterobacteriaceae strains were found to contain class 1 integrons (In37, In62, In1085, and In1086, respectively. Two of these plasmids, pEco336 and pNsa292, containing In1085 and In1086, respectively, were further characterized by antibiotic susceptibility testing, conjugation experiments, PCR, sequencing, and gene mapping. The OXA-type carbapenemase activities of the parental strains were also assessed. The results revealed that the novel integrons had different genetic environments, and therefore demonstrated diverse biochemical characteristics. Using evolutionary inferences based on the recombination of gene cassettes, we also identified a role for attCaadA16 structural features during attI1 × attC insertion reactions. Our analysis showed that gene cassette insertions in the bottom strand of attCaadA16 in the correct orientation lead to the expression the encoded genes from the Pc promoter. Our study suggests that the genetic features harbored within the integrons are inserted in a discernable pattern, involving the stepwise and parallel evolution of class 1 integron variations under antibiotic selection pressures in a clinical setting.

  9. Low intensity beam target unit

    CERN Multimedia

    1976-01-01

    This is a wheel fitted with many targets around its periphery (each with three longitudinally arranged thin rods) of which one is placed into the beam via a rotation of the wheel. Upstream of each target is placed a luminescent screen, aligbed on each target axis and viewed with a TV camera, to make sure that one is hitting the target. This target unit was probably used to study target's behaviour (like beam heating). Gualtiero Del Torre stands on the left, Pierre Gerdil on the right.

  10. Loviisa Unit One: Annealing - healing

    Energy Technology Data Exchange (ETDEWEB)

    Kohopaeae, J.; Virsu, R. [ed.; Henriksson, A. [ed.

    1997-11-01

    Unit 1 of the Loviisa nuclear powerplant was annealed in connection with the refuelling outage in the summer of 1996. This type of heat treatment restored the toughness properties of the pressure vessel weld, which had been embrittled be neutron radiation, so that it is almost equivalent to a new weld. The treatment itself was an ordinary metallurgical procedure that took only a few days. But the material studies that preceded it began over fifteen years ago and have put IVO at the forefront of world-wide expertise in the area of radiation embrittlement

  11. Asymptotic Rayleigh instantaneous unit hydrograph

    Science.gov (United States)

    Troutman, B.M.; Karlinger, M.R.

    1988-01-01

    The instantaneous unit hydrograph for a channel network under general linear routing and conditioned on the network magnitude, N, tends asymptotically, as N grows large, to a Rayleigh probability density function. This behavior is identical to that of the width function of the network, and is proven under the assumption that the network link configuration is topologically random and the link hydraulic and geometric properties are independent and identically distributed random variables. The asymptotic distribution depends only on a scale factor, {Mathematical expression}, where ?? is a mean link wave travel time. ?? 1988 Springer-Verlag.

  12. Enhanced Master Controller Unit Tester

    Science.gov (United States)

    Benson, Patricia; Johnson, Yvette; Johnson, Brian; Williams, Philip; Burton, Geoffrey; McCoy, Anthony

    2007-01-01

    The Enhanced Master Controller Unit Tester (EMUT) software is a tool for development and testing of software for a master controller (MC) flight computer. The primary function of the EMUT software is to simulate interfaces between the MC computer and external analog and digital circuitry (including other computers) in a rack of equipment to be used in scientific experiments. The simulations span the range of nominal, off-nominal, and erroneous operational conditions, enabling the testing of MC software before all the equipment becomes available.

  13. Hovercraft auxiliary power units (APUs)

    Energy Technology Data Exchange (ETDEWEB)

    Russell, B.J.

    1983-08-01

    Auxiliary power units (APU) manufactured by British firms for use in hovercraft are characterized. Both diesel and gas-turbine APUs are found to be well suited to the demands of this application. The design features, dimensions, performance data, and installation requirements are discussed for the SS 90, SS 923, DA-1, BA-1, HM 5, and Gevaudan 9 APUs, as well as the TRS 18 gas-turbine smoke generator. The progress made in improving the fuel efficiency of gas turbines and reducing the weight of diesel engines is considered significant.

  14. Compact monolithic capacitive discharge unit

    Science.gov (United States)

    Roesler, Alexander W.; Vernon, George E.; Hoke, Darren A.; De Marquis, Virginia K.; Harris, Steven M.

    2007-06-26

    A compact monolithic capacitive discharge unit (CDU) is disclosed in which a thyristor switch and a flyback charging circuit are both sandwiched about a ceramic energy storage capacitor. The result is a compact rugged assembly which provides a low-inductance current discharge path. The flyback charging circuit preferably includes a low-temperature co-fired ceramic transformer. The CDU can further include one or more ceramic substrates for enclosing the thyristor switch and for holding various passive components used in the flyback charging circuit. A load such as a detonator can also be attached directly to the CDU.

  15. HIV Testing in the United States

    Science.gov (United States)

    ... HIV/AIDS HIV Testing in the United States HIV Testing in the United States Jun 23, 2017 ... States or for refugees. 27 Insurance Coverage of HIV Testing HIV testing that is “medically necessary” – recommended ...

  16. ARTICLE 106 OF THE UNITED NATIONS CHARTER

    National Research Council Canada - National Science Library

    Theodore M Cooperstein

    2007-01-01

    Toward that end, Articles 42 and 43 of the United Nations Charter posit that member nations would train and dedicate armed forces to be placed at the disposal of the United Nations security Council...

  17. Join Cost for Unit Selection Speech Synthesis

    OpenAIRE

    Vepa, Jithendra

    2004-01-01

    Undoubtedly, state-of-the-art unit selection-based concatenative speech systems produce very high quality synthetic speech. this is due to a large speech database containing many instances of each speech unit, with a varied and natural distribution of prosodic and spectral characteristics. the join cost, which measures how well two units can be joined together is one of the main criteria for selecting appropriate units from this large speech database. The ideal join cost is one that measur...

  18. Oversight Institutions Within the United Nations

    DEFF Research Database (Denmark)

    Pontoppidan, Caroline Aggestam

    2015-01-01

    This article will give a description of the role of internal audit and governance functions within the United Nations system. The United Nations has, during the last 10 years, worked to establish effective oversight services. Oversight, governance and hereunder the internal audit function has been...... a key priority within the United Nations and a crucial ingredient in the Secretary-General’s efforts to reform and strengthen the United Nations to meet the challenges of the 21st century....

  19. IVOA recommendation: Units in the VO

    CERN Document Server

    Demleitner, Markus; Gray, Norman; Louys, Mireille; Ochsenbein, Francois

    2015-01-01

    This document describes a recommended syntax for writing the string representation of unit labels ("VOUnits"). In addition, it describes a set of recognised and deprecated units, which is as far as possible consistent with other relevant standards (BIPM, ISO/IEC and the IAU). The intention is that units written to conform to this specification will likely also be parsable by other well-known parsers. To this end, we include machine-readable grammars for other units syntaxes.

  20. Oversight Institutions Within the United Nations

    DEFF Research Database (Denmark)

    Pontoppidan, Caroline Aggestam

    2015-01-01

    This article will give a description of the role of internal audit and governance functions within the United Nations system. The United Nations has, during the last 10 years, worked to establish effective oversight services. Oversight, governance and hereunder the internal audit function has been...... a key priority within the United Nations and a crucial ingredient in the Secretary-General’s efforts to reform and strengthen the United Nations to meet the challenges of the 21st century....

  1. Fatigue in Breakwater Concrete Armour Units

    DEFF Research Database (Denmark)

    Burcharth, Hans F.

    The reliability of rubble mound breakwaters depends on the hydraulic stability and the mechanical strength of the armour units. The paper deals with the important aspect of fatigue related to the strength of concrete armour units.......The reliability of rubble mound breakwaters depends on the hydraulic stability and the mechanical strength of the armour units. The paper deals with the important aspect of fatigue related to the strength of concrete armour units....

  2. Equivalent Culture-Anchored Units Translation? The Phraseological Units Issue

    Directory of Open Access Journals (Sweden)

    Maciej Paweł Jaskot

    2016-12-01

    Full Text Available Equivalent Culture-Anchored Units Translation? The Phraseological Units Issue This article examines a question that has been of long-standing interest to linguists working in the fields of cross-linguistic phraseology and the translation of idiosyncratic language units, such as phraseological units (PUs. The challenge of translating PUs, which are understood as "patterns sanctioned by a given culture", involves the translation of culturemes. Therefore, a good translator must be able to assess the importance of the elements containing cultural references in the source language while "moving" them to the target language. When translating PUs, it is desirable that interlingual (cross-linguistic equivalence be achieved. The fact that translations of a PU can be very different (the translator can paraphrase the text, creatively change it, or simply eliminate the PU implies that the translational equivalence of PUs must be functional. While a cross-linguistic comparison (and the achievement of translational equivalence of PUs can be made by omitting the form parameter, it is desirable to preserve the extension and semantic structure, the connotative-pragmatic component, and the phrase combinatorics.   Ekwiwalencja jedostek "kulturowo zakotwiczonych"? Kwestia jednostek frazeologicznych Artykuł porusza zagadnienie, które od kilkudziesięciu lat cieszy się zainteresowaniem językoznawców zajmujących się konfrontacją językową frazeologii oraz tłumaczeniem idiosynkratycznych jednostek językowych, takich jak jednostki frazeologiczne (JF. Wyzwaniem podczas tłumaczenia JF, rozumianych jako "wzorce sankcjonowane przez daną kulturę", jawi się konieczność tłumaczenia kulturemów. Tłumacz zatem stoi w obliczu konieczności prawidłowej oceny danego elementu pod względem jego odniesień kulturowych w języku źródłowym podczas przekładania JF na język docelowy. Podczas tłumaczenia JF pożądane jest osiągnięcie międzyjęzykowej (cross

  3. 7 CFR 1280.127 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1280.127 Section 1280.127 Agriculture... INFORMATION ORDER Lamb Promotion, Research, and Information Order Definitions § 1280.127 United States. United States means collectively the 50 States and the District of Columbia....

  4. 7 CFR 1218.22 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1218.22 Section 1218.22 Agriculture... INFORMATION ORDER Blueberry Promotion, Research, and Information Order Definitions § 1218.22 United States. United States means collectively the 50 states, the District of Columbia, the Commonwealth of Puerto...

  5. 7 CFR 1215.20 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1215.20 Section 1215.20 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... United States. United States means all of the States. Popcorn Board...

  6. 7 CFR 1260.108 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1260.108 Section 1260.108 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... Promotion and Research Order Definitions § 1260.108 United States. United States means the 50 States and...

  7. 7 CFR 1216.30 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1216.30 Section 1216.30 Agriculture... INFORMATION ORDER Peanut Promotion, Research, and Information Order Definitions § 1216.30 United States. United States means collectively the 50 states, the District of Columbia, the Commonwealth of Puerto...

  8. 7 CFR 1210.315 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1210.315 Section 1210.315 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... PLAN Watermelon Research and Promotion Plan Definitions § 1210.315 United States. United States...

  9. 7 CFR 1221.32 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1221.32 Section 1221.32 Agriculture... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Definitions § 1221.32 United States. United States or U.S. means collectively the 50 States, the District of Columbia, the Commonwealth...

  10. Reflections: Mexico and the United States.

    Science.gov (United States)

    Paz, Octavio

    1980-01-01

    Illustrates how Mexico and the United States represent two versions of Western civilization that are profoundly different from one another. Concludes that the United States has always ignored minorities in foreign and domestic policy. Suggests that, to conquer its enemies, the United States must first conquer its historical attitude toward…

  11. Reflections: Mexico and the United States.

    Science.gov (United States)

    Paz, Octavio

    1980-01-01

    Illustrates how Mexico and the United States represent two versions of Western civilization that are profoundly different from one another. Concludes that the United States has always ignored minorities in foreign and domestic policy. Suggests that, to conquer its enemies, the United States must first conquer its historical attitude toward…

  12. Combustion Power Unit--400: CPU-400.

    Science.gov (United States)

    Combustion Power Co., Palo Alto, CA.

    Aerospace technology may have led to a unique basic unit for processing solid wastes and controlling pollution. The Combustion Power Unit--400 (CPU-400) is designed as a turboelectric generator plant that will use municipal solid wastes as fuel. The baseline configuration is a modular unit that is designed to utilize 400 tons of refuse per day…

  13. 77 FR 65459 - United Nations Day, 2012

    Science.gov (United States)

    2012-10-29

    ... Documents#0;#0; ] Proclamation 8893 of October 24, 2012 United Nations Day, 2012 By the President of the... shadows of war, the 51 founding member states of the United Nations came together to take up the new test of forging a lasting peace. In a decade scarred by genocide, the United Nations chose the hope...

  14. 76 FR 66845 - United Nations Day, 2011

    Science.gov (United States)

    2011-10-27

    ... October 27, 2011 Part IV The President Proclamation 8740--United Nations Day, 2011 #0; #0; #0... Nations Day, 2011 By the President of the United States of America A Proclamation In 1945, 51 nations in a world shaken by war signed the Charter of the United Nations. Determined to move beyond an era...

  15. 75 FR 65561 - United Nations Day, 2010

    Science.gov (United States)

    2010-10-26

    ... Documents#0;#0; #0; #0;Title 3-- #0;The President ] Proclamation 8589 of October 22, 2010 United Nations Day, 2010 By the President of the United States of America A Proclamation Sixty-five years ago, 51 nations... peace, justice, and progress. The founders of the United Nations vowed to work together to ensure...

  16. Unit 2: Application Letters & The Job Interview

    OpenAIRE

    Aleson Carbonell, Marian

    2007-01-01

    Unit 2a_ Letters of Application and the CV: Reading the employment section. Unit 2b_Letters of Application and the CV:Writing Letters and the Job Hunting Process. Unit 2c_ Letters of Application and the CV: The Job Interview.

  17. AQA A2 Chemistry Student Unit Guide

    CERN Document Server

    Cross, Margaret

    2010-01-01

    Student Unit Guides are perfect for revision. Each guide is written by an examiner and explains the unit requirements, summarises the relevant unit content and includes a series of specimen questions and answers. There are three sections to each guide:. Introduction - includes advice on how to use the guide, an explanation of the skills being tested by the assessment objectives, an outline of the unit or module and, depending on the unit, suggestions for how to revise effectively and prepare for the examination questions. Content Guidance - provides an examiner's overview of the module's key t

  18. Edexcel AS Physics Student Unit Guide

    CERN Document Server

    Benn, Mike

    2009-01-01

    Student Unit Guides are perfect for revision. Each guide is written by an examiner and explains the unit requirements, summarises the relevant unit content and includes a series of specimen questions and answers. There are three sections to each guide:. Introduction - includes advice on how to use the guide, an explanation of the skills being tested by the assessment objectives, an outline of the unit or module and, depending on the unit, suggestions for how to revise effectively and prepare for the examination questions. Content Guidance - provides an examiner's overview of the module's key t

  19. Edexcel A2 Physics Student Unit Guide

    CERN Document Server

    Benn, Mike

    2010-01-01

    Student Unit Guides are perfect for revision. Each guide is written by an examiner and explains the unit requirements, summarises the relevant unit content and includes a series of specimen questions and answers. There are three sections to each guide:. Introduction - includes advice on how to use the guide, an explanation of the skills being tested by the assessment objectives, an outline of the unit or module and, depending on the unit, suggestions for how to revise effectively and prepare for the examination questions. Content Guidance - provides an examiner's overview of the module's key t

  20. Division Unit for Binary Integer Decimals

    DEFF Research Database (Denmark)

    Lang, Tomas; Nannarelli, Alberto

    2009-01-01

    -recurrence algorithm to BID representation and implement the division unit in standard cell technology. The implementation of the proposed BID division unit is compared to that of a BCD based unit implementing the same algorithm. The comparison shows that for normalized operands the BID unit has the same latency......In this work, we present a radix-10 division unit that is based on the digit-recurrence algorithm and implements binary encodings (binary integer decimal or BID) for significands. Recent decimal division designs are all based on the binary coded decimal (BCD) encoding. We adapt the radix-10 digit...

