WorldWideScience

Sample records for unit aiken sc

  1. University of South Carolina Aiken Biofuels Laboratory in Aiken, SC

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Garriet W. [Univ. of South Carolina, Aiken, SC (United States)

    2017-02-17

    Biological production of hydrogen has been investigated over the past 30 years with the ultimate goal of providing a clean, carbon-neutral fuel. However, based on an extensive literature search and the recommendations of several recent DOE- and DOD-sponsored expert review panels it is obvious that an important element of this research has been largely overlooked - the physiology and diversity of naturally occurring, H2-producing bacteria. The main objective of this project was to develop a technique to extensively screen nitrogen fixing bacteria isolated from unique environments suspected of H2 production. Those showing H2-producing activity were tested on latex based mats, which could provide active centers of fuel cells. Specific objectives of the project were to establish a biofuels laboratory at the Aiken County Center for Hydrogen Research, where the following activities were persued.1) Develop a semi-automated apparatus to screen hundreds of bacteria in a short time; 2) Identify bacteria capable of producing hydrogen at rates sufficiently high to power a fuel cell. 3) Embed specific bacteria with high hydrogen production potentials into latex mats that can be incorporated in fuel cells applicable to a variety of industrial settings. During this project we developed screening techniques which include colorimetric and gas chromatographic assays for hydrogen production by bacterial isolates. Isolates were characterized both metabolically and genetically and preserved for future use. Isolates found to produce significant amounts of hydrogen were screened for activity under various environments. Potential isolates were then embedded in latex coatings and assayed for hydrogen production under different environmental conditions

  2. University of South Carolina Aiken Biofuels Laboratory in Aiken, SC

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Garriet W. [Univ. of South Carolina, Aiken, SC (United States); Piskorska, Magdalena [Univ. of South Carolina, Aiken, SC (United States)

    2014-10-30

    Biological production of hydrogen has been investigated over the past 30 years with the ultimate goal of providing a clean, carbon-neutral fuel. However, based on an extensive literature search and the recommendations of several recent DOE- and DOD-sponsored expert review panels it is obvious that an important element of this research has been largely overlooked - the physiology and diversity of naturally occurring, H2-producing bacteria. The main objective of this project was to develop a technique to extensively screen nitrogen fixing bacteria isolated from unique environments suspected of H2 production. Those showing H2-producing activity were tested on latex based mats, which could provide active centers of fuel cells. Specific objectives of the project were to establish a biofuels laboratory at the Aiken County Center for Hydrogen Research, where the following activities were persued.1) Develop a semi-automated apparatus to screen hundreds of bacteria in a short time; 2) Identify bacteria capable of producing hydrogen at rates sufficiently high to power a fuel cell. 3) Embed specific bacteria with high hydrogen production potentials into latex mats that can be incorporated in fuel cells applicable to a variety of industrial settings. During this project we developed screening techniques which include colorimetric and gas chromatographic assays for hydrogen production by bacterial isolates. Isolates were characterized both metabolically and genetically and preserved for future use. Isolates found to produce significant amounts of hydrogen were screened for activity under various environments. Potential isolates were then embedded in latex coatings and assayed for hydrogen production under different environmental conditions

  3. 77 FR 68886 - Aiken Railway Company, LLC-Lease and Operation Exemption-Lines of Norfolk Southern Railway...

    Science.gov (United States)

    2012-11-16

    ... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [Docket No. FD 35665] Aiken Railway Company, LLC--Lease and Operation Exemption--Lines of Norfolk Southern Railway Company in Aiken County, SC On October 31, 2012, Aiken Railway Company, LLC (AIKR), a noncarrier, filed a verified notice of...

  4. 2012 South Carolina DNR Lidar: Aiken County

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towill Inc. collected LiDAR for over 3,300 square miles in Calhoun, Aiken, Barnwell, Edgefield, McCormick, and Abbeville counties in South Carolina. This metadata...

  5. Police as contributors to Healthy Communities: Aiken, South Carolina.

    OpenAIRE

    Frommer, P; Papouchado, K

    2000-01-01

    In Aiken, South Carolina, community policing has led to numerous innovative programs that have contributed to a healthy community. The MOMS and COPS (Managing Our Maternity System with Community Oriented Policing System) program has played a significant part in the county's 50% decrease in infant mortality since 1989 and contributed to Aiken's designation as an All-America City in 1997. Other programs include a mentoring program for at-risk teen girls; instant crime reporting with donated cel...

  6. Aiken for armageddon: The Savannah River Site and Aiken, SC, 1950-1955. Master`s thesis

    Energy Technology Data Exchange (ETDEWEB)

    Turner, J.S.

    1998-01-30

    Constructed between November 1950 and March 1955, the Savannah River Site (SRS) nuclear production facility was a product of the Cold War and its accompanying arms race. The first Soviet atomic detonation in 1949 shook the foundations of American Cold War diplomacy. Although the diplomatic situation with the Soviets had never been amicable since the end of World War 2, the atomic bomb had provided a psychological edge for American policy makers. Worried about the military balance of power in the aftermath of the unanticipated Soviet test, President Harry S. Truman authorized research for construction of a hydrogen or fusion weapon. The program required a new nuclear weapons facility to produce the hydrogen isotope tritium in sufficient quantities to create a large stockpile of fusion weapons.

  7. Interview with a quality leader. Linda Aiken on the healthcare industry and workplace issues. Interview by Susan V. White and Colleen J. Hewes.

    Science.gov (United States)

    Aiken, Linda

    2003-01-01

    Linda Aiken, PhD MSN, is director of the Center for Health Outcomes and Policy Research and The Claire M. Fagin Leadership Professor of Nursing and Professor of Sociology at the University of Pennsylvania in Philadelphia. Dr. Aiken's other appointments at the University of Pennsylvania include senior fellow at the Leonard Davis Institute for Health Economics and research associate in the Population Studies Center. Before joining the University of Pennsylvania faculty in 1988, Dr. Aiken served as vice president of the Robert Wood Johnson Foundation. She is a member of the Institute of Medicine, a fellow of the American Academy of Arts and Sciences and of the National Academy of Social Insurance, a former president of the American Academy of Nursing, a distinguished fellow of the Academy for Health Services Research and Health Policy (now AcademyHealth), and a member of the Council on the Economic Impact of Health System Change. Dr. Aiken served on the Medicare Physician Payment Review Commission for 6 years and was a member of the 1982 Social Security Advisory Council and of President Clinton's National Health Reform Task Force. Her recent work, for which she received the Sigma Theta Tau International Clinical Research Award in 1999, has focused on accounting for variation in hospital patient outcomes in the United States, Canada, the United Kingdom, and Germany. Dr. Aiken received her bachelor's and master's degrees in nursing from the University of Florida, Gainesville, and her doctorate in sociology and demography from the University of Texas at Austin.

  8. Biological monitoring of Upper Three Runs Creek, Savannah River Plant, Aiken County, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Specht, W.L.

    1991-10-01

    In anticipation of the fall 1988 start up of effluent discharges into Upper Three Creek by the F/H Area Effluent Treatment Facility of the Savannah River Site, Aiken, SC, a two and one half year biological study was initiated in June 1987. Upper Three Runs Creek is an intensively studied fourth order stream known for its high species richness. Designed to assess the potential impact of F H area effluent on the creek, the study includes qualitative and quantitative macroinvertebrate stream surveys at five sites, chronic toxicity testing of the effluent, water chemistry and bioaccumulation analysis. This final report presents the results of both pre-operational and post-operational qualitative and quantitative (artificial substrate) macroinvertebrate studies. Six quantitative and three qualitative studies were conducted prior to the initial release of the F/H ETF effluent and five quantitative and two qualitative studies were conducted post-operationally.

  9. Factorial Validity of Scores on the Aiken Attitude to Mathematics Scales for Adult Pretertiary Students.

    Science.gov (United States)

    Taylor, Janet A.

    1997-01-01

    The Aiken Attitude to Mathematics Scale (L. Aiken, 1974, 1979) was administered to 430 adult students in a tertiary preparation program, and the factorial validity of the scale was investigated through exploratory factor analysis. Two factors were extracted with high reliabilities, as opposed to Aiken's four-factor structure. (SLD)

  10. 40 CFR 81.114 - Augusta (Georgia)-Aiken (South Carolina) Interstate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Augusta (Georgia)-Aiken (South... PLANNING PURPOSES Designation of Air Quality Control Regions § 81.114 Augusta (Georgia)-Aiken (South Carolina) Interstate Air Quality Control Region. The Augusta (Georgia)-Aiken (South Carolina) Interstate...

  11. Environmental Survey preliminary report, Savannah River Plant, Aiken, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    1987-08-01

    This report contains the preliminary findings based on the first phase of an Environmental Survey at the Department of Energy (DOE) Savannah River Plant (SRP), located at Aiken, South Carolina. The Survey is being conducted by DOE's Office of Environment, Safety and Health. The following topics are discussed: general site information; air, soil, surface water and ground water; hydrogeology; waste management; toxic and chemical materials; release of tritium oxides; radioactivity in milk; contamination of ground water and wildlife; pesticide use; and release of radionuclides into seepage basins. 149 refs., 44 figs., 53 tabs.

  12. Development of a compact HTS lead unit for the SC correction coils of the SuperKEKB final focusing magnet system

    Energy Technology Data Exchange (ETDEWEB)

    Zong, Zhanguo, E-mail: zhanguo.zong@kek.jp; Ohuchi, Norihito; Tsuchiya, Kiyosumi; Arimoto, Yasushi

    2016-09-11

    Forty-three superconducting (SC) correction coils with maximum currents of about 60 A are installed in the SuperKEKB final focusing magnet system. Current leads to energize the SC correction coils should have an affordable heat load and fit the spatial constraints in the service cryostat where the current leads are installed. To address the requirements, design optimization of individual lead was performed with vapor cooled current lead made of a brass material, and a compact unit was designed to accommodate eight current leads together in order to be installed with one port in the service cryostat. The 2nd generation high temperature SC (HTS) tape was adopted and soldered at the cold end of the brass current lead to form a hybrid HTS lead structure. A prototype of the compact lead unit with HTS tape was constructed and tested with liquid helium (LHe) environment. This paper presents a cryogenic measurement system to simulate the real operation conditions in the service cryostat, and analysis of the experimental results. The measured results showed excellent agreement with the theoretical analysis and numerical simulation. In total, 11 sets of the compact HTS lead units were constructed for the 43 SC correction coils at KEK. One set from the mass production was tested in cryogenic conditions, and exhibited the same performance as the prototype. The compact HTS lead unit can feed currents to four SC correction coils simultaneously with the simple requirement of controlling and monitoring helium vapor flow, and has a heat load of about 0.762 L/h in terms of LHe consumption. - Highlights: • The requirements of the SC correction coils on current leads are introduced. • The optimum design of the brass vapor cooled current lead is described. • The compact structure of eight leads with HTS tape is presented. • The theoretical, numerical, and experimental results are compared. • The current lead heat load is evaluated for cryogenic system.

  13. Joan Aiken's Armitage Family Stories: Place and Storytelling as a Way into the World

    Science.gov (United States)

    Sackett, Hannah

    2012-01-01

    This article explores the importance of place and story in the life and work of Joan Aiken (1924-2004), with a focus on the Armitage Family short stories. It explores the fluid relationship between books, storytelling and place in Joan Aiken's childhood and looks at her close relationship with the landscape of the Sussex Downs. Particular…

  14. An Update on the Bubel Aiken Foundation: Seeds of Dreams Taking Root in Reality

    Science.gov (United States)

    Austin, Dianne; O'Hearn, Sue

    2007-01-01

    When RCA recording artist Clay Aiken created an independent study project to fulfill requirements for a degree in Special Education, he had no idea that his theoretical design would soon become reality. Aiken's concept on paper outlined an organization that would promote inclusion for children with disabilities. The seed of the idea was planted…

  15. The Aiken Attitude to Mathematics Scales: Psychometric Data on Reliability and Discriminant Validity.

    Science.gov (United States)

    Watson, Jane M.

    1983-01-01

    Providing additional data concerning the reliability and discriminant validity of Aiken's Enjoyment of Mathematics and Value of Mathematics Scales resulted in a degree of correlation between scales lower than for Aiken's data. Also, the view that the scales measure different aspects of attitude toward mathematics was supported. (PN)

  16. A Chain Structure Based on Homodinuclear Scandium Units: [Sc(μ-OH)(2,5-pydc)(H2O)]n

    Institute of Scientific and Technical Information of China (English)

    HUANG You-Gui; JIANG Fei-Long; WU Ming-Yan; GAO Qiang; WEI Wei; HONG Mao-Chun

    2008-01-01

    The reaction of pyridine-2,5-dicarboxylic acid with Sc2O3 under hydrothermal con-dition yields a new complex [Sc(μ-OH)(2,5-pydc)(H2P)]n 1 which has a chain structure based on homodinuclear scandium units. Crystal data for 1: space group P1, a = 6.7192(13), b = 7.6131(13),c= 8.9313(14) A, α = 95.976(6), β = 101.663(6),γ,= 108.151(5)°, V = 418.26(13) A3, Z = 2, Dc =1.946 g/cm3,μ = 0.889 mm-1, F(000) = 248, C7H6NO6Sc, M, = 245.09, the final R = 0.0429 and wR = 0.1086.

  17. Development of a compact HTS lead unit for the SC correction coils of the SuperKEKB final focusing magnet system

    Science.gov (United States)

    Zong, Zhanguo; Ohuchi, Norihito; Tsuchiya, Kiyosumi; Arimoto, Yasushi

    2016-09-01

    Forty-three superconducting (SC) correction coils with maximum currents of about 60 A are installed in the SuperKEKB final focusing magnet system. Current leads to energize the SC correction coils should have an affordable heat load and fit the spatial constraints in the service cryostat where the current leads are installed. To address the requirements, design optimization of individual lead was performed with vapor cooled current lead made of a brass material, and a compact unit was designed to accommodate eight current leads together in order to be installed with one port in the service cryostat. The 2nd generation high temperature SC (HTS) tape was adopted and soldered at the cold end of the brass current lead to form a hybrid HTS lead structure. A prototype of the compact lead unit with HTS tape was constructed and tested with liquid helium (LHe) environment. This paper presents a cryogenic measurement system to simulate the real operation conditions in the service cryostat, and analysis of the experimental results. The measured results showed excellent agreement with the theoretical analysis and numerical simulation. In total, 11 sets of the compact HTS lead units were constructed for the 43 SC correction coils at KEK. One set from the mass production was tested in cryogenic conditions, and exhibited the same performance as the prototype. The compact HTS lead unit can feed currents to four SC correction coils simultaneously with the simple requirement of controlling and monitoring helium vapor flow, and has a heat load of about 0.762 L/h in terms of LHe consumption.

  18. Factorial Validity of the Aiken-Dreger Mathematics Attitude Scale for Urban School Students.

    Science.gov (United States)

    Adwere-Boamah, Joseph; And Others

    1986-01-01

    The revised 20-item Aiken-Dreger Mathematics Attitude Scale was administered to 2538 urban minority students in grades 8 to 10. Results supported the existence of two underlying factors, enjoyment and fear. (GDC)

  19. Possible pharmacological interactions in hypertensive and/or diabetic elderly in family health units at Blumenau (SC

    Directory of Open Access Journals (Sweden)

    Vicente Codagnone Neto

    2010-12-01

    Full Text Available The aim of this study was to examine the possible adverse drug-drug interactions in the elderly population (>60 years diagnosed either with diabetes, arterial hypertension or both, at a Family Health Unit (FHU clinic in Blumenau, state of Santa Catarina, Brazil. For this purpose 318 subjects were interviewed using a pretested form with social and demographic aspects regarding their disease and its complications. All drugs used by this population were grouped, and the drug-drug interactions were detected by using the "Drug Interaction Checker" software, and classified for frequency and severity. The average age of patients was 70.6 years, with a higher number of female patients (216; 67.9%. Most subjects were being treated for both diseases (149; 46.86%. Out of a total of 1,541 medications prescribed, the most prevalent were: hydrochlorothiazide (131; 8.4% and enalapril maleate (130; 8.4%. A total of 295 possible drug-drug interactions were detected in 152 patients (1.9 interactions per subject, 275 (93.2% moderate and 20 (6.8% severe or highly severe. The possible interaction prevalence was 0.93 (0.55 to 1.40 depending on health unit. The most frequent possible interaction was that between acetylsalicylic acid and enalapril maleate (37; 12.5%. Patients had an average consumption of 6.6 drugs and 9.8% of subjects reported physical discomfort when using medicines. Elderly patients use many medications that could cause adverse reactions and possible drug-drug interactions, where this issue warrants closer attention of prescribers and health providers.Buscou-se identificar possíveis interações medicamentosas em pessoas idosas com diabetes melito (DM e/ou hipertensão arterial sistêmica (HAS sendo atendidas em unidades de Saúde da Família, em Blumenau (SC. Entrevistaram-se 318 pessoas com 60 e mais anos, portadoras de DM e/ou HAS, mediante questionário estruturado pré-testado, com variáveis sócio-demográficas da doença e do tratamento. As

  20. Microcrustaceans (Branchipoda and Copepoda) of Wetland Impoundments on the Savannah River Site, Aiken, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    DeBiase, Adrienne E; Taylor, Barbara E

    2005-09-21

    The United States Department of Energy’s Savannah River Site (SRS) in Aiken, Allendale, and Barnwell Counties, South Carolina, contains an abundance of freshwater wetlands and impoundments. Four large impoundments, as well as several small, abandoned farm and mill ponds, and about 400 Carolina bays and other small, isolated depression wetland ponds are located within the 893 km2 area of the SRS. Crustaceans of the orders Branchiopoda and Copepoda are nearly ubiquitous in these water bodies. Although small in size, these organisms are often very abundant. They consequently play an important trophic role in freshwater food webs supporting fish, larval salamanders, larval insects, and numerous other animals, aquatic and terrestrial. This report provides an introduction to the free-living microcrustaceans of lentic water bodies on the SRS and a comprehensive list of species known to occur there. Occurrence patterns are summarized from three extensive survey studies, supplemented with other published and unpublished records. In lieu of a key, we provide a guide to taxonomic resources and notes on undescribed species. Taxa covered include the orders Cladocera, Anostraca, Laevicaudata, and Spinicaudata of the Subclass Branchiopoda and the Superorders Calanoida and Cyclopoida of Subclass Copepoda. Microcrustaceans of the Superorder Harpacticoida of the Subclass Copepoda and Subclass Ostracoda are also often present in lentic water bodies. They are excluded from this report because they have not received much study at the species level on the SRS.

  1. Biological monitoring of Upper Three Runs Creek, Savannah River Site, Aiken County, South Carolina, March 1990--July 1991

    Energy Technology Data Exchange (ETDEWEB)

    1991-12-01

    In anticipation of the fall 1988 start up of effluent discharges into Upper Three Runs Creek by the F/H Area Effluent Treatment Facility of the Savannah River Site, Aiken, SC, a two and one half year biological study was initiated in June 1987. Upper Three Runs Creek is an intensively studied fourth order stream known for its high species richness. Designed to assess the potential impact of F/H area effluent on the creek, the study included qualitative and quantitative macroinvertebrate stream surveys at five sites (see map), chronic toxicity testing of the effluent, water chemistry and bioaccumulation analysis. In a March 1990 study of the potential impact of F/H Area effluent on the macroinvertebrate communities of Upper Three Runs Creek was extended, with reductions in the number of sites to be sampled and in the frequency of water chemistry sampling. This report presents the results of macroinvertebrate stream surveys at three sites, chronic toxicity testing of the effluent and water chemistry analysis of the three stream sites and the effluent from March 1990 to July 1991.

  2. Biological monitoring of Upper Three Runs Creek, Savannah River Site, Aiken County, South Carolina, March 1990--July 1991

    Energy Technology Data Exchange (ETDEWEB)

    1991-12-01

    In anticipation of the fall 1988 start up of effluent discharges into Upper Three Runs Creek by the F/H Area Effluent Treatment Facility of the Savannah River Site, Aiken, SC, a two and one half year biological study was initiated in June 1987. Upper Three Runs Creek is an intensively studied fourth order stream known for its high species richness. Designed to assess the potential impact of F/H area effluent on the creek, the study included qualitative and quantitative macroinvertebrate stream surveys at five sites (see map), chronic toxicity testing of the effluent, water chemistry and bioaccumulation analysis. In a March 1990 study of the potential impact of F/H Area effluent on the macroinvertebrate communities of Upper Three Runs Creek was extended, with reductions in the number of sites to be sampled and in the frequency of water chemistry sampling. This report presents the results of macroinvertebrate stream surveys at three sites, chronic toxicity testing of the effluent and water chemistry analysis of the three stream sites and the effluent from March 1990 to July 1991.

  3. Applying a Score Confidence Interval to Aiken's Item Content-Relevance Index

    Science.gov (United States)

    Penfield, Randall D.; Giacobbi, Peter R., Jr

    2004-01-01

    Item content-relevance is an important consideration for researchers when developing scales used to measure psychological constructs. Aiken (1980) proposed a statistic, "V," that can be used to summarize item content-relevance ratings obtained from a panel of expert judges. This article proposes the application of the Score confidence interval to…

  4. Explorations in Mathematics Attitude: An Empirical Investigation of the Aiken Scale.

    Science.gov (United States)

    Nolen, William F.; And Others

    The Mathematics Attitude Scale (Aiken, 1974) purports to reflect attitude toward mathematics on two basic dimensions, enjoyment and value. While this scale is widely used in mathematics research, the only empirical evidence supporting the two-factor structure is the item analysis of college freshmen responses. The present study examines the…

  5. History Run Wild: The Alternate World of Joan Aiken's "The Wolves of Willoughby Chase" Series

    Science.gov (United States)

    Dams, Isobel

    2005-01-01

    This article examines the historical fantasy world created by Joan Aiken in the eleven volumes of her "Wolves of Willoughby Chase" series. In particular it looks at her subversion of historical reality by the creation of an alternative yet recognisable representation of our own world, using a wide range of events, and the remoulding of aspects of…

  6. The Perception upon Landscape Revitalization of Industrial Spaces. Case Study – The Industrial Units Belvedere Cigarette Factory and S.C. Mefin Sinaia

    Directory of Open Access Journals (Sweden)

    ALINA E. HUZUI

    2011-01-01

    Full Text Available Many Romanian cities are confronted with difficulties regarding the insertion of redundant industrial objectives in the present urban landscape. This study focuses on two industrial units that have created a certain place identity through time, both undergoing a conversion process, due to relict or underused industrial structures. These industrial units are reclaimed by the increasingly public demand for new construction spaces that are more adapted to the cultural, social, economic and ecological context. Belvedere Cigarette Factory was an important factory in Bucharest because it initiated the tobacco manufacturing in the Romanian capital city. The buildings of the cigarette factory, which were constructed from the late 19th century until the early 20th century, are considered heritage objectives. Currently, some factory buildings and annexes are demolished and in their place shopping and entertainment spaces have been built. S.C. MEFIN S.A. Sinaia was established on a pre-existing industrial unit in 1953 and in 2007 it was decided to be integrated into the services sector (tourist accommodation, commercial spaces, sports and leisure in order to raise the attractiveness of the area. However, the transformation of this unit cannot be dissociated from the community`s preferences regarding the area`s revitalization (Stan A, 2009, p. 201. The methods applied in this study are the case study research and the survey that allows the comparison of the reuse perception of the industrial units. The need to return these productive areas to the urban context recognizes people (residents as active participants in the revitalization process of industrial landscapes.

  7. 77 FR 3100 - Standard Instrument Approach Procedures, and Takeoff Minimums and Obstacle Departure Procedures...

    Science.gov (United States)

    2012-01-23

    ... Aiken, SC, Aiken Muni, ILS OR LOC/DME RWY 7, Orig Aiken, SC, Aiken Muni, LOC RWY 7, Orig, CANCELLED Aiken, SC, Aiken Muni, RNAV (GPS) RWY 7, Amdt 1 Aiken, SC, Aiken Muni, RNAV (GPS) RWY 25, Amdt 1...

  8. Regional groundwater flow model for C, K. L. and P reactor areas, Savannah River Site, Aiken, SC

    Energy Technology Data Exchange (ETDEWEB)

    Flach, G.P.

    2000-02-11

    A regional groundwater flow model encompassing approximately 100 mi2 surrounding the C, K, L, and P reactor areas has been developed. The reactor flow model is designed to meet the planning objectives outlined in the General Groundwater Strategy for Reactor Area Projects by providing a common framework for analyzing groundwater flow, contaminant migration and remedial alternatives within the Reactor Projects team of the Environmental Restoration Department. The model provides a quantitative understanding of groundwater flow on a regional scale within the near surface aquifers and deeper semi-confined to confined aquifers. The model incorporates historical and current field characterization data up through Spring 1999. Model preprocessing is automated so that future updates and modifications can be performed quickly and efficiently. The CKLP regional reactor model can be used to guide characterization, perform scoping analyses of contaminant transport, and serve as a common base for subsequent finer-scale transport and remedial/feasibility models for each reactor area.

  9. A QUICK KEY TO THE SUBFAMILIES AND GENERA OF ANTS OF THE SAVANNAH RIVER SITE, AIKEN, SC

    Energy Technology Data Exchange (ETDEWEB)

    Martin, D

    2006-10-04

    This taxonomic key was devised to support development of a Rapid Bioassessment Protocol using ants at the Savannah River Site. The emphasis is on ''rapid'' and, because the available keys contained a large number of genera not known to occur at the Savannah River Site, we found that the available keys were unwieldy. Because these keys contained more genera than we would likely encounter and because this larger number of genera required both more couplets in the key and often required examination of characters that are difficult to assess without higher magnifications (60X or higher) more time was required to process samples. In developing this set of keys I recognize that the character sets used may lead to some errors but I believe that the error rate will be small and, for the purpose of rapid bioassessment, this error rate will be acceptable provided that overall sample sizes are adequate. Oliver and Beattie (1996a, 1996b) found that for rapid assessment of biodiversity the same results were found when identifications were done to morphospecies by people with minimal expertise as when the same data sets were identified by subject matter experts. Basset et al. (2004) concluded that it was not as important to correctly identify all species as it was to be sure that the study included as many functional groups as possible. If your study requires high levels of accuracy, it is highly recommended that when you key out a specimen and have any doubts concerning the identification, you should refer to keys in Bolton (1994) or to the other keys used to develop this area specific taxonomic key.

  10. Reconnaissance survey of site 7 of the proposed Three Rivers Regional Landfill and Technology Center, Savannah River Site, Aiken County, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Cabak, M.A.; Beck, M.L.; Gillam, C.; Sassaman, K.E.

    1996-02-01

    This report documents the archaeological investigation of Site 7 of the proposed Three Rivers Regional Landfill and Technology Center in Aiken County on the United States Department of Energy`s Savannah River Site (SRS) in Aiken and Barnwell Counties, South Carolina. Pedestrian and subsurface survey techniques were used to investigate the 1,403-acre project area. Survey resulted in the discovery of 23 previously unrecorded sites and 11 occurrences; six previously recorded sites were also investigated. These sites consist of six prehistoric sites, nine historic sites, and 14 sites with both prehistoric and historic components. Sites locations and project area boundaries are provided on a facsimile of a USGS 7.5 topographic map. The prehistoric components consist of very small, low-density lithic and ceramic scatters; most contain less than 10 artifacts. Six of the prehistoric components are of unknown cultural affiliation, the remaining prehistoric sites were occupied predominately in the Woodland period. The historic sites are dominated by postbellum/modem home places of tenant and yeoman farmers but four historic sites were locations of antebellum house sites (38AK136, 38AK613, 38AK660, and 38AK674). The historic sites also include an African-American school (38AK677).

  11. Microcrustaceans (Branchiopoda and Copepoda) of Wetland Ponds and Impoundments on the Savannah River Site, Aiken, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Adrienne E. DeBiase; Barbara E. Taylor

    2005-09-21

    The United States Department of Energy's Savannah River Site (SRS) in Aiken, Allendale, and Barnwell Counties, South Carolina, contains an abundance of freshwater wetlands and impoundments. Four large impoundments, as well as several small, abandoned farm and mill ponds, and about 400 Carolina bays and other small, isolated depression wetland ponds are located within the 893 km2 area of the SRS. Crustaceans of the orders Branchiopoda and Copepoda are nearly ubiquitous in these water bodies. Although small in size, these organisms are often very abundant. They consequently play an important trophic role in freshwater food webs supporting fish, larval salamanders, larval insects, and numerous other animals, aquatic and terrestrial. This report provides an introduction to the free-living microcrustaceans of lentic water bodies on the SRS and a comprehensive list of species known to occur there. Occurrence patterns are summarized from three extensive survey studies, supplemented with other published and unpublished records. In lieu of a key, we provide a guide to taxonomic resources and notes on undescribed species. Taxa covered include the orders Cladocera, Anostraca, Laevicaudata, and Spinicaudata of the Subclass Branchiopoda and the Superorders Calanoida and Cyclopoida of Subclass Copepoda. Microcrustaceans of the Superorder Harpacticoida of the Subclass Copepoda and Subclass Ostracoda are also often present in lentic water bodies. They are excluded from this report because they have not received much study at the species level on the SRS.

  12. Knowledge insufficient: the management of haemoglobin SC disease.

    Science.gov (United States)

    Pecker, Lydia H; Schaefer, Beverly A; Luchtman-Jones, Lori

    2017-02-01

    Although haemoglobin SC (HbSC) accounts for 30% of sickle cell disease (SCD) in the United States and United Kingdom, evidence-based guidelines for genotype specific management are lacking. The unique pathology of HbSC disease is complex, characterized by erythrocyte dehydration, intracellular sickling and increased blood viscosity. The evaluation and treatment of patients with HbSC is largely inferred from studies of SCD consisting mostly of haemoglobin SS (HbSS) patients. These studies are underpowered to allow definitive conclusions about HbSC. We review the pathophysiology of HbSC disease, including known and potential differences between HbSS and HbSC, and highlight knowledge gaps in HbSC disease management. Clinical and translational research is needed to develop targeted treatments and to validate management recommendations for efficacy, safety and impact on quality of life for people with HbSC. © 2016 John Wiley & Sons Ltd.

  13. Biological monitoring of Upper Three Runs Creek, Savannah River Plant, Aiken County, South Carolina. Final report on macroinvertebrate stream assessments for F/H area ETF effluent discharge, July 1987--February 1990

    Energy Technology Data Exchange (ETDEWEB)

    Specht, W.L.

    1991-10-01

    In anticipation of the fall 1988 start up of effluent discharges into Upper Three Creek by the F/H Area Effluent Treatment Facility of the Savannah River Site, Aiken, SC, a two and one half year biological study was initiated in June 1987. Upper Three Runs Creek is an intensively studied fourth order stream known for its high species richness. Designed to assess the potential impact of F?H area effluent on the creek, the study includes qualitative and quantitative macroinvertebrate stream surveys at five sites, chronic toxicity testing of the effluent, water chemistry and bioaccumulation analysis. This final report presents the results of both pre-operational and post-operational qualitative and quantitative (artificial substrate) macroinvertebrate studies. Six quantitative and three qualitative studies were conducted prior to the initial release of the F/H ETF effluent and five quantitative and two qualitative studies were conducted post-operationally.