  1. Sleep in intensive care unit

    DEFF Research Database (Denmark)

    Boyko, Yuliya; Jennum, Poul; Nikolic, Miki

    2017-01-01

    PURPOSE: To determine if improving intensive care unit (ICU) environment would enhance sleep quality, assessed by polysomnography (PSG), in critically ill mechanically ventilated patients. MATERIALS AND METHODS: Randomized controlled trial, crossover design. The night intervention "quiet routine......" protocol was directed toward improving ICU environment between 10pm and 6am. Noise levels during control and intervention nights were recorded. Patients on mechanical ventilation and able to give consent were eligible for the study. We monitored sleep by PSG.The standard (American Association of Sleep...... Medicine) sleep scoring criteria were insufficient for the assessment of polysomnograms. Modified classification for sleep scoring in critically ill patients, suggested by Watson et al. (Crit Care Med 2013;41:1958-1967), was used. RESULTS: Sound level analysis showed insignificant effect...

  2. Asynchronous Capacity per Unit Cost

    CERN Document Server

    Chandar, Venkat; Tse, David

    2010-01-01

    The capacity per unit cost, or equivalently minimum cost to transmit one bit, is a well-studied quantity. It has been studied under the assumption of full synchrony between the transmitter and the receiver. In many applications, such as sensor networks, transmissions are very bursty, with small amounts of bits arriving infrequently at random times. In such scenarios, the cost of acquiring synchronization is significant and one is interested in the fundamental limits on communication without assuming a priori synchronization. In this paper, we show that the minimum cost to transmit B bits of information asynchronously is (B + \\bar{H})k_sync, where k_sync is the synchronous minimum cost per bit and \\bar{H} is a measure of timing uncertainty equal to the entropy for most reasonable arrival time distributions.

  3. Units of measure in clinical information systems.

    Science.gov (United States)

    Schadow, G; McDonald, C J; Suico, J G; Föhring, U; Tolxdorff, T

    1999-01-01

    The authors surveyed existing standard codes for units of measures, such as ISO 2955, ANSI X3.50, and Health Level 7's ISO+. Because these standards specify only the character representation of units, the authors developed a semantic model for units based on dimensional analysis. Through this model, conversion between units and calculations with dimensioned quantities become as simple as calculating with numbers. All atomic symbols for prefixes and units are defined in one small table. Huge permutated conversion tables are not required. This method is also simple enough to be widely implementable in today's information systems. To promote the application of the method the authors provide an open-source implementation of this method in JAVA. All existing code standards for units, however, are incomplete for practical use and require substantial changes to correct their many ambiguities. The authors therefore developed a code for units that is much more complete and free from ambiguities.

  4. Discharge from an emergency department observation unit and a surgical assessment unit

    DEFF Research Database (Denmark)

    Schultz, Helen; Qvist, Niels; Backer Mogensen, Christian;

    2014-01-01

    To investigate the experiences of patients with acute abdominal pain at discharge from an emergency department observation unit compared with discharge from a surgical assessment unit.......To investigate the experiences of patients with acute abdominal pain at discharge from an emergency department observation unit compared with discharge from a surgical assessment unit....

  5. 3 CFR - Waiver of Reimbursement Under the United Nations Participation Act to Support the United Nations...

    Science.gov (United States)

    2010-01-01

    ... 3 The President 1 2010-01-01 2010-01-01 false Waiver of Reimbursement Under the United Nations Participation Act to Support the United Nations/African Union Mission in Darfur Presidential Documents Other... the United Nations Participation Act to Support the United Nations/African Union Mission in...

  6. Proposal of a bootstrap procedure using measures of influence in non-linear regression models with outliers - doi: 10.4025/actascitechnol.v36i1.17564

    Directory of Open Access Journals (Sweden)

    Larissa Ribeiro de Andrade

    2014-01-01

    Full Text Available The bootstrap method is generally performed by presupposing that each sample unit would show the same probability of being re-sampled. However, when a sample with outliers is taken into account, the empirical distribution generated by this method may be influenced, or rather, it may not accurately represent the original sample. Current study proposes a bootstrap algorithm that allows the use of measures of influence in the calculation of re-sampling probabilities. The method was reproduced in simulation scenarios taking into account the logistic growth curve model and the CovRatio measurement to evaluate the impact of an influential observation in the determinacy of the matrix of the co-variance of parameter estimates. In most cases, bias estimates were reduced. Consequently, the method is suitable to be used in non-linear models and allows the researcher to apply other measures for better bias reductions.

  7. μ3-Oxido-tris{dichlorido[1,3-bis(1,3,5-trimethylphenylimidazol-2-ylidene]gold(III} bis(trifluoromethanesulfonylimide–[bis(trifluoromethanesulfonylimide]silver(I (1/2

    Directory of Open Access Journals (Sweden)

    Marek Pažický

    2010-07-01

    Full Text Available The unusual trinuclear AuIII oxide title complex, [Au3Cl6O(C21H24N23](C2F6NO4S2·2[Ag(C2F6NO4S2], is the side product of the reaction of [1,3-bis(1,3,5-trimethylphenylimidazol-2-ylidene]dichloridophenylgold(III with silver bis(trifluoromethanesulfonylimide in the presence of traces of water. In contrast to corresponding AuI complexes, the core structure of the title compound is planar. Two silver(I bis(trifluoromethanesulfonylimide units are loosely bound to the complex cation. Here the silver atoms, disordered over two positions in a 0.870 (2:0.130 (2 ratio, interact either with the lone pairs of three chlorine ligands or two chlorine ligands and one edge of the mesityl π-system. The crystal under investigation was a partial racemic twin.

  8. Malaria Surveillance - United States, 2014.

    Science.gov (United States)

    Mace, Kimberly E; Arguin, Paul M

    2017-05-26

    Malaria in humans is caused by intraerythrocytic protozoa of the genus Plasmodium. These parasites are transmitted by the bite of an infective female Anopheles mosquito. The majority of malaria infections in the United States occur among persons who have traveled to regions with ongoing malaria transmission. However, malaria is occasionally acquired by persons who have not traveled out of the country through exposure to infected blood products, congenital transmission, laboratory exposure, or local mosquitoborne transmission. Malaria surveillance in the United States is conducted to identify episodes of local transmission and to guide prevention recommendations for travelers. This report summarizes cases in persons with onset of illness in 2014 and trends during previous years. Malaria cases diagnosed by blood film, polymerase chain reaction, or rapid diagnostic tests are reported to local and state health departments by health care providers or laboratory staff. Case investigations are conducted by local and state health departments, and reports are transmitted to CDC through the National Malaria Surveillance System, National Notifiable Diseases Surveillance System, or direct CDC consultations. CDC conducts antimalarial drug resistance marker testing on blood samples submitted by health care providers or local or state health departments. Data from these reporting systems serve as the basis for this report. CDC received reports of 1,724 confirmed malaria cases, including one congenital case and two cryptic cases, with onset of symptoms in 2014 among persons in the United States. The number of confirmed cases in 2014 is consistent with the number of confirmed cases reported in 2013 (n = 1,741; this number has been updated from a previous publication to account for delayed reporting for persons with symptom onset occurring in late 2013). Plasmodium falciparum, P. vivax, P. ovale, and P. malariae were identified in 66.1%, 13.3%, 5.2%, and 2.7% of cases, respectively

  9. Generating units performances: power system requirements

    Energy Technology Data Exchange (ETDEWEB)

    Fourment, C.; Girard, N.; Lefebvre, H.

    1994-08-01

    The part of generating units within the power system is more than providing power and energy. Their performance are not only measured by their energy efficiency and availability. Namely, there is a strong interaction between the generating units and the power system. The units are essential components of the system: for a given load profile the frequency variation follows directly from the behaviour of the units and their ability to adapt their power output. In the same way, the voltage at the units terminals are the key points to which the voltage profile at each node of the network is linked through the active and especially the reactive power flows. Therefore, the customer will experience the frequency and voltage variations induced by the units behaviour. Moreover, in case of adverse conditions, if the units do not operate as well as expected or trip, a portion of the system, may be the whole system, may collapse. The limitation of the performance of a unit has two kinds of consequences. Firstly, it may result in an increased amount of not supplied energy or loss of load probability: for example if the primary reserve is not sufficient, a generator tripping may lead to an abnormal frequency deviation, and load may have to be shed to restore the balance. Secondly, the limitation of a unit performance results in an economic over-cost for the system: for instance, if not enough `cheap` units are able to load-following, other units with higher operating costs have to be started up. We would like to stress the interest for the operators and design teams of the units on the one hand, and the operators and design teams of the system on the other hand, of dialog and information exchange, in operation but also at the conception stage, in order to find a satisfactory compromise between the system requirements and the consequences for the generating units. (authors). 11 refs., 4 figs.

  10. Prevalência de infecções hospitalares em um hospital geral de alta complexidade no município de Ponta Grossa - doi: 10.4025/actascihealthsci.v34i1.8943 Prevalence of hospital infections in a general hospital of high complexity in the Ponta Grossa city in 2007 - doi: 10.4025/actascihealthsci.v34i1.8943

    Directory of Open Access Journals (Sweden)

    Emanoel Severo

    2011-12-01

    Committees (HICC. The objective was to outline the profile of infections in a hospital of high complexity, located in the city of Ponta Grossa, Paraná State, determining the prevalence of Hospital Infection in Adult Intensive Care Unit and Neonatal Intensive Care Unit, concerning the profile of sensitivity to antimicrobials. This is a descriptive, retrospective, quantitative study, with 768 infections treated in 2007, 36.8% from Community origin, 63.2% hospital - 16.3% from the NICU, 27.8% from adult ICU and 55.9% from Units. The most prevalent bacteria in the units were: Escherichia coli, Staphylococcus aureus, and Pseudomonas aeruginosa. Adult ICU: Acinetobacter baumannii, Staphylococcus aureus, Escherichia coli. NICU: SNPC, Staphylococcus aureus, Klebsiella pneumoniae. We emphasized the high sensitivity of Acinetobacter baumannii to Ampicillin / sub-activity and Tobramycin; effectiveness of Meropenem, Vancomycin and Ciprofloxacin; low prevalence of methicillin-resistant Staphylococcus aureus/MRSA. These indicators presented significant values of prevalence and antimicrobial sensitivity, resulting from the criteria used by the HICC from the surveyed institution - conducting epidemiological surveillance; Antibiogram Stepped; monitoring of antibiotic prescriptions, and employee training.

  11. Decommissioning: a United Kingdom perspective

    Energy Technology Data Exchange (ETDEWEB)

    Haworth, A.; Reed, D.L.; Bleeze, A. [Health and Safety Executive, London (United Kingdom)

    1995-12-31

    The paper considers the United Kingdom legislative framework relevant to decommissioning of facilities on nuclear licensed sites. It describes the various legislative bodies involved in regulating this activity and the inspectorate concerned. The licensing regime is described in some detail highlighting the UK arrangements whereby a license is granted for the site upon which nuclear facilities are planned or exist. The license remains in place throughout the life of the plant on the site: from initial planning through to the end of decommissioning. A site (of part of) is not de-licensed until it can be stated that there has ceased to be any danger from ionising radiations from anything on the site (or appropriate part of the site). The final part of the paper considers the changes arising from the commercialization of the nuclear power industry in UK and the restatement of the Nuclear Installation Inspectorate`s policy on decommissioning which has arisen as a result of a review made in response to these changes. (author).

  12. The PRIMA Fringe Sensor Unit

    CERN Document Server

    Sahlmann, Johannes; Abuter, Roberto; Accardo, Matteo; Mottini, Sergio; Delplancke, Francoise

    2009-01-01

    The Fringe Sensor Unit (FSU) is the central element of the Phase Referenced Imaging and Micro-arcsecond Astrometry (PRIMA) dual-feed facility and provides fringe sensing for all observation modes, comprising off-axis fringe tracking, phase referenced imaging, and high-accuracy narrow-angle astrometry. It is installed at the Very Large Telescope Interferometer (VLTI) and successfully servoed the fringe tracking loop during the initial commissioning phase. Unique among interferometric beam combiners, the FSU uses spatial phase modulation in bulk optics to retrieve real-time estimates of fringe phase after spatial filtering. A R=20 spectrometer across the K-band makes the retrieval of the group delay signal possible. The FSU was integrated and aligned at the VLTI in summer 2008. It yields phase and group delay measurements at sampling rates up to 2 kHz, which are used to drive the fringe tracking control loop. During the first commissioning runs, the FSU was used to track the fringes of stars with K-band magnitu...

  13. Neurovascular Unit in Chronic Pain

    Directory of Open Access Journals (Sweden)

    Beatrice Mihaela Radu

    2013-01-01

    Full Text Available Chronic pain is a debilitating condition with major socioeconomic impact, whose neurobiological basis is still not clear. An involvement of the neurovascular unit (NVU has been recently proposed. In particular, the blood-brain barrier (BBB and blood-spinal cord barrier (BSCB, two NVU key players, may be affected during the development of chronic pain; in particular, transient permeabilization of the barrier is suggested by several inflammatory- and nerve-injury-based pain models, and we argue that the clarification of molecular BBB/BSCB permeabilization events will shed new light in understanding chronic pain mechanisms. Possible biases in experiments supporting this theory and its translational potentials are discussed. Moving beyond an exclusive focus on the role of the endothelium, we propose that our understanding of the mechanisms subserving chronic pain will benefit from the extension of research efforts to the NVU as a whole. In this view, the available evidence on the interaction between analgesic drugs and the NVU is here reviewed. Chronic pain comorbidities, such as neuroinflammatory and neurodegenerative diseases, are also discussed in view of NVU changes, together with innovative pharmacological solutions targeting NVU components in chronic pain treatment.

  14. Filicide in the United States.

    Science.gov (United States)

    Resnick, Phillip J

    2016-12-01

    In the United States the Accreditation Council of Graduate Medical Education determines the curriculum required for fellows in forensic psychiatry to become board certified as a subspecialist. Areas that must be covered during the one year fellowship include criminal issues, such as insanity; civil issues, such as tort law and Workers' Compensation; legal regulation of psychiatry, such as confidentiality and involuntary hospitalization; and correctional psychiatry issues, such as dual agency and prisoner's rights. Fellows are also expected to have knowledge about juvenile courts, the structure of the legal system, and child custody issues. In addition, fellows are required to analyze complex cases and write forensic reports which are well reasoned. Teaching methods include lectures, storytelling, use of video vignettes, and mock trials. Additional teaching methodologies include group supervision of fellows in their report writing and direct observation of giving testimony. During the year we see fellows evolve and shift their orientation from being an advocate for patients to perceiving their role as serving justice.

  15. FRIDA integral field unit manufacturing

    Science.gov (United States)

    Cuevas, Salvador; Eikenberry, Stephen S.; Sánchez, Beatriz

    2014-07-01

    FRIDA (inFRared Imager and Dissector for the Adaptive optics system of the Gran Telescopio Canarias) has been designed as a cryogenic and diffraction limited instrument that will offer broad and narrow band imaging and integral field spectroscopy (IFS). Both, the imaging mode and IFS observing modes will use the same Teledyne 2Kx2K detector. This instrument will be installed at Nasmyth B station, behind the GTC Adaptive Optics system (GTCAO). FRIDA will provide the IFS mode using a 30 slices Integral Field Unit (IFU). This IFU design is based on the University of Florida FISICA where the mirror block arrays are diamond turned on monolithic metal blocks. The FRIDA IFU is of the slicer type; conformed mainly by 3 mirror blocks with 30 spherical mirrors each. It also has a Schwarzschild relay based on two off axis spherical mirrors and an afocal system of two parabolic off axis mirrors. Including two insertion mirrors the IFU holds 96 metal mirrors. All the mirrors have been manufactured by diamond turning techniques on monolithic blocks of aluminum 6061-T6 coated by a Nickel alloy. Except for the Schwarzschild relay and the insertion mirrors, 92 mirrors were manufactured by Corning in Keene NH, USA. The different blocks and mirrors are mounted on an opto-mechanical support that ensures the image quality and integrity of the complete IFU. In this work advances on the manufacturing of the FRIDA IFU components are described. Furthermore, the mirror blocks individual verification tests and are also described.

  16. United Kingdom electric system privatization

    Energy Technology Data Exchange (ETDEWEB)

    Lolli, A. (Bologna Univ. (Italy))

    1992-03-01

    This paper reviews the mechanics and first results of deregulation in the electric power industry of the United Kingdom. Several aspects are dealt with, namely: 1983 Energy Act impacts on ownership and subsequent changes brought about by the 1989 Energy Act; the Act's stipulations with regard to share acquisition and distribution; the division of the patrimony of the Area Boards; natural monopolistic characteristics of power distribution; vertical integration in Scotland, target investment limits in Government and public participation; the 'golden share' concept to guarantee public participation; current 40% share ownership by the Government; 15% private ownership limit for individual investors; external control by Government of licensing and rate structure setting; the impacts of organizational changes on the overall cost benefits of deregulation; modified Governmental regulatory powers; measures to ensure competition and consumer protection; provisions regarding misbehaviour; second tier suppliers and reserve fuel supply obligations; deregulation impacts on nuclear power marketing; power pooling regulations; installation of new transmission lines; provisions encouraging the use of diverse energy sources; franchising; interconnection with national grid; regulation of technical operations; standby as it affects rate structure; and spot market pricing.

  17. Sleep in acute care units.

    Science.gov (United States)

    BaHammam, Ahmed

    2006-03-01

    Patients in the acute care units (ACU) are usually critically ill, making them more susceptible to the unfavorable atmosphere in the hospital. One of these unfavorable factors is sleep disruption and deprivation. Many factors may affect sleep in the ACU, including therapeutic interventions, diagnostic procedures, medications, the underlying disease process, and noise generated in the ACU environment. Many detrimental physiological effects can occur secondary to noise and sleep deprivation, including cardiovascular stimulation, increased gastric secretion, pituitary and adrenal stimulation, suppression of the immune system and wound healing, and possible contribution to delirium. Over the past few years, many studies have endeavored to objectively assess sleep in the ACUs, as well as the effect of mechanical ventilation and circadian rhythm changes critically ill patients. At this time, therefore, it is important to review published data regarding sleep in ACUs, in order to improve the knowledge and recognition of this problem by health care professionals. We have therefore reviewed the methods used to assess sleep in ACUs, factors that may affect sleep in the ACU environment, and the clinical implications of sleep disruption in the ACU.

  18. Neurovascular Unit in Chronic Pain

    Science.gov (United States)

    Radu, Beatrice Mihaela; Bramanti, Placido; Osculati, Francesco; Flonta, Maria-Luisa; Radu, Mihai; Bertini, Giuseppe; Fabene, Paolo Francesco

    2013-01-01

    Chronic pain is a debilitating condition with major socioeconomic impact, whose neurobiological basis is still not clear. An involvement of the neurovascular unit (NVU) has been recently proposed. In particular, the blood-brain barrier (BBB) and blood-spinal cord barrier (BSCB), two NVU key players, may be affected during the development of chronic pain; in particular, transient permeabilization of the barrier is suggested by several inflammatory- and nerve-injury-based pain models, and we argue that the clarification of molecular BBB/BSCB permeabilization events will shed new light in understanding chronic pain mechanisms. Possible biases in experiments supporting this theory and its translational potentials are discussed. Moving beyond an exclusive focus on the role of the endothelium, we propose that our understanding of the mechanisms subserving chronic pain will benefit from the extension of research efforts to the NVU as a whole. In this view, the available evidence on the interaction between analgesic drugs and the NVU is here reviewed. Chronic pain comorbidities, such as neuroinflammatory and neurodegenerative diseases, are also discussed in view of NVU changes, together with innovative pharmacological solutions targeting NVU components in chronic pain treatment. PMID:23840097

  19. The United States in the 1980's

    Directory of Open Access Journals (Sweden)

    D. Conradie

    2012-02-01

    Full Text Available The era of optimism which prevailed in the United States since the Korean War, came to an abrupt end after the debacle in Vietnam. By the end of the Seventies the United States was no longer the dominant military power. American foreign policy lacked consistence, coherence and a strategic sense. The United States became indecisive. Under these circumstances the Soviet Union successfully enforced its imperialistic designs upon countries far from its shores.

  20. Body Structure and Design Feature of DTC New UItra-supercriticaI 1 000 MW Steam Turbine%东方新超超临界1000 MW汽轮机本体结构及设计特点

    Institute of Scientific and Technical Information of China (English)

    刘雄; 袁永强; 黄果; 高展羽

    2015-01-01

    文章详细介绍了东方新一代超超临界1000 MW汽轮机的本体结构及设计特点。该机型是东方采用现代汽轮机技术自主研发而成的一种新型高参数汽轮机,通过重要结构的优化设计以及高温材料的合理选择,有效地提高了机组的经济性与可靠性。%The body structure and design feature of DTC new ultra-supercritical 1 000 MW steam turbine are introduced in details. The unit is a new high-parameter and self-developed turbine by DTC. These products are based on modern steam turbine tech-nologies.The reliability and economy of turbine are improved effectively through the optimization design of structure and the reason-able selection of high temperature material.

  1. Treatment of textile effluent containing indigo blue dye by a UASB reactor coupled with pottery clay adsorption - doi: 10.4025/actascitechnol.v35i1.13091

    Directory of Open Access Journals (Sweden)

    Vinicius Conceição

    2013-01-01

    Full Text Available This study aimed to evaluate the treatment of a synthetic textile wastewater containing the blue indigo dye in a UASB (upflow anaerobic reactor, on a bench scale, followed by pottery clay adsorption. The system monitoring was verified by the following physical and chemical parameters: pH, alkalinity, volatile acids, COD and removal of color. The adsorption tests using pottery clay (construction debris as an alternative adsorbent material were performed on a jar test equipment. The results showed satisfactory effectiveness in removing color and organic matter (COD by the UASB, at the order of 69 and 81.2%, respectively. The color removal using ceramic clay as an alternative adsorbent material was 97% for the concentration of 200 g L-1 of adsorbent, evidencing that the use of pottery clay as adsorbent material had significant and promising results, and may be used as a post-treatment unit for removal of dyes present in textile effluents, and since construction debris currently represents a major environmental problem, its use in wastewater treatment may become an alternative to a proper destination of this waste.  

  2. Portable Unit for Metabolic Analysis

    Science.gov (United States)

    Dietrich, Daniel L.; Pitch, Nancy D.; Lewis, Mark E.; Juergens, Jeffrey R.; Lichter, Michael J.; Stuk, Peter M.; Diedrick, Dale M.; Valentine, Russell W.; Pettegrew, Richard D.

    2007-01-01

    The Portable Unit for Metabolic Analysis (PUMA) is an instrument that measures several quantities indicative of human metabolic function. Specifically, this instrument makes time-resolved measurements of temperature, pressure, flow, and the partial pressures of oxygen and carbon dioxide in breath during both inhalation and exhalation. Portable instruments for measuring these quantities have been commercially available, but the response times of those instruments are too long to enable temporal resolution of phenomena on the time scales of human respiration cycles. In contrast, the response time of the PUMA is significantly shorter than characteristic times of human respiration phenomena, making it possible to analyze varying metabolic parameters, not only on sequential breath cycles but also at successive phases of inhalation and exhalation within the same breath cycle. In operation, the PUMA is positioned to sample breath near the subject s mouth. Commercial off-the-shelf sensors are used for three of the measurements: a miniature pressure transducer for pressure, a thermistor for temperature, and an ultrasonic sensor for flow. Sensors developed at Glenn Research Center are used for measuring the partial pressures of oxygen and carbon dioxide: The carbon dioxide sensor exploits the relatively strong absorption of infrared light by carbon dioxide. Light from an infrared source passes through the stream of inhaled or exhaled gas and is focused on an infrared- sensitive photodetector. The oxygen sensor exploits the effect of oxygen in quenching the fluorescence of ruthenium-doped organic molecules in a dye on the tip of an optical fiber. A blue laser diode is used to excite the fluorescence, and the optical fiber carries the fluorescent light to a photodiode, the temporal variation of the output of which bears a known relationship with the rate of quenching of fluorescence and, hence, with the partial pressure of oxygen. The outputs of the sensors are digitized

  3. "Units of Comparison" across Languages, across Time

    Science.gov (United States)

    Thomas, Margaret

    2009-01-01

    Lardiere's keynote article adverts to a succession of "units of comparison" that have been employed in the study of cross-linguistic differences, including mid-twentieth-century structural patterns, generative grammar's parameters, and (within contemporary Minimalism) features. This commentary expands on the idea of units of cross-linguistic…

  4. Portable Power And Digital-Communication Units

    Science.gov (United States)

    Levin, Richard R.; Henry, Paul K.; Rosenberg, Leigh S.

    1992-01-01

    Conceptual network of electronic-equipment modules provides electrical power and digital radio communications at multiple sites not served by cables. System includes central communication unit and portable units powered by solar photovoltaic arrays. Useful to serve equipment that must be set up quickly at remote sites or buildings that cannot be modified to provide cable connections.

  5. Brexit and Devolution in the United Kingdom

    Directory of Open Access Journals (Sweden)

    Michael Keating

    2017-03-01

    Full Text Available Devolution in the United Kingdom is deeply connected to United Kingdom membership of the European Union, which provides an external support system for the internal settlement. Exit from the European Union destabilizes the internal settlement and raises a series of major constitutional issues.

  6. Unit: Plants, Inspection Pack, National Trial Print.

    Science.gov (United States)

    Australian Science Education Project, Toorak, Victoria.

    This is a National Trial Print of a unit on plants produced as a part of the Australian Science Education Project. The unit consists of an information booklet for students, a booklet for recording student data, and a teacher's guide. The material, designed for use with students in the upper elementary grades, takes from 15 to 20 forty-minute…

  7. 28 CFR 0.1 - Organizational units.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Organizational units. 0.1 Section 0.1 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Organizational Structure of the Department of Justice § 0.1 Organizational units. The Department of Justice shall consist...

  8. Performance and burnout in intensive care units

    NARCIS (Netherlands)

    Keijsers, GJ; Schaufeli, WB; LeBlanc, P; Zwerts, C; Miranda, DR

    1995-01-01

    The relationship between three different performance measures and burnout was explored in 20 Dutch Intensive Care Units (ICUs). Burnout (i.e. emotional exhaustion and depersonalization) proved to be significantly related to nurses' perceptions of performance as well as to objectively assessed unit p

  9. Topology optimization of inertia driven dosing units

    DEFF Research Database (Denmark)

    Andreasen, Casper Schousboe

    2016-01-01

    This paper presents a methodology for optimizing inertia driven dosing units, sometimes referred to as eductors, for use in small scale flow applications. The unit is assumed to operate at low to moderate Reynolds numbers and under steady state conditions. By applying topology optimization...

  10. REACH. Electricity Units, Post-Secondary.

    Science.gov (United States)

    Smith, Gene; And Others

    As a part of the REACH (Refrigeration, Electro-Mechanical, Air-Conditioning, Heating) electromechanical cluster, this postsecondary student manual contains individualized instructional units in the area of electricity. The instructional units focus on electricity fundamentals, electric motors, electrical components, and controls and installation.…

  11. 40 CFR 157.27 - Unit packaging.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Unit packaging. 157.27 Section 157.27 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PACKAGING REQUIREMENTS FOR PESTICIDES AND DEVICES Child-Resistant Packaging § 157.27 Unit packaging. Pesticide...

  12. Clique-width of unit interval graphs

    OpenAIRE

    Lozin, Vadim V.

    2007-01-01

    The clique-width is known to be unbounded in the class of unit interval graphs. In this paper, we show that this is a minimal hereditary class of unbounded clique-width, i.e., in every hereditary subclass of unit interval graphs the clique-width is bounded by a constant.

  13. Introduction to Agribusiness. Unit A-6.

    Science.gov (United States)

    Luft, Vernon D.; Backlund, Paul

    This secondary curriculum guides is comprised of two jobs (units of instruction) designed to introduce students to Agribusiness. An introductory section lists the jobs included in the guide, intended use, unit objectives, and references. Jobs included are (1) Understanding the Importance of Agribusiness and (2) Defining Types of Business…

  14. Integrating Geospatial Technologies in an Energy Unit

    Science.gov (United States)

    Kulo, Violet A.; Bodzin, Alec M.

    2011-01-01

    This article presents a design-based research study of the implementation of an energy unit developed for middle school students. The unit utilized Google Earth and a geographic information system (GIS) to support student understanding of the world's energy resources and foster their spatial thinking skills. Findings from the prototype study…

  15. Linguistic Units and Speech Production Theory.

    Science.gov (United States)

    MacNeilage, Peter F.

    This paper examines the validity of the concept of linguistic units in a theory of speech production. Substantiating data are drawn from the study of the speech production process itself. Secondarily, an attempt is made to reconcile the postulation of linguistic units in speech production theory with their apparent absence in the speech signal.…

  16. Understanding "Romeo and Juliet": A Thematic Unit.

    Science.gov (United States)

    Koveleski, Erin

    This curriculum unit for Grade 9 combines the classic Shakespeare play "Romeo and Juliet" with three young adult novels: "The Outsiders" (S.E. Hinton), "Summer of My German Soldier" (Bette Greene), and "The Witch of Blackbird Pond" (Elizabeth George Speare). To complete the unit, all students will be required to read the Shakespeare play; however,…

  17. SPOKEN COCHABAMBA QUECHUA, UNITS 13-24.

    Science.gov (United States)

    LASTRA, YOLANDA; SOLA, DONALD F.

    UNITS 13-24 OF THE SPOKEN COCHABAMBA QUECHUA COURSE FOLLOW THE GENERAL FORMAT OF THE FIRST VOLUME (UNITS 1-12). THIS SECOND VOLUME IS INTENDED FOR USE IN AN INTERMEDIATE OR ADVANCED COURSE AND INCLUDES MORE COMPLEX DIALOGS, CONVERSATIONS, "LISTENING-INS," AND DICTATIONS, AS WELL AS GRAMMAR AND EXERCISE SECTIONS COVERING ADDITIONAL…

  18. SPOKEN COCHABAMBA QUECHUA, UNITS 1-12.

    Science.gov (United States)

    LASTRA, YOLANDA; SOLA, DONALD F.

    THE FIRST OF TWO VOLUMES PREPARED FOR TEACHING THE COCHABAMBA DIALECT OF QUECHUA TO SPEAKERS OF ENGLISH, THIS DOCUMENT IS MADE UP OF 12 UNITS THAT COMPRISE A 6-WEEK INTENSIVE COURSE OF 20 CLASS HOURS A WEEK. EACH UNIT CONSISTS OF ONE OR MORE DIALOGS TO BE MEMORIZED, A DIALOG REVIEW, A SECTION ON GRAMMAR WITH ACCOMPANYING EXERCISES, CONVERSATION,…

  19. Block Gas Sol Unit in Haderslev

    DEFF Research Database (Denmark)

    Vejen, Niels Kristian

    2000-01-01

    Investigation of a SDHW system based on a Block Gas Sol Unit from Baxi A/S installed by a consumer i Haderslev, Denmark.......Investigation of a SDHW system based on a Block Gas Sol Unit from Baxi A/S installed by a consumer i Haderslev, Denmark....