  14. Understanding dissolved organic matter reactivity in a global context: tribute to Dr. George Aiken's many contributions

    Science.gov (United States)

    McKnight, Diane

    2017-04-01

    As Dr. George Aiken emphasized throughout his distinguished research career, the diversity of sources of dissolved organic material (DOM) is associated with a diversity of dissolved organic compounds with a range of chemistries and reactivities that are present in the natural environment. From a limnological perspective, dissolved organic matter (DOM) can originate from allochthonous sources on the landscape which drains into a lake, river, wetland, coastal region, or other aquatic ecosystem, or from autochthonous sources within the given aquatic ecosystem. In many landscapes, the precursor organic materials that contribute to the DOM of the associated aquatic ecosystem can be derived from diverse sources, e.g. terrestrial plants, plant litter, organic material in different soil horizons, and the products of microbial growth and decay. Yet, through his focus on the underlying chemical processes a clear, chemically robust foundation for understanding DOM reactivity has emerged from Aiken's research. These processes include the enhancement in solubility due to ionized carboxylic acid functional groups and the reactions of organic sulfur groups with mercury. This approach has advanced understand of carbon cycling in the lakes of the Mars-like barren landscapes of the McMurdo Dry Valleys in Antarctica and the rivers draining the warming tundra of the Arctic.

  15. Photoionization study of Ne-like K9+, Ca10+, Sc11+, Ti12+, V13+, Cr14+, Mn15+, and Fe16+ ions using the screening constant by unit nuclear charge method

    Science.gov (United States)

    Goyal, Arun; Khatri, Indu; Sow, Malick; Sakho, Ibrahima; Aggarwal, Sunny; Singh, A. K.; Mohan, Man

    2016-08-01

    Photoionization of the 2s22p6 (1S0) ground state of the Ne-like (Z=19-29) ions is presented in this paper. Resonance energies and total natural width of the 2s2p6np 1P series of the Ne-like K9+, Ca10+, Sc11+, Ti12+, V13+, Cr14+, Mn15+, and Fe16+are reported. All the calculations are made using the Screening constant by unit nuclear charge (SCUNC) formalism. New data for Ne-like K9+, Sc11+, Ti12+, V13+, Cr14+, and Mn15+ions are tabulated. Good agreements are found with available literature data.

  16. Cs3ScCl6

    Directory of Open Access Journals (Sweden)

    Matthew D. Ward

    2014-06-01

    Full Text Available Crystals of tricaesium scandium(III hexachloride were obtained as a side product from the reaction of U, SnCl2, Sc, and S in a CsCl flux at 1073 K. Cs3ScCl6 crystallizes in the Rb3YCl6 structure type. The asymmetric unit comprises three Cs sites, two Sc sites, and six Cl sites, all of which have site symmetry 1, except for the two Sc sites that have site symmetries of 2 and -1, respectively. The structure is composed of isolated [ScCl6]3− octahedra that are surrounded by Cs+ cations. Two Cs+ cations have interactions with eight Cl− anions, while the third has interactions with ten Cl− anions.

  17. A Sourcebook of Interdisciplinary Materials in American Drama: George Aiken, "Uncle Tom's Cabin" (1852). Showcasing American Drama.

    Science.gov (United States)

    Jiji, Vera, Ed.

    Prepared as part of a project aimed at redressing the neglect of American drama in college and secondary school programs of drama, American literature, and American studies, this booklet provides primary and secondary source materials to assist teachers and students in the study of George L. Aiken's dramatic adaptation of Harriet Beecher Stowe's…

  18. S-C Mylonites

    NARCIS (Netherlands)

    Lister, G.S.; Snoke, A.W.

    1984-01-01

    Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C mylonites

  19. SC tuning fork

    CERN Multimedia

    The tuning fork used to modulate the radiofrequency system of the synchro cyclotron (SC) from 1957 to 1973. This piece is an unused spare part. The SC was the 1st accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990. In the SC the magnetic field did not change with time, and the particles were accelerated in successive pulses by a radiofrequency voltage of some 20kV which varied in frequency as they spiraled outwards towards the extraction radius. The frequency varied from 30MHz to about 17Mz in each pulse. The tuning fork vibrated at 55MHz in vacuum in an enclosure which formed a variable capacitor in the tuning circuit of the RF system, allowing the RF to vary over the appropriate range to accelerate protons from the centre of the macine up to 600Mev at extraction radius. In operation the tips of the tuning fork blade had an amplitude of movement of over 1 cm. The SC accelerator underwent extensive improvements from 1973 to 1975, including the installation of a...

  20. SC2 dee

    CERN Multimedia

    1974-01-01

    Checking the positioning of the dee before its introduction into the vacuum chamber of SC2. The dee is mounted on a large cover plate which also carries the dee liner and the pump manifold. The dummy dee is fixed to the pole faces within the vacuum chamber.

  1. O enfermeiro de unidade básica de saúde e o usuário de drogas: um estudo em Biguaçú-SC El enfermeros de unidades de salud del primer nivel y el usuario de droga: un estudio en Biguaçú-SC The nurse from health unit and the drug user: one analysis in Biguaçu/SC

    Directory of Open Access Journals (Sweden)

    Jonas Salomão Spricigo

    2004-04-01

    Full Text Available O presente estudo buscou conhecer a opinião do enfermeiro sobre usuários de drogas, identificar de qual abordagem a opinião dos enfermeiros se aproxima e levantar que conhecimentos consideram essenciais para o cuidado de enfermagem. As informações foram obtidas através de entrevista semi-estruturada com sete enfermeiros lotados em Unidades Básicas de Saúde (UBS do município de Biguaçú-SC, e submetidas à técnica de análise de conteúdo de Bardin. A análise mostra que as opiniões concentram-se na abordagem médica e sócio-cultural. No entanto, alguns extratos das falas podem estar indicando a compreensão de que o processo de globalização possa estar contribuindo para a "desregulamentação" do uso de drogas, aproximando-se da abordagem Crítico-Holístico de Saúde Internacional.El presente estudo buscó conocer la opinión de los enfermeros acerca de los usuarios de drogas: identificar a cual abordaje la opinión de los enfermeros se acerca y conocer que conocimentos consideran esenciales para el cuidado de enfermería. Las informaciones fueron obtenidas por medio de una entrevista semi-estructurada con siete enfermeros de Unidades de Salud del primer nivel, del Município de Biguaçú-SC, y los resultados fueran analisados atraves del metodo de análisis de contenido de Bardin. Los resultados demuestran que las opiniones se concetran en la abordaje médica y socio-cultural. Todavia, algunos discursos pueden estar indicando una compreensión de que el proceso de globalización tiene contribuido para la "desregulamentación" del uso de drogas, en una aproximación de la abordaje crítico-holístico de la salud internacional.The present study investigates the opinion of healthcare professionals (nurses toward drug users; to identify individual approaches and to know what knowledge they consider essential to the nursing care. The information was collected by interviewing 7 nurses from health units in the city of Biguacu -SC

  2. A survey of cavity-nesting bees and wasps in loblolly pine stands of the Savannah River Site, Aiken County, South Carolina.

    Energy Technology Data Exchange (ETDEWEB)

    Horn, S.; Hanula, J., L.

    2004-03-10

    Horn, Scott, and James L. Hanula. 2004. A survey of cavity-nesting bees and wasps in loblolly pine stands of the Savannah River Site, Aiken County, South Carolina. 39(3): 464-469. Abstract: In recent years concern over widespread losses in biodiversity has grown to include a possible decline of many native pollinators, primarily bees. Factors such as habitat fragmentation, agricultural practices, use of pesticides, the introduction of invasive species, or changes in land use may negatively impact these vital organisims. Most reported studies show that human impacts on pollinators are overwhelmingly negative. Reductions in pollinator populations may profoundly impact plant population dynamics and ecosystem function. Little baseline data exists on the diversity and relative abundance of bees and wasps in southern forests. The objective of this study was to develop a simple, effective method of surveying cavity-nesting bees and wasps and to determine species diversity in mature forests of loblolly pine, the most widely planted tree species in the southern United States.

  3. Intensive archaeological survey of the F/H Surface Enhancement Project Area, Savannah River Site, Aiken and Barnwell Counties, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Sassaman, K.E.; Gillam, J.C.

    1993-08-01

    Twelve archaeological sites and four artifact occurrences were located by intensive survey of two tracts of land for the F and H Surface Enhancement Project on the Savannah River Site, Aiken and Barnwell Counties, South Carolina. Fieldwork in the 480-acre project area included surface reconnaissance of 3.6 linear kilometers of transects, 140 shovel tests along 4.2 linear kilometers of transects, an additional 162 shovel tests at sites and occurrences, and the excavation of six l {times} 2 m test units. All but one of the sites contained artifacts of the prehistoric era; the twelfth site consists of the remains of a twentieth-century home place. The historic site and six of the prehistoric sites consist of limited and/or disturbed contexts of archaeological deposits that have little research potential and are therefore considered ineligible for nomination to the National Register of Historic Places (NRHP). The remaining five sites have sufficient content and integrity to yield information important to ongoing investigations into upland site use. These sites (38AK146, 38AK535, 38AK539, 38AK541, and 38AK543) are thus deemed eligible for nomination to the NRHP and the Savannah River Archaeological Research Program (SRARP) recommends that they be preserved through avoidance or data recovery.

  4. Doctoral training in statistics, measurement, and methodology in psychology: replication and extension of Aiken, West, Sechrest, and Reno's (1990) survey of PhD programs in North America.

    Science.gov (United States)

    Aiken, Leona S; West, Stephen G; Millsap, Roger E

    2008-01-01

    In a survey of all PhD programs in psychology in the United States and Canada, the authors documented the quantitative methodology curriculum (statistics, measurement, and research design) to examine the extent to which innovations in quantitative methodology have diffused into the training of PhDs in psychology. In all, 201 psychology PhD programs (86%) participated. This survey replicated and extended a previous survey (L. S. Aiken, S. G. West, L. B. Sechrest, & R. R. Reno, 1990), permitting examination of curriculum development. Most training supported laboratory and not field research. The median of 1.6 years of training in statistics and measurement was mainly devoted to the modally 1-year introductory statistics course, leaving little room for advanced study. Curricular enhancements were noted in statistics and to a minor degree in measurement. Additional coverage of both fundamental and innovative quantitative methodology is needed. The research design curriculum has largely stagnated, a cause for great concern. Elite programs showed no overall advantage in quantitative training. Forces that support curricular innovation are characterized. Human capital challenges to quantitative training, including recruiting and supporting young quantitative faculty, are discussed. Steps must be taken to bring innovations in quantitative methodology into the curriculum of PhD programs in psychology.

  5. The high-temperature modification of ScRuSi - Structure, 29Si and 45Sc solid state NMR spectroscopy

    Science.gov (United States)

    Hoffmann, Rolf-Dieter; Rodewald, Ute Ch.; Haverkamp, Sandra; Benndorf, Christopher; Eckert, Hellmut; Heying, Birgit; Pöttgen, Rainer

    2017-10-01

    A polycrystalline sample of the TiNiSi type low-temperature (LT) modification of ScRuSi was synthesized by arc-melting. Longer annealing in a sealed silica tube (6 weeks at 1270 K) followed by quenching led to the high-temperature (HT) phase. HT-ScRuSi adopts the ZrNiAl structure type: P 6 bar 2 m , a = 688.27(9), c = 336.72(5) pm, wR2 = 0.0861, 260 F2 values, 14 variables. The striking structural building units are regular, tricapped trigonal prisms Si1@Ru3Sc6 and Si2@Ru6Sc3. Both polymorphs have been characterized by 29Si and 45Sc MAS-NMR spectroscopy. The local scandium environments in the two polymorphs are easily distinguished by their electric field gradient tensor values, in agreement with theoretically calculated values.

  6. Gadolinium scandium germanide, Gd2Sc3Ge4

    Directory of Open Access Journals (Sweden)

    Sumohan Misra

    2009-04-01

    Full Text Available Gd2Sc3Ge4 adopts the orthorhombic Pu5Rh4-type structure. The crystal structure contains six sites in the asymmetric unit: two sites are statistically occupied by rare-earth atoms with Gd:Sc ratios of 0.967 (4:0.033 (4 and 0.031 (3:0.969 (3, one site (.m. symmetry is occupied by Sc atoms, and three distinct sites (two of which with .m. symmetry are occupied by Ge atoms. The rare-earth atoms form two-dimensional slabs with Ge atoms occupying the trigonal-prismatic voids.

  7. Monitor of SC beam profiles

    CERN Multimedia

    1977-01-01

    A high-resolution secondary emission grid for the measurement of SC beam profiles. Modern techniques of metal-ceramic bonding, developed for micro-electronics, have been used in its construction. (See Annual Report 1977 p. 105 Fig. 12.)

  8. First coil for the SC

    CERN Multimedia

    CERN PhotoLab

    1955-01-01

    The coils for the SC magnet were stored in the large hangar of the Cointrin Airport (to make sure that they would be available before snow and ice would block the roads and canals from Belgium, where they were built).

  9. Fabrication and testing history prototypes and production units

    Energy Technology Data Exchange (ETDEWEB)

    1954-09-01

    From April, 1951 to Aug, 1954, New York Shipbuilding Corp. carried out a subcontract with E.I. du Pont de Nemours & Company that was without parallel in the shipyard`s history. The work, designated the NYX Project for reasons of security, was vital to the operations of the Savannah River Plant, Aiken, S.C., which was then being designed and constructed by du Pont for the Atomic Energy Commission. It consisted of three broad parts: developmental and experimental work; fabrication and testing of a prototype unit; fabrication of production units. Five production units were ultimately built, one of them converted from the prototype. All were fabricated from stainless steel, and involved welding techniques, control of thermal distortion and tolerances never previously attempted on assemblies of comparable size. Du Pont`s technical experience and the background of New York Ship in heavy construction, particularly in the fabrication of naval gun turrets, were combined from the outset to resolve the difficult fabrication problems that occurred almost daily. Representatives of both companies worked together as a team in the shops and at supervisory levels to an unprecedented extent. The report is intended primarily to summarize New York Ship`s part in the project, but also includes some of du Pont`s activities since the work of the two organizations was so interrelated. Because of the scope of the program, it will not always be possible to provide detailed information, but rather to record what happened in general terms. Where the reader desires more specific data, he should refer to original plans and records, including various reports compiled during the course of the project.

  10. Hydrogeologic investigation and establishment of a permanent multi-observational well network in Aiken, Allendale, and Barnwell Counties, South Carolina. Eight-year interim report (1986-1994). Volume 1 cluster-site description

    Energy Technology Data Exchange (ETDEWEB)

    Gellici, J.A.; Reed, R.H.; Logan, W.R.; Aadland, R.K.; Simones, G.C.

    1995-05-01

    The South Carolina Department of Natural Resources, Water Resources Division (SCWRD), in collaboration with the United States Department of Energy (USDOE) is conducting a hydrogeologic investigation of the ground-water system(s) peripheral to the Savannah River Site. The study area is located in the Southeastern Coastal Plain hydrogeologic province in Aiken, Allendale and Barnwell Counties, South Carolina. Ground-water movement, quality, and availability are being evaluated in order to better protect and manage this valuable regional resource. The investigation involves a well-cluster system comparable to the one constructed on the SRS. Cluster sites are situated outside the SRS on the basis of study objectives, proximity to the plant`s borders, land availability, and for the optimization of hydrogeologic control. One to three wells are completed into each major aquifer, and at each cluster site, at least one borehole is continuously cored and geophysically logged from land surface to at least 10 feet into unweathered bedrock. Data collected from the ongoing study include 146 paleontologic and palynologic age dates, 100 x-ray diffraction analyses of clay and bulk mineralogy, 442 sieve analyses, 6,040 feet of detailed core description, mineral composition and porosity determined from thin-section analyses, and continuous water-level data. This report is a compilation and interpretation of the {open_quotes}C-well{close_quotes} data that have been generated from the project and that will be used to model and characterize the aquifers and confining units in the region.

  11. Report of AAPM Therapy Physics Committee Task Group 74: in-air output ratio, Sc, for megavoltage photon beams.

    Science.gov (United States)

    Zhu, Timothy C; Ahnesjö, Anders; Lam, Kwok Leung; Li, X Allen; Ma, Chang-Ming Charlie; Palta, Jatinder R; Sharpe, Michael B; Thomadsen, Bruce; Tailor, Ramesh C

    2009-11-01

    The concept of in-air output ratio (Sc) was introduced to characterize how the incident photon fluence per monitor unit (or unit time for a Co-60 unit) varies with collimator settings. However, there has been much confusion regarding the measurement technique to be used that has prevented the accurate and consistent determination of Sc. The main thrust of the report is to devise a theoretical and measurement formalism that ensures interinstitutional consistency of Sc. The in-air output ratio, Sc, is defined as the ratio of primary collision water kerma in free-space, Kp, per monitor unit between an arbitrary collimator setting and the reference collimator setting at the same location. Miniphantoms with sufficient lateral and longitudinal thicknesses to eliminate electron contamination and maintain transient electron equilibrium are recommended for the measurement of Sc. The authors present a correction formalism to extrapolate the correct Sc from the measured values using high-Z miniphantom. Miniphantoms made of high-Z material are used to measure Sc for small fields (e.g., IMRT or stereotactic radiosurgery). This report presents a review of the components of Sc, including headscatter, source-obscuring, and monitor-backscattering effects. A review of calculation methods (Monte Carlo and empirical) used to calculate Sc for arbitrary shaped fields is presented. The authors discussed the use of Sc in photon dose calculation algorithms, in particular, monitor unit calculation. Finally, a summary of Sc data (from RPC and other institutions) is included for QA purposes.

  12. Two anionically derivatized scandium oxoselenates(IV): ScF[SeO3] and Sc2O2[SeO3

    Science.gov (United States)

    Greiner, Stefan; Chou, Sheng-Chun; Schleid, Thomas

    2017-02-01

    Scandium fluoride oxoselenate(IV) ScF[SeO3] and scandium oxide oxoselenate(IV) Sc2O2[SeO3] could be synthesized through solid-state reactions. ScF[SeO3] was obtained phase-pure, by reacting mixtures of Sc2O3, ScF3 and SeO2 (molar ratio: 1:1:3) together with CsBr as fluxing agent in corundum crucibles embedded into evacuated glassy silica ampoules after firing at 700 °C for seven days. Sc2O2[SeO3] first emerged as by-product during the attempts to synthesize ScCl[SeO3] following aforementioned synthesis route and could later be reproduced from appropriate Sc2O3/SeO3 mixtures. ScF[SeO3] crystallizes monoclinically in space group P21/m with a=406.43(2), b =661.09(4), c=632.35(4) pm, β=93.298(3)° and Z=2. Sc2O2[SeO3] also crystallizes in the monoclinic system, but in space group P21/n with a=786.02(6), b=527.98(4), c=1086.11(8) pm, β=108.672(3)° for Z=4. The crystal structures of both compounds are strongly influenced by the stereochemically active lone pairs of the ψ1-tetrahedral [SeO3]2- anions. They also show partial structures, where the derivatizing F- or O2- anions play an important role. For ScF[SeO3] chains of the composition 2+ ∞ 1[FSc2/2] form from connected [FSc2]5+ dumbbells, while [OSc3]7+ pyramids and [OSc4]10+ tetrahedra units are condensed to layers according to 2+ ∞ 2[O2Sc2 ] in Sc2O2[SeO3].

  13. 76 FR 65706 - Environmental Management Site-Specific Advisory Board, Savannah River Site

    Science.gov (United States)

    2011-10-24

    ... Aiken Convention Center, 471 University Parkway, Aiken, SC 29801. FOR FURTHER INFORMATION CONTACT: Gerri..., Aiken, SC 29802; Phone: (803) 952-7886. SUPPLEMENTARY INFORMATION: Purpose of the Board: The purpose of...

  14. Rotary condenser for SC2

    CERN Multimedia

    1975-01-01

    During 1975 the SC2 performance was improved among other things by redesigning some of the elements of the ROTCO (Annual Report 1975, p. 55). The photo shows an interior wiew of the housing of the rotary condenser and of the sixteen sets of shaped stator blades.

  15. Intensive archaeological survey of the proposed Central Sanitary Wastewater Treatment Facility, Savannah River Site, Aiken and Barnwell Counties, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Stephenson, D.K.; Sassaman, K.E.

    1993-11-01

    The project area for the proposed Central Sanitary Wastewater Treatment Facility on the Savannah River Site includes a six-acre tract along Fourmile Branch and 18 mi of trunk line corridors. Archaeological investigations of the six-acre parcel resulted in the discovery of one small prehistoric site designated 38AK465. This cultural resource does not have the potential to add significantly to archaeological knowledge of human occupation in the region. The Savannah River Archaeological Research Program (SRARP) therefore recommends that 38AK465 is not eligible for nomination to the National Register of Historic Places (NRHP) and further recommends a determination of no effect. Archaeological survey along the trunk line corridors implicated previously recorded sites 38AK92, 38AK145, 38AK415, 38AK417, 38AK419, and 38AK436. Past disturbance from construction had severely disturbed 38AK92 and no archaeological evidence of 38AK145, 38AK419, and 38AK436 was recovered during survey. Lacking further evidence for the existence of these sites, the SRARP recommends that 38AK92, 38AK145, 38AK419, and 38AK436 are not eligible for nomination to the NRHP and thus warrant a determination of no effect. Two of these sites, 38Ak415 and 38AK417, required further investigation to evaluate their archaeological significance. Both of the sites have the potential to yield significant data on the prehistoric period occupation of the Aiken Plateau and the SRARP recommends that they are eligible for nomination to the NRHP. The Savannah River Archaeological Research Program recommends that adverse effects to sites 38AK415 and 38AK417 from proposed construction can be mitigated through avoidance.

  16. 2010 ARRA Lidar: Hampton County (SC)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Provide high density LiDAR elevation data map of Hampton County, SC. Provide Bare Earth DEM (vegetation removal) of Hampton County, SC.

  17. Magnetic moment of {sup 48}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Ohtsubo, T., E-mail: tohtsubo@np.gs.niigata-u.ac.jp; Kawamura, Y.; Ohya, S. [Niigata University, Department of Physics (Japan); Izumikawa, T. [Niigata University, Radioisotope Center (Japan); Nishimura, K. [Toyama University, Faculty of Engineering (Japan); Muto, S. [Neutron Science Laboratory, KEK (Japan); Shinozuka, T. [Tohoku University, Cyclotron and Radioisotope Center (Japan)

    2007-11-15

    Nuclear magnetic resonances were measured for {sup 48}Sc and {sup 44m}Sc oriented at 8 mK in an Fe host metal. The magnetic hyperfine splitting frequencies at an external magnetic field of 0.2 T were determined to be 63.22(11) MHz and 64.81(1) MHz for {sup 48}Sc and {sup 44m}Sc, respectively. With the known magnetic moment of {mu}({sup 44m}Sc)=+3.88 (1) {mu}{sub N}, the magnetic moment of {sup 48}Sc is deduced as {mu}({sup 44}Sc)=+3.785(12) {mu}{sub N}. The measured magnetic moment of {sup 48}Sc is discussed in terms of the shell model using the effective interactions.

  18. Xemilofiban: SC 54684A, xemlofiban.

    Science.gov (United States)

    2003-01-01

    Xemilofiban [SC 54684, SC 54684A (HCl), xemlofiban], a glycoprotein IIb/IIIa antagonist, is an orally available prodrug of a non-peptide mimetic of the tetrapeptide RGDF. It is converted to the active metabolite, SC 54701 (the free base form of SC 54701A). Development was initiated by Searle (Monsanto). Searle became part of Pharmacia Corporation, which was acquired by, and merged into, Pfizer in April 2003. Searle had co-development and co-marketing agreements with Sankyo in Japan; these have been discontinued. In January 2003, Pharmacia donated the intellectual property for xemilofiban to Western Michigan University. In February 2003, Western Michigan University granted an exclusive worldwide licence of xemilofiban to VDDI Pharmaceuticals (formerly Virtual Drug Development Inc.). Xemilofiban was in a phase III clinical trial, the Evaluation of Xemilofiban in Controlling Thrombotic Events (EXCITE) trial, with Searle (Monsanto) in the US and Europe for the treatment of thrombosis in patients with unstable angina pectoris and acute myocardial infarction undergoing angioplasty. However, as xemilofiban demonstrated no significant clinical benefit, Searle discontinued its development. In Japan, Sankyo discontinued the development of xemilofiban for thrombosis at phase II following Searle's decision to drop the project. VDDI Pharmaceuticals plans to develop xemilofiban in cardiovascular disorders following on from the phase III studies completed by Pharmacia; a restructured dosing schedule and narrowed patient selection will be used. VDDI has research facilities worldwide and will utilise facilities in Ireland for the European clinical development programme; research facilities in the Southwest Michigan Innovation Center are planned while the head office of VDDI is based in Tennessee. Xemilofiban is in phase III development for the treatment of cardiovascular disease in conjunction with percutaneous coronary intervention.

  19. Materials Characterization of High-Temperature Epoxy Resins: SC-79 and SC-15/SC-79 Blend

    Science.gov (United States)

    2011-03-01

    Army composite applications. SC-15 is a toughened commercial vacuum-assisted resin transfer molding ( VARTM ) resin produced by Applied Poleramic Inc...very well in VARTM processes and has good damage resistance in structural and ballistic applications. However, the relatively low glass transition...low-viscosity, two-phase toughened, cycloaliphatic amine–cured commercial VARTM resin system designed to be easy to handle and have a long processing

  20. Main: 3SC2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 3SC2 小麦 Bread Wheat Triticum aestivum Serine Carboxypeptidase Ii Chains A And B Nam... 1WHS; X-ray; A=6-260, B=266-418.|PDB; 1WHT; X-ray; A=5-260, B=266-418.|PDB; 3SC2; X-ray; A=1-259, B=266-417...WHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPGQTKNAT wheat_3SC2.jpg ...

  1. Academic Training - Pulsed SC Magnets

    CERN Multimedia

    Françoise Benz

    2006-01-01

    2005-2006 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 2, 3, June 29, 30, 31 May, 1, 2 June 11:00-12:00 - Auditorium, bldg 500 Pulsed SC Magnets by M. Wilson Lecture 1. Introduction to Superconducting Materials Type 1,2 and high temperature superconductors; their critical temperature, field & current density. Persistent screening currents and the critical state model. Lecture 2. Magnetization and AC Loss How screening currents cause irreversible magnetization and hysteresis loops. Field errors caused by screening currents. Flux jumping. The general formulation of ac loss in terms of magnetization. AC losses caused by screening currents. Lecture 3. Twisted Wires and Cables Filamentary composite wires and the losses caused by coupling currents between filaments, the need for twisting. Why we need cables and how the coupling currents in cables contribute more ac loss. Field errors caused by coupling currents. Lecture 4. AC Losses in Magnets, Cooling and Measurement Summary of all loss mech...

  2. 46 CFR 7.70 - Folly Island, SC to Hilton Head Island, SC.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Folly Island, SC to Hilton Head Island, SC. 7.70 Section... BOUNDARY LINES Atlantic Coast § 7.70 Folly Island, SC to Hilton Head Island, SC. (a) A line drawn from the southernmost extremity of Folly Island to latitude 32°35′ N. longitude 79°58.2′ W. (Stono Inlet Lighted...

  3. rotor of the SC rotating condenser

    CERN Multimedia

    1974-01-01

    The rotor of the rotating condenser was installed instead of the tuning fork as the modulating element of the radiofrequency system, when the SC accelerator underwent extensive improvements between 1973 to 1975 (see object AC-025). The SC was the first accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990.

  4. Radiation Protection Section (SC/SL/RP)

    CERN Multimedia

    2006-01-01

    We should like to inform you that the Radiation Protection Section (SC/SL/RP) located on the Prévessin site has moved from Building 865 (ground floor) to new premises in Wing A of Building 892 (second floor). Telephone numbers remain the same. SC/SL/RP section

  5. Intensive archaeological survey of the proposed Savannah River Ecology Laboratory Conference Center and Educational Facility, Savannah River Site, Aiken County, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Stephenson, K.; Crass, D.C.; Sassaman, K.E.

    1993-02-01

    Documented in this report are the methods and results of an intensive archaeological survey for the proposed University of Georgia Savannah River Ecology Laboratory (SREL) Conference Center and Educational Facility on the DOE Savannah River Site (SRS). Archaeological investigations conducted by the Savannah River Archaeological Research Program (SRARP) on the 70-acre project area and associated rights-of-way consisted of subsurface testing at two previously recorded sites and the discovery of one previously unrecorded site. The results show that 2 sites contain archaeological remains that may yield significant information about human occupations in the Aiken Plateau and are therefore considered eligible for nomination to the National Register of Historic Places. Adverse impacts to these sites can be mitigated through avoidance.

  6. SC-FDMA for mobile communications

    CERN Document Server

    Abd El-Samie, Fathi E

    2013-01-01

    SC-FDMA for Mobile Communications examines Single-Carrier Frequency Division Multiple Access (SC-FDMA). Explaining this rapidly evolving system for mobile communications, it describes its advantages and limitations and outlines possible solutions for addressing its current limitations. The book explores the emerging trend of cooperative communication with SC-FDMA and how it can improve the physical layer security. It considers the design of distributed coding schemes and protocols for wireless relay networks where users cooperate to send their data to the destination. Supplying you with the re

  7. 77 FR 74472 - Application to Export Electric Energy; Energia Renovable S.C., LLC

    Science.gov (United States)

    2012-12-14

    ... Application to Export Electric Energy; Energia Renovable S.C., LLC AGENCY: Office of Electricity Delivery and... Renovable) has applied for authority to transmit electric energy from the United States to Mexico pursuant... application from Energia Renovable for authority to transmit electric energy from the United States to...

  8. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  9. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  10. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  11. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  12. Bandwidth challenge teams at SC2003 conference

    CERN Multimedia

    2003-01-01

    Results from the fourth annual High-Performance Bandwidth Challenge, held in conjunction with SC2003, the international conference on high-performance computing and networking which occurred last week in Phoenix, AZ (1 page).

  13. Recrystallization of Al-Sc alloys

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Bykov, Yu.G.; Ber, L.B.

    Scandium effect on the temperature range of aluminium recrystallization was investigated. Al-Sc alloys were studied under cold rolled and hot pressed conditions. It is found that the temperature range of Al-Sc alloy recrystallization depends on ScAl/sub 3/ particle dispersion during recrystallization heats. During heating in quenched alloys at 200-300 deg C decomposition occurs which prevents recrystallization, In the alloys with scandium contents less 0.2% decomposition and recrystallization processes pass simultaneously. In quenched alloys with scandium contents over 0.2% and in aged alloys the initiation and subsequent development of recrystallization are determined by the processes of coalescence and solution of ScAl/sub 3/ phase particles.

  14. Sc3N and Sc2C2 encapsulated B40: Smarter than its carbon analogue

    Science.gov (United States)

    Shah, Esha V.; Roy, Debesh R.

    2016-10-01

    A detailed comparative investigation on the recently synthesised B40 and C40 along with their metal nitride (Sc3N)and carbide (Sc2C2) encapsulated endohedral fullerenes, is performed under density functional theory for the first time. The structures, electronic, thermodynamic and magnetic properties of all the considered compounds are explored in detail. The present study identifies borospherene (B40) and its encapsulated nitride (Sc3N@B40) and carbide (Sc2C2@B40) endohedral borofullerenes as the better candidates for future novel nano-applications compared to their carbon bucky ball analogues.