  20. Unit 1003: The Language of Exposition.

    Science.gov (United States)

    Minnesota Univ., Minneapolis. Center for Curriculum Development in English.

    This language unit for grade 10 builds on a definition of the expository use of language developed in the two previous 10th-grade units. In a brief overview of report language, the referential language of Thomas Huxley is compared with the expressive language of Edgar Allan Poe. The writings of S. I. Hayakawa, Hans Guth, and others are examined…

  1. Nuclear Proliferation: A Unit for Study.

    Science.gov (United States)

    Fernekes, William R.

    1990-01-01

    Using Argentina as a sample case study, presents a classroom unit designed to explain the implications for world peace of nuclear weapons development. Employs a policy analysis model to make an indepth examination of the values underlying all government policy decisions. Includes unit topics and procedures for the exercise. (NL)

  2. Receipts. Agricultural Record Keeping. Supplementary Units.

    Science.gov (United States)

    Missouri Univ., Columbia. Instructional Materials Lab.

    Eight supplementary units are included in these instructional materials for agricultural recordkeeping: (1) receipts; (2) expenditures; (3) cash flow; (4) inventory; (5) financial statement; (6) business agreements; (7) ownership business agreements; and (8) placement training agreements. Each unit contains an introduction, lesson objectives, and…

  3. Unit 1003: The Language of Exposition.

    Science.gov (United States)

    Minnesota Univ., Minneapolis. Center for Curriculum Development in English.

    This language unit for grade 10 builds on a definition of the expository use of language developed in the two previous 10th-grade units. In a brief overview of report language, the referential language of Thomas Huxley is compared with the expressive language of Edgar Allan Poe. The writings of S. I. Hayakawa, Hans Guth, and others are examined…

  4. Unit: Cells, Inspection Set, National Trial Print.

    Science.gov (United States)

    Australian Science Education Project, Toorak, Victoria.

    This trial version of a unit is the series being produced by the Australian Science Education Project provides instructions for students to prepare a variety of cell types and examine them with microscopes. It also gives some information about the variety and function of cells. The core of the unit, which all students are expected to complete,…

  5. Addressing the United States Debt and Deficit

    Science.gov (United States)

    2010-03-01

    current government approach to the economy , then examining the current projections for United States’ spending from 2009 through 2019 and examining...manner and thereby strengthen the economy of the United States, this paper concludes with three examples that are predicated on the synergistic benefits associated with small reforms.

  6. SPOKEN COCHABAMBA QUECHUA, UNITS 1-12.

    Science.gov (United States)

    LASTRA, YOLANDA; SOLA, DONALD F.

    THE FIRST OF TWO VOLUMES PREPARED FOR TEACHING THE COCHABAMBA DIALECT OF QUECHUA TO SPEAKERS OF ENGLISH, THIS DOCUMENT IS MADE UP OF 12 UNITS THAT COMPRISE A 6-WEEK INTENSIVE COURSE OF 20 CLASS HOURS A WEEK. EACH UNIT CONSISTS OF ONE OR MORE DIALOGS TO BE MEMORIZED, A DIALOG REVIEW, A SECTION ON GRAMMAR WITH ACCOMPANYING EXERCISES, CONVERSATION,…

  7. SPOKEN COCHABAMBA QUECHUA, UNITS 13-24.

    Science.gov (United States)

    LASTRA, YOLANDA; SOLA, DONALD F.

    UNITS 13-24 OF THE SPOKEN COCHABAMBA QUECHUA COURSE FOLLOW THE GENERAL FORMAT OF THE FIRST VOLUME (UNITS 1-12). THIS SECOND VOLUME IS INTENDED FOR USE IN AN INTERMEDIATE OR ADVANCED COURSE AND INCLUDES MORE COMPLEX DIALOGS, CONVERSATIONS, "LISTENING-INS," AND DICTATIONS, AS WELL AS GRAMMAR AND EXERCISE SECTIONS COVERING ADDITIONAL…

  8. SPOKEN COCHABAMBA QUECHUA, UNITS 13-24.

    Science.gov (United States)

    LASTRA, YOLANDA; SOLA, DONALD F.

    UNITS 13-24 OF THE SPOKEN COCHABAMBA QUECHUA COURSE FOLLOW THE GENERAL FORMAT OF THE FIRST VOLUME (UNITS 1-12). THIS SECOND VOLUME IS INTENDED FOR USE IN AN INTERMEDIATE OR ADVANCED COURSE AND INCLUDES MORE COMPLEX DIALOGS, CONVERSATIONS, "LISTENING-INS," AND DICTATIONS, AS WELL AS GRAMMAR AND EXERCISE SECTIONS COVERING ADDITIONAL GRAMMATICAL…

  9. Tetrahedral Units: For Dodecahedral Super-Structures

    CERN Document Server

    Ortiz, Y; Liebman, J F

    2016-01-01

    Different novel organic-chemical possibilities for tetrahedral building units are considered, with attention to their utility in constructing different super-structures. As a representative construction we consider the use of sets of 20 such identical tetrahedral units to form a super-dodecahedron.

  10. Biogas for Javanese villages - a simple unit

    Energy Technology Data Exchange (ETDEWEB)

    Steward, J.; Richmond, B.

    1980-09-01

    Java is on the verge of suffering severe ecological damage due to deforestation as villagers attempt to meet a desperate need for food and firewood. In an attempt to alleviate this situation a biogas unit has been developed suited to local conditions with the potential for distribution to Javanese village farmers. The design, construction and operation of one such unit is described.

  11. Who's afraid of the Unit Quaternion ?

    CERN Document Server

    O'Sullivan, Brian

    2016-01-01

    Far from being just a 2-level Quantum system the Qubit is a Unit Quaternion, also known as a Spinor. Therefore it follows that the Qubit is a 4-dimensional vector which traces a path on the surface of the unit 3-sphere. This is the meaning of the global phase.

  12. Cornerstones: Literacy Units Ready for Teachers, Students

    Science.gov (United States)

    Blasko, Jennifer; Donahue, Sheila

    2008-01-01

    Every day, teachers face the time-consuming task of adapting materials from curricula that do not meet their students' needs or match their learning styles. This article discusses ready-made literacy units specifically designed for teachers of deaf and hard of hearing students. The units were part of the Cornerstones Project, an activity of the…

  13. Foods and Nutrition Resource Unit. Entertaining.

    Science.gov (United States)

    Gantt, Sara

    This resource unit, a supplement to the foods and nutrition curriculum guide (see related note), was designed to help secondary education home economics teachers provide students with additional food study and plan for learning experiences in the art of entertaining. The unit covers four principle topics regarding the art of entertaining in a…

  14. Units for the Laboratory of Industries.

    Science.gov (United States)

    Gorham State Coll., ME.

    This institute focused on manufacturing industries for junior high industrial arts. It was attended by 20 teachers from 14 states who worked in four groups to develop pairs of instructional units titled "Introduction to Technology and Industrial Arts." Each of these units covers personnel management, engineering, production, finance, and…

  15. Social Studies: United States. Grade 5.

    Science.gov (United States)

    Kellogg, E. G.

    This teachers guide attempts to facilitate the study of the United States through a conceptual approach and multimedia instruction in a spiral curriculum. There are five units: 1) Natural Setting --location, climate, terrain, water, soil, and economic and esthetic value, and conservation; 2) Historial Development --North American Indian cultures,…

  16. A Novel Classification of Concentration Units.

    Science.gov (United States)

    MacCarthy, Patrick

    1983-01-01

    Presents a classification scheme that organizes concentration units (such as molarity) into four logical classes. These classes clearly illustrate relationships and differences between the various units. The scheme is operationally simple to apply and removes the apparent arbitrariness of definitions as normally presented. (Author/JN)

  17. Unit 148 - World Wide Web Basics

    OpenAIRE

    133, CC in GIScience; Yeung, Albert K.

    2000-01-01

    This unit explains the characteristics and the working principles of the World Wide Web as the most important protocol of the Internet. Topics covered in this unit include characteristics of the World Wide Web; using the World Wide Web for the dissemination of information on the Internet; and using the World Wide Web for the retrieval of information from the Internet.

  18. Performance and burnout in intensive care units

    NARCIS (Netherlands)

    Keijsers, GJ; Schaufeli, WB; LeBlanc, P; Zwerts, C; Miranda, DR

    1995-01-01

    The relationship between three different performance measures and burnout was explored in 20 Dutch Intensive Care Units (ICUs). Burnout (i.e. emotional exhaustion and depersonalization) proved to be significantly related to nurses' perceptions of performance as well as to objectively assessed unit

  19. Charpak, Garwin, propose unit for radiation dose

    CERN Multimedia

    Feder, Toni

    2002-01-01

    Becquerels, curries, grays, rads, rems, roentgens, sieverts - even for specialists the units of radiation can get confusing. That's why two eminent physicists, Georges Charpak of France, and Richard Garwin, are proposing the DARI as a unit of radiation dose they hope will help the public evaluate the risks associated with low-level radiation exposure (1 page)

  20. Unit labour costs, productivity and international competitiveness

    NARCIS (Netherlands)

    Ark, Bart van; Stuivenwold, Edwin; Ypma, Gerard

    2005-01-01

    This paper provides international comparisons of relative levels of unit labour costs (ULC) for several OECD countries relative to the United States. The estimates are based on the Total Economy Database and the 60-Industry Database of the Groningen Growth and Development Centre (GGDC), and are also

  1. 1:2,000,000-scale Hydrologic Units of the United States

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This data set has been superseded by huc2m. This file contains hydrologic unit boundaries and codes for the conterminous United States along with Alaska, Hawaii,...

  2. Flyway Habitat Management Unit Project report no. 1: Introduction to the Flyway Habitat Management Unit Project

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — To reduce uncertainties and provide improved program guidance, we divided the coterminous United States into 164 management units, developed sets of key information...

  3. (SUPERSEDED) 1:2,000,000-scale Hydrologic Units of the United States (SUPERSEDED)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This file contains hydrologic unit boundaries and codes for the conterminous United States along with Alaska, Hawaii, Puerto Rico and the U.S. Virgin Islands. It was...

  4. Abortion Surveillance - United States, 2013.

    Science.gov (United States)

    Jatlaoui, Tara C; Ewing, Alexander; Mandel, Michele G; Simmons, Katharine B; Suchdev, Danielle B; Jamieson, Denise J; Pazol, Karen

    2016-11-25

    Since 1969, CDC has conducted abortion surveillance to document the number and characteristics of women obtaining legal induced abortions in the United States. 2013. Each year, CDC requests abortion data from the central health agencies of 52 reporting areas (the 50 states, the District of Columbia, and New York City). The reporting areas provide this information voluntarily. For 2013, data were received from 49 reporting areas. For trend analysis, abortion data were evaluated from 47 areas that reported data every year during 2004-2013. Census and natality data, respectively, were used to calculate abortion rates (number of abortions per 1,000 women) and ratios (number of abortions per 1,000 live births). A total of 664,435 abortions were reported to CDC for 2013. Of these abortions, 98.2% were from the 47 reporting areas that provided data every year during 2004-2013. Among these 47 reporting areas, the abortion rate for 2013 was 12.5 abortions per 1,000 women aged 15-44 years, and the abortion ratio was 200 abortions per 1,000 live births. From 2012 to 2013, the total number, rate, and ratio of reported abortions decreased 5%. From 2004 to 2013, the total number, rate, and ratio of reported abortions decreased 20%, 21%, and 17%, respectively. In 2013, all three measures reached their lowest level for the entire period of analysis (2004-2013). In 2013 and throughout the period of analysis, women in their 20s accounted for the majority of abortions and had the highest abortion rates; women in their 30s and older accounted for a much smaller percentage of abortions and had lower abortion rates. In 2013, women aged 20-24 and 25-29 years accounted for 32.7% and 25.9% of all abortions, respectively, and had abortion rates of 21.8 and 18.2 abortions per 1,000 women aged 20-24 and 25-29 years, respectively. In contrast, women aged 30-34, 35-39, and ≥40 years accounted for 16.8%, 9.2%, and 3.6% of all abortions, respectively, and had abortion rates of 11.8, 7.0, and 2

  5. Abortion Surveillance - United States, 2012.

    Science.gov (United States)

    Pazol, Karen; Creanga, Andreea A; Jamieson, Denise J

    2015-11-27

    Since 1969, CDC has conducted abortion surveillance to document the number and characteristics of women obtaining legal induced abortions in the United States. 2012. Each year, CDC requests abortion data from the central health agencies of 52 reporting areas (the 50 states, the District of Columbia, and New York City). The reporting areas provide this information voluntarily. For 2012, data were received from 49 reporting areas. For trend analysis, abortion data were evaluated from 47 areas that reported data every year during 2003-2012. Census and natality data, respectively, were used to calculate abortion rates (number of abortions per 1,000 women) and ratios (number of abortions per 1,000 live births). A total of 699,202 abortions were reported to CDC for 2012. Of these abortions, 98.4% were from the 47 reporting areas that provided data every year during 2003-2012. Among these same 47 reporting areas, the abortion rate for 2012 was 13.2 abortions per 1,000 women aged 15-44 years, and the abortion ratio was 210 abortions per 1,000 live births. From 2011 to 2012, the total number and ratio of reported abortions decreased 4% and the abortion rate decreased 5%. From 2003 to 2012, the total number, rate, and ratio of reported abortions decreased 17%, 18%, and 14%, respectively, and reached their lowest level in 2012 for the entire period of analysis (2003-2012). In 2012 and throughout the period of analysis, women in their 20s accounted for the majority of abortions and had the highest abortion rates; women in their 30s and older accounted for a much smaller percentage of abortions and had lower abortion rates. In 2012, women aged 20-24 and 25-29 years accounted for 32.8% and 25.4% of all abortions, respectively, and had abortion rates of 23.3 and 18.9 abortions per 1,000 women aged 20-24 and 25-29 years, respectively. In contrast, women aged 30-34, 35-39, and ≥40 years accounted for 16.4%, 9.1%, and 3.7% of all abortions, respectively, and had abortion rates of

  6. Cultural traits as units of analysis

    Science.gov (United States)

    O'Brien, Michael J.; Lyman, R. Lee; Mesoudi, Alex; VanPool, Todd L.

    2010-01-01

    Cultural traits have long been used in anthropology as units of transmission that ostensibly reflect behavioural characteristics of the individuals or groups exhibiting the traits. After they are transmitted, cultural traits serve as units of replication in that they can be modified as part of an individual's cultural repertoire through processes such as recombination, loss or partial alteration within an individual's mind. Cultural traits are analogous to genes in that organisms replicate them, but they are also replicators in their own right. No one has ever seen a unit of transmission, either behavioural or genetic, although we can observe the effects of transmission. Fortunately, such units are manifest in artefacts, features and other components of the archaeological record, and they serve as proxies for studying the transmission (and modification) of cultural traits, provided there is analytical clarity over how to define and measure the units that underlie this inheritance process. PMID:21041205

  7. Cultural traits as units of analysis.

    Science.gov (United States)

    O'Brien, Michael J; Lyman, R Lee; Mesoudi, Alex; VanPool, Todd L

    2010-12-12

    Cultural traits have long been used in anthropology as units of transmission that ostensibly reflect behavioural characteristics of the individuals or groups exhibiting the traits. After they are transmitted, cultural traits serve as units of replication in that they can be modified as part of an individual's cultural repertoire through processes such as recombination, loss or partial alteration within an individual's mind. Cultural traits are analogous to genes in that organisms replicate them, but they are also replicators in their own right. No one has ever seen a unit of transmission, either behavioural or genetic, although we can observe the effects of transmission. Fortunately, such units are manifest in artefacts, features and other components of the archaeological record, and they serve as proxies for studying the transmission (and modification) of cultural traits, provided there is analytical clarity over how to define and measure the units that underlie this inheritance process.

  8. The vacuum impedance and unit systems

    CERN Document Server

    Kitano, M

    2006-01-01

    In electromagnetism, the vacuum impedance $Z_0$ is a universal constant, which is as important as the velocity of light $c$ in vacuum. Unfortunately, however, its significance does not seem to be appreciated so well and sometimes the presence itself is ignored. It is partly because in the Gaussian system of units, which has widely been used for long time, $Z_0$ is a dimensionless constant and of unit magnitude. In this paper, we clarify that $Z_0$ is a fundamental parameter in electromagnetism and plays major roles in the following scenes: reorganizing the structure of the electromagnetic formula in reference to the relativity; renormalizing the quantities toward natural unit systems starting from the SI unit system; and defining the magnitudes of electromagnetic units.

  9. Units of measurement past, present and future international system of units

    CERN Document Server

    Gupta, S V

    2010-01-01

    It is for the first time that the subject of quantities and their respective units is dealt this much in detail a glimpse of units of measurements of base quantities of length, time, mass and volume is given for ancient India three and four dimensional systems of measurement units are critically examined establishment of the fact that only four base units are needed to describe a system of units the basics to arrive at the unit of a derived quantity are explained basic, derived and dimensionless quantities including quantity calculus are introduced life history of scientists concerned with measurements units are presented to be inspiring to working metrologists and students. The International System of Units including, Metre Convention Treaty and its various organs including International National of Weights and Measure are described. The realisation of base units is given in detail. Classes of derived units within the SI, units permitted for time to come, units outside SI but used in special fields of measur...

  10. Avaliação econômica e desempenho de frangos de corte alimentados com diferentes níveis de milheto em substituição ao milho - DOI: 10.4025/actascianimsci.v31i1.5761 Economic evaluation and performance of broilers fed with different levels of pearl millet in substitution of corn - DOI: 10.4025/actascianimsci.v31i1.5761

    Directory of Open Access Journals (Sweden)

    Fabiana Villa Alves

    2009-05-01

    Full Text Available Dois experimentos foram conduzidos com o objetivo de determinar o valor energético do milheto (Pennisetum glaucum ADR 7010 e avaliar o desempenho e a viabilidade econômica dos frangos de corte alimentados com rações contendo níveis crescentes de milheto ADR 7010. No Experimento 1 foram utilizados 72 frangos de corte com 21 dias de idade em um delineamento inteiramente casualizado com dois tratamentos, seis repetições de nove aves cada. A energia metabolizável aparente do milheto foi de 3.362,24 kcal kg-1 de matéria seca e 3.066,00 kcal kg-1 de matéria natural e o teor de proteína bruta de 12,6%. No Experimento 2 foram utilizados 960 pintos de um dia de idade, distribuídos em um delineamento inteiramente casualizado com seis tratamentos, cinco repetições e 32 aves cada. Os tratamentos consistiram de seis níveis de substituição do milho pelo milheto, variando de 0 a 100%. Observou-se efeito linear dos níveis crescentes do milheto sobre o ganho de peso e consumo de ração no período de 1-21 dias e no ganho de peso, no período de 1-41 dias de idade. Em rações isoenergéticas e isoaminoacídicas, o milho pode ser substituído pelo milheto ADR 7010 em nível de 100%, o que corresponde a cerca de 60% de inclusão de milheto nas rações para frangos de corte, sem prejuízos no desempenho das aves e com maior viabilidade econômica.Two experiments were carried out to determine the energy value, performance and economical feasibility of broiler chickens feeding on different levels of ADR 7010 pearl millet. Experiment 1 was conducted by using 72 broilers with 21 days of age distributed in metabolism cages. A completely randomized experimental design was conducted, with two treatments, six replicates and nine broilers per experimental unit. Pearl millet replaced 40% of reference diet. Values of apparent metabolizable energy of ADR 7010 pearl millet were 3,362 kcal kg-1 (as dry matter and 3,066 kcal kg-1 (as feed basis and 12.6% crude

  11. Níveis de inclusão de farinha de penas na dieta sobre o desempenho e características de carcaça de codornas para corte - DOI: 10.4025/actascianimsci.v28i1.661 Inclusion levels of feather meal in the diet on performance and carcasses characteristics of quail for meat - DOI: 10.4025/actascianimsci.v28i1.661

    Directory of Open Access Journals (Sweden)

    Marcus Ferreira Pessôa

    2006-01-01

    Full Text Available Avaliou-se o desempenho de 240 codornas européias para corte mediante diferentes níveis de inclusão de farinha de penas na dieta. O delineamento experimental utilizado foi o inteiramente casualizado, com 4 tratamentos (0, 3, 6 e 9% de farinha de penas, 5 repetições e 12 animais por unidade experimental. De acordo com os resultados, a farinha de penas pode ser utilizada na dieta de codornas para corte, exceto no período de 1 a 7 dias, em até 9%, sem alterações negativas sobre o desempenho dos animais. Entretanto, foi observado que na medida em que houve aumento da inclusão de farinha de penas na dieta, houve redução do consumo de ração e no rendimento de coxa mais sobrecoxa, assim como aumento do rendimento de dorso mais asas.The performance of 240 European quail for meat was evaluated using different levels of feather meal in the diet. The experiment was conducted with a totally randomized design, consisting of four treatments (0, 3, 6, and 9% of feather meal, five repetitions and twelve animals per experimental unit. Results show that, feather meal can be utilized in the quail for meat diet, except in a period of 1 to 7 days, up to 9%, without significant negative effects on the performance of the animals. However, as the inclusion of feather flour in the diet increased, a reduction in the consumption of feed and in the thigh yield were observed, as well as an increase in back + wing yield.

  12. Assessment of Motor Units in Neuromuscular Disease.

    Science.gov (United States)

    Henderson, Robert D; McCombe, Pamela A

    2017-01-01

    The motor unit comprises the anterior horn cell, its axon, and the muscle fibers that it innervates. Although the true number of motor units is unknown, the number of motor units appears to vary greatly between different muscles and between different individuals. Assessment of the number and function of motor units is needed in diseases of the anterior horn cell and other motor nerve disorders. Amyotrophic lateral sclerosis is the most important disease of anterior horn cells. The need for an effective biomarker for assessing disease progression and for use in clinical trials in amyotrophic lateral sclerosis has stimulated the study of methods to measure the number of motor units. Since 1970 a number of different methods, including the incremental, F-wave, multipoint, and statistical methods, have been developed but none has achieved widespread applicability. Two methods (MUNIX and the multipoint incremental method) are in current use across multiple centres and are discussed in detail in this review, together with other recently published methods. Imaging with magnetic resonance and ultrasound is increasingly being applied to this area. Motor unit number estimates have also been applied to other neuromuscular diseases such as spinal muscular atrophy, compression neuropathies, and prior poliomyelitis. The need for an objective measure for the assessment of motor units remains tantalizingly close but unfulfilled in 2016.

  13. Practical unit testing with JUnit and Mockito

    CERN Document Server

    Kaczanowski, Tomek

    2013-01-01

    This book explains in detail how to implement unit tests using two very popular open source Java technologies: JUnit and Mockito. It presents a range of techniques necessary to write high quality unit tests - e.g. mocks, parametrized tests and matchers. It also discusses trade-offs related to the choices we have to make when dealing with some real-life code issues. The book stresses the importance of writing readable and maintainable unit tests, and puts a lot of stress on code quality. It shows how to achieve testable code and to eliminate common mistakes by following the Test Driven Development approach. Every topic discussed in the book is illustrated with code examples, and each chapter is accompanied by some exercises. By reading this book you will: Grasp the role and purpose of unit tests Write high-quality, readable and maintainable unit tests Learn how to use JUnit and Mockito (but also other useful tools) Avoid common pitfalls when writing unit tests Recognize bad unit tests, a...

  14. CCEA as physics student unit guide unit 1 : forces, energy and electricity

    CERN Document Server

    Cosgrove, Ferguson

    2014-01-01

    Perfect for revision, these guides explain the unit requirements, summarise the content and include specimen questions with graded answers. Each full-colour New Edition Student Unit Guide provides ideal preparation for your unit exam:. - Feel confident you understand the unit: each guide comprehensively covers the unit content and includes topic summaries, knowledge check questions and a reference index. - Get to grips with the exam requirements: the specific skills on which you will be tested are explored and explained. - Analyse exam-style questions: graded student responses will help you fo

  15. A influência dos fatores familiares e escolares no processo saúde-doença da criança na primeira infância - DOI: 10.4025/actascihealthsci.v26i1.1681 Influence of family and school factors on child's health-illness process during infancy - DOI: 10.4025/actascihealthsci.v26i1.1681

    Directory of Open Access Journals (Sweden)

    Katiane Moisés de Lima

    2004-04-01

    Full Text Available Este estudo teve como objetivo identificar as situações de agravos à saúde das crianças, na primeira infância, no contexto familiar e escolar. Para a coleta de dados na escola, realizamos uma avaliação da criança quanto ao crescimento e aos agravos à saúde, e no contexto domiciliar, avaliamos 16 famílias quanto à estrutura familiar e ecomapa. Os principais problemas de saúde das crianças foram desnutrição e problemas de integridade da pele. A maioria das famílias era composta pelos casais e seus filhos. O número de cômodos era insuficiente para o número de pessoas que residiam no domicílio. Quanto à rede social de apoio, constatamos que as famílias procuraram as unidades de saúde e pessoas significativas para auxiliar nas situações de dificuldade. Sendo assim, verificamos a importância da Enfermagem apreender a realidade das famílias, como forma de se planejar práticas de educação em saúde, minimizando as situações de agravo à criança.This study aimed to identify situations potentially harmful to children's health during infancy in the familiar and school contexts. To gather the data in schools, an evaluation of the child's growth and health damages was performed; for the domestic context, 16 families were evaluated regarding familiar structure and genetic map. The main problems of the children's health were: malnutrition and skin integrity. Couples and their children composed most of the families. The number of rooms was insufficient for the number of people living in the home. Regarding the network of social aid, families searched public health units and particular people to aid in difficult situations. Thus, it became evident the importance of assessing the families’ reality to nursing, as a means of planning education practices in health, minimizing situations harmful to the child.

  16. Auto-exame das mamas: conhecimento e prática entre profissionais da área da saúde de uma instituição pública - DOI: 10.4025/actascihealthsci.v25i1.2304 Self-examination of breast: knowledge and practice in government health professionals - DOI: 10.4025/actascihealthsci.v25i1.2304

    Directory of Open Access Journals (Sweden)

    Sandra Marisa Pelloso

    2003-04-01

    Full Text Available O câncer de mama é ainda considerado um problema de saúde pública. No Brasil, é uma das principais causas de morte entre as mulheres. Por sua letalidade e seqüelas físicas e emocionais que acarreta, é de suma importância sua detecção precoce. Os meios eficazes de detecção precoce são a mamografia e o auto-exame de mama. O objetivo deste trabalho foi analisar o conhecimento das profissionais da área da saúde de uma instituição pública sobre seu conhecimento em relação ao auto-exame de mama. Caracterizou-se como estudo descritivo-exploratório. Foram entrevistadas 38 mulheres, perfazendo um total de 95,0% das profissionais. Os resultados revelaram que as profissionais, apesar de compreendem a importância do auto-exame, têm muitas dúvidas quanto à técnica. Desconhecem a época de realizá-lo e muitas vezes não o fazem. Recomenda-se curso de capacitação no sentido de envolver essas profissionais em ações preventivas e educativas em saúde.Breast cancer is a public health problem and one of the major causes of death among females in Brazil. Early diagnosis is of paramount importance due to its lethality coupled to severe physical and emotional consequences. X-ray of breast and self-examination of breast are the most efficient early diagnosis methods. Government health professionals’ knowledge on breast self-examination has been analyzed in current descriptive and exploratory research. Thirty-eight females, or 95% of the health professionals in the government unit, were interviewed. Results reveal that these professionals still have many doubts regarding that technique, although they are aware of the examination importance. They do not know the period in which it may be undertaken and frequently they leave the task undone. An updating course is recommended so that these health professionals may be involved in preventive and educational health activities.

  17. Composição química, digestibilidade e predição dos valores energéticos da farinha de carne e ossos para suínos - DOI: 10.4025/actascianimsci.v30i1.3597 Chemical Composition, Digestibility and Prediction of the Energy Values of Meat and Bone Meal for Swine - DOI: 10.4025/actascianimsci.v30i1.3597

    Directory of Open Access Journals (Sweden)

    Horácio Santiago Rostagno

    2008-06-01

    Full Text Available O objetivo do trabalho foi determinar a composição química e energética de seis diferentes farinhas de carne e ossos, bem como desenvolver equações de predição da energia digestível e metabolizável, com base na composição química dos alimentos. Foram utilizados 28 suínos, mestiços, machos castrados, com peso médio inicial de 25,90 ± 1,95 kg, distribuídos em delineamento experimental de blocos ao acaso, com sete tratamentos, quatro repetições e um animal por unidade experimental. Os tratamentos consistiram de uma ração-referência e seis diferentes farinhas de carne e ossos, que substituíram em 20% a ração-referência. Os valores de energia digestível e metabolizável variaram de 1.717 a 2.908 kcal kg-1 e de 1.519 a 2.608 kcal kg-1, respectivamente. As equações de predição da energia digestível e metabolizável que apresentaram maiores R2 para a farinha de carne e ossos foram: ED = 1.196,11 + 44,18 PB – 121,55 P e EM = 2.103,35 + 22,56 PB – 164,02 P.The objective of this study was to determine the chemical and energetic composition of six different meat and bone meals, and to develop prediction equations of digestible and metabolizable energy based on the chemical composition of the feeds. In order to determine the digestible and metabolizable energy values, 28 crossbreed swine were used – castrated males, averaging 25.90 ± 1.95 kg initial weight, allotted in a randomized block design with seven treatments, four replicates and one animal per experimental unit. The treatments consisted of a basal diet and six meat and bone meals, which replaced by 20% the basal diet. The digestible and metabolizable energy values varied from 1717 to 2908 kcal kg-1 and from 1519 to 2608 kcal kg-1, respectively. The prediction equation of digestible and metabolizable energy that presented the highest R2 for meat and bone meal were: DE = 1196.11 + 44.18 CP – 121.55 P and ME = 2103.35 + 22.56 CP – 164.02 P.

  18. Acute infantile motor unit disorder. Infantile botulism?

    Science.gov (United States)

    Clay, S A; Ramseyer, J C; Fishman, L S; Sedgwick, R P

    1977-04-01

    Eight infants with an acute reversible motor unit disorder are described, including two infants from whom Clostridum botulinum type A was isolated from stool specimens. The clinical spectrum includes constipation, cranial nerve deficits, pupillary involvement, and generalized hypotonic weakness. There were no deaths, and all infants have had complete clinical recovery. A characteristic electromyographic (EMG) pattern was present in part until clinical recovery. This distinctive pattern consisted of brief, small, abundant for power exerted motor unit potentials. This EMG pattern in the context of the clinical syndrome may well be diagnostic for acute infantile motor unit disorder.

  19. Power Efficient Division and Square Root Unit

    DEFF Research Database (Denmark)

    Liu, Wei; Nannarelli, Alberto

    2012-01-01

    shows that division and square root units based on the digit-recurrence algorithm offer the best tradeoff delay-area-power. Moreover, the two operations can be combined in a single unit. Here, we present a radix-16 combined division and square root unit obtained by overlapping two radix-4 stages......Although division and square root are not frequent operations, most processors implement them in hardware to not compromise the overall performance. Two classes of algorithms implement division or square root: digit-recurrence and multiplicative (e.g., Newton-Raphson) algorithms. Previous work...