  15. 77 FR 20375 - Notice of Availability of Secretarial Determination and Basis for Determination Under Section...

    Science.gov (United States)

    2012-04-04

    ... Carolina University of South Carolina-Aiken, Gregg-Graniteville Library, 471 University Parkway, Aiken, SC..., U.S. Department of Energy, Savannah River Operations Office, Aiken, SC 29802 (ATTN: F-Tank Farm... Savannah River Site near Aiken, South Carolina. The FTF consists of 22 underground radioactive waste...

  16. Sc20C60: a volleyballene

    Science.gov (United States)

    Wang, Jing; Ma, Hong-Man; Liu, Ying

    2016-06-01

    An exceptionally stable hollow cage containing 20 scandium atoms and 60 carbon atoms has been identified. This Sc20C60 molecular cluster has a Th point group symmetry and a volleyball-like shape that we refer to below as ``Volleyballene''. Electronic structure analysis shows that the formation of delocalized π bonds between Sc atoms and the neighboring pentagonal rings made of carbon atoms is crucial for stabilizing the cage structure. A relatively large HOMO-LUMO gap (~1.4 eV) was found. The results of vibrational frequency analysis and molecular dynamics simulations both demonstrate that this Volleyballene molecule is exceptionally stable.An exceptionally stable hollow cage containing 20 scandium atoms and 60 carbon atoms has been identified. This Sc20C60 molecular cluster has a Th point group symmetry and a volleyball-like shape that we refer to below as ``Volleyballene''. Electronic structure analysis shows that the formation of delocalized π bonds between Sc atoms and the neighboring pentagonal rings made of carbon atoms is crucial for stabilizing the cage structure. A relatively large HOMO-LUMO gap (~1.4 eV) was found. The results of vibrational frequency analysis and molecular dynamics simulations both demonstrate that this Volleyballene molecule is exceptionally stable. Electronic supplementary information (ESI) available: Sc20C60: a Volleyballene_SI. See DOI: 10.1039/c5nr07784b

  17. Crystal structure of triple oxides HO/sub 2/ScNbO/sub 7/ and Sm/sub 2/ScTaO/sub 7/

    Energy Technology Data Exchange (ETDEWEB)

    Filip' ev, V.S.; Cherner, Ya.E.; Bunina, O.A.; Seregin, V.F.

    The structure of new Ho/sub 2/Sc NbO/sub 7/ and Sm/sub 2/ScTaO/sub 7/ compounds synthesized by the three-stage roasting at 1100-1350 deg C was investigated. Powdergrams of the synthesized compounds indicated to be like the cubic structure of pyrochlore type. Periods of unit cells were determined by Bragg reflex angles. The dependence of unreliability factor on values of the position parameter of oxygen x atoms was calculated. Data were obtained that indirectly indicated a substantial disorder in the disposition of Ho and Sc atoms over A and B positions. Values of bond lengths and valence angles were presented.

  18. Recrystallization and Morphology of Microstructure in Al-Sc Alloys

    Institute of Scientific and Technical Information of China (English)

    Zhang Jun; Zhang Zonghua

    2007-01-01

    Minor addition of Sc to aluminum results in the rapid precipitation of homogeneously distributed Al3Sc dispersoids. The presence of Al3Sc dispersoids is more effective recrystallization inhibitors. Our work established the precipitation of homogeneously distributed Al3Sc dispersoids, which are coherent with the matrix, have the L12 structure. It was also established that the addition of Sc was effective in improving the recrystallization resistance.

  19. K2SC: K2 Systematics Correction

    Science.gov (United States)

    Aigrain, Suzanne; Parviainen, Hannu; Pope, Benjamin

    2016-05-01

    K2SC (K2 Systematics Correction) models instrumental systematics and astrophysical variability in light curves from the K2 mission. It enables the user to remove both position-dependent systematics and time-dependent variability (e.g., for transit searches) or to remove systematics while preserving variability (for variability studies). K2SC automatically computes estimates of the period, amplitude and evolution timescale of the variability for periodic variables and can be run on ASCII and FITS light curve files. Written in Python, this pipeline requires NumPy, SciPy, MPI4Py, Astropy (ascl:1304.002), and George (ascl:1511.015).

  20. Norma Audio Revo SC-/PA-150

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Norma audio是意大利一间顶级HI-Fi音响器材生产商。这款IRevo SC-2/PA-150为正是公司旗下的一款高端型号产品。其中,Revo SC-2前置放大器的放大电路以低噪音、高速和宽频作为设计重点,能反映出音频信号中的每一个细节。

  1. Rapid Selection of Phage Se-scFv with GPX Activity via Combination of Phage Display Antibody Library with Chemical Modification

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Glutathione peroxidase (GPX) plays an important role in scavenging reactive oxygen species. A series of catalytic antibodies with GPX activity have been generated by the authors of this study. To obtain humanized catalytic antibodies, the phage-displayed human antibody library was used to select novel antibodies by repetitive screening. Phage antibodies, scFv-B8 and scFv-H6 with the GSH-binding site, were obtained from the library by enzyme-linked immunosorbent assay(ELISA) analysis with 4 rounds of selection against their respective haptens, S-2,4-dinitriphenyl t-butyl ester(GSH-s-DNP-Bu) and S-2,4-dinitriphenyl t-hexyl ester(GSH-s-DNP-He). Nevertheless, several studies need to be conducted to determine whether scFv-B8 and scFv-H6 possess GPX activity. To enhance the speed of the selection, selenocysteine(Sec, the catalytic group of GPX) was incorporated directly into the phages, scFv-B8 and scFv-H6, by chemical mutation to form the phages Se-scFv-B8 and Se-scFv-H6. The GPX activities were found to be 3012 units/μmol and 2102 units/μmol, respectively. To improve the GPX activity of the phage Se-scFv-B8, DNA shuffling was used to construct a secondary library and another positive phage antibody scFv-B9 was screened out by another panning against GSH-s-DNP-Bu. When Sec was incorporated via chemical mutation into the phage antibody scFv-B9, its GPX activity reached 3560 units/μmol, which is 1.17-fold higher than the phage antibody Se-scFv-B8and almost approached the order of magnitude of native GPX. The rapid selection is the prerequisite for generating humanized Se-scFv with GPX activity.

  2. Measurement of the SC magnetic field

    CERN Multimedia

    CERN PhotoLab

    1973-01-01

    The 3.5-metre-arm carrying 100 Hall plates used for the measurmeent of the SC magnetic field. The arm rotates in a horizontal plane, its positioning and the data read-out are controlled by an on-line computer.

  3. Magnet measuring equipment of SC2

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator.

  4. Magnet measuring equipment of SC2

    CERN Multimedia

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator. On the left, Marinus van Gulik. (See Photo Archive 7402005 and Annual Report 1974, p. 44.)

  5. The Synchrocyclotron (SC) in building 300

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    The red magnet of CERN's first accelerator, the Synchrocyclotron (SC), has occupied a large part of Hall 300 since it was installed in the late 1950s. The remaining part of the 300-square-metre building has been used as a storage room since the accelerator was shut down in 1990. Now a public exhibition will breathe new life into the hall.

  6. Structure, phase transition, and controllable thermal expansion behaviors of Sc(2-x)Fe(x)Mo₃O₁₂.

    Science.gov (United States)

    Wu, Meimei; Liu, Xinzhi; Chen, Dongfeng; Huang, Qingzhen; Wu, Hui; Liu, Yuntao

    2014-09-02

    The crystal structures, phase transition, and thermal expansion behaviors of solid solutions of Sc(2-x)Fe(x)Mo3O12 (0 ≤ x ≤ 2) have been examined using X-ray diffraction (XRD), neutron powder diffraction (NPD), and differential scanning calorimetry (DSC). At room temperature, samples crystallize in a single orthorhombic structure for the compositions of x thermal expansion, and the volumetric coefficients of thermal expansion derived from XRD and NPD are 0.28 × 10(-6) °C(-1) (250-800 °C) and 0.65 × 10(-6) °C(-1) (227-427 °C), respectively. NPD results of Sc2Mo3O12 (x = 0) and Sc(1.3)Fe(0.7)Mo3O12 (x = 0.7) indicate that Fe substitution for Sc induces reduction of the mean Sc(Fe)-Mo nonbond distance and the different thermal variations of Sc(Fe)-O5-Mo2 and Sc(Fe)-O3-Mo2 bond angles. The correlation between the displacements of oxygen atoms and the variation of unit cell parameters was investigated in detail for Sc2Mo3O12.

  7. 77 FR 59451 - Pickens Railway Company-Abandonment Exemption-in Pickens County, SC

    Science.gov (United States)

    2012-09-27

    ... abandon approximately 8.5 miles of rail line between approximate milepost 0.0 (at or near Pickens) and the end of the line at approximate milepost 8.5 (at or near Easley), in Pickens County, S.C. The line traverses United States Postal Service Zip Codes 29671 and 29641. Pickens has certified that: (1) No...

  8. Precipitation hardening in ternary alloys of the Al-Sc-Cu and Al-Sc-Si systems

    Energy Technology Data Exchange (ETDEWEB)

    Kharakterova, M.L.; Eskin, D.G.; Toropova, L.S. (Russian Academy of Sciences, Moscow (Russian Federation). A.A. Baikov Inst. of Metallurgy)

    1994-07-01

    The processes of precipitation hardening in cast ternary alloys of the Al-Sc-Cu and Al-Sc-Si systems were studied in the temperature range of aging from 100 to 450 C and at exposures to 200 h. It was shown that the CuAl[sub 2] and ScAl[sub 3] phases were involved in the process of aging in ternary Al-Sc-Cu alloys, and the Si and V (AlSiSc) phases, in ternary Al-Sc-Si alloys with excess silicon in a supersaturated solid solution. The V phase was for the first time revealed as the hardening phase in aluminum alloys.

  9. LHCb Data Replication During SC3

    CERN Multimedia

    Smith, A

    2006-01-01

    LHCb's participation in LCG's Service Challenge 3 involves testing the bulk data transfer infrastructure developed to allow high bandwidth distribution of data across the grid in accordance with the computing model. To enable reliable bulk replication of data, LHCb's DIRAC system has been integrated with gLite's File Transfer Service middleware component to make use of dedicated network links between LHCb computing centres. DIRAC's Data Management tools previously allowed the replication, registration and deletion of files on the grid. For SC3 supplementary functionality has been added to allow bulk replication of data (using FTS) and efficient mass registration to the LFC replica catalog.Provisional performance results have shown that the system developed can meet the expected data replication rate required by the computing model in 2007. This paper details the experience and results of integration and utilisation of DIRAC with the SC3 transfer machinery.

  10. Reduced-Latency SC Polar Decoder Architectures

    CERN Document Server

    Zhang, Chuan; Parhi, Keshab K

    2011-01-01

    Polar codes have become one of the most favorable capacity achieving error correction codes (ECC) along with their simple encoding method. However, among the very few prior successive cancellation (SC) polar decoder designs, the required long code length makes the decoding latency high. In this paper, conventional decoding algorithm is transformed with look-ahead techniques. This reduces the decoding latency by 50%. With pipelining and parallel processing schemes, a parallel SC polar decoder is proposed. Sub-structure sharing approach is employed to design the merged processing element (PE). Moreover, inspired by the real FFT architecture, this paper presents a novel input generating circuit (ICG) block that can generate additional input signals for merged PEs on-the-fly. Gate-level analysis has demonstrated that the proposed design shows advantages of 50% decoding latency and twice throughput over the conventional one with similar hardware cost.

  11. Single chain Fab (scFab fragment

    Directory of Open Access Journals (Sweden)

    Brenneis Mariam

    2007-03-01

    Full Text Available Abstract Background The connection of the variable part of the heavy chain (VH and and the variable part of the light chain (VL by a peptide linker to form a consecutive polypeptide chain (single chain antibody, scFv was a breakthrough for the functional production of antibody fragments in Escherichia coli. Being double the size of fragment variable (Fv fragments and requiring assembly of two independent polypeptide chains, functional Fab fragments are usually produced with significantly lower yields in E. coli. An antibody design combining stability and assay compatibility of the fragment antigen binding (Fab with high level bacterial expression of single chain Fv fragments would be desirable. The desired antibody fragment should be both suitable for expression as soluble antibody in E. coli and antibody phage display. Results Here, we demonstrate that the introduction of a polypeptide linker between the fragment difficult (Fd and the light chain (LC, resulting in the formation of a single chain Fab fragment (scFab, can lead to improved production of functional molecules. We tested the impact of various linker designs and modifications of the constant regions on both phage display efficiency and the yield of soluble antibody fragments. A scFab variant without cysteins (scFabΔC connecting the constant part 1 of the heavy chain (CH1 and the constant part of the light chain (CL were best suited for phage display and production of soluble antibody fragments. Beside the expression system E. coli, the new antibody format was also expressed in Pichia pastoris. Monovalent and divalent fragments (DiFabodies as well as multimers were characterised. Conclusion A new antibody design offers the generation of bivalent Fab derivates for antibody phage display and production of soluble antibody fragments. This antibody format is of particular value for high throughput proteome binder generation projects, due to the avidity effect and the possible use of

  12. Low Temperature Synthesis and Characterization of AlScMo3O12

    Directory of Open Access Journals (Sweden)

    Rebecca Truitt

    2015-02-01

    Full Text Available Recent interest in low and negative thermal expansion materials has led to significant research on compounds that exhibit this property, much of which has targeted the A2M3O12 family (A = trivalent cation, M = Mo, W. The expansion and phase transition behavior in this family can be tuned through the choice of the metals incorporated into the structure. An undesired phase transition to a monoclinic structure with large positive expansion can be suppressed in some solid solutions by substituting the A-site by a mixture of two cations. One such material, AlScMo3O12, was successfully synthesized using non-hydrolytic sol-gel chemistry. Depending on the reaction conditions, phase separation into Al2Mo3O12 and Sc2Mo3O12 or single-phase AlScMo3O12 could be obtained. Optimized conditions for the reproducible synthesis of stoichiometric, homogeneous AlScMo3O12 were established. High resolution synchrotron diffraction experiments were carried out to confirm whether samples were homogeneous and to estimate the Al:Sc ratio through Rietveld refinement and Vegard’s law. Single-phase samples were found to adopt the orthorhombic Sc2W3O12 structure at 100 to 460 K. In contrast to all previously-reported A2M3O12 compositions, AlScMo3O12 exhibited positive thermal expansion along all unit cell axes instead of contraction along one or two axes, with expansion coefficients (200–460 K of αa = 1.7 × 10−6 K−1, αb = 6.2 × 10−6 K−1, αc = 2.9 × 10−6 K−1 and αV = 10.8 × 10−6 K−1, respectively.

  13. The SC gets ready for visitors

    CERN Multimedia

    Antonella Del Rosso

    2012-01-01

    Hall 300, which houses the Synchrocyclotron (SC), CERN’s first accelerator, is getting ready to host a brand-new exhibition. The site will be one of the stops on the new visit itineraries that will be inaugurated for the 2013 CERN Open Day.   The Synchrocyclotron through the years. Just as it did in the late 1950s, when the accelerator was first installed, the gigantic red structure of the Synchrocyclotron's magnet occupies a large part of the 300-square-metre hall. “We have completed the first phase of the project that will give the SC a new lease of life,” says Marco Silari, the project leader and a member of CERN’s Radiation Protection Group. “We have removed all the equipment that was not an integral part of the accelerator. The hall is now ready for the civil-engineering work that will precede the installation of the exhibition.” The SC was witness to a big part of the history of CERN. The accelerator produced ...

  14. Characterization and closure of the Met Lab Carolina Bay at the Savannah River site, Aiken, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Jerome, K.M.; Frazier, W.L.; Haselow, L.A.; Voss, L.

    1993-07-01

    The Met Lab Carolina Bay is subject to Subtitle C of RCRA and CERCLA requirements. Located in the northwestern section of the Savannah River Site, the Met Lab Carolina Bay is a marshy, oval-shaped natural depression covering approximately six acres. The Carolina Bay received wastes from three sources: the Met Lab Basin A-007 drainage outfall, the A-Area coal-fire power plant A-008 drainage outfall and the A/M-Area vehicle maintenance parking lot stormwater runoff A-009 outfall. Two characterization efforts conducted in 1988/89 and 1991 indicate the presence of metals in the sediments and soils of the bay. The greatest concentrations of the metals and organics being in the north-central portion of the bay. The metals and organics were primarily associated with surface sediments and the organic-rich soil layer to a depth of about two feet. Conclusions from the Human Health Baseline Risk indicate the future on-unit resident exposure to sediments and soil poses an unacceptable level of risk to human health. However, the assumptions built into the calculations lead to conservative human health risk findings. A qualitative Ecological Risk Assessment was performed on the Carolina Bay. This ecological assessment, based on historical and existing sampling data, was found to be insufficient to make a definitive decision on the contaminants` effects on the ecology of the bay. The proposed action for the Carolina Bay is to conduct an ecological characterization. It appears that the ecological risks will be in the driving factor in determining the remedial action for the Met Lab Carolina Bay.

  15. ViSC Social Competence Program.

    Science.gov (United States)

    Strohmeier, Dagmar; Hoffmann, Christine; Schiller, Eva-Maria; Stefanek, Elisabeth; Spiel, Christiane

    2012-01-01

    The ViSC Social Competence Program has been implemented in Austrian schools within the scope of a national strategy plan, Together Against Violence. The program is a primary preventive program designed for grades 5 to 8. The prevention of aggression and bullying is defined as a school development task, and the initial implementation of the program lasts one school year. The program consists of universal and specific actions that are implemented through in-school teacher training and a class project for students. The program was evaluated with a randomized intervention control group design. Data were collected from teachers and students. Results suggest that the program reduces aggression in schools.

  16. Axial compression behavior and partial composite action of SC walls in safety-related nuclear facilities

    Science.gov (United States)

    Zhang, Kai

    Steel-plate reinforced concrete (SC) composite walls typically consist of thick concrete walls with two exterior steel faceplates. The concrete core is sandwiched between the two steel faceplates, and the faceplates are attached to the concrete core using shear connectors, for example, ASTM A108 steel headed shear studs. The shear connectors and the concrete infill enhance the stability of the steel faceplates, and the faceplates serve as permanent formwork for concrete placement. SC composite walls were first introduced in the 1980's in Japan for nuclear power plant (NPP) structures. They are used in the new generation of nuclear power plants (GIII+) and being considered for small modular reactors (SMR) due to their structural efficiency, economy, safety, and construction speed. Steel faceplates can potentially undergo local buckling at certain locations of NPP structures where compressive forces are significant. The steel faceplates are usually thin (0.25 to 1.50 inches in Customary units, or 6.5 to 38 mm in SI units) to maintain economical and constructional efficiency, the geometric imperfections and locked-in stresses induced during construction make them more vulnerable to local buckling. Accidental thermal loading may also reduce the compressive strength and exacerbate the local buckling potential of SC composite walls. This dissertation presents the results from experimental and numerical investigations of the compressive behavior of SC composite walls at ambient and elevated temperatures. The results are used to establish a slenderness limit to prevent local buckling before yielding of the steel faceplates and to develop a design approach for calculating the compressive strength of SC composite walls with non-slender and slender steel faceplates at ambient and elevated temperatures. Composite action in SC walls is achieved by the embedment of shear connectors into the concrete core. The strength and stiffness of shear connectors govern the level of

  17. {sup 27}Al and {sup 45}Sc NMR spectroscopy on ScT{sub 2}Al and Sc(T{sub 0.5}T{sup '}{sub 0.5}){sub 2}Al (T = T{sup '} = Ni, Pd, Pt, Cu, Ag, Au) Heusler phases and superconductivity in Sc(Pd{sub 0.5}Au{sub 0.5}){sub 2}Al

    Energy Technology Data Exchange (ETDEWEB)

    Benndorf, Christopher [Institut fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Universitaet Muenster (Germany); Institut fuer Physikalische Chemie, Westfaelische Wilhelms-Universitaet Muenster (Germany); Niehaus, Oliver; Janka, Oliver [Institut fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Universitaet Muenster (Germany); Eckert, Hellmut [Institut fuer Physikalische Chemie, Westfaelische Wilhelms-Universitaet Muenster (Germany)

    2015-02-15

    The intermetallic Heusler compounds with ScT{sub 2}Al and Sc(T{sub 0.5}T{sup '}{sub 0.5}){sub 2}Al composition with T = T{sup '} = Ni, Pd, Pt, Cu, Ag, Au were synthesized from the elements by arc melting. They crystallize in the cubic MnCu{sub 2}Al type structure, space group Fm anti 3m. The unit cell parameters were determined by powder X-ray diffraction and the structure of Sc(Pd{sub 0.5}Au{sub 0.5}){sub 2}Al was refined on the basis of single-crystal X-ray diffraction. While the majority of the compounds show Pauli-paramagnetism, ScAu{sub 2}Al and the newly synthesized solid solution Sc(Pd{sub 0.5}Au{sub 0.5}){sub 2}Al exhibit superconductivity with transition temperatures of T{sub C} = 4.4 K and T{sub C} = 3.0(1) K, respectively. The superconducting state of Sc(Pd{sub 0.5}Au{sub 0.5}){sub 2}Al was also investigated by electrical resistivity measurements. All the synthesized compounds were furthermore studied by {sup 27}Al and {sup 45}Sc MAS-NMR spectroscopy. The resonance shifts of the synthesized compounds were determined and in Sc(Pd{sub 1-x}Au{sub x}){sub 2}Al a linear relationship between the resonance shifts and the composition was found. Line broadening effects and enhanced quadrupolar interaction strengths observed in the mixed samples can be attributed to the effect of Pd/Au mixing on the 8c Wyckoff site. The NMR spectroscopic data give no clear evidence for or against Sc/Al site disordering. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  18. Measurement of (43)Sc and (44)Sc production cross-section with an 18MeV medical PET cyclotron.

    Science.gov (United States)

    Carzaniga, Tommaso Stefano; Auger, Martin; Braccini, Saverio; Bunka, Maruta; Ereditato, Antonio; Nesteruk, Konrad Pawel; Scampoli, Paola; Türler, Andreas; van der Meulen, Nicholas

    2017-11-01

    (43)Sc and (44)Sc are positron emitter radionuclides that, in conjunction with the β(-) emitter (47)Sc, represent one of the most promising possibilities for theranostics in nuclear medicine. Their availability in suitable quantity and quality for medical applications is an open issue and their production with medical cyclotrons represents a scientific and technological challenge. For this purpose, an accurate knowledge of the production cross sections is mandatory. In this paper, we report on the cross section measurement of the reactions (43)Ca(p,n)(43)Sc, (44)Ca(p,2n) (43)Sc, (46)Ti(p,α)(43)Sc, and (44)Ca(p,n)(44)Sc at the Bern University Hospital cyclotron. A study of the production yield and purity performed by using commercially available enriched target materials is also presented. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. BOOK REVIEW: Assessing Sc1 for GCSE

    Science.gov (United States)

    Reynolds, H.

    2000-01-01

    It is well known that investigations that `fit' the National Curriculum or examination board criteria are few in number. The fair testing emphasis means that pupils all over the country are finding out what affects the rate of a chemical reaction, the rate of photosynthesis or, in the case of Physics, the resistance of a wire. This book focuses on nine of the most common Sc1 investigations and how to prepare for them, manage and assess them. The author, a GCSE examiner, has turned his expertise into a handbook for improving Sc1 performance in the classroom. He has produced a book that would be extremely useful to both newly qualified teachers and experienced teachers. The first aim of the book, however, is to explain the requirements of Sc1. This is done comprehensively with examples of what the jargon means in practice. By breaking down the elements of planning, obtaining evidence, analysing evidence and evaluating, it is easy to see the subtleties of the mark descriptors. At first glance there seems to be little difference between the type of scientific knowledge needed for planning at level 6 and level 8. However, the level 8 statement specifies `detailed' scientific knowledge and understanding, which would mean a student should use equations from physics or symbolic chemical equations to support their arguments. One of the most useful sections in the book details the marking problems that can arise with some investigations. For example, in an investigation into electromagnets it is difficult for students to provide sufficient relevant scientific theory to satisfy the requirements of planning at level 6. One of the problems with Sc1 is that certain requirements, such as graph plotting, are difficult for many students. This book provides exercises that can be given to students to improve those skills. Each of the nine investigations is covered in great detail. Each investigation begins with an introduction detailing the rationale for choosing it, whether students

  20. Construction of multiform scFv antibodies using linker peptide

    Institute of Scientific and Technical Information of China (English)

    Shihua Wang; Cengjie Zheng; Ying Liu; Huirong Zheng; Zonghua Wang

    2008-01-01

    Multiform single chain variable fragments (acFvs) including different length linker scFvs and bispecific seFv were constructed. The linker lengths of 0, 3, 5, 8, 12, and 15 amino acids between VH and VL of antideoxynivalenol (anti-DON) scFv were used to analyze the affinities of scFvs. The affinity constants of these scFvs increased when the linker was lower than 12 amino acids. The affinity constant would not change when the linker was longer than 12 amino acids. Fusion gene of anti-DON seFv and antizearalenone (anti-ZEN) scFv was also constructed through eormection by a short peptide tinker DNA to express a bispecific scFv. The affinity constants assay showed that the two scFvs of fusion bispecific scFv remained their own affinity compared to their parental scFvs. Competitive direct enzyme linked immunosorbent assay was used to detect DON and ZEN in contaminated wheat (Triticum aestivum L.) samples, and the results indicated that this bispecifie acFv was applicable in DON and ZEN detection. This work confirmed that bispecific scFv could be successfully obtained, and might also have an application in diagnosing fungal infection, and breeding transgertic plants.

  1. DATABASE, AIKEN COUNTY, SOUTH CAROLINA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Digital Flood Insurance Rate Map (DFIRM) Database depicts flood risk information and supporting data used to develop the risk data. The primary risk...

  2. Effects of Sc and Y substitution on the structure and thermoelectric properties of Yb14MnSb11

    Science.gov (United States)

    Grebenkemper, Jason H.; Klemenz, Sebastian; Albert, Barbara; Bux, Sabah K.; Kauzlarich, Susan M.

    2016-10-01

    Yb14MnSb11 is the most efficient bulk p-type thermoelectric material for high temperature applications. Materials with Y and Sc substitutions in Yb14MnSb11 were made both in Sn-flux and by ball milling. These small 3+ rare earth (RE) cations were introduced with the goal of providing chemical pressure on the structure. The RE3+ cation is smaller than Yb2+ and also donates one additional electron to this p-type semiconductor. In Yb14-xRExMnSb11 (RE = Sc, Y) the maximum x was about 0.5. X-ray diffraction experiments on the single crystals obtained from Sn-flux showed that Sc preferentially substitutes for Yb(1) and Yb(3), and decreases the size of the unit cell by about 0.3%. Y substitutes on all Yb sites and increases the size of the unit cell by about 0.2%. Samples with Yb14-xRExMnSb11 (x~0.3) were prepared via powder metallurgy and spark plasma sintering for transport and thermal conductivity measurements. Electron microprobe of the Sc-substituted sample showed small regions (≤1 μ m) containing greater amounts of Sc, and X-ray powder diffraction of the ball milled Sc sample could be fitted as phase pure Yb14-xScxMnSb11. Y-substituted samples showed larger regions of excess Y in electron microprobe, and small amounts of Yb4Sb3 in X-ray powder diffraction. The Sc sample has slightly reduced carrier concentration over optimized Yb14MnSb11, while the Y samples have even lower carrier concentrations. These carrier concentrations lead to comparable resistivity to Yb14MnSb11 in the Sc-substituted material, and higher resistivities in the Y-substituted material. All materials had similar Seebeck coefficients that slightly exceed Yb14MnSb11 at high temperatures, with the Sc-substituted sample having the highest despite having a higher carrier concentration. Sc-substituted samples also had a slightly higher thermal conductivity over the Y-substituted samples, which had comparable thermal conductivity to Yb14MnSb11. The zT values of the Sc and Y substituted samples are

  3. SC response characteristics of two kinds of coagulant

    Institute of Scientific and Technical Information of China (English)

    杨万东; 宋爽; 史惠祥

    2002-01-01

    Automatic coagulant dosage control with streaming current (SC) technique is introduced in this paper. Aluminum and ferric coagulants are widely used in surface water treatment. The SC response characteristics of P-AlCl3 aluminum coagulant and P-FeCl3 ferric coagulant were investigated in this work. Bench-scale water treatment results were obtained from jar tests including rapid mixing, flocculation and undisturbed sedimentation. Results showed that aluminum coagulant is more sensitive than ferric coagulant to SC response.

  4. SC response characteristics of two kinds of coagulant

    Institute of Scientific and Technical Information of China (English)

    杨万东; 宋爽; 史惠祥

    2002-01-01

    Automatic coagulant dosage control with streaming current (SC) technique is in troduced inthis paper. Aluminum and ferric coagulants are widely used in surface water treatment. The SC response characteristics of P-AiCI3 aluminum coagulant and P-FeCI3 ferric coagulant were investigated in this work. Bench-scale water treatment results were obtained from jar tests including rapid mixing,flocculation and undisturbed sedimentation. Results showed that aluminum coagulant is more sensitive than ferric coagulant to SC response.

  5. Final Scientific Report: DE-SC0002194

    Energy Technology Data Exchange (ETDEWEB)

    Seidler, Gerald [Univ. of Washington, Seattle, WA (United States)

    2017-04-07

    We provide the final scientific report for DE-SC0002194. During the term of this grant, 28 publications spanning a variety of topics were addressed under the rubric of advanced x-ray methods and their application to extreme conditions of time-resolution or x-ray intensities. Notable accomplishments include a new observation of XANES features associated with f-shell reconfiguration in lanthanides, size-dependent x-ray heating effects under XFEL illumination conditions, theoretical development of improved treatments of inelastic x-ray scattering for 'warm dense matter' conditions, and several new instrument develop efforts for atomic, molecular, and condensed phase studies in the lab and at major facility lightsources.

  6. Anomalous Halo Formation in an Arc-Melted ScNi-Sc2Ni Off-Eutectic Binary Alloy

    Directory of Open Access Journals (Sweden)

    Kai Wang

    2016-07-01

    Full Text Available Diverse non-equilibrium eutectic structures have attracted numerous experimental and theoretical studies. One special type is the formation of a halo of one phase around a primary dendrite of another phase. In our experiments, it was occasionally observed that ScNi halos grow as dendritic morphology around the primary Sc 2 Ni dendrites in an arc-melted ScNi-Sc 2 Ni off-eutectic binary alloy. The formation of this anomalous halo structure was then well reproduced by employing quantitative phase-field simulations. Based on the phase-field simulation, It was found that (i the large undercooling and growth velocity of the ScNi phase during solidification causes the formation of halos; and (ii the released latent heat induces the recalescence phenomenon, and changes the solidification sequence largely, resulting in the anomalous halo structure in the Sc-34 at % Ni alloy.