  20. Electron accelerating unit for streak image tubes

    Indian Academy of Sciences (India)

    Fangke Zong; Qinlao Yang; Houzhi Cai; Li Gu; Xiang Li; Jingjin Zhang

    2015-12-01

    An electron accelerating unit is proposed for use in streak image tubes (SITs). An SIT with this new accelerating unit was simulated using the Monte Carlo method. The simulation results show that the accelerating unit improves both the spatial and temporal resolution. Compared to a traditional SIT, the transit time spread for electrons in the cathode-to-mesh region is reduced from 247 to 162 fs, the line width of the electron beam on the image surface is reduced from 42.7 to 26.1 m, and the temporal resolution is improved from 515 to 395 fs.

  1. Estimated United States Transportation Energy Use 2005

    Energy Technology Data Exchange (ETDEWEB)

    Smith, C A; Simon, A J; Belles, R D

    2011-11-09

    A flow chart depicting energy flow in the transportation sector of the United States economy in 2005 has been constructed from publicly available data and estimates of national energy use patterns. Approximately 31,000 trillion British Thermal Units (trBTUs) of energy were used throughout the United States in transportation activities. Vehicles used in these activities include automobiles, motorcycles, trucks, buses, airplanes, rail, and ships. The transportation sector is powered primarily by petroleum-derived fuels (gasoline, diesel and jet fuel). Biomass-derived fuels, electricity and natural gas-derived fuels are also used. The flow patterns represent a comprehensive systems view of energy used within the transportation sector.

  2. Unit Replacement System Analysis I (URSA I).

    Science.gov (United States)

    1982-01-01

    action creates a void in CONUS of one unit. A new unit is formed in CONUS to fill this void . The forming of a new unit is 3-5 -,.. - ..-- o. . CAA-SR-82...compares the observed average regimental strengths with the respective authorizations. Note the E-1 to E-4 and E-5 overfill and the E-6 to E-8 underfill ...When the data is adjusted to compensate for grade substitution flexibility (see Figure 6-26), the E-6 to E-8 underfill is corrected, but the

  3. Fatigue in Breakwater Concrete Armour Units

    DEFF Research Database (Denmark)

    Burcharth, Hans F.

    1985-01-01

    The reliability of rubble mound breakwaters depends on the hydraulic stability and the mechanical strength of the armour units. The paper deals with the important aspect of fatigue related to the strength of concrete armour units. Results showing significant fatigue from impact tests with Dolosse...... made of unreinforced and steel fibre reinforced flyash concrete are presented. Moreover universal graphs for fatigue in armour units made of conventional unreinforced concrete exposed to impact load and pulsating load are presented. The effect of fibre reinforcement and the implementation of fatigue...

  4. Delay Time Analysis of Reconfigurable Firewall Unit

    Directory of Open Access Journals (Sweden)

    Tomoaki Sato

    2012-10-01

    Full Text Available A firewall function is indispensable for mobile devices and it demands low-power operations. To realize this demand, the authors have developed a firewall unit with a reconfigurable device. The firewall unit needs a large amount of register for the timing adjustment of packets. Using the registers is the cause of power consumption. In this paper, to solve the problem of power consumption, the firewall unit has developed by using wave-pipelining technique and detailed delay time for the technique is analyzed.

  5. CRITICAL UNIT STREAM POWER FOR SEDIMENT TRANSPORT

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    Yang's (1996) sediment transport theory based on unit stream power is one of the most accurate theories, but in his equations the use of product of slope and critical velocity instead for critical unit stream power is not suitable. Dimensionless critical unit stream power required at incipient motion can be derived from the principle of conservation of power as a function of dimensionless particle diameter and relative roughness. Based on a lot of data sets, this new criterion was developed. By use of this new criteria, Yang's (1973) sand transport formula and his 1984 gravel transport formula could be improved when sediment concentration is less than about 100 ppm by weight.

  6. Analysis of Serbian Military Riverine Units Capability for Participation in the United Nations Peacekeeping Operations

    Directory of Open Access Journals (Sweden)

    Slobodan Radojevic

    2017-06-01

    Full Text Available This paper analyses required personnel, training capacities and equipment for participation in the United Nations peacekeeping operations with the riverine elements. In order to meet necessary capabilities for engagement in United Nations peacekeeping operations, Serbian military riverine units have to be compatible with the issued UN requirements. Serbian Armed Forces have the potential to reach such requirements with the River Flotilla as a pivot for the participation in UN missions. Serbian Military Academy adopted and developed educational and training program in accordance with the provisions and recommendations of the IMO conventions and IMO model courses. Serbian Military Academy has opportunities for education and training military riverine units for participation in the United Nations peacekeeping operations. Moreover, Serbia has Multinational Operations Training Center and Peacekeeping Operations Center certified to provide selection, training, equipping and preparations of individuals and units to the United Nations multinational operations.

  7. Does racism affect health? Evidence from the United States and the United Kingdom.

    Science.gov (United States)

    Muennig, Peter; Murphy, Michael

    2011-02-01

    Blacks have worse overall health than whites in both the United States and the United Kingdom. However, the relative difference in health between the two groups within each cultural context differs between each context. In this article, we attempt to glean insights into these health disparities. We do so by first examining what is currently known about differences in morbidity and mortality for blacks and whites in the United States and the United Kingdom. We then turn to medical examination data by race and country of birth in an attempt to further untangle the complex interplay of socioeconomic status (SES), race, and racism as determinants of health in the United States and the United Kingdom. We find that (1) longer exposure of blacks to the recipient country is a risk for mortality in the United States but not in the United Kingdom; (2) adjustment for SES matters a good deal for mortality in the United States, but less so in the United Kingdom; (3) morbidity indicators do not paint a clear picture of black disadvantage relative to whites in either context; and (4) were one to consider medical examination data alone, differences between the two groups exist only in the United States. Taken together, we conclude that it is possible that the "less racist" United Kingdom provides a healthier environment for blacks than the United States. However, there remain many mysteries that escape simple explanation. Our findings raise more questions than they answer, and the health risks and health status of blacks in the United States are much more complex than previously thought.

  8. United States Stateplane Zones - NAD27

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — U.S. State Plane Zones (NAD 1927) represents the State Plane Coordinate System (SPCS) Zones for the 1927 North American Datum within United States.

  9. 2010 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2010 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  10. Tax_Unit_Certification_Final_2012

    Data.gov (United States)

    Kansas Data Access and Support Center — The Statewide GIS Tax Unit boundary file was created through a collaborative partnership between the State of Kansas Department of Revenue Property Valuation...

  11. Tax_Units_Certification_2013_0301

    Data.gov (United States)

    Kansas Data Access and Support Center — The Statewide GIS Tax Unit boundary file was created through a collaborative partnership between the State of Kansas Department of Revenue Property Valuation...

  12. Sequential strokes in a hyperacute stroke unit.

    Science.gov (United States)

    Ganesalingam, Jeban; Buddha, Sandeep; Carlton-Jones, Anoma L; Nicholas, Richard

    2014-08-01

    Vasculitis is a rare, but treatable condition that can present to hyperacute stroke units. Thrombolysis does not treat the underlying pathology, and a rapidly evolving clinical picture drives clinical decision often before all the investigation results are available.

  13. United Nations and Other International Organizations.

    Science.gov (United States)

    Negaard, Chere; Van Fossen, Michael

    1993-01-01

    Presents an annotated bibliography of 124 items published by the United Nations and 12 other international organizations in 1992-93. Themes addressed include agriculture, development, poverty eradication, trade, privatization, peace, conflict resolution, women's equality, and health issues. (LRW)

  14. Mineral operations outside the United States

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Mineral facilities and operations outside the United States compiled by the National Minerals Information Center of the USGS. This representation combines source...

  15. United States Stateplane Zones - NAD83

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — U.S. State Plane Zones (NAD 1983) represents the State Plane Coordinate System (SPCS) Zones for the 1983 North American Datum within United States.

  16. Hanford Site Waste Management Units Report

    Energy Technology Data Exchange (ETDEWEB)

    Shearer, Jeffrey P. [Hanford Site (HNF), Richland, WA (United States)

    2014-02-19

    The Hanford Site Waste Management Units Report (HSWMUR) has been created to meet the requirements of the Tri-Party Agreement (TPA) Action Plan, Section 3.5, which states: “The Hanford Site Waste Management Units Report shall be generated, in a format agreed upon by the Parties, as a calendar year report and issued annually by the DOE by the end of February of each year, and posted electronically for regulator and public access. This report shall reflect all changes made in waste management unit status during the previous year.” This February 2013 version of the HSWMUR contains a comprehensive inventory of the 3438 sites and 569 subsites in the Waste Information Data System (WIDS). The information for each site contains a description of each unit and the waste it contains, where applicable. The WIDS database provides additional information concerning the sites contained in this report and is maintained with daily changes to these sites.

  17. Hanford Site Waste Management Units Report

    Energy Technology Data Exchange (ETDEWEB)

    Shearer, Jeffrey P. [Hanford Site (HNF), Richland, WA (United States)

    2012-02-29

    The Hanford Site Waste Management Units Report (HSWMUR) has been created to meet the requirements of the Tri-Party Agreement (TPA) Action Plan, Section 3.5, which states: “The Hanford Site Waste Management Units Report shall be generated, in a format agreed upon by the Parties, as a calendar year report and issued annually by the DOE by the end of February of each year, and posted electronically for regulator and public access. This report shall reflect all changes made in waste management unit status during the previous year.” This February 2012 version of the HSWMUR contains a comprehensive inventory of the 3389 sites and 540 subsites in the Waste Information Data System (WIDS). The information for each site contains a description of each unit and the waste it contains, where applicable. The WIDS database provides additional information concerning the sites contained in this report and is maintained with daily changes to these sites.

  18. Hanford Site Waste Management Units Report

    Energy Technology Data Exchange (ETDEWEB)

    Shearer, Jeffrey P. [Hanford Site (HNF), Richland, WA (United States)

    2013-02-13

    The Hanford Site Waste Management Units Report (HSWMUR) has been created to meet the requirements of the Tri-Party Agreement (TPA) Action Plan, Section 3.5, which states: “The Hanford Site Waste Management Units Report shall be generated, in a format agreed upon by the Parties, as a calendar year report and issued annually by the DOE by the end of February of each year, and posted electronically for regulator and public access. This report shall reflect all changes made in waste management unit status during the previous year.” This February 2013 version of the HSWMUR contains a comprehensive inventory of the 3427 sites and 564 subsites in the Waste Information Data System (WIDS). The information for each site contains a description of each unit and the waste it contains, where applicable. The WIDS database provides additional information concerning the sites contained in this report and is maintained with daily changes to these sites.

  19. ON DEVELOPING CLEANER ORGANIC UNIT PROCESSES

    Science.gov (United States)

    Organic waste products, potentially harmful to the human health and the environment, are primarily produced in the synthesis stage of manufacturing processes. Many such synthetic unit processes, such as halogenation, oxidation, alkylation, nitration, and sulfonation are common to...

  20. CNPC Exports Drilling Equipment to United States

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ Beijing Petroleum Machinery Plant(BPM) of CNPC and Rowan Drilling Company Inc, one of the most powerful drilling service and driller manufacturing companies in the United States signed a petroleum equipment contract on December 9 in Beijing.

  1. Rest Areas in the Western United States

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Rest areas in the western United States. Data was collected from various data sources including georeferenced locations obtained from other agencies, digitizied...

  2. United States Interagency Elevation Inventory (USIEI)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The U.S. Interagency Elevation Inventory displays high-accuracy topographic and bathymetric data for the United States and its territories. The project is a...

  3. Implementation of an Integrated Neuroscience Unit.

    Science.gov (United States)

    Breslin, Rory P; Franker, Lauren; Sterchi, Suzanne; Sani, Sepehr

    2016-02-01

    Many challenges exist in today's health care delivery system, and much focus and research are invested into ways to improve care with cost-effective measures. Specialty-specific dedicated care units are one solution for inpatient hospital care because they improve outcomes and decrease mortality. The neuroscience population encompasses a wide variety of diagnoses of spinal to cranial issues with a wide spectrum of needs varying from one patient to the next. Neuroscience care must be patient-specific during the course of frequent acuity changes, and one way to achieve this is through a neuroscience-focused unit. Few resources are available on how to implement this type of unit. Advanced practice nurses are committed to providing high-quality, safe, and cost-effective care and are instrumental in the success of instituting a unit dedicated to the care of neuroscience patients.

  4. Health, United States, 2012: Men's Health

    Science.gov (United States)

    ... Disparities Report Healthy People Older Americans Health Report Rural-Urban Chartbook NCHS Health, United States, 2015 - Men's Health ... Disparities Report Healthy People Older Americans Health Report Rural-Urban Chartbook File Formats Help: How do I view ...

  5. Agricultural Land in the Western United States

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Agricultural land cover for the western United States. This dataset was developed from Sagestitch, the Eastern Washington Shrubsteppe Mapping Project, and several...

  6. Hydrologic landscape regions of the United States

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Hydrologic landscape regions (HLRs) in the United States were delineated by using geographic information system (GIS) tools and statistical methods including...

  7. RF accelerating unit installed in the PSB

    CERN Multimedia

    1972-01-01

    RF accelerating unit installed in the PSB ring between two bending magnets. Cool air from a heat exchanger is injected into the four cavities from the central feeder and the hot air recirculated via the lateral ducts.

  8. The Grand Strategy of the United States

    Science.gov (United States)

    2014-10-01

    United States both militarily and by setting the terms of trade. While cultural and ideological affinities with European democra- cies played...military establishments (Japan, Russia, India, South Korea, Vietnam, Taiwan, Indonesia , Malaysia, Singapore) can check possible military expansion when

  9. TB in Children in the United States

    Science.gov (United States)

    ... in Children Treatment Vaccines Statistics Related Links TB in Children in the United States TB disease in children under ... person with infectious TB disease. Testing for TB in Children In the absence of symptoms, usually the ...

  10. Occurrence of naturally acetylated lignin units.

    Science.gov (United States)

    Del Río, José C; Marques, Gisela; Rencoret, Jorge; Martínez, Angel T; Gutiérrez, Ana

    2007-07-11

    This work examines the occurrence of native acetylated lignin in a large set of vascular plants, including both angiosperms and gymnosperms, by a modification of the so-called Derivatization Followed by Reductive Cleavage (DFRC) method. Acetylated lignin units were found in the milled wood lignins of all angiosperms selected for this study, including mono- and eudicotyledons, but were absent in the gymnosperms analyzed. In some plants (e.g., abaca, sisal, kenaf, or hornbeam), lignin acetylation occurred at a very high extent, exceeding 45% of the uncondensed (alkyl-aryl ether linked) syringyl lignin units. Acetylation was observed exclusively at the gamma-carbon of the lignin side chain and predominantly on syringyl units, although a predominance of acetylated guaiacyl over syringyl units was observed in some plants. In all cases, acetylation appears to occur at the monomer stage, and sinapyl and coniferyl acetates seem to behave as real lignin monomers participating in lignification.

  11. 2014 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2014 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  12. Death in the United States, 2011

    Science.gov (United States)

    ... Order from the National Technical Information Service NCHS Death in the United States, 2011 Recommend on Facebook ... 2011 SOURCE: National Vital Statistics System, Mortality. Do death rates vary by state? States experience different mortality ...

  13. Shuttle Kit Freezer Refrigeration Unit Conceptual Design

    Science.gov (United States)

    Copeland, R. J.