  7. Atomic structure and phason modes of the Sc-Zn icosahedral quasicrystal.

    Science.gov (United States)

    Yamada, Tsunetomo; Takakura, Hiroyuki; Euchner, Holger; Pay Gómez, Cesar; Bosak, Alexei; Fertey, Pierre; de Boissieu, Marc

    2016-07-01

    The detailed atomic structure of the binary icosahedral (i) ScZn7.33 quasicrystal has been investigated by means of high-resolution synchrotron single-crystal X-ray diffraction and absolute scale measurements of diffuse scattering. The average atomic structure has been solved using the measured Bragg intensity data based on a six-dimensional model that is isostructural to the i-YbCd5.7 one. The structure is described with a quasiperiodic packing of large Tsai-type rhombic triacontahedron clusters and double Friauf polyhedra (DFP), both resulting from a close-packing of a large (Sc) and a small (Zn) atom. The difference in chemical composition between i-ScZn7.33 and i-YbCd5.7 was found to lie in the icosahedron shell and the DFP where in i-ScZn7.33 chemical disorder occurs on the large atom sites, which induces a significant distortion to the structure units. The intensity in reciprocal space displays a substantial amount of diffuse scattering with anisotropic distribution, located around the strong Bragg peaks, that can be fully interpreted as resulting from phason fluctuations, with a ratio of the phason elastic constants K 2/K 1 = -0.53, i.e. close to a threefold instability limit. This induces a relatively large perpendicular (or phason) Debye-Waller factor, which explains the vanishing of 'high-Q perp' reflections.

  8. IEC SC15E: Report on liaison activities of CIGRÉ-SC15

    DEFF Research Database (Denmark)

    Henriksen, Mogens

    2000-01-01

    WG’s activities under CIGRÉ SC15:WG 15.01 - Fluid impregnated systems.WG 15.02 - Dielectric Liquids.WG 15.03 - Gas Insulation.WG 15.04 - Outdoor Insulation.WG 15.05 - Capacitors.WG 15.07 - Solid Insulating Materials for Rotating Machines.WG 15/33.08 - Insulation Monitoring and Life Estimation. WG...

  9. Energy dependence of deformation parameters in the SC(p,p') SC reaction

    Energy Technology Data Exchange (ETDEWEB)

    Jones, K.W.; Glashausser, C.; de Swiniarski, R.; Nanda, S.; Carey, T.A.; Cornelius, W.; Moss, J.M.; McClelland, J.B.; Comfort, J.R.; Escudie, J.

    1986-01-01

    Values of deformation parameters have been extracted from macroscopic coupled-channels analyses of inelastic proton scattering to the first 2 , 3 , and 4 states of SC over the energy range from 200 to 700 MeV. The apparent deformations are almost unchanged over this energy interval; they agree also with nucleon scattering data at much lower energies and at 800 MeV and 1 GeV.

  10. Electronic structure and magnetism of new scandium-based full Heusler compounds: Sc{sub 2}CoZ (Z = Si, Ge, Sn)

    Energy Technology Data Exchange (ETDEWEB)

    Birsan, A., E-mail: anca_birsan@infim.ro

    2014-06-15

    Highlights: • First principles calculations were performed for Sc{sub 2}CoSi, Sc{sub 2}CoGe and Sc{sub 2}CoSn. • The total magnetic moments are 1μ{sub B}/f.u. at equilibrium lattice constants. • Sc{sub 2}CoSi is fully spin polarized for lattice parameters ranging between 6.21 and 6.56 Å. • Sc{sub 2}CoGe presents a pseudogap formed around Fermi level. • Sc{sub 2}CoSn exhibits a half metallic ferromagnetic character, up to 7.05 Å. - Abstract: First principles FPLAPW calculations were performed in the framework of Density Functional Theory (DFT), to study the electronic structures and magnetic properties for the new full-Heusler compounds: Sc{sub 2}CoZ (Z = Si, Ge, Sn). The investigated materials are stable against decomposition, in ferromagnetic configuration and crystallize in the inverse Heusler structures. The half-metallic properties as function of the variation of unit cell volumes are analysed regarding the fourth main group constituent elements. The electronic structure calculations for Sc{sub 2}CoSi and Sc{sub 2}CoSn show half-metallic characters, with indirect band gaps of 0.544 eV and 0.408 eV at optimised lattice parameters of 6.28 Å and 6.62 Å, respectively. For Sc{sub 2}CoGe compound, the Fermi energy is not pinned inside the energy band gap from minority density of states, neither for unit cell contraction nor for enlargement. The calculated total magnetic moments are 1μ{sub B}/f.u., for all compounds, in agreement with Slater–Pauling rule.

  11. Effect of minor Sc and Zr addition on grain refi nement of as-cast Al-Zn-Mg-Cu alloys

    Directory of Open Access Journals (Sweden)

    He Yongdong

    2009-08-01

    Full Text Available The optical microscopy and scanning electron microscopy as well as energy dispersive spectroscopy were employed to investigate the infl uence of joint addition of Sc and Zr on grain refi nement of Al-Zn-Mg-Cu alloys.Results show that the addition of 0.20% Sc has a little effect on grain refi nement because Sc is mainly dissolved into the matrix and hardly any primary Al3Sc particles are precipitated. The alloy with addition of 0.30% Sc and 0.16% Zr has more equiaxed grains than that of others, giving cast grain sizes as fi ne as 13 μm. This is because the Sc substitutes for Al atom in the Al-Zr crystal cell and forms Al-Sc-Zr unit cell, which grows and becomes Al3(Scx,Zr1-x particle, acting as a nucleus for the formation of α-Al. The addition of 0.04% Ti and 0.008% B makes the grain size drop from 250 μm to 50 μm. Its refi nement effect is less than the 13 μm achieved by the alloy including 0.30% Sc and 0.16% Zr.

  12. Human bulbar conjunctival hemodynamics in hemoglobin SS and SC disease.

    Science.gov (United States)

    Wanek, Justin; Gaynes, Bruce; Lim, Jennifer I; Molokie, Robert; Shahidi, Mahnaz

    2013-08-01

    The known biophysical variations of hemoglobin (Hb) S and Hb C may result in hemodynamic differences between subjects with SS and SC disease. The purpose of this study was to measure and compare conjunctival hemodynamics between subjects with Hb SS and SC hemoglobinopathies. Image sequences of the conjunctival microcirculation were acquired in 9 healthy control subjects (Hb AA), 24 subjects with SC disease, and 18 subjects with SS disease, using a prototype imaging system. Diameter (D) and blood velocity (V) measurements were obtained in multiple venules of each subject. Data were categorized according to venule caliber by averaging V and D for venules with diameters less than (vessel size 1) or greater than (vessel size 2) 15 µm. V in vessel size 2 was significantly greater than V in vessel size 1 in the AA and SS groups (P ≥ 0.009), but not in the SC group (P = 0.1). V was significantly lower in the SC group as compared to the SS group (P = 0.03). In AA and SS groups, V correlated with D (P ≤ 0.005), but the correlation was not statistically significant in the SC group (P = 0.08). V was inversely correlated with hematocrit in the SS group for large vessels (P = 0.03); however, no significant correlation was found in the SC group (P ≥ 0.2). Quantitative assessment of conjunctival microvascular hemodynamics in SS and SC disease may advance understanding of sickle cell disease pathophysiology and thereby improve therapeutic interventions.

  13. 76 FR 58401 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2011-09-21

    ... Zone; Swim Around Charleston, Charleston, SC in the Federal Register (76 FR 38586). We received no... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... temporary moving safety zone during the Swim Around Charleston, a swimming race occurring on waters of...

  14. Thermal stability of Al-Mg-Sc-Zr alloy

    Institute of Scientific and Technical Information of China (English)

    ZHAO Wei-tao; YAN De-sheng; RONG Li-jian

    2006-01-01

    The thermal stability of Al3(Sc,Zr) precipitates in the cold worked Al-Mg-Sc-Zr alloy after elevated temperature exposure was investigated. The evaluation was conducted using room temperature tensile, Vicker's hardness, optical metallography and scanning electron microscope (SEM) with the backscatter. The results show that the Al3(Sc,Zr) precipitates and mechanical properties have no obvious change, and the grains keep elongated along the working direction as that in cold worked sample after exposure at 300 ℃ for 1 000 h. The coarsening of Al3(Sc,Zr) precipitates occurs and is no longer effective on the recrystallization resistance, and partial recrystallization is observed after 400 ℃ exposure. In particular, after 500 ℃ exposure, the hardness decreases drastically and the alloy has fully recrystallized due to the obvious coarsening of Al3(Sc,Zr) precipitates.

  15. Cyclotron production of (44)Sc: From bench to bedside.

    Science.gov (United States)

    van der Meulen, Nicholas P; Bunka, Maruta; Domnanich, Katharina A; Müller, Cristina; Haller, Stephanie; Vermeulen, Christiaan; Türler, Andreas; Schibli, Roger

    2015-09-01

    (44)Sc, a PET radionuclide, has promising decay characteristics (T1/2 = 3.97 h, Eβ(+)av = 632 keV) for nuclear imaging and is an attractive alternative to the short-lived (68)Ga (T1/2 = 68 min, Eβ(+)av = 830 keV). The aim of this study was the optimization of the (44)Sc production process at an accelerator, allowing its use for preclinical and clinical PET imaging. (44)CaCO3 targets were prepared and irradiated with protons (~11 MeV) at a beam current of 50 μA for 90 min. (44)Sc was separated from its target material using DGA extraction resin and concentrated using SCX cation exchange resin. Radiolabeling experiments at activities up to 500 MBq and stability tests were performed with DOTANOC by investigating different scavengers, including gentisic acid. Dynamic PET of an AR42J tumor-bearing mouse was performed after injection of (44)Sc-DOTANOC. The optimized chemical separation method yielded up to 2 GBq (44)Sc of high radionuclidic purity. In the presence of gentisic acid, radiolabeling of (44)Sc with DOTANOC was achieved with a radiochemical yield of ~99% at high specific activity (10 MBq/nmol) and quantities which would allow clinical application. The dynamic PET images visualized increasing uptake of (44)Sc-DOTANOC into AR42J tumors and excretion of radioactivity through the kidneys of the investigated mouse. The concept "from-bench-to-bedside" was clearly demonstrated in this extended study using cyclotron-produced (44)Sc. Sufficiently high activities of (44)Sc of excellent radionuclidic purity are obtainable for clinical application, by irradiation of enriched calcium at a cyclotron. This work demonstrates a promising basis for introducing (44)Sc to clinical routine of nuclear imaging using PET. Copyright © 2015 Elsevier Inc. All rights reserved.

  16. INTERVIU CU DOAMNA SIMONA CAROBENE, ADMINISTRATORUL SC PROIECT MOZAIC SRL

    Directory of Open Access Journals (Sweden)

    Gheorghe Pascaru

    2013-12-01

    Full Text Available Fabrica de mozaic, înregistrată la Oficiul Registrului Comerţului în aprilie 2012 a luat fiinţă în cadrul unui proiect cu finanţare europeană nerambursabilă și are în prezent statutul de unitate protejată autorizată. În cadrul acesteia sunt angajați 10 tineri post instituţionalizați, pentru care integrarea în viaţa socială şi profesională este dificilă. Întreprinderea socială SC Proiect Mozaic SRL este rezultatul întâlnirii dintre sectorul social, non-profit şi sectorul business, deoarece are la bază un parteneriat cu un important grup de firme din domeniul construcţiilor şi amenajărilor interioare din București. În paralel cu activitatea de producţie a mozaicului, ocazional, Proiect Mozaic oferă către clienți și servicii de ambalare și asamblare produse.

  17. Hydride vapor phase epitaxy growth of GaN, InGaN, ScN, and ScAIN

    NARCIS (Netherlands)

    Bohnen, T.

    2010-01-01

    Chemical vapor deposition (CVD); hydride vapor phase epitaxy (HVPE); gallium nitride (GaN); indium gallium nitride (InGaN); scandium nitride (ScN); scandium aluminum nitride (ScAlN); semiconductors; thin films; nanowires; III nitrides; crystal growth - We studied the HVPE growth of different III ni

  18. Effective single chain antibody (scFv) concentrations in vivo via adenoviral vector mediated expression of secretory scFv

    NARCIS (Netherlands)

    Arafat, WO; Gomez-Navarro, J; Buchsbaum, DJ; Xiang, J; Casado, E; Barker, SD; Mahasreshti, PJ; Haisma, HJ; Barnes, MN; Siegal, GP; Alvarez, RD; Hemminki, A; Nettelbeck, DM; Curiel, DT

    2002-01-01

    Single chain antibodies (scFv) represent powerful interventional agents for the achievement of targeted therapeutics. The practical utility of these agents have been limited, however, by difficulties related to production of recombinant scFv and the achievement of effective and sustained levels of s

  19. Cyclotron production of {sup 43}Sc for PET imaging

    Energy Technology Data Exchange (ETDEWEB)

    Walczak, Rafał [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Krajewski, Seweryn [Synektik S.A., Research and Development Center, Warsaw (Poland); Szkliniarz, Katarzyna [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Sitarz, Mateusz [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Abbas, Kamel [Nuclear Security Unit, Joint Research Centre, Institute for Transuranium Elements, European Commission, Ispra (Italy); Choiński, Jarosław; Jakubowski, Andrzej; Jastrzębski, Jerzy [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Majkowska, Agnieszka [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Simonelli, Federica [Nuclear Decommissioning Unit, Joint Research Centre, Ispra Site Management Directorate, European Commission, Ispra (Italy); Stolarz, Anna; Trzcińska, Agnieszka [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Zipper, Wiktor [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland)

    2015-12-04

    Recently, significant interest in {sup 44}Sc as a tracer for positron emission tomography (PET) imaging has been observed. Unfortunately, the co-emission by {sup 44}Sc of high-energy γ rays (E{sub γ} = 1157, 1499 keV) causes a dangerous increase of the radiation dose to the patients and clinical staff. However, it is possible to produce another radionuclide of scandium—{sup 43}Sc—having properties similar to {sup 44}Sc but is characterized by much lower energy of the concurrent gamma emissions. This work presents the production route of {sup 43}Sc by α irradiation of natural calcium, its separation and purification processes, and the labeling of [DOTA,Tyr3] octreotate (DOTATATE) bioconjugate. Natural CaCO{sub 3} and enriched [{sup 40}Ca]CaCO{sub 3} were irradiated with alpha particles for 1 h in an energy range of 14.8–30 MeV at a beam current of 0.5 or 0.25 μA. In order to find the optimum method for the separation of {sup 43}Sc from irradiated calcium targets, three processes previously developed for {sup 44}Sc were tested. Radiolabeling experiments were performed with DOTATATE radiobioconjugate, and the stability of the obtained {sup 43}Sc-DOTATATE was tested in human serum. Studies of {sup nat}CaCO{sub 3} target irradiation by alpha particles show that the optimum alpha particle energies are in the range of 24–27 MeV, giving 102 MBq/μA/h of {sup 43}Sc radioactivity which creates the opportunity to produce several GBq of {sup 43}Sc. The separation experiments performed indicate that, as with {sup 44}Sc, due to the simplicity of the operations and because of the chemical purity of the {sup 43}Sc obtained, the best separation process is when UTEVA resin is used. The DOTATATE conjugate was labeled by the obtained {sup 43}Sc with a yield >98 % at elevated temperature. Tens of GBq activities of {sup 43}Sc of high radionuclidic purity can be obtainable for clinical applications by irradiation of natural calcium with an alpha beam.

  20. Acute Splenic Sequestration Crisis in a 70-Year-Old Patient With Hemoglobin SC Disease

    Directory of Open Access Journals (Sweden)

    John J. Squiers BSE

    2016-03-01

    Full Text Available A 70-year-old African American female with a past medical history significant for chronic bilateral shoulder pain and reported sickle cell trait presented with acute-onset bilateral thoracolumbar pain radiating to her left arm. Two days after admission, Hematology was consulted for severely worsening microcytic anemia and thrombocytopenia. Examination of the patient’s peripheral blood smear from admission revealed no cell sickling, spherocytes, or schistocytes. Some targeting was noted. A Coombs test was negative. The patient was eventually transferred to the medical intensive care unit in respiratory distress. Hemoglobin electrophoresis confirmed a diagnosis of hemoglobin SC disease. A diagnosis of acute splenic sequestration crisis complicated by acute chest syndrome was crystallized, and red blood cell exchange transfusion was performed. Further research is necessary to fully elucidate the pathophysiology behind acute splenic sequestration crisis, and the role of splenectomy to treat hemoglobin SC disease patients should be better defined.

  1. Supercritical CO2 direct cycle Gas Fast Reactor (SC-GFR) concept.

    Energy Technology Data Exchange (ETDEWEB)

    Wright, Steven Alan; Parma, Edward J., Jr.; Suo-Anttila, Ahti Jorma (Computational Engineering Analysis, Albuquerque, NM); Al Rashdan, Ahmad (Texas A& M University, College Station, TX); Tsvetkov, Pavel Valeryevich (Texas A& M University, College Station, TX); Vernon, Milton E.; Fleming, Darryn D.; Rochau, Gary Eugene

    2011-05-01

    This report describes the supercritical carbon dioxide (S-CO{sub 2}) direct cycle gas fast reactor (SC-GFR) concept. The SC-GFR reactor concept was developed to determine the feasibility of a right size reactor (RSR) type concept using S-CO{sub 2} as the working fluid in a direct cycle fast reactor. Scoping analyses were performed for a 200 to 400 MWth reactor and an S-CO{sub 2} Brayton cycle. Although a significant amount of work is still required, this type of reactor concept maintains some potentially significant advantages over ideal gas-cooled systems and liquid metal-cooled systems. The analyses presented in this report show that a relatively small long-life reactor core could be developed that maintains decay heat removal by natural circulation. The concept is based largely on the Advanced Gas Reactor (AGR) commercial power plants operated in the United Kingdom and other GFR concepts.

  2. EngenuitySC Commercialization and Entrepreneurial Training Project

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, Meghan; Hutton, Katherine R

    2012-12-31

    Holtec International for research about deployment of advanced small modular reactor (SMR) technologies. The workforce training efforts from NuHub have focused on assisting existing industry to fill positions needed to construct and operate new nuclear plants being built at the VC Summer plant in Jenkinsville, SC and at Plant Votgle in Augusta, Georgia both of whom are constructing the first nuclear reactors (Westinghouse AP 1000 units), to be built in over 30 years. This includes a partnership with Midlands Technical College to train reactor operators and the development of training facilities to support workforce development activities. It is anticipated that approximately 70 students a year will be trained through these programs in the next five years, and it will be expanded to meet new industry needs.

  3. Effects of cooling rate on solidification behavior of dilute Al-Sc and Al-Sc-Zr solid solution

    Institute of Scientific and Technical Information of China (English)

    金头男; 聂祚仁; 徐国富; 阮海琼; 杨军军; 付静波; 左铁镛

    2004-01-01

    Six alloys with different compositions of Al-0.1%Sc, Al-0.3%Sc, Al-0.3%Zr, Al-0.1% Sc-0. 1%Zr,Al-0.3%Sc-0.1%Zr and Al-0.3%Sc-0.3%Zr were prepared by casting in a wedge shaped copper mould. The hardness test, microstructure observation, and DSC thermal analysis were applied to fully investigate the solidification behavior of the wedge tip (whose cooling rate is 1 000 K/s) and the top surface (cooling rate 100 K/s) of each casting. The results show that the cast structures in the hypoeutectic region of Al-Sc alloys are slightly affected by cooling rates during the solidification. In the case of hypereutectic alloy of Al-0.3%Sc-0.3%Zr , the cast grains were remarkably refined under the condition of a 100 K/s cooling rate, however, under a 1 000 K/s cooling rate condition,solute atoms contribute nothing to the grain-refinement, due to the eutectic concentration becomes higher. The hardness can be improved to a greater degree by Sc single addition, compared to single Zr addition, but it can be improved even greater when Sc added together with Zr. It is sensitive to cooling rate, the higher the cooling rate, the greater the hardness. By combining the results of TEM examination and DSC analysis, it can be seen that a supersaturated Al solid solution forms during the solidification, and the solubility of Sc in Al solution can be improved by increasing the cooling rate.

  4. The influence of shear-velocity heterogeneity on ScS2/ScS amplitude ratios and estimates of Q in the mantle

    Science.gov (United States)

    Chaves, Carlos A. M.; Ritsema, Jeroen

    2016-08-01

    Regional waveforms of deep-focus Tonga-Fiji earthquakes indicate anomalous traveltime differences (ScS2-ScS) and amplitude ratios (ScS2/ScS) of the phases ScS and ScS2. The correlation between the ScS2-ScS delay time and the ScS2/ScS amplitude ratio suggests that shear wave apparent Q in the mantle below the Tonga-Fiji region is highest when shear wave velocities are lowest. This observation is unexpected if temperature variations were responsible for the seismic anomalies. Using spectral element method waveform simulations for four tomographic models, we demonstrate that focusing and scattering of shear waves by long-wavelength 3-D heterogeneity in the mantle may overwhelm the signal from intrinsic attenuation in long-period ScS2/ScS amplitude ratios. The tomographic models reproduce the trends in recorded ScS2-ScS difference times and ScS2/ScS amplitude ratios. Although they cannot be ruled out, variations in shear wave attenuation (i.e., the quality factor Q) are not necessary to explain the data.

  5. Pascal-SC a computer language for scientific computation

    CERN Document Server

    Bohlender, Gerd; von Gudenberg, Jürgen Wolff; Rheinboldt, Werner; Siewiorek, Daniel

    1987-01-01

    Perspectives in Computing, Vol. 17: Pascal-SC: A Computer Language for Scientific Computation focuses on the application of Pascal-SC, a programming language developed as an extension of standard Pascal, in scientific computation. The publication first elaborates on the introduction to Pascal-SC, a review of standard Pascal, and real floating-point arithmetic. Discussions focus on optimal scalar product, standard functions, real expressions, program structure, simple extensions, real floating-point arithmetic, vector and matrix arithmetic, and dynamic arrays. The text then examines functions a

  6. III-V compound SC for optoelectronic devices

    Directory of Open Access Journals (Sweden)

    Sudha Mokkapati

    2009-04-01

    Full Text Available III-V compound semiconductors (SC have played a crucial role in the development of optoelectronic devices for a broad range of applications. Major applications of InP or GaAs based III-V compound SC are devices for optical fiber communications, infrared and visible LEDs/LDs and high efficiency solar cells. GaN based compounds are extremely important for short wavelength light emitters used in solid state lighting systems. We review the important device applications of various III-V compound SC materials.

  7. SC-System of convergence theory and foundations

    Directory of Open Access Journals (Sweden)

    Sergio G. De los Cobos Silva

    2015-08-01

    Full Text Available In this paper a novel system of convergence (SC is presented as well as its fundamentals and computing experience. An implementation using a novel mono-objetive particle swarm optimization (PSO algorithm with three phases (PSO-3P: stabilization, generation with broad-ranging exploration and generation with in-depth exploration, is presented and tested in a diverse benchmark problems. Evidence shows that the three-phase PSO algoritm along with the SC criterion (SC-PSO-3Pcan converge to the global optimum in several difficult test functions for multiobjective optimization problems, constrained optimization problems and unconstrained optimization problems with 2 until 120,000 variables.

  8. 40 CFR Appendix A to Part 81 - Air Quality Control Regions (AQCR's)

    Science.gov (United States)

    2010-07-01

    ... Georgia: Augusta-Aiken (S.C.) 53 Central Georgia 54 Chattanooga (Tenn.) 55 Columbus-Phenix City (Ala.) 2... Providence (Mass.) 120 South Carolina: Augusta-Aiken (Ga.) 53 Camden-Sumter 198 Charleston 199 Columbia 200...

  9. 78 FR 10163 - Notice of Availability of Draft Section 3116 Basis for Determination for Closure of H Tank Farm...

    Science.gov (United States)

    2013-02-13

    ... River Operations Office, Aiken, SC 29802 (ATTN: H-Tank Farm Draft Basis). Alternatively, comments may.... SUPPLEMENTARY INFORMATION: The HTF is a 45-acre site, located at the Savannah River Site (SRS) near Aiken, South...

  10. 75 FR 33270 - Procurement List; Proposed Additions and Deletions

    Science.gov (United States)

    2010-06-11

    ... Clinic (CBOC), 9249 Highway 29 South, Athens, GA. Aiken Community Based Outpatient Clinic (CBOC), 951 Milbrook Avenue, Aiken, SC. Charlie Norwood VA Medical Center Uptown Division, 1 Freedom Way, Augusta, GA...

  11. 78 FR 28576 - Notice of Petitions by Firms for Determination of Eligibility To Apply for Trade Adjustment...

    Science.gov (United States)

    2013-05-15

    ... Kimball, NE 69145. electrical components and parts for alarms and security systems. AGY Aiken, LLC 2556 Wagener Road, Aiken, 5/7/2013 The firm produces fiberglass SC 29801. yarns; the primary manufacturing...

  12. Infectivity-associated PrP(Sc) and disease duration-associated PrP(Sc) of mouse BSE prions.

    Science.gov (United States)

    Miyazawa, Kohtaro; Okada, Hiroyuki; Masujin, Kentaro; Iwamaru, Yoshifumi; Yokoyama, Takashi

    2015-01-01

    Disease-related prion protein (PrP(Sc)), which is a structural isoform of the host-encoded cellular prion protein, is thought to be a causative agent of transmissible spongiform encephalopathies. However, the specific role of PrP(Sc) in prion pathogenesis and its relationship to infectivity remain controversial. A time-course study of prion-affected mice was conducted, which showed that the prion infectivity was not simply proportional to the amount of PrP(Sc) in the brain. Centrifugation (20,000 ×g) of the brain homogenate showed that most of the PrP(Sc) was precipitated into the pellet, and the supernatant contained only a slight amount of PrP(Sc). Interestingly, mice inoculated with the obtained supernatant showed incubation periods that were approximately 15 d longer than those of mice inoculated with the crude homogenate even though both inocula contained almost the same infectivity. Our results suggest that a small population of fine PrP(Sc) may be responsible for prion infectivity and that large, aggregated PrP(Sc) may contribute to determining prion disease duration.

  13. Precipitation in cold-rolled Al-Sc-Zr and Al-Mn-Sc-Zr alloys prepared by powder metallurgy

    KAUST Repository

    Vlach, Martin

    2013-12-01

    The effects of cold-rolling on thermal, mechanical and electrical properties, microstructure and recrystallization behaviour of the AlScZr and AlMnScZr alloys prepared by powder metallurgy were studied. The powder was produced by atomising in argon with 1% oxygen and then consolidated by hot extrusion at 350 C. The electrical resistometry and microhardness together with differential scanning calorimetry measurements were compared with microstructure development observed by transmission and scanning electron microscopy, X-ray diffraction and electron backscatter diffraction. Fine (sub)grain structure developed and fine coherent Al3Sc and/or Al3(Sc,Zr) particles precipitated during extrusion at 350 C in the alloys studied. Additional precipitation of the Al3Sc and/or Al3(Sc,Zr) particles and/or their coarsening was slightly facilitated by the previous cold rolling. The presence of Sc,Zr-containing particles has a significant antirecrystallization effect that prevents recrystallization at temperatures minimally up to 420 C. The precipitation of the Al6Mn- and/or Al 6(Mn,Fe) particles of a size ~ 1.0 μm at subgrain boundaries has also an essential antirecrystallization effect and totally suppresses recrystallization during 32 h long annealing at 550 C. The texture development of the alloys seems to be affected by high solid solution strengthening by Mn. The precipitation of the Mn-containing alloy is highly enhanced by a cold rolling. The apparent activation energy of the Al3Sc particles formation and/or coarsening and that of the Al6Mn and/or Al 6(Mn,Fe) particle precipitation in the powder and in the compacted alloys were determined. The cold deformation has no effect on the apparent activation energy values of the Al3Sc-phase and the Al 6Mn-phase precipitation. © 2013 Elsevier Inc.

  14. Design of SC walls and slabs for impulsive loading

    Energy Technology Data Exchange (ETDEWEB)

    Varma, Amit H. [Purdue Univ., West Lafayette, IN (United States)

    2015-11-11

    Reinforced concrete (RC) structures have historically been the preferred choice for blast resistant structures because of their mass and the ductility provided by steel reinforcement. Steel-plate composite (SC) walls are a viable alternative to RC for protecting the infrastructure against explosive threats. SC structures consist of two steel faceplates with a plain concrete core between them. The steel faceplates are anchored to the concrete using stud anchors and connected to each other using tie bars. SC structures provide mass from the concrete infill and ductility from the continuous external steel faceplates. This dissertation presents findings and recommendations from experimental and analytical investigations of the performance of SC walls subjected to far-field blast loads.

  15. The data acquisition system (DAS) for the improved CERN SC

    CERN Document Server

    Beger, H; Fiebig, A; Schroot, H

    1975-01-01

    A digital data acquisition system (DAS) based on a minicomputer is described which registers the failure sequences in various equipment areas of the CERN synchrocyclotron (henceforward referred to as the SC). The avalanches of failure signals which occur from time to time are tapped from the alarm/security systems, time-resolved to 10 msec and recorded on a printer in order to aid SC failure diagnosis. The mechanisms of the DAS and its relation to the SC equipment are explained in some detail. All programs were constructed at assembler language level for speed and for ease of on-line program maintenance. The alarm sequences recorded have been of considerable help during the running in of the new radiofrequency system. Now that the new SC is operational, the DAS furnishes useful data from several equipment areas to the operators and engineers.

  16. 75 FR 71734 - Outer Continental Shelf (OCS), Scientific Committee (SC)

    Science.gov (United States)

    2010-11-24

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management, Regulation and Enforcement Outer Continental Shelf (OCS), Scientific Committee (SC) AGENCY: Bureau of Ocean Energy Management, Regulation and Enforcement (BOEMRE),...

  17. Aging of Al-0,3 at. % Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Ber, L.B.; Bykov, L.S.; Toropova, L.S.; Anastas' eva, G.K. (AN SSSR, Moscow. Inst. Metallurgii)

    1984-06-01

    Method of measuring electric conductivity, hardness and yield limit was used to study the kinetics of aging of Al-0.3 at.%Sc alloy in 20-450 deg c range. It was established by X-ray methods of monocrystal investigation and diffraction electron microscopy that coherent precipitations of equilibrium ScAl/sub 3/ pha se with li/sub 2/ type structure and 0.41 nm lattice parameter represent the product of decomposition of supersaturated solid solution. Characteristic features and the kinetics of ScAl/sub 3/ phase particle growth were studied by the electron microscopic method. The activation energy of scandium and aluminium diffusion equal to 3.81 MJ/kg was determined. The analysis of deformation hardening of Al-0.3 at.%Sc alloy at different stages of aging was conducted.

  18. Magnetic properties of the Sc-H system

    Energy Technology Data Exchange (ETDEWEB)

    Volkenshtein, N.V.; Galoshina, E.V. (AN SSSR, Sverdlovsk. Ural' skij Nauchnyj Tsentr); Kost, M.E. (AN SSSR, Moscow. Inst. Obshchej i Neorganicheskoj Khimii); Shubina, T.S. (Ural' skij Gosudarstvennyj Univ., Sverdlovsk (USSR))

    1983-05-01

    The magnetic susceptibility in the ..cap alpha..-phase region of the Sc-H system and in scandium hydrides ScH/sub 2/ is investigated. The temperature dependence of the susceptibility was measured from liquid-helium temperature to room temperature in a magnetic field of 10 kOe. The influence of hydrogenation and of band structure parameters (density of states at the Fermi level, spin-relaxation time, and Fermi energy) on the susceptibility is shown and discussed.

  19. Homogenization of alloys in the system Al-Mg-Sc

    Science.gov (United States)

    Drits, M. E.; Toropova, L. S.; Bykov, Yu. G.

    1983-07-01

    A reduction in homogenizing anneal temperature and a reduction in soaking time leads to an increase in yield point for alloys of the system Al-Mg-Sc. The optimum homogenizing schedule for alloys of this system is heating to 400°C and soaking for up to 10 h. This homogenizing schedule provides an alloy structure of fine coherent ScAl3-phase precipitates and dissolution of excess β-phase precipitates.

  20. FPA Tuned Fuzzy Logic Controlled Synchronous Buck Converter for a Wave/SC Energy System

    Directory of Open Access Journals (Sweden)

    SAHIN, E.

    2017-02-01

    Full Text Available This paper presents a flower pollination algorithm (FPA tuned fuzzy logic controlled (FLC synchronous buck converter (SBC for an integrated wave/ supercapacitor (SC hybrid energy system. In order to compensate the irregular wave effects on electrical side of the wave energy converter (WEC, a SC unit charged by solar panels is connected in parallel to the WEC system and a SBC is controlled to provide more reliable and stable voltage to the DC load. In order to test the performance of the designed FLC, a classical proportional-integral-derivative (PID controller is also employed. Both of the controllers are optimized by FPA which is a pretty new optimization algorithm and a well-known optimization algorithm of which particle swarm optimization (PSO to minimize the integral of time weighted absolute error (ITAE performance index. Also, the other error-based objective functions are considered. The entire energy system and controllers are developed in Matlab/Simulink and realized experimentally. Real time applications are done through DS1104 Controller Board. The simulation and experimental results show that FPA tuned fuzzy logic controller provides lower value performance indices than conventional PID controller by reducing output voltage sags and swells of the wave/SC energy system.

  1. Theoretical studies of the low-lying states of ScO, ScS, VO, and VS

    Science.gov (United States)

    Bauschlicher, Charles W., Jr.; Langhoff, Stephen R.

    1986-01-01

    Bonding in the low-lying states of ScO, ScS, VO, and VS is theoretically studied. Excellent agreement is obtained with experimental spectroscopic constants for the low-lying states of ScO and VO. The results for VS and ScS show that the bonding in the oxides and sulfides is similar, but that the smaller electronegativity in S leads to a smaller ionic component in the bonding. The computed D0 of the sulfides are about 86 percent of the corresponding oxides, and the low-lying excited states are lower in the sulfides than in the corresponding oxides. The CPF method is shown to be an accurate and cost-effective method for obtaining reliable spectroscopic constants for these systems.

  2. Effect of homogenizing heatings on the properties of Al-Sc and Al-Mg-Sc alloy systems

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Anastas' eva, G.K.; Nagornichnykh, G.L.

    Effect of annealing on hardness and electric conductivity of cast alloys of Al-Mg-Sc and Al-Sc systems has been studied. Magnesium content in studied alloys was changed in the range of 0-6.5%, scandium content was chosen to be constant -0.4%. It has been revealed that homogenizing heatings of Al-Sc alloys lead to a decomposition of abnormally saturated solid solution during crystallization at temperatures >250 deg C. Maximum hardness values are achieved after annealing at 300 deg C during 1h. Homogenizing of Al-Mg--- Sc alloys at 350 deg C during 24h leads to practically full solubility of a nonequilibrium ..beta..-phase (Mg/sub 2/Al/sub 3/) and also to a decomposition of a solid solution abnormally saturated with scandium. Maximum values of hardness are achieved after annealing at 35O deg C during 0.5-1h.

  3. Compensation of native donor doping in ScN: Carrier concentration control and p-type ScN

    Science.gov (United States)

    Saha, Bivas; Garbrecht, Magnus; Perez-Taborda, Jaime A.; Fawey, Mohammed H.; Koh, Yee Rui; Shakouri, Ali; Martin-Gonzalez, Marisol; Hultman, Lars; Sands, Timothy D.

    2017-06-01

    Scandium nitride (ScN) is an emerging indirect bandgap rocksalt semiconductor that has attracted significant attention in recent years for its potential applications in thermoelectric energy conversion devices, as a semiconducting component in epitaxial metal/semiconductor superlattices and as a substrate material for high quality GaN growth. Due to the presence of oxygen impurities and native defects such as nitrogen vacancies, sputter-deposited ScN thin-films are highly degenerate n-type semiconductors with carrier concentrations in the (1-6) × 1020 cm-3 range. In this letter, we show that magnesium nitride (MgxNy) acts as an efficient hole dopant in ScN and reduces the n-type carrier concentration, turning ScN into a p-type semiconductor at high doping levels. Employing a combination of high-resolution X-ray diffraction, transmission electron microscopy, and room temperature optical and temperature dependent electrical measurements, we demonstrate that p-type Sc1-xMgxN thin-film alloys (a) are substitutional solid solutions without MgxNy precipitation, phase segregation, or secondary phase formation within the studied compositional region, (b) exhibit a maximum hole-concentration of 2.2 × 1020 cm-3 and a hole mobility of 21 cm2/Vs, (c) do not show any defect states inside the direct gap of ScN, thus retaining their basic electronic structure, and (d) exhibit alloy scattering dominating hole conduction at high temperatures. These results demonstrate MgxNy doped p-type ScN and compare well with our previous reports on p-type ScN with manganese nitride (MnxNy) doping.

  4. Conversion of the dual training aircraft (DC into single control advanced training aircraft (SC. Part I

    Directory of Open Access Journals (Sweden)

    Ioan ŞTEFĂNESCU

    2011-03-01

    Full Text Available Converting the DC school jet aircraft into SC advanced training aircraft - and use them forthe combat training of military pilots from the operational units, has become a necessity due to thebudget cuts for Air Force, with direct implications on reducing the number of hours of flight assignedto operating personnel for preparing and training.The purpose of adopting such a program is to reduce the number of flight hours allocated annuallyfor preparing and training in advanced stages of instruction, for every pilot, by more intensive use ofthis type of aircraft, which has the advantage of lower flight hour costs as compared to a supersoniccombat plane.

  5. Final Technical Report for Award SC0008613

    Energy Technology Data Exchange (ETDEWEB)

    Knopf, Daniel A. [Stony Brook Univ., NY (United States)

    2017-04-05

    Discovering how aerosol particles, present in the atmosphere in sizes of a few nanometers to hundred micrometers, initiate ice crystal formation represents a great challenge. Atmospheric ice nucleation is important because ice crystals alter the radiative properties of clouds and thus climate, and impact precipitation and thus the hydrological cycle. The difficulty in predicting atmospheric ice formation is attributable at least in part, to the diversity of ice nucleation pathways, the physical and chemical complexity of the ice nucleating particles (INPs), and the relatively small numbers of INPs (compared with all other aerosol particles), sometimes less than one in 100000. These factors in turn makes constraining ice nucleation parameterizations for modeling applications challenging. The majority of airborne particles are known to be organic in nature or contain organic biogenic material. The presence of organic material adds to the complexity of the particles and therefore the predictability of ice nucleation events since the organic species can display different phase states, e.g. liquid or solid, in response to temperature and humidity. The award DE-SC0008613 to PI Prof. Daniel Knopf at Stony Brook University, “Relating the Chemical and Physical Properties of Aerosols to the Water Uptake and Ice Nucleation Potential of Particles Collected During the Carbonaceous Aerosols and Radiative Effects Study (CARES)”, allowed examination of laboratory generated aerosol particles and field-collected particles for their propensity to nucleate ice under typical tropospheric conditions and relate ice nucleation to the physicochemical properties of the particles including their morphology and chemical composition. This in turn allowed for development of ice nucleation parameterizations for implementation in cloud models. The award resulted in 10 peer-reviewed publications and more than 20 seminar and conference presentations. We demonstrated that the rate of immersion

  6. Medialogy (English Information Brochure on the education M.Sc.,Medialogy, 3rd to 10th semester (B.Sc. & M.Sc) - For graduates from higher study programmes such as Multimedia Design and IT Graduates)

    DEFF Research Database (Denmark)

    Nordahl, Rolf

    2005-01-01

    An information brochure, 24 pages, in English which describes the education M.Sc., Medialogy, offered by Aalborg University in Copenhagen and Esbjerg. The brochure describes the 3rd to 10th semester (B.Sc. and M.Sc. degree) of the education. The information is primarily directed toward potential...

  7. Total mercury, methylmercury, and selected elements in soils of the Fishing Brook watershed, Hamilton County, New York, and the McTier Creek watershed, Aiken County, South Carolina, 2008

    Science.gov (United States)

    Woodruff, Laurel G.; Cannon, William F.; Knightes, Christopher D.; Chapelle, Francis H.; Bradley, Paul M.; Burns, Douglas A.; Brigham, Mark E.; Lowery, Mark A.

    2010-01-01

    Mercury is an element of on-going concern for human and aquatic health. Mercury sequestered in upland and wetland soils represents a source that may contribute to mercury contamination in sensitive ecosystems. An improved understanding of mercury cycling in stream ecosystems requires identification and quantification of mercury speciation and transport dynamics in upland and wetland soils within a watershed. This report presents data for soils collected in 2008 from two small watersheds in New York and South Carolina. In New York, 163 samples were taken from multiple depths or soil horizons at 70 separate locations near Fishing Brook, located in Hamilton County. At McTier Creek, in Aiken County, South Carolina, 81 samples from various soil horizons or soil depths were collected from 24 locations. Sample locations within each watershed were selected to characterize soil geochemistry in distinct land-cover compartments. Soils were analyzed for total mercury, selenium, total and carbonate carbon, and 42 other elements. A subset of the samples was also analyzed for methylmercury.

  8. Piezoelectric coefficients and spontaneous polarization of ScAlN.

    Science.gov (United States)

    Caro, Miguel A; Zhang, Siyuan; Riekkinen, Tommi; Ylilammi, Markku; Moram, Michelle A; Lopez-Acevedo, Olga; Molarius, Jyrki; Laurila, Tomi

    2015-06-24

    We present a computational study of spontaneous polarization and piezoelectricity in Sc(x)Al(1-x)N alloys in the compositional range from x = 0 to x = 0.5, obtained in the context of density functional theory and the Berry-phase theory of electric polarization using large periodic supercells. We report composition-dependent values of piezoelectric coefficients e(ij), piezoelectric moduli d(ij) and elastic constants C(ij). The theoretical findings are complemented with experimental measurement of e33 for a series of sputtered ScAlN films carried out with a piezoelectric resonator. The rapid increase with Sc content of the piezoelectric response reported in previous studies is confirmed for the available data. A detailed description of the full methodology required to calculate the piezoelectric properties of ScAlN, with application to other complex alloys, is presented. In particular, we find that the large amount of internal strain present in ScAlN and its intricate relation with electric polarization make configurational sampling and the use of large supercells at different compositions necessary in order to accurately derive the piezoelectric response of the material.

  9. Crystallization and preliminary X-ray diffraction analysis of the mitochondrial transcription factor sc-mtTFB from Saccharomyces cerevisiae.

    Science.gov (United States)

    Schubot, F D; Chen, C J; Rose, J P; Wang, B C

    2000-07-01

    Eukaryotic mitochondria contain a distinct mini-chromosome. In yeast, transcription of the mitochondrial genome is mediated by a nuclear-encoded RNA polymerase consisting of a single polypeptide core enzyme and a specificity factor termed sc-mtTFB which bears some similarity to bacterial sigma-factors. sc-mtTFB from Saccharomyces cerevisiae has been cloned, expressed, purified and crystallized. The crystals belong to the monoclinic space group C2, with unit-cell parameters a = 89.7, b = 44.6, c = 98.9 A, beta = 110 degrees. Based on one molecule per asymmetric unit, the solvent content is estimated to be 48%. Small crystals of dimensions 0.01 x 0.05 x 0.13 mm diffract to at least 2.7 A resolution on a rotating-anode X-ray source.

  10. Doctoral Training in Statistics, Measurement, and Methodology in Psychology: Replication and Extension of Aiken, West, Sechrest, and Reno's (1990) Survey of PhD Programs in North America

    Science.gov (United States)

    Aiken, Leona S.; West, Stephen G.; Millsap, Roger E.

    2008-01-01

    In a survey of all PhD programs in psychology in the United States and Canada, the authors documented the quantitative methodology curriculum (statistics, measurement, and research design) to examine the extent to which innovations in quantitative methodology have diffused into the training of PhDs in psychology. In all, 201 psychology PhD…

  11. Doctoral Training in Statistics, Measurement, and Methodology in Psychology: Replication and Extension of Aiken, West, Sechrest, and Reno's (1990) Survey of PhD Programs in North America

    Science.gov (United States)

    Aiken, Leona S.; West, Stephen G.; Millsap, Roger E.

    2008-01-01

    In a survey of all PhD programs in psychology in the United States and Canada, the authors documented the quantitative methodology curriculum (statistics, measurement, and research design) to examine the extent to which innovations in quantitative methodology have diffused into the training of PhDs in psychology. In all, 201 psychology PhD…

  12. Experience with OpenMP for MADX-SC

    Energy Technology Data Exchange (ETDEWEB)

    D' Imperio, Nicholas [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Montag, Christophe [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Yu, Kwangmin [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Kapin, Valery [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); McIntosh, Eric [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Renshall, Harry [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Schmidt, Frank [European Organization for Nuclear Research (CERN), Geneva (Switzerland)

    2014-07-01

    MADX-SC allows the treatment of frozen space charge using beam-beam elements in a thin lattice, i.e. one can take advantage of the standard set-up of MAD-X lattices without the need for specialized codes for the space-charge (SC) evaluation. The idea is to simulate over many turns without the problem of noise as in the PIC SC codes. For the examples under study, like the PS and RHIC, it would be desirable to simulate up to 1 million turns or more. To this end one had to make an effort to optimize the scalar speed and, most importantly, get a speed-up of approximately a factor of 5 using OpenMP.

  13. Estudo medico da hemoglobinopatia SC em negroides paulistas

    OpenAIRE

    Raquel Ribeiro Gomes

    1988-01-01

    Resumo: A hemoglobinopatia SC é a segunda síndrome falcêmica mais importante no Brasil, devido à sua significativa prevalência entre negróides e também pelas manifestações clínicas apresentadas Apesar disso, ela tem sido pouco estudada em nosso país, não existindo na literatura nacional nenhum trabalho específico sobre essa doença. No presente trabalho, procurou-se investigar o significado médico da doença SC no Estado de são Paulo, analisando-se dois tipos de casuísticas de pacientes SC. Em ...

  14. Experience with OpenMP 1 for MADX-SC

    CERN Document Server

    D’Imperio, N; Yu, K; Kapin, V; McIntosh, E; Renshall, H; Schmidt, F

    2014-01-01

    MADX-SC [1–3] allows the treatment of frozen space charge using beam-beam elements in a thin lattice, i.e. one can take advantage of the standard set-up of MAD-X [4] lattices without the need for specialized codes for the space-charge (SC) evaluation. The idea is to simulate over many turns without the problem of noise as in the PIC 1 SC codes. For the examples under study, like the PS and RHIC, it would be desirable to simulate up to 1 million turns or more. To this end one had to make an effort to optimize the scalar speed and, most importantly, get a speed-up of approximately a factor of 5 using OpenMP [5].

  15. Transport of one SC coil through the village of Meyrin

    CERN Multimedia

    1956-01-01

    In 1952, before CERN was officially founded, two accelerator projects were launched: one for an innovative accelerator to operate at an energy level unequalled at the time, the other for a more standard machine, a Synchro-Cyclotron (SC) to operate at 600 MeV. Design work on the SC was started in 1952 and carried out by teams scattered throughout Europe. Once construction began in 1954, CERN had to arrange road transport for the first of what has since been a long series of spectacular component deliveries, such as those of the machine's two magnetic coils each weighing 60 tonnes and measuring 7.2 metres in diameter. Above, one of them is seen passing through the village of Meyrin. The SC was commissioned in 1957 and was operational for 34 years!

  16. Synthesis and structure of perovskite ScMnO3.

    Science.gov (United States)

    Chen, Haiyan; Yu, Tian; Gao, Peng; Bai, Jianming; Tao, Jing; Tyson, Trevor A; Wang, Liping; Lalancette, Roger

    2013-08-19

    The rare-earth manganites RMnO3 (R = rare earth) are a class of important multiferroics with stable hexagonal structures for small R ion radius (Sc, Lu, Yb, ...). Metastable perovskite phases of these systems possess intriguing electronically driven electrical polarization, but the synthesis of the perovskite phase for the end member ScMnO3 system has proven to be elusive. We report the structure of a new monoclinic P2(1)/n perovskite phase of ScMnO3 synthesized from the hexagonal phase under high-pressure and high-temperature conditions. This extends the small ion region for so-called E-phase electronically driven ferroelectric manganese perovsites.

  17. The {\\sc Majorana Demonstrator} Neutrinoless Double-Beta Decay Experiment

    CERN Document Server

    Abgrall, N; Avignone, F T; Barabash, A S; Bertrand, F E; Boswell, M; Brudanin, V; Busch, M; Caldwell, A S; Chan, Y-D; Christofferson, C D; Combs, D C; Detwiler, J A; Doe, P J; Efremenko, Yu; Egorov, V; Ejiri, H; Elliott, S R; Esterline, J; Fast, J E; Finnerty, P; Fraenkle, F M; Galindo-Uribarri, A; Giovanetti, G K; Goett, J; Green, M P; Gruszko, J; Guiseppe, V E; Gusey, K; Hallin, A L; Hazama, R; Hegai, A; Henning, R; Hoppe, E W; Howard, S; Howe, M A; Keeter, K J; Kidd, M F; Knecht, A; Kochetov, O; Konovalov, S I; Kouzes, R T; LaFerriere, B D; Leon, J; Leviner, L E; Loach, J C; MacMullin, S; Martin, R D; Mertens, S; Mizouni, L; Nomachi, M; Orrell, J L; O'Shaughnessy, C; Overman, N R; Phillips, D G; Poon, A W P; Pushkin, K; Radford, D C; Rielage, K; Robertson, R G H; Ronquest, M C; Schubert, A G; Shanks, B; Shima, T; Shirchenko, M; Snavely, K J; Snyder, N; Steele, D; Strain, J; Suriano, A M; Thompson, J; Timkin, V; Tornow, W; Varner, R L; Vasilyev, S; Vetter, K; Vorren, K; White, B R; Wilkerson, J F; Xu, W; Yakushev, E; Young, A R; Yu, C-H; Yumatov, V

    2013-01-01

    The {\\sc Majorana Demonstrator will search for the neutrinoless double-beta decay of the isotope Ge-76 with a mixed array of enriched and natural germanium detectors. The observation of this rare decay would indicate the neutrino is its own antiparticle, demonstrate that lepton number is not conserved, and provide information on the absolute mass scale of the neutrino. The {\\sc Demonstrator} is being assembled at the 4850-foot level of the Sanford Underground Research Facility in Lead, South Dakota. The array will be situated in a low-background environment and surrounded by passive and active shielding. Here we describe the science goals of the {\\sc Demonstrator} and the details of its design.

  18. Thermoelectric performance of functionalized Sc2C MXenes

    KAUST Repository

    Kumar, S.

    2016-07-05

    Functionalization of the MXene Sc2C, which has the rare property to realize semiconducting states for various functionalizations including O, F, and OH, is studied with respect to the electronic and thermal behavior. The lowest lattice thermal conductivity is obtained for OH functionalization and an additional 30% decrease can be achieved by confining the phonon mean free path to 100 nm. Despite a relatively low Seebeck coefficient, Sc2C(OH)2 is a candidate for intermediate-temperature thermoelectric applications due to compensation by a high electrical conductivity and very low lattice thermal conductivity.

  19. Determination of Sc by Ion-exchanger Colorimetry

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    Ion-exchanger colorimetry for scandium in the form of ternary color system "Sc(Ⅲ)-CPA-pc-Ac" was developed. The influences of types and grain sizes of resin, adsorption modes and the acidity on the determination were studied systematically, and the optimum operating conditions and the allowable amounts of foreign ions were determined. In comparison with the ordinary solution colorimetry, both of the sensitivity and the selectivity of this ion-exchanger colorimetry are improved obviously. The preliminary uses of this method to the determination of Sc(Ⅲ) in two synthetic samples were satisfied.

  20. Product policy of SC Electrecord S.A.

    Directory of Open Access Journals (Sweden)

    Ph. D. Candidate Cristina Andreescu (Manolache

    2009-12-01

    Full Text Available The global brand has the advantage of the scale economy, facilitates the company image and prestige and sometimes benefits even from its origin country effect. Its use is quite difficult (the semantic variations can impede the use of the same brand. The international brands act as a restriction against standardisation (the product should not be differentiated as there are internationally accepted and recognized brands. This paper makes an overview description of the general market environment, but also of the arket environment of SC ELECTRECORD S.A.; it underlines the product characteristics as well as the commercial diagnosis within SC ELECTRECORD S.A.

  1. Bayesian narrowband interference mitigation in SC-FDMA

    KAUST Repository

    Ali, Anum

    2015-08-12

    This paper presents a novel narrowband interference (NBI) mitigation scheme for SC-FDMA systems. The proposed scheme exploits the frequency domain sparsity of the unknown NBI signal and adopts a low complexity Bayesian sparse recovery procedure. In practice, however, the sparsity of the NBI is destroyed by a grid mismatch between NBI sources and SC-FDMA system. Towards this end, an accurate grid mismatch model is presented and a sparsifying transform is utilized to restore the sparsity of the unknown signal. Numerical results are presented that depict the suitability of the proposed scheme for NBI mitigation.

  2. Radiation protection Group (SC/RP) desperately seeking...

    CERN Multimedia

    A. Hervé, Y. Donjoux / SC

    2006-01-01

    We are trying to trace two transit permits (passavants), which constitute the customs clearance documentation for two 'AD6'portable radiation detectors. The two permits (No. 1308 and No. 1309) were sent in the same internal mail envelope towards the middle of March 2006 but never reached their final destination. After weeks of searching in vain, we are now appealing for your help. If you have these two permits in your possession, please get in touch with us. Many thanks in advance. A.HERVE - SC/RP- ( 163168 / 70927) Y.DONJOUX - SC/RP - (160105 / 73171)

  3. Tetrahedron dynamics in the icosahedral quasicrystals i-ZnMgSc and i-ZnAgSc and the cubic 1/1-approximant Zn6Sc.

    Science.gov (United States)

    Euchner, H; Yamada, T; Rols, S; Ishimasa, T; Kaneko, Y; Ollivier, J; Schober, H; Mihalkovic, M; de Boissieu, M

    2013-03-20

    A comparison of periodic approximants and their quasicrystalline counterparts offers the opportunity to better understand the structure, physical properties and stabilizing mechanisms of these complex phases. We present a combined experimental and molecular dynamics study of the lattice dynamics of the icosahedral quasicrystals i-ZnMgSc and i-ZnAgSc and compare it to recently published results obtained for the cubic 1/1-approximant Zn(6)Sc. Both phases, quasicrystal and approximant, are built up from large atomic clusters which contain a tetrahedral shell at the cluster centre and are packed either quasiperiodically or on a bcc lattice. Using quasielastic neutron scattering and atomic scale simulations, we show that in the quasicrystal the tetrahedra display a dynamics similar to that observed in the 1/1-approximant: the tetrahedra behave as a 'single molecule' and reorient dynamically on a timescale of the order of a few ps. The tetrahedra reorientation is accompanied by a large distortion of the surrounding cluster shells which provide a unique dynamical flexibility to the quasicrystal. However, whereas in the 1/1-approximant the tetrahedron reorientation is observed down to T(c) = 160 K, where a phase transition takes place, in the quasicrystal the tetrahedron dynamics is gradually freezing from 550 to 300 K, similarly to a glassy system.

  4. Paramagnetic atom number and paramagnetic critical pressure of the sc, bcc and fcc Ising nanolattices

    Science.gov (United States)

    Şarlı, Numan

    2015-01-01

    The effects of the magnetic atom number in the unit volume on the magnetic properties are investigated by using sc (n=8), bcc (n=9) and fcc (n=14) Ising NLs within the effective field theory with correlations. We find that the magnetic properties expand as the magnetic atom number increases in the unit volume and this expanding constitutes an elliptical path at TC. The effect of the magnetic atom number (n) in the unit volume on the magnetic properties (mp) appear as nscconstant is directly proportional with the atom number in the unit volume (C α n). Hence, by using the slopes of the paramagnetic hysteresis curves of any nanosystem, it can be predicted that the number of particles in its unit volume. Moreover, the magnetic atoms in the paramagnetic region can be considered as particles in the gas. Because of the absence of an external magnetic field, the spin orientations of these atoms are random and free to rotate. Hence, they act on individually with no mutual interaction between two nearest-neighbor magnetic atoms. Therefore, we use the statistical mechanics form of the ideal gas law in the paramagnetic region and we obtain the critical paramagnetic pressure (PC=npkBTC) of the Ising NLs at TC. We define the paramagnetic magnetic atom number in the unit volume as np=n(1-M(T)).

  5. Genome Sequence of Herpes Simplex Virus 1 Strain SC16

    Science.gov (United States)

    Rastrojo, Alberto; López-Muñoz, Alberto Domingo

    2017-01-01

    ABSTRACT Herpes simplex virus 1 (HSV-1), also known as Human herpesvirus 1, is a highly prevalent human neurotropic pathogen that causes a variety of diseases, including lethal encephalitis. Here, we report the genome sequence of the HSV-1 strain SC16. PMID:28126930

  6. Calibration of the DLP-SC-3300-02 probe

    DEFF Research Database (Denmark)

    Pivnenko, Sergey; Breinbjerg, Olav

    This report douments the calibration measurement of the DLP-SC-3300-02 dual-linearly polarized near-field probe. The measurement comprises radiation pattern, diretivity, gain, spetra of spherial wave coefients, polarization charateristis, and complex channel balance at 41 frequencies, as well...

  7. Programmable SC biquad using one single capacitor bank

    OpenAIRE

    Torralba Silgado, Antonio Jesús; Pérez Vega-Leal, Alfredo; García Franquelo, Leopoldo

    2001-01-01

    This paper presents a new technique for programming SC circuits using a single time-multiplexed capacitor bank, achieving a significant reduction in capacitance area. Simulation results of a programmable biquad low pass filter show the validity of the proposed method.

  8. Toelating Herbasan SC welkom voor dahlia, A. coronaria en narcis

    NARCIS (Netherlands)

    Leeuwen, van P.J.; Koster, A.T.J.; Trompert, J.P.T.

    2005-01-01

    Onlangs is Herbasan SC voor de onkruidbestrijding in onder meer dahlia, narcis en Anemone coronaria toegelaten. PPO ging na hoe het middel het beste is in te zetten. In dit artikel zijn de resultaten van het onderzoek vermeld en een advies voor toepassing

  9. 78 FR 20369 - South Carolina Disaster #SC-00021

    Science.gov (United States)

    2013-04-04

    ... ADMINISTRATION South Carolina Disaster SC-00021 AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is a notice of an Administrative declaration of a disaster for the State of South Carolina dated 03/29/2013. Incident: Windsor Green Condo Complex Fire. Incident Period: 03/16/2013....

  10. 77 FR 14700 - Safety Zones; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2012-03-13

    ... notice regarding our public dockets in the January 17, 2008, issue of the Federal Register (73 FR 3316... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zones; Swim Around Charleston, Charleston, SC... establish temporary moving safety zones during the Swim Around Charleston, a swimming race occurring on...

  11. 76 FR 38586 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2011-07-01

    ... Federal Register (73 FR 3316). Public Meeting We do not now plan to hold a public meeting. But you may... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... establish a temporary moving safety zone during the Swim Around Charleston, a swimming race occurring...

  12. 78 FR 54583 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2013-09-05

    ..., telephone 202-366-9826. SUPPLEMENTARY INFORMATION: Table of Acronyms DHS Department of Homeland Security FR... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... temporary moving safety zone during the Swim Around Charleston, a swimming race occurring on waters of...

  13. 77 FR 51471 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2012-08-24

    ... rulemaking (NPRM) entitled Safety Zone; Swim Around Charleston, Charleston, SC in the Federal Register (77 FR...: Table of Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice of Proposed... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston,...

  14. South Carolina's SC LENDS: Optimizing Libraries, Transforming Lending

    Science.gov (United States)

    Hamby, Rogan; McBride, Ray; Lundberg, Maria

    2011-01-01

    Since SC LENDS started operating in June 2009, more public libraries have come on board. All of this on the back end connects to a Mozilla-based staff client that has distributions for Mac OS X and Microsoft Windows, using SSL encryption to keep communications secure and private between remote libraries and the servers hosted at a high-end…

  15. Envíos Confianza, S.C.

    OpenAIRE

    Banco Interamericano de Desarrollo (BID); S.C. Envíos Confianza

    2009-01-01

    Presentación acerca de Envíos Confianza, S.C., en el cual da a conocer su historia, misión, visión, valores, efecto de las remesas en comunidades e impacto de la crisis financiera. Además, señala la proyección para el 2009-2011.

  16. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    The catalogue contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd semester...... projects at the M.Sc. programme in Civil and Structural Engineering....

  17. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    The following pages contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short master projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering....

  18. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    This catalogue contains a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering....

  19. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    Clausen, Johan

    The report contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd semester...... projects at the M.Sc. programme in Civil and Structural Engineering....

  20. 44gSc from metal calcium targets for PET

    DEFF Research Database (Denmark)

    Severin, Gregory; Gagnon, K.; Engle, J. W.

    2012-01-01

    A low-cost and efficient method for producing pre-clinical scale quantities of 44gSc is presented. Production involves proton irradiation of natural unenriched calcium metal followed by rapid separation of radioscandium from the target using hydroxmate functionalized resin.© 2012 American Institu...

  1. Pregnancy outcome in patients with sickle cell disease in the UK--a national cohort study comparing sickle cell anaemia (HbSS) with HbSC disease.

    Science.gov (United States)

    Oteng-Ntim, Eugene; Ayensah, Benjamin; Knight, Marian; Howard, Jo

    2015-04-01

    We describe the findings from a national study of maternal and fetal outcomes of pregnancy in women with sickle cell disease (SCD). Data were collected via the United Kingdom Obstetric Surveillance System between 1 February 2010 and 31 January 2011 from 109 women, of whom 51 (46·8%) had HbSS and 44 (40·4%) had HbSC. Data included antenatal, maternal and fetal outcomes. Comparisons were made between women with HbSS and HbSC. Incidence of complications were acute pain (57%), blood transfusion (26%), urinary tract infection (UTI; 12%) and critical care unit admission (23%) and these were all more common in women with HbSS than HbSC. There was no difference in the incidence of acute chest syndrome, hypertension and venous thromboembolism between HbSS and HbSC. Women with HbSS were more likely to deliver at complications in mothers with SCD, even in women with HbSC, which has previously been considered to have a more benign phenotype in pregnancy.