    1975-01-01

    The refrigerated food/medical sample storage compartment as a kit to the space shuttle orbiter is examined. To maintain the -10 F in the freezer kit, an active refrigeration unit is required, and an air cooled Stirling Cycle refrigerator was selected. The freezer kit contains two subsystems, the refrigeration unit, and the storage volume. The freezer must provide two basic capabilities in one unit. One requirement is to store 215 lbs of food which is consumed in a 30-day period by 7 people. The other requirement is to store 128.3 lbs of medical samples consisting of both urine and feces. The unit can be mounted on the lower deck of the shuttle cabin, and will occupy four standard payload module compartments on the forward bulkhead. The freezer contains four storage compartments.

  14. 2009 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2009 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  15. Ridgefield - Oak Release at the Carty Unit

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The proposed project will remove small diameter Doug-fir trees on 45 acres of the Carty Unit at Ridgefield NWR by cutting or girdling. Himalayan blackberry will also...

  16. 2011 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2011 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  17. 2012 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2012 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  18. Realistic Approach for Phasor Measurement Unit Placement

    DEFF Research Database (Denmark)

    Rather, Zakir Hussain; Chen, Zhe; Thøgersen, Paul

    2015-01-01

    This paper presents a realistic cost-effectivemodel for optimal placement of phasor measurement units (PMUs) for complete observability of a power system considering practical cost implications. The proposed model considers hidden or otherwise unaccounted practical costs involved in PMU...

  19. US Forest Service National Grassland Units

    Data.gov (United States)

    US Forest Service, Department of Agriculture — A map service on the www depicting National Grassland units designated by the Secretary of Agriculture and permanently held by the Department of Agriculture under...

  20. Terrestrial Ecosystems of the Conterminous United States

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The U.S. Geological Survey (USGS) modeled the distribution of terrestrial ecosystems for the contiguous United States using a standardized, deductive approach to...

  1. Anthropogenic Fragmentation in the western United States

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — We evaluated the fragmentation of the western United States by anthropogenic features. The addition of roads, railroads, and power lines to wildlands, and the...

  2. Waterborne Transportation Lines of the United States

    Science.gov (United States)

    1988-10-01

    JUNCTION Ny 12533 32! GANES TO0615 COMPANT 4419 OOLUARD DR. APT. O n SEA ORLEANS LU 70114 "I1 GEN A CACRICAL Cl. I QC EAST bALlET RIMD I A NE OP. TZO I I...1911 91I 339 9494090x. bay" , p. 0;.* 0019 I 9 ;’ 4010 00 7 96 31------- TAdtE - ALPNA& ETICA LIST OF TRANSPORTATION LINES- - - -. E4G. OPERATOR NAME A...200009 ".0! 19.9 I 00ISM00 9 Ss 0019 9644707 9 9 484 200.09 30.09 9.09 - 9 1500 14.99iON 9L6 GEN 1 9 9 9 9 9 200.01 00 9.9! 9 - 9 9 9 0RLEAN S8 5098

  3. Analysis of United States’ Broadband Policy

    Science.gov (United States)

    2007-03-01

    glass fiber. The light signals are then decoded at the end of the fiber by a special optic decoder /encoder. This allows for the light signal to be...CDMA technology while Cingular offers it through the HSDPA/ GSM technology. One quarter of the United States’ Internet users have a cell phone that...well Cingular 900 Kbps 100 Kbps $79.00 HSDPA/ GSM 1 yr contract Table 13. Unlimited Cellular Broadband Plans in the United States (From PCWorld.com

  4. The United Nations Peacekeeping Current Challenges

    Directory of Open Access Journals (Sweden)

    Yu P Spirin

    2010-12-01

    Full Text Available The article focuses on the problem of strengthening structures, potential and resources of the United Nations Secretariat forces, realizing peacekeeping activities of the Organization. The special attention is given to the «Brakhimi Group» as well as to the activities of the United Nations Security Council in the context of the search for effective peacekeeping activity of the Organization.

  5. Visible-Light Resin Curing Units.

    Science.gov (United States)

    1984-03-01

    Base, Texas, Vhen 4Qoenet. drawings, specification*, or other data are used for any purpoe. other than In connection with a definitely Governent-related...suplied, the said drawings, specifications, or other data , ise not to be regarded: ’by isplixatIon, or otherwise in may manner construed. as lics~ig...490 nm........ 51 18. Unit I: Prisma -Lite... .... ..... * ......... 0. ....... . .. . ... * 52 19. Unit I: Prisma -Lite--Wavelength distribution, with

  6. Nosocomial Infections in Neonatal Intensive Care Units

    OpenAIRE

    2013-01-01

    Neonates, especially prematures, requiring care in Intensive Care Unit are a highly vulnerable population group at increased risk for nosocomial infections. In recent decades become one of the leading causes of morbidity and mortality in the Neonatal Intensive Care Unit. Aim: Highlighting the severity of nosocomial infections for hospitalized infants and the imprinting of risk factors that affects their development. Material-Methods: Searched for studies published in international scientific ...

  7. Unit distances and diameters in Euclidean spaces

    CERN Document Server

    Swanepoel, Konrad J

    2007-01-01

    We show that the maximum number of unit distances or of diameters in a set of n points in d-dimensional Euclidean space is attained only by specific types of Lenz constructions, for all d >= 4 and n sufficiently large, depending on d. As a corollary we determine the exact maximum number of unit distances for all even d >= 6, and the exact maximum number of diameters for all d >= 4, for all $n$ sufficiently large, depending on d.

  8. UNESCOsat: The United Nations’ First Satellite

    OpenAIRE

    Platt, Donald

    2010-01-01

    An international effort is underway to produce the first satellite in the history of the United Nations. The idea of the preparation and launch, with the endorsement of the UNESCO branch of the United Nations, of an international satellite to promote science education, public awareness of science, and international co-operation in the basic sciences, was presented by the National Commission of the Russian Federation for UNESCO to the UNESCO basic sciences committee. The General Conference of ...

  9. Generating Large Unit Staffs during Wartime Mobilization

    Science.gov (United States)

    2013-12-10

    Graham Cosmas, An Army for Empire: The United States Army in the Spanish-American War (Columbia, MO: University of Missouri Press, 1971), 195. 76 Ibid...100 Keast, The Procurement and Branch Distribution of Officers, 1. 101 Kent Greenfield, Robert Palmer, and Bell Wiley, The Army Ground Forces...A Gallant Little Army: The Mexico City Campaign, 84-85. 154 Graham Cosmas, An Army for Empire: The United States Army in the Spanish-American War

  10. Qatar Peninsula, United Arab Emirates, Persian Gulf

    Science.gov (United States)

    1983-01-01

    In this view of the Qatar Peninsula, United Arab Emirates, Persian Gulf, (25.0N, 51.0E) a large oil spill, seen as a large dark toned mass in the water covers much of the surface of the western Persian Gulf. Qatar is one of several of the oil rich United Arab Emirate states. Oil spills and oil pollution of the environment are common occurrances associated with oil tanker loading operations.

  11. United Airlines Makes Gonnections Easier for Passengers

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    @@ United is the only U.S. Carrier connecting Pearl River Delta Region to offer customers SkyPier ferry service and pier-side check-in. United Airlines is the first U.S. Airline to offer customers convenient travel between the Pearl River Delta cities and Hong Kong International Airport using the SkyPier ferry service and pier-side check-in, beginning today.

  12. Non-linear Loudspeaker Unit Modelling

    DEFF Research Database (Denmark)

    Pedersen, Bo Rohde; Agerkvist, Finn T.

    2008-01-01

    Simulations of a 6½-inch loudspeaker unit are performed and compared with a displacement measurement. The non-linear loudspeaker model is based on the major nonlinear functions and expanded with time-varying suspension behaviour and flux modulation. The results are presented with FFT plots of three...... frequencies and different displacement levels. The model errors are discussed and analysed including a test with loudspeaker unit where the diaphragm is removed....

  13. Stresses in Dolos Breakwater Armour Units

    DEFF Research Database (Denmark)

    Burcharth, H. F.; Liu, Z.

    1991-01-01

    Breakage of slender unreinforced armour unite is the cause of many breakwater failures. Design diagrams to ensure structural integrity of armour unite such as dolosse and tetrapods have not been available. The article presents results of an analysis of the stresses in dolosse based on model tests...... with load-cell instrumented dolosse with masses of 200 kg and 200 g. A preliminary design diagram is presented as well....

  14. Party Formation in the United States

    OpenAIRE

    2013-01-01

    This dissertation is about how political parties formed in the world's first mass democracy, the United States. I trace the process of party formation from the bottom up. First, I ask: How do individuals become engaged in politics and develop political affiliations? In most states, throughout the antebellum era, the county was the primary unit of political administration and electoral representation. Owing to their small size, contiguity, and economic homogeneity, I expect that each county's ...

  15. 31 CFR 560.314 - United States person.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States person. 560.314 Section... § 560.314 United States person. The term United States person means any United States citizen, permanent resident alien, entity organized under the laws of the United States (including foreign branches), or...

  16. 31 CFR 596.313 - United States person.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States person. 596.313 Section... General Definitions § 596.313 United States person. The term United States person means any United States... States, or any person in the United States....

  17. Integrated and Applied Curriculum: Six School-to-Work Units.

    Science.gov (United States)

    Lo Guidice, Tom, Comp.

    This publication consists of six units for middle and high school grades that incorporate school-to-work (STW). The six units were developed by six practicing teachers. The first unit, "Wellness: An Integrated Unit with STW Emphasis for Seventh Grade" (Sara Hellenbrand), provides STW objectives and a list of activities. The second unit,…

  18. International boundary experiences by the United Nations

    Science.gov (United States)

    Kagawa, A.

    2013-12-01

    Over the last few decades, the United Nations (UN) has been approached by Security Council and Member States on international boundary issues. The United Nations regards the adequate delimitation and demarcation of international boundaries as a very important element for the maintenance of peace and security in fragile post-conflict situations, establishment of friendly relationships and cross-border cooperation between States. This paper will present the main principles and framework the United Nations applies to support the process of international boundary delimitation and demarcation activities. The United Nations is involved in international boundary issues following the principle of impartiality and neutrality and its role as mediator. Since international boundary issues are multi-faceted, a range of expertise is required and the United Nations Secretariat is in a good position to provide diverse expertise within the multiple departments. Expertise in different departments ranging from legal, political, technical, administrative and logistical are mobilised in different ways to provide support to Member States depending on their specific needs. This presentation aims to highlight some of the international boundary projects that the United Nations Cartographic Section has been involved in order to provide the technical support to different boundary requirements as each international boundary issue requires specific focus and attention whether it be in preparation, delimitation, demarcation or management. Increasingly, the United Nations is leveraging geospatial technology to facilitate boundary delimitation and demarcation process between Member States. Through the presentation of the various case studies ranging from Iraq - Kuwait, Israel - Lebanon (Blue Line), Eritrea - Ethiopia, Cyprus (Green Line), Cameroon - Nigeria, Sudan - South Sudan, it will illustrate how geospatial technology is increasingly used to carry out the support. In having applied a range

  19. Predação de pós-larvas de curimba (Prochilodus lineatus, Valenciennes, 1836 por larvas de Odonata (Pantala, Fabricius, 1798 em diferentes tamanhos - DOI: 10.4025/actascibiolsci.v25i1.2105 Predation of Prochilodus lineatus (Valenciennes, 1836 post-larvae by dragonfly (Pantala Fabricius, 1978 fry in different development phases - DOI: 10.4025/actascibiolsci.v25i1.2105

    Directory of Open Access Journals (Sweden)

    Carmino Hayashi

    2003-04-01

    experimental unit. The P. lineatus post-larvae (Lt: 6.20±0.22 mm and Wt: 0.91 mg. 15 P. lineatus post-larvae were distributed in each aquarium (18:00h, each three- hour-interval (21.00, 0.00, 3.00, 6.00, 9.00, 12.00, 15.00 e 18.00h, the live post-larvae were counted and the dead ones were replaced. The physical and chemical parameters pH, dissolved oxygen, electric conductivity and temperature was measured in the beginning and in the end of the experiment, the average values of these ones were 7.83±1.11, 6.57±1.23 mg/L, 212.71±3.93 µS/cm and 27.19±0.27ºC, respectively. A quadratic effect of the dragonfly fry size on the total number of P. lineatus post-larvae eaten with maximum point with dragonfly larvae of 24.46mm. was observed. And a decrease in the number of post larvae eaten in time of the experimental period was also observed. It may be concluded that there was an increase in the number of P. lineatus post-larvae eaten with a size increase of dragonfly fry

  20. The Units Ontology: a tool for integrating units of measurement in science.

    Science.gov (United States)

    Gkoutos, Georgios V; Schofield, Paul N; Hoehndorf, Robert

    2012-01-01

    Units are basic scientific tools that render meaning to numerical data. Their standardization and formalization caters for the report, exchange, process, reproducibility and integration of quantitative measurements. Ontologies are means that facilitate the integration of data and knowledge allowing interoperability and semantic information processing between diverse biomedical resources and domains. Here, we present the Units Ontology (UO), an ontology currently being used in many scientific resources for the standardized description of units of measurements.

  1. Challenges encountered by critical care unit managers in the large intensive care units

    Directory of Open Access Journals (Sweden)

    Mokgadi C. Matlakala

    2014-02-01

    Full Text Available Background: Nurses in intensive care units (ICUs are exposed regularly to huge demands interms of fulfilling the many roles that are placed upon them. Unit managers, in particular, are responsible for the efficient management of the units and have the responsibilities of planning, organising, leading and controlling the daily activities in order to facilitate the achievement of the unit objectives.Objectives: The objective of this study was to explore and present the challenges encountered by ICU managers in the management of large ICUs.Method: A qualitative, exploratory and descriptive study was conducted at five hospital ICUs in Gauteng province, South Africa. Data were collected through individual interviews from purposively-selected critical care unit managers, then analysed using the matic coding.Results: Five themes emerged from the data: challenges related to the layout and structure of the unit, human resources provision and staffing, provision of material resources, stressors in the unit and visitors in the ICU.Conclusion: Unit managers in large ICUs face multifaceted challenges which include the demand for efficient and sufficient specialised nurses; lack of or inadequate equipment that goes along with technology in ICU and supplies; and stressors in the ICU that limit the efficiency to plan, organise, lead and control the daily activities in the unit. The challenges identified call for multiple strategies to assist in the efficient management of large ICUs.

  2. A comparison of commercial auditory evoked potential units: the midpriced and luxury units.

    Science.gov (United States)

    Ferraro, J A; Ruth, R R

    1990-05-01

    This report represents the second of two providing a consumer-oriented comparison of commercially available auditory evoked potential units. The units compared here were those whose basic price was between $10,000-$30,000 ("midpriced"), and greater than $30,000 ("luxury"). The midpriced group included the Amplaid MK15, Bio-Logic Navigator and Traveler LT, Cadwell 5200A and Quantum 84, GSI-50, Nicolet CA-2000 and Compact Auditory, Nihon-Kohden Neuropak IV Mini, Madsen ERA2250, Siegen (Dantec) Neuroscope, and Tracor Nomad. The luxury units comprised the Bio-Logic Brain Atlas, Cadwell Spectrum 32 and Nicolet Pathfinder. Descriptive information and the names and addresses of users were solicited from the manufacturers for each of the above units. Questionnaires were sent to the users asking them for information on how their unit was used and to rate some of its features. The midpriced and luxury units offer more flexibility and options than less expensive (i.e., "economy") units. However, the basis for a given unit's price versus another's was not always apparent by a comparison of features or options. In general, users of the midpriced and luxury units rated the majority of their instruments' features highly. The lowest ratings were received for some aspect of the printer or print-out, and portability.

  3. Graviton as a Grand United Gauge Boson

    Science.gov (United States)

    Sharafiddinov, Rasulkhozha S.

    2015-04-01

    To any type of charge corresponds a kind of inertial mass. Such a mass-charge duality explains the availability in the neutrino of the naturally united rest mass and charge equal to all its mass and charge consisting of the electric, weak, strong and a range of other the innate components. From their point of view, we discuss a new theory of a grand unification. In this theory, the gravitational field is a naturally united field of the unified system of the most diverse combinations of the electric photons, magnetic monophotons, weak bosons and the strong gluons where the four pairs of forces of a different nature are united. Some consequences and laboratory confirmations of the discussed theory have been listed, in which graviton is predicted as a grand united gauge boson. Therefore, the gravitons constitute a natural light testifying in favor of gravitational force. They show that to each type of light corresponds a kind of force. Thereby, the suggested field theory that unites all gauge bosons in gravitons gives the possibility to directly look on the nature of gravitational matter elucidating the interratio of intragraviton forces and the problem of elementary particle fundamental symmetries.

  4. Ectopic folliculosebaceous units at the coronal sulcus.

    Science.gov (United States)

    Fernandez-Flores, Angel

    2014-12-01

    Tyson glands were described in the 17th century as modified sebaceous glands of the coronal sulcus of the penis. However, this description and other early texts supporting the existence of Tyson glands were not accompanied by illustrations. The existence of such glands has been passing through the literature without adequate graphical demonstration, which has contributed to controversial debates. Herein we present a case of a partial penectomy performed on a 65-year-old man with a squamous cell carcinoma of the penis. In this case we identified sebaceous glands as well as folliculosebaceous units in the coronal sulcus. We also comparatively examined 12 cases of partial penectomy to search for sebaceous glands or folliculosebaceous units in the coronal sulcus or the preputium. We found neither sebaceous glands nor folliculosebaceous units at the coronal sulcus or the mucosal aspect of the prepuce. We conclude that: (1) folliculosebaceous units are possible in the coronal sulcus, as the current case illustrates for the first time in literature and (2) the current case is an oddity, probably induced by the accompanying squamous cell carcinoma, and therefore it may represent an ectopic folliculosebaceous unit rather than an anatomic variation.

  5. Low resource ventilation unit; Ressourcebesparende ventilationsenhed

    Energy Technology Data Exchange (ETDEWEB)

    Drivsholm, C.

    2012-03-15

    In the project a resource-saving ventilation device was developed which is based on the use of a regenerator and a reversible air flow. The regenerator is placed in the building envelope, and the concept works in the way that the heat in the air during ventilation is stored in the regenerator and brought back into the building by a reversible air change. The heated air is blown from inside the building out through the regenerator. In this way the regenerator accumulates the heat in the air. Over a period of 30-120 seconds, the regenerator capacity is utilized. When the regenerator cannot be further heated, the air flow is reversed and there is now blown cold air through the regenerator. Thereby the heat from the regenerator is released to the cold fresh air. Thus, the fresh air brings heat back into the building, whereby the air is replaced with a limited heat loss. Ventilation with a regenerator is described as micro-ventilation. The developed micro-ventilation unit was tested by the Danish Technological Institute. The test results shows that the unit performs according to expectations: 1) The heat recovery is 85%; 2) The flow through the unit is 80m3 per hour in a 5 section unit; 3) The noise level is 30 db(A) in a representative room; 4) The energy consumption is <300 J/m3. The unit is introduced into the market, and the first plants have been sold. (LN)

  6. Curing efficiency of modern LED units.

    Science.gov (United States)

    Rencz, Adam; Hickel, Reinhard; Ilie, Nicoleta

    2012-02-01

    Recent reports claim that modern light-emitting diode (LED) curing units improve curing efficiency by increasing the units' irradiance. In this context also, short polymerisation times up to 5 s are proposed. The aim of this study was to examine whether there are differences in the curing efficiency of modern LED curing units by assessing their effect on two different composite materials and by varying the irradiation time. A nano- and a micro-hybrid resin-based composite (RBC) were polymerised for 5, 10 and 20 s with three commercial and a Prototype LED unit (Elipar™ S10). Cylindrical specimens (6 mm in depth, 4 mm in diameter) were prepared in three increments, each 2-mm thick, and were consecutively cured. Degree of cure was measured for 20 min in real time at the bottom of the samples, starting with the photoinitiation. The micro-mechanical properties (modulus of elasticity, E and Vickers hardness, HV) were measured as a function of depth, in 100-μm steps, on the above described samples stored in distilled water for 24 h at 37°C. Data were analysed with multivariate ANOVA followed by Tukey's test, t test and partial eta-squared statistics. In descending order of the strength of their effect, the type of RBC, depth, polymerisation time and curing unit were significant factors affecting the micro-mechanical parameters (p surface, a minimum of 20 s of irradiation is necessary for an adequate polymerisation 2 mm beyond the surface.

  7. Simulation training for hyperacute stroke unit nurses.

    Science.gov (United States)

    Roots, Angela; Thomas, Libby; Jaye, Peter; Birns, Jonathan

    National clinical guidelines have emphasized the need to identify acute stroke as a clinical priority for early assessment and treatment of patients on hyperacute stroke units. Nurses working on hyperacute stroke units require stroke specialist training and development of competencies in dealing with neurological emergencies and working in multidisciplinary teams. Educational theory suggests that experiential learning with colleagues in real-life settings may provide transferable results to the workplace with improved performance. Simulation training has been shown to deliver situational training without compromising patient safety and has been shown to improve both technical and non-technical skills (McGaghie et al, 2010). This article describes the role that simulation training may play for nurses working on hyperacute stroke units explaining the modalities available and the educational potential. The article also outlines the development of a pilot course involving directly relevant clinical scenarios for hyperacute stroke unit patient care and assesses the benefits of simulation training for hyperacute stroke unit nurses, in terms of clinical performance and non-clinical abilities including leadership and communication.

  8. Is water in dental units microbiologically safe?

    Directory of Open Access Journals (Sweden)

    Michał Michałkiewicz

    2015-12-01

    Full Text Available Background: Water supplied to the dental units must be of sufficient quality. The article presents the results of the microbiological analysis of cold municipal water which flows into a patient’s disposable mouthwash cup, and demineralized water which flows through a waterline into the tool panel of a dental unit from the tank placed in the water group. Material and Methods: In order to assess the degree of purity (impurities of water used in dental units, 2 series of microbiological tests were carried out in 6 dental surgeries from April to June, 2013. The water samples for microbiological testing were collected into sterile microbiological bottles in accordance with the current methodology. The water for the tests was collected from a sterile cup-filling tap (municipal water and from an air/water syringe (demineralized water. The bacteria were cultured according to the Polish Standards – PN-EN ISO 6222, PN-EN ISO 9308-1, and PN-EN ISO 16266. Results: In the tested samples of water numerous psychrophilic bacteria (max 29 100 CFU/ml and mesophilic bacteria (max 24 700 CFU/ml, including single coliforms, were found. Conclusions: The results show that water delivered to a dental unit should be periodically tested bacteriologically and in terms of physical and chemical properties. Water systems of dental units should also be periodically disinfected to eliminate bacteria and biofilm. Med Pr 2015;66(6:763–770

  9. Stepwise redefinition of the SI base units

    CERN Document Server

    Issaev, L K; Khruschov, V V

    2012-01-01

    The four SI base units are proposed to be redefined in two stages: first, the kilogram, mole and ampere should be defined, and then the kelvin. To realize the redefinition of a base unit of the SI in terms of fundamental physical constant (FPC), a principle of coincidence of their physical dimensions is put forward. Direct applying this principle will lead to the changing of the sets of base and derived units in the new SI. If we want to preserve the continuity of the division between base and derived units in the new and the current SI, the principle is to be generalized with the time dimension factor be included. The status of the mole as the base unit of measurement is considered in the current and new SI. It is proposed to redefine the kilogram using a fixed value of the Avogadro constant and then to redefine the kelvin, after the measurement accuracy of the Boltzmann constant has been increased and agreed with the values of other constants of molecular physics.

  10. Antenna unit and radio base station therewith

    Science.gov (United States)

    Kuwahara, Mikio; Doi, Nobukazu; Suzuki, Toshiro; Ishida, Yuji; Inoue, Takashi; Niida, Sumaru

    2007-04-10

    Phase and amplitude deviations, which are generated, for example, by cables connecting an array antenna of a CDMA base station and the base station, are calibrated in the baseband. The base station comprises: an antenna apparatus 1; couplers 2; an RF unit 3 that converts a receive signal to a baseband signal, converts a transmit signal to a radio frequency, and performs power control; an A/D converter 4 for converting a receive signal to a digital signal; a receive beam form unit 6 that multiplies the receive signal by semi-fixed weight; a despreader 7 for this signal input; a time-space demodulator 8 for demodulating user data; a despreader 9 for probe signal; a space modulator 14 for user data; a spreader 13 for user signal; a channel combiner 12; a Tx calibrater 11 for controlling calibration of a signal; a D/A converter 10; a unit 16 for calculation of correlation matrix for generating a probe signal used for controlling an Rx calibration system and a TX calibration system; a spreader 17 for probe signal; a power control unit 18; a D/A converter 19; an RF unit 20 for probe signal; an A/D converter 21 for signal from the couplers 2; and a despreader 22.

  11. NIC atomic operation unit with caching and bandwidth mitigation

    Science.gov (United States)

    Hemmert, Karl Scott; Underwood, Keith D.; Levenhagen, Michael J.

    2016-03-01

    A network interface controller atomic operation unit and a network interface control method comprising, in an atomic operation unit of a network interface controller, using a write-through cache and employing a rate-limiting functional unit.

  12. Computational unit for non-contact photonic system

    Science.gov (United States)

    Kochetov, Alexander V.; Skrylev, Pavel A.

    2005-06-01

    Requirements to the unified computational unit for non-contact photonic system have been formulated. Estimation of central processing unit performance and required memory size are calculated. Specialized microcontroller optimal to use as central processing unit has been selected. Memory chip types are determinated for system. The computational unit consists of central processing unit based on selected microcontroller, NVRAM memory, receiving circuit, SDRAM memory, control and power circuits. It functions, as performing unit that calculates required parameters ofrail track.

  13. Eccentric Pumping Unit: Cost-effective and Reliable

    Institute of Scientific and Technical Information of China (English)

    Zhang Shaobo; Gao Heping; Chen Yibao; Shi Linsong; Zhang Huiwen

    1996-01-01

    @@ The beam-type pumping unit is the most widely used ty pe of pumping unit because of its simple geometry and its reliability. However. when its stroke exceeds five meters, the structure of the unit becomes massive and its cost becomes quite high. In order to make full use of the advantages of the beam pumping unit and to enhance its stroke. a new type of pumping unit - the ECCENTRIC PUMPING UNIT - has been designed after two years of the research work.

  14. INTERNET CONNECTIVITY FOR MASS PRODUCED UNITS WITHOUT USER INTERFACE

    DEFF Research Database (Denmark)

    2000-01-01

    To the manufacturer of mass produced units without a user interface, typically field level units, connection of these units to a communications network for enabling servicing, control and trackability is of interest. To provide this connection, a solution is described in which an interface...... comprising an ASIC is built into a mass produced unit, whereby the ASIC is incorporating selected portions of selected layers of the Internet Protocol. The mass produced unit is then allocated a unit address....

  15. Inexpensive Instruments for a Sound Unit

    Science.gov (United States)

    Brazzle, Bob

    2011-04-01

    My unit on sound and waves is embedded within a long-term project in which my high school students construct a musical instrument out of common materials. The unit culminates with a performance assessment: students play the first four measures of "Somewhere Over the Rainbow"—chosen because of the octave interval of the first two notes—in the key of C, and write a short paper describing the theory underlying their instrument. My students have done this project for the past three years, and it continues to evolve. This year I added new instructional materials that I developed using a freeware program called Audacity. This software is very intuitive, and my students used it to develop their musical instruments. In this paper I will describe some of the inexpensive instructional materials in my sound unit, and how they fit with my learning goals.

  16. Insuring unit failures in electricity markets

    Energy Technology Data Exchange (ETDEWEB)

    Pineda, S.; Conejo, A.J.; Carrion, M. [Univ. Castilla-La Mancha (Spain)

    2010-11-15

    An electric energy producer participates in futures markets in the hope of hedging the risk of trading in the pool. However, this producer is required to supply the energy associated with all its signed forward contracts even if some of its units are forced out due to unexpected failures. In this case, the producer must purchase some of the energy needed to meet its futures market commitments in the pool, which may result in high losses if the pool prices happen to be higher than the forward contract prices. To mitigate these losses, the producer can take out insurance against the forced outages of its units. Using a stochastic programming model, this paper analyzes the convenience of signing an insurance against unit failure by an electric energy producer and its impact on forward contracting decisions. Results from a realistic case study are provided and analyzed. (author)

  17. Ambient Cured Alkali Activated Flyash Masonry Units

    Science.gov (United States)

    Venugopal, K.; Radhakrishna; Sasalatti, Vinod M.

    2016-09-01

    Geopolymers belong to a category of non-conventional and non-Portland cement based cementitious binders which are produced using industrial by products like fly ash and ground granulated blast furnace slag (GGBFS). This paper reports on the development of geopolymer mortars for production of masonry units. The geopolymer mortars were prepared by mixing various by products with manufactured sand and a liquid mixture of sodium silicate and sodium hydroxide solutions. After curing at ambient conditions, the masonry units were tested for strength properties such as water absorption, initial rate of absorption, compression, shear- bond, and stress-strain behaviour etc. It was observed that the flexural strength of the blocks is more than 2 MPa and shear bond strength is more than 0.4MPa. It was found that the properties of geopolymer blocks were superior to the traditional masonry units. Hence they can be recommended for structural masonry.

  18. Transformations of units and world's geometry

    CERN Document Server

    Quirós, I

    2000-01-01

    The issue of the transformations of units is treated, mainly, in a geometrical context. Spacetime singularities are shown to be a consequence of a wrong choice of the geometrical formulation of the laws of gravitation. This result is discussed, in particular, for Friedmann-Robertson-Walker cosmology. It is also shown that Weyl geometry is a consistent framework for the formulation of the gravitational laws since the basic laws on which this geometry rests are invariant under the one-parameter Abelian group of units transformations studied in the paper. Riemann geometry does not fulfill this requirement. Arguments are given that point at Weyl geometry as a geometry implicitly containing the quantum effects of matter. The notion of geometrical relativity is presented. This notion may represent a natural extension of general relativity to include invariance under the group of units transformations.

  19. Understanding human trafficking in the United States.

    Science.gov (United States)

    Logan, T K; Walker, Robert; Hunt, Gretchen

    2009-01-01

    The topic of modern-day slavery or human trafficking has received increased media and national attention. However, to date there has been limited research on the nature and scope of human trafficking in the United States. This article describes and synthesizes nine reports that assess the U.S. service organizations' legal representative knowledge of, and experience with, human trafficking cases, as well as information from actual cases and media reports. This article has five main goals: (a) to define what human trafficking is, and is not; (b) to describe factors identified as contributing to vulnerability to being trafficked and keeping a person entrapped in the situation; (c) to examine how the crime of human trafficking differs from other kinds of crimes in the United States; (d) to explore how human trafficking victims are identified; and, (e) to provide recommendations to better address human trafficking in the United States.

  20. Following Zhang Wenjin to the United States

    Institute of Scientific and Technical Information of China (English)

    1997-01-01

    In 1937,Zhang Ying studied at the Lu Xun Art Institute in Yan’an.After graduation she began working in the art world under Zhou Enlai’s direction.In 1983, she followed her husband Zhang Wenjin to the United States as wife of the ambassador.During her two-year stay in the U.S., she came into close contact with many American women while working to promote mutual understanding and friendship between the people of the two countries.After her retirement in 1991,she sponsored the production of a 10-episode documentary TV program,"Zhou Enlai and the Arts."She also wrote a book about her experience in the United States,Called,Following Zhang Wenjin to the United States—Notes of an Ambassador’s Wife.The following are extracts from the book.