  2. Effect of Sc on Precipitation Hardening of AlSi6Mg Alloy

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The effect of Sc on precipitation hardening of AlSi6Mg was studied. Zr was previously reported that it increased the effectiveness of Sc in wrought aluminum in many areas so Zr was also used together with Sc in this study.Different levels of Sc and Zr additions were added to AlSi6Mg before casting in the permanent mold. The samples were precipitation hardened at different aging temperatures and for various aging time before testing for tensile strength and hardness. It was found that Sc addition into Al6SiMg can change its response to age hardening. Additions of Sc and Sc with Zr increased both yield strength and hardness for both aging temperatures. In addition, Sc was found to modify eutectic Si to obtain fibrous morphology. This effect of Sc on eutectic silicon modification has never been reported before.

  3. Role of cell death in the propagation of PrP(Sc) in immune cells.

    Science.gov (United States)

    Takahashi, Kenichi; Inoshima, Yasuo; Ishiguro, Naotaka

    2015-03-01

    A number of studies have suggested that macrophages, dendritic cells, and follicular dendritic cells play an important role in the propagation of PrP(Sc). Both accumulation and proteolysis of PrP(Sc) have been demonstrated in peripheral macrophages. Macrophages may act as reservoirs for PrP(Sc) particles if the cells die during transient PrP(Sc) propagation. However, whether cell death plays a role in PrP(Sc) propagation in macrophages remains unclear. In this study, we investigated the possibility of propagation and transmission of PrP(Sc) between dead immune cells and living neural cells. We found that under specific conditions, transient PrP(Sc) propagation occurs in dead cells, indicating that interaction between PrP(C) and PrP(Sc) on plasma membrane lipid rafts might be important for PrP(Sc) propagation. Co-culturing of killed donor PrP(Sc)-infected macrophages with recipient N2a-3 neuroblastoma cells accelerated PrP(Sc) transmission. Our results suggest that cell death may play an important role in PrP(Sc) propagation, whereas transient PrP(Sc) propagation in macrophages has little effect on PrP(Sc) transmission.

  4. Update on the NSF PAARE Program at SC State

    Science.gov (United States)

    Walter, Donald K.; Ajello, Marco; Brittain, Sean D.; Cash, Jennifer; Hartmann, Dieter; Ho, Shirley; Howell, Steve B.; King, Jeremy R.; Leising, Mark D.; Smith, Daniel M.

    2017-01-01

    We report on results from our NSF PAARE program during Year 2 of the project. Our partnership under this PAARE award includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) as well as individual investigators at NASA Ames and Carnegie Mellon University. Our recent work on variable and peculiar stars, work with the Kepler Observatory and our educational products in cosmology for non-STEM majors will be presented. We have successfully piloted sharing our teaching resources by offering an upper-level astrophysics course taught at Clemson via video conferencing , allowing a graduating senior from SC State to take a course not available through his home institution. Additionally, we are working on a memorandum of agreement between the two institutions that will allow for the seamless transfer of an undergraduate from SC State to Clemson’s graduate program in physics and astronomy. Our curriculum work includes new web-based cosmology activities and laboratory experiments. SC State undergraduates are reporting at this conference on their work with the light curves of semiregular variables using Kepler data. Additionally, we are heavily involved in the Citizen CATE Experiment. A PAARE scholarship student from SC State and the PAARE PI traveled to Indonesia for the March 2016 solar eclipse. Their results are also being presented elsewhere at this conference (see Myles McKay’s poster). Support for this work includes our NSF PAARE award AST-1358913 as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory. Additional support has been provided by the South Carolina Space Grant Consortium and from NASA to SC State under awards NNX11AB82G and NNX13AC24G. CATE work has been supported by NASA SMD award NNX16AB92A to the National Solar Observatory. Additional details can be found at: http://physics.scsu.edu

  5. The Analytical method (HPLC) used for identification, assay of triclabendazole, related substances and preservatives used in finished product Tricladem 5, in SC Delos Impex 96 SRL

    OpenAIRE

    Maria Neagu,; Cristina I. Marinescu; Roxana M. Covaci; Catalina S. Macovei

    2012-01-01

    Because, triclabendazole is an active pharmaceutical ingredient without compendial monography (European Pharmacopoeia, United Stated Pharmacopoeia) in SC Delos Impex ’96 SRL, the API identification, assay, related substances, and, preservatives, assay and identification is efectuated used the method presented below. It permit, all these determination in a relative short time (the chromatogram time recorded is 25 min.).

  6. The Analytical method (HPLC used for identification, assay of triclabendazole, related substances and preservatives used in finished product Tricladem 5, in SC Delos Impex 96 SRL

    Directory of Open Access Journals (Sweden)

    Maria Neagu

    2012-12-01

    Full Text Available Because, triclabendazole is an active pharmaceutical ingredient without compendial monography (European Pharmacopoeia, United Stated Pharmacopoeia in SC Delos Impex ’96 SRL, the API identification, assay, related substances, and, preservatives, assay and identification is efectuated used the method presented below. It permit, all these determination in a relative short time (the chromatogram time recorded is 25 min..

  7. Effect of solution treatment on the aging processes of Al-Sc alloys

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S. (AN SSSR, Moscow. Inst. Metallurgii); Dutkiewicz, J.; Salawa, J. (Polish Academy of Sciences, Cracow. Inst. for Metal Research)

    1984-10-01

    The kinetics of aging process of two Al-Sc alloys containing 0.2 and 0.5 wt% Sc, respectively was investigated using electrical resistivity and hardness measurements. Transmission electron micrographs of quenched samples show Sc-rich precipitates, especially Al/sub 3/Sc precipitates. The addition of Sc to Al causes the strongest hardening effect during aging in relation to other alloying additions. Cast Al-Sc alloys and water quenched ones from solid solubility range show very similiar age-hardening curves.

  8. 77 FR 69929 - Western Carolina Railway Service Corporation, Steven C. Hawkins and Cheryl R. Hawkins-Continuance...

    Science.gov (United States)

    2012-11-21

    .... Hawkins--Continuance in Control Exemption--Aiken Railway Company, LLC Western Carolina Railway Service... noncarrier Aiken Railway Company, LLC (AIKR), upon AIKR's becoming a Class III rail carrier. This transaction... near Oakwood, S.C.; and (2) the AB Line extending 6.45 miles between milepost AB 23.75 at or near Aiken...

  9. Structural, elastic and thermodynamic properties of Ti2SC

    Indian Academy of Sciences (India)

    Hongzhi Fu; Wenfang Liu; Tao Gao

    2011-12-01

    The structural parameters, elastic constants and thermodynamic properties of Ti2SC were investigated under pressure and temperature by using first-principles plane-wave pseudopotential density functional theory within the generalized gradient approximation. The obtained results are in agreement with the available experimental data. The bulk moduli along the - and -axes, $B_{a}$ and $B_{c}$, almost linearly increase with pressure, and the former is always smaller than the latter. The ratio of $B_{c}/B_{a}$ has a trend of gradual increase as the pressure increases. It is found that the elastic constants, anisotropy and Debye temperature of Ti2SC increase with pressure, while axial compressibility along the - and -axes decreases with pressure. The thermal properties including the equation of state, the Grüneisen parameter , the anisotropies $\\Delta_{p}, \\Delta_{S1}$ and $\\Delta_{S2}$, and the heat capacity are estimated at various pressures and temperatures.

  10. Dynamical stability and evolution of the discs of Sc galaxies

    CERN Document Server

    Fuchs, B

    1997-01-01

    We examine the local stability of galactic discs against axisymmetric density perturbations with special attention to the different dynamics of the stellar and gaseous components. In particular the discs of the Milky Way and of NGC 6946 are studied. The Milky Way is shown to be stable, whereas the inner parts of NGC 6946, a typical Sc galaxy from the Kennicutt (1989) sample, are dynamically unstable. The ensuing dynamical evolution of the composite disc is studied by numerical simulations. The evolution is so fierce that the stellar disc heats up dynamically on a short time scale to such a degree, which seems to contradict the morphological appearance of the galaxy. The star formation rate required to cool the disc dynamically is estimated. Even if the star formation rate in NGC 6946 is at present high enough to meet this requirement, it is argued that the discs of Sc galaxies cannot sustain such a high star formation rate for longer periods.

  11. A Study on the Fluorescence System of Sc-BPMPHD-CTMAB and Its Analytical Application

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Introduction The fluorescence of Sc3+ itself in solution is not observed. After complexed with an organic ligand with a chromophore, Sc3+ makes the ligand, which has no or has weak fluorescence, emit strong fluorescence.

  12. Status of Simulation Tools for the ILD ScECAL

    OpenAIRE

    Kotera, Katsushige; anduze, marc; Boudry, Vincent; Brient, Jean-Claude; Jeans, Daniel; Kawagoe, Kiyotomo; Miyamoto, Akiya; de Freitas, Paulo Mora; Musat, Gabriel; Ono, Hiroaki; Takeshita, Tohru; Uozumi, Satoru

    2010-01-01

    The scintillator-strip electromagnetic calorimeter (ScECAL) is one of the calorimeter technic for the ILC. To achieve the fine granularity from the strip-segmented layers the strips in odd layers are orthogonal with respect to those in the even layers. In order to extract the best performance from such detector concept, a special reconstruction method and simulation tools are being developed in ILD collaboration. This manuscript repots the status of developing of those tools.

  13. Metastable Al-Sc phase diagram in aluminium rich region

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Bykov, Yu.G.; Gushchina, F.L.; Elagin, V.I.; Filatov, Yu.A.

    1982-12-01

    An aluminium rich part of binary metastable phase diagram Al-Sc for 100 deg/s alloy cooling rate under crystallization is studied. Eutectic horizontal in the metastable diagram is 4 deg lower as compared to the equilibrium one, scandium concentration in the eutectic point makes up approximately 0.8%, the maximum solubility is 0.6%. Maximum cast grain refining in aluminium under crystallization at the rate of 100 deg/s is attained at 0.6% scandium content.

  14. QUALITY MANAGEMENT OF BAKERY PRODUCTS: A CASE STUDY IN SC

    Directory of Open Access Journals (Sweden)

    Nicoleta- Luminiţa STRÂMBEANU RISTEA

    2013-01-01

    Full Text Available The paper aimed to present the benefits of implementing HACCP (Hazard Analysis and Critical Control Points to company S.C. "DOBRE AND SONS" S.R.L. Constanta, Romania. The data have been provided by the above mentioned manufacturer. The objectives of S.C. "DOBRE AND SONS" S.R.L. are protecting the health of the consumers of the products and their satisfaction regarding the consumption of products that are nutritional, tasty, fresh, free from microbiological, chemical and physical hazard, as well as possessing stable properties during the validity for consumption. In this respect, there has been implemented and maintained an integrated management system of food quality and safety according to SR EN ISO 9001:2008, SR EN ISO 22000:2005 and according to IFS standard, version 5/2007, which consists of determining the potential biological, chemical and physical hazards that might affect the safety of bread and bakery products, or the health of the consumer. HACCP team is analyzing hazard using one of the recommended techniques: brainstorming or the cause - effect diagram. In conclusion, the company S.C. "DOBRE AND SONS" S.R.L. Constanta, Romania provides awareness and employee involvement at all levels in achieving the appointed objectives.

  15. Charleston Harbor, SC, Regional Sediment Management Study; Beneficial Use of Dredged Material through Nearshore Placement

    Science.gov (United States)

    2017-05-01

    ER D C/ CH L TR -1 7- 7 Regional Sediment Management (RSM) Program Charleston Harbor, SC, Regional Sediment Management Study...acwc.sdp.sirsi.net/client/default. Regional Sediment Management (RSM) Program ERDC/CHL TR-17-7 May 2017 Charleston Harbor, SC, Regional Sediment...454632, “Charleston Harbor, SC; Regional Sediment Management Study” ERDC/CHL TR-17-7 ii Abstract The 2015 Charleston Harbor, SC, final

  16. A study of Al-Sc-Zr alloys in the aluminum-rich region

    Energy Technology Data Exchange (ETDEWEB)

    Toropova, L.S.; Kamardinkin, A.N.; Kindzhibalo, V.V.; Tyvanchuk, A.T. (AN SSSR, Institut Metallurgii, Moscow (USSR))

    1990-12-01

    Alloys in the ternary system Al-Sc-Zr along a section of approximately 1.0 pct Sc and 0.8 pct Zr were investigated by X-ray diffraction and electron probe analyses. It is found that phases Al3Sc and Al3Zr are in equilibrium with the alpha solid solution of aluminum. The contents of zirconium and scandium in the phase Al3Sc are determined as a function of their concentrations in the alloy.

  17. Effect of ScAl/sub 3/ phase dispersity on hardening of A1-6. 3% Mg-0. 21% Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Bykov, Y.G.; Toropova, L.S.

    1985-09-01

    This paper reports on attempts to evaluate the quantitatively separate influence exerted on the hardening of an aluminum alloy containing 6.3% Mg and 0.21% Sc by both particles of the ScAl/sub 3/ phase exhibiting a different degree of dispersity and also the substructure which is formed in the alloy after hot deformation. The binary aluminum alloy containing 6.3% of Mg after hot deformation has a fully recrystallized structure, while the aluminum alloy containing 6.5% of Mg and Sc is recrystallized. It is concluded that: the magnitude of substructure hardening of the A1-6.3% Mg-0.21% Sc alloy is similar, irrespective of the dispersity of coherent ScAl/sub 3/ particles; and, hardening of the alloy, which is governed by coherent ScAl/sub 3/-phase segregations less than 20 mm in diameter, significantly exceeds the effect of substructure hardening.

  18. Crystal fields of dilute Tb, Dy, or Er in Sc obtained by magnetization measurements

    DEFF Research Database (Denmark)

    Høg, J.; Touborg, P.

    1976-01-01

    Crystal-field parameters for dilute Sc-Tb, Sc-Dy, and Sc-Er alloys have been obtained by fitting theoretical expressions to the experimentally measured paramagnetic susceptibility. The initial susceptibility was measured and corrected for the effects of ordering at the lowest temperatures in the ...

  19. Preparation and characterization of Sc doped MgB2 wires

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude; Burdusel, M.

    2016-01-01

    The in-situ technique was used to manufacture scandium (Sc) doped MgB2 wires in a composite Cu–Nb sheath. After reaction at 700 °C, at most 1 at.% Mg was replaced by Sc in the MgB2 phase, without significant influence on its superconducting transition temperature. For higher Sc concentrations...

  20. File list: InP.PSC.10.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 35242 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.10.AllAg.EpiSC.bed ... ...InP.PSC.10.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX590285,SRX5

  1. File list: InP.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 90285 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.50.AllAg.EpiSC.bed ... ...InP.PSC.50.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX535242,SRX5

  2. File list: InP.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 90285 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.20.AllAg.EpiSC.bed ... ...InP.PSC.20.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX535242,SRX5

  3. File list: His.PSC.10.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 0286,SRX535238 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.10.AllAg.EpiSC.bed ... ...His.PSC.10.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX590288,SRX535240,

  4. File list: Unc.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 074908,SRX1074905 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.05.AllAg.EpiSC.bed ... ...Unc.PSC.05.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1

  5. File list: His.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 909,SRX1074906 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.50.AllAg.EpiSC.bed ... ...His.PSC.50.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX535239,SRX535240,

  6. File list: InP.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 35242 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.05.AllAg.EpiSC.bed ... ...InP.PSC.05.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX590285,SRX5

  7. File list: Unc.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 074905,SRX1074908 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.50.AllAg.EpiSC.bed ... ...Unc.PSC.50.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1

  8. File list: His.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 4916,SRX590286 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.05.AllAg.EpiSC.bed ... ...His.PSC.05.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX590288,SRX535240,

  9. File list: Unc.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 074908,SRX1074905 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.20.AllAg.EpiSC.bed ... ...Unc.PSC.20.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1

  10. File list: His.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 4906,SRX535241 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.20.AllAg.EpiSC.bed ... ...His.PSC.20.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX535239,SRX661083,

  11. Overview of 2009 IEC/TC SC 77C Plenary Meeting%2009 IEC/TC SC 77C年会

    Institute of Scientific and Technical Information of China (English)

    孟萃

    2009-01-01

    介绍了在法国召开的2009 IEC/TC SC 77C分技术委员会工作组会议讨论的IEC 61000-4-35、IEC 6100-5-9、IEC 6100-5-8三个标准项目实施情况、标准维护需求及新的技术工作.

  12. INTERVIEW WITH MRS. SIMONA CAROBENE, ADMINISTRATOR OF SC PROIECT MOZAIC SRL

    Directory of Open Access Journals (Sweden)

    Gheorghe Pascaru

    2013-12-01

    Full Text Available The mosaic factory, recorded at the Registry of Commerce Office in the month of April 2012 was created within a non-reimbursable European financed project and currently has the status of authorized protected unit. There are ten young people who were institutionalized and who have difficulties to become integrated in the social and professional life. The social enterprise SC Proiect Mozaic SRL is the result of a meeting between the social sector, the non-profit sector and the business sector because it has at its basis a partnership with an important group of companies from the field of constructions and interior design from Bucharest. In parallel with the activity of producing mosaic, the Mosaic project provides occasionally to its clients also services of products packaging and assembly.

  13. Molecular and functional characterization of peptidoglycan-recognition protein SC2 (PGRP-SC2) from Nile tilapia (Oreochromis niloticus) involved in the immune response to Streptococcus agalactiae.

    Science.gov (United States)

    Gan, Zhen; Chen, Shannan; Hou, Jing; Huo, Huijun; Zhang, Xiaolin; Ruan, Baiye; Laghari, Zubair Ahmed; Li, Li; Lu, Yishan; Nie, Pin

    2016-07-01

    PGRP-SC2, the member of PGRP family, plays an important role in regulation of innate immune response. In this paper, a PGRP-SC2 gene of Nile tilapia, Oreochromis niloticus (designated as On-PGRP-SC2) was cloned and its expression pattern under the infection of Streptococcus agalactiae was investigated. Sequence analysis showed main structural features required for amidase activity were detected in the deduced amino acid sequence of On-PGRP-SC2. In healthy tilapia, the On-PGRP-SC2 transcripts could be detected in all the examined tissues, with the most abundant expression in the muscle. When infected with S. agalactiae, there was a clear time-dependent expression pattern of On-PGRP-SC2 in the spleen, head kidney and brain. The assays for the amidase activity suggested that recombinant On-PGRP-SC2 protein had a Zn(2+)-dependent PGN-degrading activity. Moreover, our works showed that recombinant On-PGRP-SC2 protein could significantly reduce bacterial load in target organs attacked by S. agalactiae. These findings indicated that On-PGRP-SC2 may play important roles in the immune response to S. agalactiae in Nile tilapia.

  14. Acid-base chemistry in the formation of Mackay-type icosahedral clusters: μ3-acidity analysis of Sc-rich phases of the Sc-Ir system.

    Science.gov (United States)

    Guo, Yiming; Stacey, Timothy E; Fredrickson, Daniel C

    2014-05-19

    The crystal structures of intermetallic phases offer a wealth of geometrical features (helices, multishelled clusters, and host-guest motifs) whose formation has yet to be explained or predicted by chemical theory. A recently developed extension of the acid-base concept to metallic systems, the μ3-acidity model, provides an avenue for developing this understanding for intermetallics formed from transition metals. In this Article, we illustrate how this approach can be used to understand one of the most striking geometrical entities to emerge in intermetallic chemistry, the Mackay cluster of icosahedral quasicrystals. We present μ3-acidity analyses, based on DFT-calibrated Hückel calculations, for a series of Sc-Ir intermetallics: ScIr (CsCl-type), Sc2Ir (Ti2Ni-type), Sc11Ir4, and the Mackay cluster containing phases Sc57Ir13 and Sc44Ir7. We begin by illustrating that a μ3-acidity model correctly predicts that each of these phases is stable relative to disproportionation into their neighboring compounds when a common set of Hückel parameters and d-orbital occupancies is used. Next, we explain these results by developing a relationship between the distance distribution of homoatomic contacts within an atom's coordination sphere and the μ3-neutralization it experiences. For a given average homoatomic distance, the role of heteroatomic contacts is higher when the distribution of homoatomic contacts is narrower. This effect is key to the strength of the acid-base neutralization of the Sc-rich phases, where the Sc atoms find a scarcity of Ir atoms from which to obtain neutralization. Under these circumstances, Sc-Ir contacts should be maximized, whereas the number and distance variations of the Sc-Sc contacts should be minimized. These expectations are borne out by the observed crystal structures. In particular, the Mackay clusters of Sc57Ir13 and Sc44Ir7, in which a central Ir atom is icosahedrally coordinated by a pentagonal dodecahedral array of face-sharing Sc

  15. Effect of ScAl/sub 3/ phase dispersity on hardening of Al-6. 3 pct Mg-0. 21 pct Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Bykov, IU.G.; Toropova, L.S.

    1985-09-01

    The relative contributions of disperse coherent ScAl/sub 3/ segregations and of the substructure to the hardening of an aluminum alloy containing 6.3 pct Mg and 0.21 pct Sc are evaluated quantitatively. It is shown that the extent of substructure hardening is independent of the dispersity of coherent ScAl/sub 3/ particles and, consequently, of the homogenizing treatment. The contribution of coherent ScAl/sub 3/ segregations less than 20 nm in diameter to the hardening of the alloy significantly exceeds that of substructure hardening. 9 references.

  16. Al-Mg-Sc-Zr合金的再结晶%Recrystallization of Al-Mg-Sc-Zr Alloys

    Institute of Scientific and Technical Information of China (English)

    张永红; 尹志民; 张杰; 潘青林; 彭志辉

    2002-01-01

    研究了添加微量Sc,Zr的Al-Mg合金的再结晶行为,结果表明:Al-Mg-Sc-Zr合金的再结晶起始温度为400℃,细小、弥散、与基体共格的析出相对位错和亚晶的钉扎作用是合金再结晶温度大幅度提高的主要原因,再结晶形核机制为亚晶聚合机制.%The recrystalization behavior of Al-Mg alloys with Sc and Zr additives was studied.It is found that the recrystallization of the alloy began at 400℃.The main reason of the great increase of recrystallization temperature is attributed to that the dislocations and subgrain boundaries.The recrystallizing nucleation mechanism was the subgrain boundary merging mechanism in the alloy are pinned by ultrafine dispersed coherent precipitates.

  17. Fourier Transform Microwave Spectroscopy of Sc13C2 and Sc12C13C: Establishing AN Accurate Structure of ScC2 (tilde{X}2A1)

    Science.gov (United States)

    Burton, Mark; Halfen, DeWayne T.; Min, Jie; Ziurys, Lucy M.

    2016-06-01

    Pure rotational spectra of Sc13C2 and Sc12C13C (tilde{X}2A1) have been obtained using Fourier Transform Microwave methods. These molecules were created from scandium vapor in combination with 13CH4 and/or 12CH4, diluted in argon, using a Discharge Assisted Laser Ablation Source (DALAS). Transitions in the frequency range of 14-30 GHz were observed for both species including hyperfine splitting due to the nuclear spin of Sc (I = 7/2) and 13C (I = 1/2). Rotational, spin-rotational, and hyperfine constants have been determined for Sc13C2 and Sc12C13C, as well as a refined structure for ScC2. In agreement with theoretical calculations and previous Sc12C2 results, these data confirm a cyclic (or T-shaped) structure for this molecule. Scandium carbides have been shown to form endohedral-doped fullerenes, which have unique electrical and magnetic properties due to electron transfer between the metal and the carbon-cage. Spectroscopy of ScC2 provides data on model systems for comparison with theory.

  18. LOCAL COLLISION SIMULATION OF AN SC WALL USING ENERGY ABSORBING STEEL

    Directory of Open Access Journals (Sweden)

    CHUL-HUN CHUNG

    2013-08-01

    Full Text Available This study evaluates the local damage of a turbine in an auxiliary building of a nuclear power plant due to an external impact by using the LS-DYNA finite element program. The wall of the auxiliary building is SC structure and the material of the SC wall plate is high manganese steel, which has superior ductility and energy absorbance compared to the ordinary steel used for other SC wall plates. The effects of the material of the wall, collision speed, and angle on the magnitude of the local damage were evaluated by local collision analysis. The analysis revealed that the SC wall made of manganese steel had significantly less damage than the SC wall made of ordinary steel. In conclusion, an SC wall made of manganese steel can have higher effective resistance than an SC wall made of ordinary steel against the local collision of an airplane engine or against a turbine impact.

  19. Performance Analysis of OFDM 60GHz System and SC-FDE 60GHz System

    Directory of Open Access Journals (Sweden)

    Han Xueyan

    2016-01-01

    Full Text Available In this paper, the performance of 60GHz wireless communication system with SC and OFDM is studied, the models of OFDM 60GHz system and SC 60GHz frequency domain equalization (SC-FDE system are established, and the bit error rate (BER performance of OFDM 60GHz system and SC-FDE 60GHz system in 802.15.3c channels is compared. The simulation results show that SC-FDE 60GHz system has a slight advantage over OFDM system in line-of-sight (LOS channels, while OFDM 60GHz system has a slight advantage over SC-FDE system in non-line-of-sight (NLOS channels. For 60GHz system, OFDM 60GHz system has a slight advantage over SC-FDE system in overcoming multipath fading, but the performance of both is close whether in the LOS or NLOS case.

  20. Post-elution processing of {sup 44}Ti/{sup 44}Sc generator-derived {sup 44}Sc for clinical application

    Energy Technology Data Exchange (ETDEWEB)

    Pruszynski, M. [Institute of Nuclear Chemistry and Technology, 03-195 Warszawa (Poland); Loktionova, N.S. [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, D-55128 Mainz (Germany); Filosofov, D.V. [Joint Institute of Nuclear Research, DLNP, 141980 Dubna (Russian Federation); Roesch, F., E-mail: frank.roesch@uni-mainz.d [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, D-55128 Mainz (Germany)

    2010-09-15

    The {sup 44}Ti/{sup 44}Sc (T{sub 1/2}{sup 44}Ti=60 a) generator provides cyclotron-independent access to positron-emitting {sup 44}Sc (T{sub 1/2}=3.97 d) for PET imaging. This work aims to post-elution processing of initial {sup 44}Sc generator eluates in order to reduce its volume, HCl concentration and remove the oxalate anions. The on-line adsorption of {sup 44}Sc on cationic resin AG 50W-X8 (200-400 mesh, H{sup +}-form) is achieved with >98% efficacy. Subsequently, the purified {sup 44}Sc is desorbed by using 3 ml of 0.25 M ammonium acetate (pH=4.0). The post-processing takes 10 min. The overall yield of the post-processing reached 90%, which is referred to the {sup 44}Sc obtained from the {sup 44}Ti/{sup 44}Sc generator. In addition to the chemical purification, the content of {sup 44}Ti breakthrough was further reduced by one order of magnitude. The 185 MBq generator finally provides 150 MBq of {sup 44}Sc containing <10 Bq of {sup 44}Ti ready for labeling.

  1. Heterogeneity of abnormal prion protein (PrP(Sc)) in murine scrapie prions determined by PrP(Sc)-specific monoclonal antibodies.

    Science.gov (United States)

    Ushiki-Kaku, Yuko; Shimizu, Yoshihisa; Tabeta, Naoko; Iwamaru, Yoshifumi; Ogawa-Goto, Kiyoko; Hattori, Shunji; Yokoyama, Takashi

    2014-03-01

    In prion diseases, abnormal prion protein (PrP(Sc)) is considered as the main component of the infectious agent. Delineation of PrP(Sc) conformation is expected to be a critical factor in understanding properties of prions. However, practical methods to differentiate between conformers of PrP(Sc) are inadequate. Here, we used two PrP(Sc)-specific monoclonal antibodies (mAbs), 3B7 and 3H6, and found that mAb 3H6 detected a limited portion of PrP(Sc) in five mice-adapted prion strains. The quantity of mAb 3H6-precipitated PrP(Sc) was significantly lesser in 22L compared to other strains. This result provides a direct evidence of the conformational heterogeneity of PrP(Sc) within the prion strains. Conformation-specific probes, like these mAbs, have the potential to be powerful tools for investigating conformational variations in PrP(Sc).

  2. THE SC7/SC14 GENE FAMILY OF SCHIZOPHYLLUM-COMMUNE CODES FOR EXTRACELLULAR PROTEINS SPECIFICALLY EXPRESSED DURING FRUIT-BODY FORMATION

    NARCIS (Netherlands)

    SCHUREN, FHJ; ASGEIRSDOTTIR, SA; KOTHE, EM; SCHEER, JMJ; WESSELS, JGH

    The Sc7 and Sc14 genes are specifically expressed in the dikaryon of the basidiomycete fungus Schizophyllum commune during fruiting. These genes are closely linked (within 6 kb) and highly similar in gene structure and nucleotide sequence (70% identical nucleotides in their coding regions). The

  3. Correlations between quality of work life and organizational commitment: clothing retail store in Joinville/SC/BraziL

    Directory of Open Access Journals (Sweden)

    Eduardo Zanardi

    2015-06-01

    Full Text Available This study contributes to the literature on quality of work life (QWL, testing the relationship between QWL and organizational commitment (OC through questionnaires. It was used a sample of 40 operating level employees of a unit  located in Joinville/SC of a large retail clothing company in Brazil. The results indicated a significant positive relationship between QWL and CO. To this end, it was  used the Pearson correlation coefficient to establish the correlation between the two factors. Statistical analyzes showed that the two constructs are correlated. Implications of results and directions for future research are presented in this study

  4. 2006 South Carolina DNR Lidar: Aiken County

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The LiDAR data acquisition was executed in five sessions, on March 15, 16 & 17, 2006, using a Leica ALS50 LiDAR System. Specific details about the ALS50 system...

  5. Structural transformations in Sc/Si multilayers irradiated by EUVlasers

    Energy Technology Data Exchange (ETDEWEB)

    Voronov, D.L.; Zubarev, E.N.; Pershyn, Y.P.; Sevryukova, V.A.; Kondratenko, V.V.; Vinogradov, A.V.; Artioukov, I.A.; Uspenskiy, Y.A.; Grisham, M.; Vaschenko, G.; Menoni, C.S.; Rocca, J.J.

    2007-08-21

    Multilayer mirrors for the extreme ultraviolet (EUV) are keyelements for numerous applications of coherent EUV sources such as newtabletop lasers and free-electron lasers. However the field ofapplications is limited by the radiation and thermal stability of themultilayers. Taking into account the growing power of EUV sources thestability of the optics becomes crucial. To overcome this problem it isnecessary to study the degradation of multilayers and try to increasetheir temporal and thermal stability. In this paper we report the resultsof detailed study of structural changes in Sc/Simultilayers when exposedto intense EUV laser pulses. Various types of surface damage such asmelting, boiling, shockwave creation and ablation were observed asirradiation fluencies increase. Cross-sectional TEM study revealed thatthe layer structure was completely destroyed in the upper part ofmultilayer, but still survived below. The layers adjacent tothe substrateremained intact even through the multilayer surface melted down, thoughthe structure of the layers beneath the molten zone was noticeablychanged. The layer structure in this thermally affected zone is similarto that of isothermally annealed samples. All stages of scandium silicideformation such as interdiffusion, solid-state amorphization, silicidecrystallization, etc., are present in the thermally affected zone. Itindicates a thermal nature of the damage mechanism. The tungstendiffusion barriers were applied to the scandium/silicon interfaces. Itwas shown that the barriers inhibited interdiffusion and increased thethermal stability of Sc/Si mirrors.

  6. V-ATPase, ScNhxlp and Yeast Vacuole Fusion

    Institute of Scientific and Technical Information of China (English)

    Quan-Sheng Qiu

    2012-01-01

    Membrane fusion is the last step in trafficking pathways during which membrane vesicles fuse with target organelles to deliver cargos.It is a central cellular reaction that plays important roles in signal transduction,protein sorting and subcellular compartmentation.Recent progress in understanding the roles of ion transporters in vacuole fusion in yeast is summanzed in this article.It is becoming increasingly evident that the vacuolar proton pump V-ATPase and vacuolar Na+/H+ antiporter ScNhxlp are key components of the vacuole fusion machinery in yeast.Yeast ScNhxlp regulates vacuole fusion by controlling the luminal pH.V-ATPases serve a dual role in vacuolar integrity in which they regulate both vacuole fusion and fission reactions in yeast.Fission defects are epistatic to fusion defects.Vacuole fission depends on the proton translocation activity of the V-ATPase; by contrast,the fusion reaction does not need the transport activity but requires the physical presence of the proton pump.Vo,the membrane-integral sector of the V-ATPase,forms trans-complexes between the opposing vacuoles in the terminal phase of vacuole fusion where the Vo trans-complexes build a continuous proteolipid channel at the fusion site to mediate the bilayer fusion.

  7. The first SC-SAGD pilot in the Grosmont

    Energy Technology Data Exchange (ETDEWEB)

    Solanki, S.C.; Barrett, K.; Riva, D.; Becker, L.; Brindle, G. [Laricina Energy Ltd. (Canada)

    2011-07-01

    In north-eastern Alberta, the Grosmont Formation is an Upper Devonian carbonate succession containing a vast amount of bitumen. In an attempt to exploit this resource, Laricina Energy Ltd. and OSUM Oil Sands Corp. built the first ever solvent-cyclic steam-assisted gravity drainage (SC-SAGD) pilot. In this process, solvent and/or steam are continuously injected at reservoir pressure to heat the reservoir and thus reduce bitumen viscosity. The aim of this paper is to present the pilot project and its initial results. The reservoir's geology, the recovery process, the drilling and completion challenges as well as the design and the operational plan are discussed in this paper. Steam injection started in December 2010 and indications show that the wells are progressing as planned. Results showed an uptime greater than 90% so far and this is expected to further improve in the future. The first SC-SAGD pilot is discussed and early phases showed excellent results from the project.

  8. A first-principles study of hydrogen interaction and saturation on ScAl{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Samolia, Madhu [Department of Chemistry, Indian Institute of Technology Ropar, Rupnagar 140001 (India); Dhilip Kumar, T.J., E-mail: dhilip@iitrpr.ac.in [Department of Chemistry, Indian Institute of Technology Ropar, Rupnagar 140001 (India)

    2013-03-05

    Graphical abstract: Electrostatic potential superimposed on electron density of H{sub 2}, Al{sub 4} and ScAI{sub 3}. Highlights: ► A first principles calculation on hydrogen interaction and saturation on stable ScAl{sub 3} cluster is performed. ► Sc atom has higher negative charge electron density over Al atom in ScAl{sub 3} from natural bond orbital charge analysis. ► H{sub 2} undergoes dissociative chemisorption on the Sc atop site resulting in Sc–H–AI bridge bond. ► H{sub 2} saturation on Sc site results initially in chemisorption and then physisorption with the maximum loading of 6 molecules resulting in stable ScAl{sub 3}H{sub 12} structure. -- Abstract: Complex metal hydrides are promising hydrogen storage material for mobile applications. The presence of scandium catalysts in complex metal hydrides is found to improve significantly the kinetics of H{sub 2} adsorption and desorption. The exact role of these additives is not completely understood. NMR studies suggests the presence of distorted ScAl{sub 3} phase which is attributed to the enhancement of reversible uptake and release rates of H{sub 2}. In this study, we have investigated the hydrogen interaction and saturation on stable ScAl{sub 3} cluster at various sites using the density functional theory by employing unrestricted B3LYP/6-311++G(d,p) and the GGA-PW91/DNP methods. From natural bond orbital charge analysis and electrostatic potential superimposed on electron density plots, ScAl{sub 3} is found to be more polarized and Sc atom in ScAl{sub 3} cluster has higher negative charge and electron density over Al atoms. H{sub 2} undergoes dissociative chemisorption on the Sc atop site in ScAl{sub 3} resulting in Sc–H–Al bridge structure. The hydrogen saturation is studied by sequential H{sub 2} adsorption on ScAl{sub 3} cluster. In the Sc site, the first H{sub 2} molecule undergoes dissociative chemisorption and further addition results in H{sub 2} physisorption with the maximum loading

  9. Directed evolution of human scFvs in DT40 cells.

    Science.gov (United States)

    Lim, Alfred W Y; Williams, Gareth T; Rada, Cristina; Sale, Julian E

    2016-02-01

    Cells that constitutively diversify their immunoglobulin genes can be used for selection of novel antibodies and for refining existing affinities and specificities. Here, we report an adaptation of the chicken DT40 system wherein its capacity for somatic hypermutation is harnessed to evolve human antibodies expressed as single-chain variable fragments (scFvs). Expression of membrane-anchored scFvs from within the rearranged Igλ locus created self-diversifying scFv libraries from which we could both select scFvs of a desired specificity and evolve both the specificity and affinity of existing scFvs by iterative expansion and selection. From these scFvs, we were able to create fully human IgG antibodies with nanomolar affinities. We further enhanced the functionality of the system by creating a pool of DT40 scFv lines with high levels of mutation driven by the overexpression of a hyperactive variant of activation-induced deaminase. From this library, we successfully isolated scFvs that bound the spliceosome factor CWC15 and the cytokine human IFNγ. Our results demonstrate the flexibility and utility of DT40 for rapid generation of scFv repertoires and efficient selection, evolution and affinity maturation of scFv specificities.

  10. Effect of Severe Plastic Deformation on Structure and Properties of Al-Sc-Ta and Al-Sc-Ti Alloys.

    Science.gov (United States)

    Berezina, Alla; Monastyrska, Tetiana; Davydenko, Olexandr; Molebny, Oleh; Polishchuk, Sergey

    2017-12-01

    The comparative analysis of the effect of monotonous and non-monotonous severe plastic deformations (SPD) on the structure and properties of aluminum alloys has been carried out. Conventional hydrostatic extrusion (HE) with a constant deformation direction and equal-channel angular hydroextrusion (ECAH) with an abrupt change in the deformation direction were chosen for the cases of monotonous and non-monotonous SPD, respectively. Model cast hypoeutectic Al-0.3%Sc alloys and hypereutectic Al-0.6%Sc alloys with Ta and Ti additives were chosen for studying. It was demonstrated that SPD of the alloys resulted in the segregation of the material into active and inactive zones which formed a banded structure. The active zones were shown to be bands of localized plastic deformation. The distance between zones was found to be independent of the accumulated strain degree and was in the range of 0.6-1 μm. Dynamic recrystallization in the active zones was observed using TEM. The dynamic recrystallization was accompanied by the formation of disclinations, deformation bands, low-angle, and high-angle boundaries, i.e., rotational deformation modes developed. The dynamic recrystallization was more intense during the non-monotonous deformation as compared with the monotonous one, which was confirmed by the reduction of texture degree in the materials after ECAH.

  11. SC1327-312 & SC1329-313 two galaxy groups in-between a major merging event observed with Beppo-SAX

    CERN Document Server

    Bardelli, S; Ettori, S; Molendi, S; Zucca, E; Colafrancesco, Sergio

    2001-01-01

    We present the results of two Beppo-SAX observations of the poor clusters SC1327-312 and SC1329-313. These objects are located in a huge structure, formed by three ACO clusters, which is probably the remnant of one of the largest and best studied major mergings known. Given the fact that these poor clusters are in between two interacting ACO clusters, the aim of this work is to study the physics of the intracluster medium and to look for the possible presence of shocks. We derived the gas distribution profiles, the global (i.e. within 0.3 Mpc) temperatures and abundances and the temperature profiles and maps for SC1327-312 and SC1329-313. Also the presence of soft excess in LECS and hard excess in PDS have been checked. We do not find evidence of regions where the gas is shocked or significantly heated. The image of SC1327-312 seems rather symmetric, while the gas profile of SC1329-313 shows disturbed, comet-like shaped isophotes, with the tail pointing toward A3562 and a compression toward SC1327-312. The pr...

  12. Preparation and characterization of Sc doped MgB2 wires

    Science.gov (United States)

    Grivel, J.-C.; Burdusel, M.

    2016-09-01

    The in-situ technique was used to manufacture scandium (Sc) doped MgB2 wires in a composite Cu-Nb sheath. After reaction at 700 °C, at most 1 at.% Mg was replaced by Sc in the MgB2 phase, without significant influence on its superconducting transition temperature. For higher Sc concentrations in the nominal composition, the formation of Sc-rich impurity phases was evidenced by SEM/EDS observations. The critical current density and accommodation field of the wires are weakly dependant on the Sc content. It is believed that these effects are related more to modifications of the thermal behaviour of the precursor powders revealed by DTA measurements than to actual doping. The best performance was obtained in a wire with Mg:Sc = 0.995_0.005 atomic ratio.

  13. In vitro neutralization of prions with PrP(Sc)-specific antibodies.

    Science.gov (United States)

    Taschuk, Ryan; Van der Merwe, Jacques; Marciniuk, Kristen; Potter, Andrew; Cashman, Neil; Griebel, Philip; Napper, Scott

    2015-01-01

    Prion diseases reflect the misfolding of a self-protein (PrP(C)) into an infectious, pathological isomer (PrP(Sc)). By targeting epitopes uniquely exposed by misfolding, our group developed PrP(Sc)-specific vaccines to 3 disease specific epitopes (DSEs). Here, antibodies induced by individual DSE vaccines are evaluated for their capacity to neutralize prions in vitro. For both purified antibodies and immunoreactive sera, the PrP(Sc)-specific antibodies were equally effective in neutralizing prions. Further, there was no significant increase in neutralizing activity when multiple DSEs were targeted within an assay. At a low antibody concentration, the PrP(Sc)-specific antibodies matched the neutralization achieved by an antibody that may act via both PrP(C) and PrP(Sc). At higher doses, however, this pan-specific antibody was more effective, potentially due to a combined deactivation of PrP(Sc) and depletion of PrP(C).

  14. Sulfated dextrans enhance in vitro amplification of bovine spongiform encephalopathy PrP(Sc and enable ultrasensitive detection of bovine PrP(Sc.

    Directory of Open Access Journals (Sweden)

    Yuichi Murayama

    Full Text Available BACKGROUND: Prions, infectious agents associated with prion diseases such as Creutzfeldt-Jakob disease in humans, bovine spongiform encephalopathy (BSE in cattle, and scrapie in sheep and goats, are primarily comprised of PrP(Sc, a protease-resistant misfolded isoform of the cellular prion protein PrP(C. Protein misfolding cyclic amplification (PMCA is a highly sensitive technique used to detect minute amounts of scrapie PrP(Sc. However, the current PMCA technique has been unsuccessful in achieving good amplification in cattle. The detailed distribution of PrP(Sc in BSE-affected cattle therefore remains unknown. METHODOLOGY/PRINCIPAL FINDINGS: We report here that PrP(Sc derived from BSE-affected cattle can be amplified ultra-efficiently by PMCA in the presence of sulfated dextran compounds. This method is capable of amplifying very small amounts of PrP(Sc from the saliva, palatine tonsils, lymph nodes, ileocecal region, and muscular tissues of BSE-affected cattle. Individual differences in the distribution of PrP(Sc in spleen and cerebrospinal fluid samples were observed in terminal-stage animals. However, the presence of PrP(Sc in blood was not substantiated in the BSE-affected cattle examined. CONCLUSIONS/SIGNIFICANCE: The distribution of PrP(Sc is not restricted to the nervous system and can spread to peripheral tissues in the terminal disease stage. The finding that PrP(Sc could be amplified in the saliva of an asymptomatic animal suggests a potential usefulness of this technique for BSE diagnosis. This highly sensitive method also has other practical applications, including safety evaluation or safety assurance of products and byproducts manufactured from bovine source materials.

  15. Toward low-cost affinity reagents: lyophilized yeast-scFv probes specific for pathogen antigens.

    Directory of Open Access Journals (Sweden)

    Sean A Gray

    Full Text Available The generation of affinity reagents, usually monoclonal antibodies, remains a critical bottleneck in biomedical research and diagnostic test development. Recombinant antibody-like proteins such as scFv have yet to replace traditional monoclonal antibodies in antigen detection applications, in large part because of poor performance of scFv in solution. To address this limitation, we have developed assays that use whole yeast cells expressing scFv on their surfaces (yeast-scFv in place of soluble purified scFv or traditional monoclonal antibodies. In this study, a nonimmune library of human scFv displayed on the surfaces of yeast cells was screened for clones that bind to recombinant cyst proteins of Entamoeba histolytica, an enteric pathogen of humans. Selected yeast-scFv clones were stabilized by lyophilization and used in detection assay formats in which the yeast-scFv served as solid support-bound monoclonal antibodies. Specific binding of antigen to the yeast-scFv was detected by staining with rabbit polyclonal antibodies. In flow cytometry-based assays, lyophilized yeast-scFv reagents retained full binding activity and specificity for their cognate antigens after 4 weeks of storage at room temperature in the absence of desiccants or stabilizers. Because flow cytometry is not available to all potential assay users, an immunofluorescence assay was also developed that detects antigen with similar sensitivity and specificity. Antigen-specific whole-cell yeast-scFv reagents can be selected from nonimmune libraries in 2-3 weeks, produced in vast quantities, and packaged in lyophilized form for extended shelf life. Lyophilized yeast-scFv show promise as low cost, renewable alternatives to monoclonal antibodies for diagnosis and research.

  16. File list: ALL.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.50.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX535239,SRX53...RX590290,SRX590286,SRX661084,SRX1074905,SRX1074908,SRX535237,SRX535241,SRX661085,SRX1074909,SRX1074906 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.50.AllAg.EpiSC.bed ...

  17. File list: ALL.PSC.10.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.10.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX590288,SRX53...RX590290,SRX1074917,SRX1074916,SRX590285,SRX590286,SRX535242,SRX1074908,SRX1074905,SRX535238,SRX535237 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.10.AllAg.EpiSC.bed ...

  18. File list: ALL.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.05.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX590288,SRX53...RX590290,SRX590289,SRX590285,SRX1074916,SRX1074917,SRX590286,SRX535242,SRX1074908,SRX1074905,SRX535237 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.05.AllAg.EpiSC.bed ...

  19. File list: ALL.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.20.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX535239,SRX66...RX590289,SRX590285,SRX590290,SRX590286,SRX1074909,SRX1074908,SRX1074905,SRX1074906,SRX535237,SRX535241 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.20.AllAg.EpiSC.bed ...

  20. DC-SC Photoinjector with Low Emittance at Peking University

    CERN Document Server

    Xiang Rong; Hao, J; Huang, Senlin; Lu Xiang Yang; Quan, Shengwen; Zhang, Baocheng; Zhao, Kui

    2005-01-01

    High average power Free Electron Lasers require the high quality electron beams with the low emittance and the sub-picosecond bunches. The design of DC-SC photoinjector, directly combining a DC photoinjector with an SRF cavity, can produce high average current beam with moderate bunch charge and high duty factor. Because of the DC gun, the emittance increases quickly at the beginning, so a carefully design is needed to control that. In this paper, the simulation of an upgraded design has been done to lower the normalized emittance below 1.5mm·mrad. The photoinjector consists of a DC gap and a 2+1/2-cell SRF cavity, and it is designed to produce 4.2 MeV electron beams at 100pC bunch charge and 81.25MHz repetition rate (8 mA average current).

  1. Domain structure and phase transition in Sc-doped zirconia

    Science.gov (United States)

    Brunauer, G.; Boysen, H.; Frey, F.; Ehrenberg, H.

    2002-01-01

    The temperature dependence of the domain structure associated with the ferroelastic phase transition (Fm↔R bar 3 m) in ZrO2 doped with 11% Sc2O3 has been determined from a peak shape analysis of high-resolution synchrotron x-ray powder diffraction data. In the temperature region of coexisting phases the observed characteristic anisotropic broadening and asymmetry of the lines is modelled by three different phases: a main rhombohedral phase, a distorted rhombohedral phase with a smaller c/a ratio, and a cubic phase. The latter two are assigned to the internal structure of the domain walls between two adjacent twin domains. The size and amount of the cubic phase show an initially slow increase with temperature followed by a very steep increase and a slow one after that. The size of the (main) rhombohedral domains remains nearly constant, while (micro-) strain in the distorted regions gradually decreases.

  2. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    Clausen, Johan Christian

    The following pages contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short master projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering. Each project description provides a brief overview of the purpose as well as the main activities. Further, a weighting between theoretical analysis, experimental work and computer modelling has been proposed. Usually...... page. Furthermore, other ideas for projects may be discussed with a potential supervisor. Many private engineering companies have a homepage on which they state that they would like to collaborate with students on a master project....

  3. Final Report for DOE Grant Number DE-SC0001481

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Edison [Rice University

    2013-12-02

    This report covers research activities, major results and publications supported by DE-SC-000-1481. This project was funded by the DOE OFES-NNSA HEDLP program. It was a joint research program between Rice University and the University of Texas at Austin. The physics of relativistic plasmas was investigated in the context of ultra-intense laser irradiation of high-Z solid targets. Laser experiments using the Texas Petawatt Laser were performed in the summers of 2011, 2012 and 2013. Numerical simulations of laser-plasma interactions were performed using Monte Carlo and Particle-in-Cell codes to design and support these experiments. Astrophysical applications of these results were also investigated.

  4. Mean pion multiplicities in Ar+Sc collisions

    CERN Document Server

    Naskręt, Michał

    2016-01-01

    Preliminary results for mean negatively charged pion multiplicities $\\langle \\pi^- \\rangle$ using the $h^-$ method are presented for central Ar+Sc collisions at 13, 19, 30, 40, 75 and 150\\textit{A} GeV/c beam momentum. The data were recorded by the NA61/SHINE detector at the CERN SPS. Starting with rapidity distributions ${dn}/{dy}$ the procedure of obtaining total multiplicities is presented. The mean number of wounded nucleons $\\langle W\\rangle$ extracted from the Glissando MC model is used to calculate the ratio $\\langle \\pi^- \\rangle/\\langle W\\rangle.$ The results are compared to those from other experiments and their dependence on colliding systems and collision energy is discussed.

  5. Ferromagnetism carried by highly delocalized hybrid states in Sc-doped ZnO thin films

    KAUST Repository

    Benali Kanoun, Mohammed

    2012-05-29

    We present first-principles results for Sc-doped ZnOthin films. Neighboring Sc atoms in the surface and/or subsurface layers are found to be coupled ferromagnetically, where only two of the possible configurations induce spin polarization. In the first configuration, the polarization is carried by the Sc d states as expected for transition metaldoping. However, there is a second configuration which is energetically favorable. It is governed by polarized hybrid states of the Zns, O p, and Sc d orbitals. Such highly delocalized states can be an important ingredient for understanding the magnetism of dopedZnOthin films.

  6. Atomic bonding and mechanical properties of Al-Mg-Zr-Sc alloy

    Institute of Scientific and Technical Information of China (English)

    高英俊; 班冬梅; 韩永剑; 钟夏平; 刘慧

    2004-01-01

    The valence electron structures of Al-Mg alloy with minor Sc and Zr were calculated according to the empirical electron theory(EET) in solid. The results show that because of the strong interaction of Al atom with Zr and Sc atom in melting during solidification, the Al3 Sc and Al3 (Sc1-xZrx) particles which act as heterogeneous nuclear are firstly crystallized in alloy to make grains refine. In progress of solidification, the Al-Sc, Al-Zr-Sc segregation regions are formed in solid solution matrix of Al-Mg alloy owing to the strong interaction of Al atom with Zr, Scatoms in bulk of alloy, so in the following homogenization treatment, the finer dispersed Al3 Sc and Al3 (Sc1-x Zrx) second-particles which are coherence with the matrix are precipitated in the segregation region. These finer second particles with the strong Al-Zr, Al-Sc covalent bonds can strengthen the covalent bonds in matrix of the alloy, and also enhance the hardness and strength of Al-Mg alloy. Those finer second-particles precipitated in interface of sub-grains can also strengthen the covalence bonds there, and effectively hinder the interface of sub-grains from migrating and restrain the sub-grains from growing, and cause better thermal stability of Al-Mg alloy.

  7. Model of Dees and Rotco for the 600 MeV SC

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    The accelerating frequency of the 600 MeV Synchro-Cyclotron (SC) was modulated by the varying capacity of a rotating condenser ("Rotco", the most delicate component of the SC). A 1/5-scale model, dating from the design-period of the SC, was used to study improvements to the SC RF-system, and also the acceleration of ions, first Helium and, at the time of this picture, Carbon. In the middle of the picture is the case containing the Dees. To the left, at the wide end of the cone, a rotco. Reinhold Hohbach is busy with measurements. See also 7805235 (Annual Report 1978, p.110).

  8. Nuclear Level Density and Gamma-Ray Strength Function of 43Sc

    CERN Document Server

    Bürger, A; Hilaire, S; Guttormsen, M; Harissopulos, S; Kmiecik, M; Konstantinopoulos, T; Krticka, M; Lagoyannis, A; Lönnroth, T; Mazurek, K; Norrby, M; Nyhus, H T; Perdikakis, G; Siem, S; Spyrou, A; Syed, N U H; 10.1103/PhysRevC.85.064328

    2012-01-01

    The nuclear level density and the gamma-ray strength function have been determined for 43Sc in the energy range up to 2 MeV below the neutron separation energy using the Oslo method with the 46Ti(p,alpha)43Sc reaction. A comparison to 45Sc shows that the level density of 43Sc is smaller by an approximately constant factor of two. This behaviour is well reproduced in a microscopical/combinatorial model calculation. The gamma-ray strength function is showing an increase at low gamma-ray energies, a feature which has been observed in several nuclei but which still awaits theoretical explanation.

  9. Bingel-Hirsch reaction mechanisms on TiSc2N@Ih-C80: the role of endohedral titanium nitride.

    Science.gov (United States)

    Zhao, Pei; Dang, Jing-Shuang; Zhao, Xiang

    2016-04-14

    Recently, two unconventional singly bonded monoadducts of mixed-metal nitride clusterfullerene TiSc2N@Ih-C80 have been synthesized. Herein, the site-selectivity and kinetic processes of Bingel-Hirsch reactions are explored by density functional theory calculations. Because of the rotation of the inner TiSc2N unit, two different types of singly bonded monoadducts (named 666 and 566 adducts) are clarified. Meanwhile, the two functionalized sites are situated above the Ti-Sc edge of the inner cluster in singly bonded adducts. Addition on the triple-fused-hexagon site (6-6-6 site) is found to be kinetically preferred, which can be attributed to the more positive charge of the carbon in the 6-6-6 site. In addition, we investigated the formation process of two conventional cycloadducts. A preference for the addition on the bridged hexagon-hexagon bond is concluded in theory, furthermore, one Sc atom instead of the Ti atom is pointing to the functionalized bond for the lowest-energy orientational product.

  10. Phase stability, band gap, and electronic and magnetic properties of quaternary heusler alloys FeMnScZ (Z = Al, Ga, In)

    Science.gov (United States)

    Gao, Y. C.; Zhang, Y.; Wang, X. T.

    2015-03-01

    By using the first-principles calculations, we have systematically investigated the phase stability, band gap, and electronic structures and magnetic properties of quaternary Heusler alloys FeMnScZ (Z = Al, Ga, In). We found that FeMnScZ (Z = Al, Ga, In) alloys are half-metallic ferrimagnets at their equilibrium lattice constants and retain a high spin polarization over a quite wide range of lattice distortions. The half-metallic band gap in the FeMnScZ (Z = Al, Ga, In) alloys arises from t 1u- t 2g splitting but not e u- t 1u splitting. The total magnetic moments are 3 µB per unit cell for FeMnScZ (Z = Al, Ga, In) alloys, following the Slater-Pauling rule with the total number of valence electrons minus 18 rather than 24. Moreover, all of these alloys have a negative formation energy, which implies that they can be synthesized experimentally.

  11. Baculovirus display of single chain antibody (scFv using a novel signal peptide

    Directory of Open Access Journals (Sweden)

    Gonzalez Gaëlle

    2010-11-01

    Full Text Available Abstract Background Cells permissive to virus can become refractory to viral replication upon intracellular expression of single chain fragment variable (scFv antibodies directed towards viral structural or regulatory proteins, or virus-coded enzymes. For example, an intrabody derived from MH-SVM33, a monoclonal antibody against a conserved C-terminal epitope of the HIV-1 matrix protein (MAp17, was found to exert an inhibitory effect on HIV-1 replication. Results Two versions of MH-SVM33-derived scFv were constructed in recombinant baculoviruses (BVs and expressed in BV-infected Sf9 cells, N-myristoylation-competent scFvG2/p17 and N-myristoylation-incompetent scFvE2/p17 protein, both carrying a C-terminal HA tag. ScFvG2/p17 expression resulted in an insoluble, membrane-associated protein, whereas scFvE2/p17 was recovered in both soluble and membrane-incorporated forms. When coexpressed with the HIV-1 Pr55Gag precursor, scFvG2/p17 and scFvE2/p17 did not show any detectable negative effect on virus-like particle (VLP assembly and egress, and both failed to be encapsidated in VLP. However, soluble scFvE2/p17 isolated from Sf9 cell lysates was capable of binding to its specific antigen, in the form of a synthetic p17 peptide or as Gag polyprotein-embedded epitope. Significant amounts of scFvE2/p17 were released in the extracellular medium of BV-infected cells in high-molecular weight, pelletable form. This particulate form corresponded to BV particles displaying scFvE2/p17 molecules, inserted into the BV envelope via the scFv N-terminal region. The BV-displayed scFvE2/p17 molecules were found to be immunologically functional, as they reacted with the C-terminal epitope of MAp17. Fusion of the N-terminal 18 amino acid residues from the scFvE2/p17 sequence (N18E2 to another scFv recognizing CD147 (scFv-M6-1B9 conferred the property of BV-display to the resulting chimeric scFv-N18E2/M6. Conclusion Expression of scFvE2/p17 in insect cells using a BV

  12. Production of single chain Fab (scFab fragments in Bacillus megaterium

    Directory of Open Access Journals (Sweden)

    Dübel Stefan

    2007-11-01

    Full Text Available Abstract Background The demand on antigen binding reagents in research, diagnostics and therapy raises questions for novel antibody formats as well as appropriate production systems. Recently, the novel single chain Fab (scFab antibody format combining properties of single chain Fv (scFv and Fab fragments was produced in the Gram-negative bacterium Escherichia coli. In this study we evaluated the Gram-positive bacterium Bacillus megaterium for the recombinant production of scFab and scFvs in comparison to E. coli. Results The lysozyme specific D1.3 scFab was produced in B. megaterium and E. coli. The total yield of the scFab after purification obtained from the periplasmic fraction and culture supernatant of E. coli was slightly higher than that obtained from culture supernatant of B. megaterium. However, the yield of functional scFab determined by analyzing the antigen binding activity was equally in both production systems. Furthermore, a scFv fragment with specificity for the human C reactive protein was produced in B. megaterium. The total yield of the anti-CRP scFv produced in B. megaterium was slightly lower compared to E. coli, whereas the specific activity of the purified scFvs produced in B. megaterium was higher compared to E. coli. Conclusion B. megaterium allows the secretory production of antibody fragments including the novel scFab antibody format. The yield and quality of functional antibody fragment is comparable to the periplasmic production in E. coli.

  13. Expression and bioactivity identification of soluble MG7 scFv

    Institute of Scientific and Technical Information of China (English)

    Zhao-Cai Yu; Jie Ding; Bo-Rong Pan; Dai-Ming Fan; Xue-Yong Zhang

    2002-01-01

    AIM: To examine the molecular mass and identify thebioactivity of MG7 scFv for its application as a targetingmediator in gene therapy of gastric cancer.METHODS: Two strongly positive recombinant phage clonesscreened from MG7 recombinant phage antibody library wereseparately transfected into E. coli TG1. Plasmid wasisolated from the transfected E. coli TG1 and digested byEcoR Ⅰ and Hind Ⅲ to examine the length of exogenousscFv gene. Then, the positive recombinant phage cloneswere individually transfected into E. coli HB2151. Thetransfectant was cultured and induced by IPTG. Perplasmicextracts was prepared from the induced transfectant byosmotic shock. ELISA was used to examine the antigen-binding affinity of the soluble MG7 scFv. Immunodottingassay was adopted to evaluate the yield of soluble MG7 scFvproduced by transfected E. coli HB2151. Western blot wasused to examine the molecular mass of MG7 scFv. Finally,the nucleotide sequence of MG7 scFv was examined by DNAsequencing.RESULTS: Two positive recombinant phage clones werefound to contain the exogenous scFv gene. ELISA showedthat MG7 scFv had strong antigen-binding affinity.Immuodotting assay showed that transfected E. coli HB2151could successfully produce the soluble MG7 scFv with highyield via induction by IPTG. The molecular mass of MG7scFv was 30 kDa by western blot. DNA sequencingdemonstrated that the VH and VL genes of MG7 scFv were363bp and 321 bp, respectively.CONCLUSION: We have successfully developed the solubleMG7 scFv which possessed strong antigen-binding affinity.

  14. The Conundrum about the United Nations Security Council: A Guardian of Peace or Cause for Concern?

    National Research Council Canada - National Science Library

    Berdal Aral

    2016-01-01

    This paper seeks to find out whether the United Nations Security Council (UN SC) has been perfoming its primary task of safeguarding international peace and security effectively since the Cold War has become a matter of history...

  15. NiO-ScSZ and Ni 0.9Mg 0.1O-ScSZ-based anodes under internal dry reforming of simulated biogas mixtures

    Science.gov (United States)

    Shiratori, Y.; Sasaki, K.

    Solid oxide fuel cells (SOFCs) with NiO-ScSZ and Ni 0.9Mg 0.1O-ScSZ-based anodes were operated by directly feeding a fuel mixture of CH 4, CO 2 and N 2 (CH 4 to CO 2 ratio of 3:2). Stable operation under constant current load (200 mA cm -2) was achieved with a NiO-ScSZ type anode during 200 h operating hours at 900 °C. Less stable operation occurred with a Ni 0.9Mg 0.1O-ScSZ type anode. In the case of SOFC with Ni 0.9Mg 0.1O-ScSZ as the anode, the methane reforming activity was higher than that with NiO-ScSZ. This was explained by change in the microstructure promoting reforming reactions. However, the addition of MgO resulted in degradation of electrochemical performance due to increase in ohmic resistance of the anode material during operation.

  16. Using Automatic Identification System Technology to Improve Maritime Border Security

    Science.gov (United States)

    2014-12-01

    18 Dave Dixon et al., Security Modeling for Maritime Port Defense Resource Allocation ( Aiken , SC: Savannah River National Laboratory, 2010), 3...Maritime Port Defense Resource Allocation. Aiken , SC: Savannah River National Laboratory, 2010. Eggers, William D., and John O’Leary. If We Can Put a

  17. Kampelite, Ba3Mg1.5Sc4(PO4)6(OH)3·4H2O, a new very complex Ba-Sc phosphate mineral from the Kovdor phoscorite-carbonatite complex (Kola Peninsula, Russia)

    Science.gov (United States)

    Yakovenchuk, Victor N.; Ivanyuk, Gregory Yu.; Pakhomovsky, Yakov A.; Panikorovskii, Taras L.; Britvin, Sergei N.; Krivovichev, Sergey V.; Shilovskikh, Vladimir V.; Bocharov, Vladimir N.

    2017-06-01

    Kampelite, Ba3Mg1.5Sc4(PO4)6(OH)3·4H2O, is a new Ba-Sc phosphate from the Kovdor phoscorite-carbonatite complex (Kola Peninsula, Russia). It is orthorhombic, Pnma, a = 11.256(1), b = 8.512(1), c = 27.707(4) Å, V = 2654.6(3) Å3 and Z = 4 (from powder diffraction data) or a = 11.2261(9), b = 8.5039(6), c = 27.699(2) Å, V = 2644.3(3) Å3 (from single-crystal diffraction data). The mineral was found in a void within the calcite-magnetite phoscorite (enriched in hydroxylapatite and Sc-rich baddeleyite) inside the axial zone of the Kovdor phoscorite-carbonatite pipe. Kampelite forms radiated aggregates (up to 1.5 mm in diameter) of platy crystals grown on the surfaces of crystals of quintinite-2H in close association with pyrite, bobierrite and quintinite-3R. Kampelite is colourless, with a pearly lustre and a white streak. The cleavage is perfect on {001}, the fracture is smooth. Mohs hardness is about 1. In transmitted light, the mineral is colourless without pleochroism or dispersion. Kampelite is biaxial + (pseudouniaxial), α ≈ β = 1.607(2), γ = 1.612(2) (589 nm), and 2V calc = 0°. The calculated and measured densities are 3.28 and 3.07(3) g·cm-3, respectively. The mean chemical composition determined by electron microprobe is: MgO 4.79, Al2O3 0.45, P2O5 31.66, K2O 0.34, Sc2O3 16.17, Mn2O3 1.62, Fe2O3 1.38, SrO 3.44, and BaO 29.81 wt%. The H2O content estimated from the crystal-structure refinement is 7.12 wt%, giving a total of 96.51 wt%. The empirical formula calculated on the basis of P = 6 apfu (atoms per formula unit) is (Ba2.62Sr0.45K0.10Ca0.06)Σ3.23Mg1.60Mn0.28(Sc3.15Fe3+ 0.23Al0.12)Σ3.50(PO4)6(OH)2.61·4.01H2O. The simplified formula is Ba3Mg1.5Sc4(PO4)6(OH)3·4H2O. The mineral easily dissolves in 10% cold HCl. The strongest X-ray powder-diffraction lines [listed as d in Å (I) (hkl)] are as follows: 15.80(100)(001), 13.86(45)(002), 3.184(18)(223), 3.129(19)(026), 2.756(16)(402), 2.688(24)(1010). The crystal structure of kampelite was refined to

  18. Final Technical Report – DOE Grant DE-SC0005904

    Energy Technology Data Exchange (ETDEWEB)

    Dear, Jody [Connecticut State Univ. System, Hartford, CT (United States)

    2013-10-23

    DOE grant DE-SC0005904 was allocated to fund the faculty development, curriculum development and travel to support the four institutions of the Connecticut State University System’s (CSUS) Initiative for Nanotechnology-related Equipment, Faculty Development and Curriculum Development. DOE grant DE-SC0005072 was also awarded for this program. In 2010, CSUS had identified the establishment of nanotechnology programs and infrastructure as a priority. At that time, the system set the goal of establishing an academic initiative in nanotechnology for the CSUS, beginning with the development of a series of courses at the graduate level. Implementation was planned via a collaborative effort including faculty from all four of the CSUS campuses. The CSUS Nanotechnology Working Group [CSUS NWG] was established to accomplish this goal. A faculty member from the Physics Department at Southern Connecticut State University [SCSU] was assigned the task of organizing and coordinating the work of the CSUS NWG. Representatives from each of the four CSUS campuses were appointed to join the CSUS NWG with the following initial representation: SCSU [Physics and Biology], Western Connecticut State University (WCSU) [Chemistry], Eastern Connecticut State University (ECSU) [Chemistry] and Central Connecticut State University (CCSU) [Chemistry. As a further outcome it was determined that this collaborative effort would lead to the establishment of a formal nanotechnology center, serving as the nucleus of CSUS student and faculty learning and research. This CSUS Nanotechnology Center [CSUS-NC] was to be located at Southern Connecticut State University (SCSU). The goal of this grant was to provide funding for curriculum and faculty development necessary to facilitate the development and implementation of a collaborative Graduate Certificate in Nanotechnology for the Connecticut State University System. This outcome has been successfully achieved. The courses and structure of the Graduate

  19. Structural and electronic studies of metal carbide clusterfullerene Sc2C2@Cs-C72

    Science.gov (United States)

    Feng, Yongqiang; Wang, Taishan; Wu, Jingyi; Feng, Lai; Xiang, Junfeng; Ma, Yihan; Zhang, Zhuxia; Jiang, Li; Shu, Chunying; Wang, Chunru

    2013-07-01

    We present a metal carbide clusterfullerene Sc2C2@Cs(10528)-C72, whose structure has been baffling for many years. A motional endohedral Sc2C2 cluster, special molecule geometry and electronic structure were found in Sc2C2@Cs(10528)-C72. The paramagnetic Sc2C2@Cs-C72 anion radical was successfully prepared by a chemical reduction method and hyperfine couplings in the ESR spectrum were observed.We present a metal carbide clusterfullerene Sc2C2@Cs(10528)-C72, whose structure has been baffling for many years. A motional endohedral Sc2C2 cluster, special molecule geometry and electronic structure were found in Sc2C2@Cs(10528)-C72. The paramagnetic Sc2C2@Cs-C72 anion radical was successfully prepared by a chemical reduction method and hyperfine couplings in the ESR spectrum were observed. Electronic supplementary information (ESI) available: Experimental details, HPLC chromatogram, and DFT calculations. CCDC 917712. For ESI and crystallographic data in CIF or other electronic format see DOI: 10.1039/c3nr01739g

  20. Implementation of LTE SC-FDMA on the USRP2 Software Defined Radio Platform

    DEFF Research Database (Denmark)

    Jørgensen, Peter Bjørn; Hansen, Thomas Lundgaard; Sørensen, Troels Bundgaard;

    2011-01-01

    In this paper we discuss the implementation of a Single Carrier Frequency Division Multiple Access (SC-FDMA) transceiver running over the Universal Software Radio Peripheral 2 (USRP2). SC-FDMA is the air interface which has been selected for the uplink in the latest Long Term Evolution (LTE...

  1. Superconductivity at 3.1 K in the orthorhombic ternary silicide ScRuSi

    Science.gov (United States)

    Ruan, Bin-Bin; Wang, Xiao-Chuan; Yu, Jia; Pan, Bo-Jin; Mu, Qing-Ge; Liu, Tong; Chen, Gen-Fu; Ren, Zhi-An

    2017-02-01

    We report the synthesis, crystal structure, superconductivity and physical property characterizations of the ternary equiatomic compound ScRuSi. Polycrystalline samples of ScRuSi were prepared by an arc-melting method. The as-prepared samples were identified as the orthorhombic Co2P-type o-ScRuSi by powder x-ray diffraction analysis. Electrical resistivity measurements show o-ScRuSi to be a metal which superconducts below a T c of 3.1 K; the upper critical field μ 0 H c2(0) is estimated to be 0.87 T. The magnetization and specific heat measurements confirm the bulk type-II superconductivity in o-ScRuSi, with a specific heat jump within the BCS weak coupling limit. o-ScRuSi is the first Co2P-type superconductor to contain scandium. After annealing at 1273 K for a week, o-ScRuSi transforms into hexagonal Fe2P-type h-ScRuSi, which is a Pauli-paramagnetic metal with no superconductivity observed above 1.8 K.

  2. Characterization of early transient accumulation of PrP(Sc) in immune cells.

    Science.gov (United States)

    Elhelaly, Abdelazim Elsayed; Inoshima, Yasuo; Ishiguro, Naotaka

    2013-09-27

    PrP(Sc) is known to elicit no specific immune response and the immune cells are suspected to support its accumulation. In the present study, we investigated the response of some immune cell types to PrP(Sc) to characterize an observed early transient accumulation of PrP(Sc). After cells were treated with PrP(Sc)-brain homogenate, PrP(Sc) was transiently accumulated for the first 8-12h post-exposure then completely cleared by the 5th day of the experiment. The accumulated PrP(Sc) was not a de novo product of the cell PrP(C). Further investigation of this phenomenon revealed some potential factors influencing it. These factors included cholesterol homeostasis, temperature, the degradation power of the cell and the availability of sufficient PrP(C). Our in vitro results suggest that immune cells, especially macrophages are potential risk factors for the accumulation and intercellular spread of PrP(Sc) if the complete clearance of PrP(Sc) were not fulfilled.

  3. 33 CFR 110.72c - Lake Murray, S.C.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lake Murray, S.C. 110.72c Section 110.72c Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.72c Lake Murray, S.C. (a) The area beginning at the 125...

  4. Hydrogenation reactions using scCO2 as a solvent in microchannel reactors.

    Science.gov (United States)

    Kobayashi, Juta; Mori, Yuichiro; Kobayashi, Shū

    2005-05-28

    We have developed an effective microfluidic system for hydrogenation reactions in scCO(2); the reactions proceeded very rapidly (within 1 second), by making the best use of scCO(2) and utilizing the large specific interfacial area of the microchannel reactor, and high reaction productivity was attained in each channel.

  5. High-efficient physical adsorption and detection of formaldehyde using Sc- and Ti-decorated graphdiyne

    Science.gov (United States)

    Chen, Xi; Gao, Pengfei; Guo, Lei; Wen, Yanni; Fang, Dangqi; Gong, Baihua; Zhang, Yang; Zhang, Shengli

    2017-03-01

    In sensitive analysis, the ultimate limit is to achieve reliable detection on trace amount of molecules. In this work, Sc- and Ti-decorated graphdiyne were proposed as promising materials for high-efficient molecular detection. Using density functional theory calculations, we investigated the electronic response of single Sc- and Ti-atom-decorated graphdiyne to HCHO (as a typical air pollutant). Thermodynamic analysis predicted that Sc or Ti adatom could be stabilized on the corner sites of single-layer graphdiyne sheet, with migration barriers high enough to prevent Sc or Ti adatom aggregation. The adsorption of HCHO on Sc- or Ti-decorated graphdiyne was found stronger than on pristine graphene or graphdiyne, which provides a prerequisite for molecular sensing. The electronegativity of HCHO leads to strong electronic attraction from Sc or Ti adatom to HCHO, resulting in a remarkable decrease of carrier density in graphdiyne. On Ti-decorated graphdiyne, the electronic attraction of HCHO appears to be stronger than on Sc-decorated graphdiyne and changes the system from metal to n-doped semiconductor. Quantum transport calculations show a decrease of current caused by the adsorbed HCHO. The results systematically exhibit the electronic response of Sc- or Ti-decorated graphdiyne to HCHO and suggest them as promising materials for molecule detection.

  6. Curriculum (Study Programme) for the M.Sc., Medialogy, at Aalborg University in Copenhagen

    DEFF Research Database (Denmark)

    Serafin, Stefania; Nordahl, Rolf; Lavatino, Salvatore

    2004-01-01

    Defining and describing the education, M.Sc., Medialogy. The curriculum (Study Programme) describes semesters, themes, projectunits, courses and contents of the eduation. offered at Aalborg University in Copenhagen.......Defining and describing the education, M.Sc., Medialogy. The curriculum (Study Programme) describes semesters, themes, projectunits, courses and contents of the eduation. offered at Aalborg University in Copenhagen....

  7. PRODUCTION, ISOLATION AND SPECTROSCOPIC STUDIES OF THE ENDOHEDRAL FULLERENE Sc2@C80 (Ⅰ-Ⅲ)

    Institute of Scientific and Technical Information of China (English)

    Chunru Wang; Lihua Gan; Chunli Bai; Hisanori Shinohara

    2004-01-01

    The isolation of multiple-isomers of Sc2@C80 (Ⅰ, Ⅱ, Ⅲ) endohedral metallofullerenes is reported for the first time. The new C80-based Sc-metallofullerenes are characterized by UV-Vis-NIR absorption spectroscopy and detailed chromatographic retention time data. A close relationship between the isomer structure and the corresponding HPLC retention time of the metallofullerenes is presented.

  8. Establishment and characterization of Roberts syndrome and SC phocomelia model medaka (Oryzias latipes).

    Science.gov (United States)

    Morita, Akihiro; Nakahira, Kumiko; Hasegawa, Taeko; Uchida, Kaoru; Taniguchi, Yoshihito; Takeda, Shunichi; Toyoda, Atsushi; Sakaki, Yoshiyuki; Shimada, Atsuko; Takeda, Hiroyuki; Yanagihara, Itaru

    2012-06-01

    Roberts syndrome and SC phocomelia (RBS/SC) are genetic autosomal recessive syndromes caused by establishment of cohesion 1 homolog 2 ( ESCO 2) mutation. RBS/SC appear to have a variety of clinical features, even with the same mutation of the ESCO2 gene. Here, we established and genetically characterized a medaka model of RBS/SC by reverse genetics. The RBS/SC model was screened from a mutant medaka library produced by the Targeting Induced Local Lesions in Genomes method. The medaka mutant carrying the homozygous mutation at R80S in the conserved region of ESCO2 exhibited clinical variety (i.e. developmental arrest with craniofacial and chromosomal abnormalities and embryonic lethality) as characterized in RBS/SC. Moreover, widespread apoptosis and downregulation of some gene expression, including notch1a, were detected in the R80S mutant. The R80S mutant is the animal model for RBS/SC and a valuable resource that provides the opportunity to extend knowledge of ESCO2. Downregulation of some gene expression in the R80S mutant is an important clue explaining non-correlation between genotype and phenotype in RBS/SC.

  9. SC-535, a Novel Oral Multikinase Inhibitor, Showed Potent Antitumor Activity in Human Melanoma Models

    Directory of Open Access Journals (Sweden)

    Xin Chen

    2013-07-01

    Full Text Available Background: Melanoma is considered as one of the most aggressive and deadliest cancers and current targeted therapies of melanoma often suffer limited efficacy or drug resistance. Discovery of novel multikinase inhibitors as anti-melanoma drug candidates is still needed. Methods: In this investigation, we assessed the in vitro and in vivo anti-melanoma activities of SC-535, which is a novel small molecule multikinase inhibitor discovered by us recently. We analyzed inhibitory effects of SC-535 on various melanoma cell lines and human umbilical vascular endothelial cells (HUVEC in vitro. Tumor xenografts in athymic mice were used to examine the in vivo activity of SC-535. Results: SC-535 could efficiently inhibit vascular endothelial growth factor receptor (VEGFR 1/2/3, B-RAF, and C-RAF kinases. It showed significant antiangiogenic potencies both in vitro and in vivo and considerable anti-proliferative ability against several melanoma cell lines. Oral administration of SC-535 resulted in dose-dependent suppression of tumor growth in WM2664 and C32 xenograft mouse models. Studies of mechanisms of action indicated that SC-535 suppressed the tumor angiogenesis and induced G2/M phase cell cycle arrest in human melanoma cells. SC-535 possesses favorable pharmacokinetic properties. Conclusion: All of these results support SC-535 as a potential candidate for clinical studies in patients with melanoma.

  10. 33 CFR 165.708 - Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC.

    Science.gov (United States)

    2010-07-01

    ... Harbor and Cooper River, Charleston, SC. 165.708 Section 165.708 Navigation and Navigable Waters COAST... Guard District § 165.708 Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC. (a... Cooper River. All coordinates referenced use datum: NAD 1983. (2) All waters within 100 yards of...

  11. 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to inhibit hepatocellular carcinoma cells

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Meili, E-mail: fumeilidrlinyi@tom.com [Department of Infectious Disease, Linyi People' s Hospital, Linyi 276000 (China); Wan, Fuqiang [Department of Head and Neck Surgery, Linyi Tumor Hospital, Linyi 276000 (China); Li, Zhengling [Department of Nursing, Tengzhou Central People' s Hospital, Tengzhou 277500 (China); Zhang, Fenghua [Department of Operating Room, Linyi People' s Hospital, Linyi 276000 (China)

    2016-03-04

    The aim of the present study is to investigate the potential anti-hepatocellular carcinoma (HCC) cell activity by 4SC-202, a novel class I HDAC inhibitor (HDACi). The associated signaling mechanisms were also analyzed. We showed that 4SC-202 treatment induced potent cytotoxic and proliferation–inhibitory activities against established HCC cell lines (HepG2, HepB3, SMMC-7721) and patient-derived primary HCC cells. Further, adding 4SC-202 in HCC cells activated mitochondrial apoptosis pathway, which was evidenced by mitochondrial permeability transition pore (mPTP) opening, cytochrome C cytosol release and caspase-3/-9 activation. Inhibition of this apoptosis pathway, by caspase-3/-9 inhibitors, mPTP blockers, or by shRNA-mediated knockdown of cyclophilin-D (Cyp-D, a key component of mPTP), significantly attenuated 4SC-202-induced HCC cell death and apoptosis. Reversely, over-expression of Cyp-D enhanced 4SC-202's sensitivity in HCC cells. Further studies showed that 4SC-202 induced apoptosis signal-regulating kinase 1 (ASK1) activation, causing it translocation to mitochondria and physical association with Cyp-D. This mitochondrial ASK1-Cyp-D complexation appeared required for mediating 4SC-202-induced apoptosis activation. ASK1 stable knockdown by targeted-shRNAs largely inhibited 4SC-202-induced mPTP opening, cytochrome C release, and following HCC cell apoptotic death. Together, we suggest that 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to potently inhibit human HCC cells. - Highlights: • 4SC-202 exerts potent anti-proliferative and cytotoxic activity against established/primary HCC cells. • SC-202-induced anti-HCC cell activity relies on caspase-dependent apoptosis activation. • 4SC-202 activates Cyp-D-dependent mitochondrial apoptosis pathway in HCC cells. • 4SC-202 activates ASK1 in HCC cells, causing it translocation to mitochondria. • Mitochondrial ASK1-Cyp-D complexation mediates 4SC-202's activity in HCC cells.

  12. Effect of Sc addition on microstructure and mechanical properties of 1460 alloy

    Directory of Open Access Journals (Sweden)

    Juan Ma

    2014-02-01

    Full Text Available The effect of minor addition of Sc on microstructure, age hardening behavior, tensile properties and fracture morphology of 1460 alloy have been studied. It is found that Sc content increase from 0.11 wt% to 0.22 wt% is favorable for grain refinement in as-cast alloy but results in a coarsening of Cu-rich particles. The alloy with 0.11 wt% Sc exhibits enhanced mechanical properties and age hardening effect. Transmission electron microscopy (TEM investigations on the alloy with 0.11 wt% Sc have suggested that a large amount of Al3(Sc, Zr particles precipitated at the earlier aging may inhibit recrystallization effectively.

  13. Homogenization and Recrystallization of Al-6Mg Alloys with and without Sc and Zr

    Institute of Scientific and Technical Information of China (English)

    姜锋; 尹志民; 黄伯云; 贺跃辉; 陈苏里

    2004-01-01

    Plates of Al-6Mg alloys with and without scandium were prepared by semi-continuous cast, homogenization, hot-rolled, cold-rolled and annealing. Based on studying of effects of temperature and time on hardness and conductivity during homogenization, it was found that homogenization of ingot with Sc and Zr can result in dispersion strengthening. Recrystallization temperature of alloys was studied by hardness method and optical metallographic method. Staring recrystallization temperature of Al-6Mg alloys with Sc and Zr is 375 ℃, increasing by 150 ℃ than Al-6Mg alloys without Sc and Zr. Mechanical properties (σb, σ0.2, δ) of hot-rolled alloy with Sc and Zr are 400 MPa, 280 MPa and 18%; cold-rolled and anneal alloy with Sc and Zr are 420 MPa, 310 MPa and 12% respectively.

  14. Scandium-44: benefits of a long-lived PET radionuclide available from the (44)Ti/(44)Sc generator system.

    Science.gov (United States)

    Roesch, F

    2012-07-01

    (44)Ti/(44)Sc radionuclide generators are of interest for molecular imaging. The 3.97 hours half-life of (44)Sc and its high positron branching of 94.27% may stimulate the application of (44)Sc-labeled PET radiopharmaceuticals. This review describes the current status of (44)Ti production, (44)Ti/(44)Sc radionuclide generator development, post-processing of generator eluates towards medical application, identification of ligands adequate to Sc(III) co-ordination chemistry, proof-of-principle labeling of (44)Sc-DOTA-octreotides, investigation of in vitro and in vivo parameters, and initial applications for molecular imaging - both in small animals and humans.

  15. Preliminary Tests Of The Decris-sc Ion Source

    CERN Document Server

    Efremov, A; Bechterev, V; Bogomolov, S L; Bondarenko, P G; Datskov, V I; Dmitriev, S; Drobin, V; Lebedev, A; Leporis, M; Malinowski, H; Nikiforov, A; Paschenko, S V; Seleznev, V; Shishov, Yu A; Smirnov, Yu; Tsvineva, G; Yakovlev, B; Yazvitsky, N Yu

    2004-01-01

    A new "liquid He-free" superconducting Electron Cyclotron Resonance Ion Source DECRIS-SC, to be used as injector for the IC-100 small cyclotron, has been designed by FLNR and LHE JINR. The main feature is that a compact refrigerator of Gifford-McMahon type is used to cool the solenoid coils. For the reason of very small cooling power at 4.2 K (about 1 W) our efforts were to optimize the magnetic structure and minimize an external heating of the coils. The maximum magnetic field strength is 3 T and 2 T in injection and extraction region respectively. For the radial plasma confinement a hexapole made of NdFeB permanent magnet is used. The source will be capable of ECR plasma heating using different frequencies (14 GHz or 18 GHz). To be able to deliver usable intensities of solids, the design is also allow axial access for evaporation oven and metal samples using the plasma sputtering technique. Very preliminary results of the source test are presented.

  16. Spectrophotometric Distances to Galactic H\\,{\\sc{ii}} Regions

    CERN Document Server

    Moisés, A P; Figuerêdo, E; Blum, R D; Conti, P S; Barbosa, C L

    2010-01-01

    We present a near infrared study of the stellar content of 35 H\\,{\\sc{ii}} regions in the Galactic plane. In this work, we have used the near infrared domain $J-$, $H-$ and $K_{s}-$ band color images to visually inspect the sample. Also, color-color and color-magnitude diagrams were used to indicate ionizing star candidates, as well as, the presence of young stellar objects such as classical TTauri Stars (CTTS) and massive young stellar objects (MYSOs). We have obtained {\\it Spitzer} IRAC images for each region to help further characterize them. {\\it Spitzer} and near infrared morphology to place each cluster in an evolutionary phase of development. {\\it Spitzer} photometry was also used to classify the MYSOs. Comparison of the main sequence in color-magnitude diagrams to each observed cluster was used to infer whether or not the cluster kinematic distance is consistent with brightnesses of the stellar sources. We find qualitative agreement for a dozen of the regions, but about half the regions have near infr...

  17. Transition energy and oscillator strength of Sc18+ion

    Institute of Scientific and Technical Information of China (English)

    Wang Zhi-Wen; Yang Di; Hu Mu-Hong; Han Qiu-Ju; Li Jin-Ying

    2005-01-01

    The transition energies and the dipole oscillator strengths for the 1s22s-1s2np (2 ≤ n ≤ 9) and 1s22p-1s2nd (3≤n ≤ 9) of lithium-like Sc18+ ion are calculated by using the full core plus correlation method. The fine structure splittings of 1s2np and 1s2nd (n ≤ 9) states are determined from the expectation values of spin-orbit and spin-otherorbit interaction operators. The quantum defects of these series, as function of principal quantum number n, are obtained. The agreement between the f-values obtained from three alternative formulae is excellent. Comparisons of our results with experimental data available in the literature are carried out. Combining the single-channel quantum defect theory with the discrete oscillator strengths obtained in this work, this paper obtains the behaviour of discrete oscillator strengths and oscillator strength densities corresponding to the bound-free transitions adjacent to ionization threshold.

  18. Final Technical Report for DE-SC0012297

    Energy Technology Data Exchange (ETDEWEB)

    Dell' Antonio, Ian [Brown Univ., Providence, RI (United States)

    2017-08-01

    This is the final report on the work performed in award DE-SC0012297, Cosmic Frontier work in support of the LSST Dark Energy Science Collaboration's work to develop algorithms, simulations, and statistical tests to ensure optimal extraction of the dark energy properties from galaxy clusters observed with LSST. This work focused on effects that could produce a systematic error on the measurement of cluster masses (that will be used to probe the effects of dark energy on the growth of structure). These effects stem from the deviations from pure ellipticity of the gravitational lensing signal and from the blending of light of neighboring galaxies. Both these effects are expected to be more significant for LSST than for the stage III experiments such as the Dark Energy Survey. We calculate the magnitude of the mass error (or bias) for the first time and demonstrate that it can be treated as a multiplicative correction and calibrated out, allowing mass measurements of clusters from gravitational lensing to meet the requirements of LSST's dark energy investigation.

  19. Domain structure and phase transition in Sc-doped zirconia

    Energy Technology Data Exchange (ETDEWEB)

    Brunauer, G.; Boysen, H.; Frey, F. [Institute for Crystallography und Applied Mineralogy, LMU Muenchen, Munich (Germany); Ehrenberg, H. [Institute for Materials Science, TU Darmstadt, Darmstadt (Germany)

    2002-01-21

    The temperature dependence of the domain structure associated with the ferroelastic phase transition (Fm{sup 3-bar}m{r_reversible}R{sup 3-bar}m) in ZrO{sub 2} doped with 11% Sc{sub 2}O{sub 3} has been determined from a peak shape analysis of high-resolution synchrotron x-ray powder diffraction data. In the temperature region of coexisting phases the observed characteristic anisotropic broadening and asymmetry of the lines is modelled by three different phases: a main rhombohedral phase, a distorted rhombohedral phase with a smaller c/a ratio, and a cubic phase. The latter two are assigned to the internal structure of the domain walls between two adjacent twin domains. The size and amount of the cubic phase show an initially slow increase with temperature followed by a very steep increase and a slow one after that. The size of the (main) rhombohedral domains remains nearly constant, while (micro-) strain in the distorted regions gradually decreases. (author)

  20. Cruise report for A1-02-SC southern California CABRILLO project, Earthquake Hazards Task

    Science.gov (United States)

    Normark, William R.; Fisher, Michael A.; Gutmacher, Christina E.; Sliter, Ray; Hibbeler, Lori; Feingold, Beth; Reid, Jane A.

    2003-01-01

    A two-week marine geophysical survey obtained sidescan-sonar images and multiple sets of high-resolution seismic-reflection profiles in the southern California offshore area between Point Arguello and Point Dume. The data were obtained to support two project activities of the United States Geological Survey (USGS) Coastal and Marine Geology (CMG) Program: (1) the evaluation of the geologic hazards posed by earthquake faults and landslides in the offshore areas of Santa Barbara Channel and western Santa Monica Basin and (2) determine the location of active hydrocarbon seeps in the vicinity of Point Conception as part of a collaborative study with the Minerals Management Service (MMS). The 2002 cruise, A1-02- SC, is the fourth major data-collection effort in support of the first objective (Normark et al., 1999a, b; Gutmacher et al., 2000). A cruise to obtain sediment cores to constrain the timing of deformation interpreted from the geophysical records is planned for the summer of 2003.

  1. Downregulation of the Musca domestica peptidoglycan recognition protein SC (PGRP-SC) leads to overexpression of antimicrobial peptides and tardy pupation.

    Science.gov (United States)

    Gao, Yifu; Tang, Ting; Gu, Jihai; Sun, Lingling; Gao, Xiaobin; Ma, Xianyong; Wang, Xiaochun; Liu, Fengsong; Wang, Jianhui

    2015-10-01

    PGRP (peptidoglycan recognition protein) is a conserved protein family that recognizes the peptidoglycan in bacterial cell wall and causes the activation of various innate immune responses. Previous studies have reported that PGRP-SCs in Drosophila dampen the activation of Immune Deficiency (Imd) pathway to microbial infection, and participate in the lifespan extension of the insects. To facilitate understanding the function of PGRP-SCs from an evolutionary angle, we identified and functionally characterized the PGRP-SC gene in the housefly Musca domestica, a species that has adapted to a septic environment much harsher than the natural habitat of Drosophila. The gene designated as MdPGRP-SC was found most abundantly expressed in the 3rd instar larvae, and is expressed at this developmental stage predominantly in the gut. MdPGRP-SC was virtually unchanged in whole larvae after a septic injury at the second larval instar, while two antimicrobial peptides (AMPs), diptericin and attacin, were upregulated in the first 24h but not later. Through dsRNA microinjection, MdPGRP-SC was knocked down by RNA interference (RNAi), and caused the significant increased expression of diptericin and attacin. The pupation of MdPGRP-SC-depleted larvae was severely suppressed compared to controls. Opposite to the expression trend of MdPGRP-SC, a spontaneous active expression of diptericin and attacin was found in pre-pupae but not in third instar larvae. Taken together, our study reveals that downregulation of MdPGRP-SC leads to the overexpression of the AMPs, and is involved in the larvae-to-pupa transition of housefly.

  2. Crystal structure of Sc1.91In1.39Mo15Se19, containing Mo6 and Mo9 clusters

    Directory of Open Access Journals (Sweden)

    Patrick Gougeon

    2015-07-01

    Full Text Available The structure of scandium indium pentadecamolybdenum nonadecaselenide, Sc1.91In1.39Mo15Se19, is isotypic with In2.9Mo15Se19 [Grüttner et al. (1979. Acta Cryst. B35, 285–292]. It is characterized by two cluster units Mo6Sei8Sea6 and Mo9Sei11Sea6 (where i represents inner and a apical atoms that are present in a 1:1 ratio. The cluster units are centered at Wyckoff positions 2b and 2c and have point-group symmetry -3 and -6, respectively. The clusters are interconnected through additional Mo—Se bonds. Sc—Se and In—Se bonds complete the structural set-up. In the title compound, the Sc3+ cations replace the trivalent indium atoms present in In2.9Mo15Se19, and a deficiency is observed at the monovalent indium site. One Mo, one Se and the Sc atom are situated on mirror planes, whereas two other Se atoms and the In atom are situated on threefold rotation axes.

  3. ScRe 2O 6: A new ternary oxide with metallic Re-Re-bonds and a ferromagnetic component above room temperature

    Science.gov (United States)

    Mikhailova, D.; Ehrenberg, H.; Miehe, G.; Trots, D.; Hess, C.; Schneider, R.; Fuess, H.

    2008-01-01

    AbstactA new phase in the system Sc-Re-O, ScRe 2O 6, was synthesized for the first time in sealed silica tubes and its crystal structure was solved by single crystal X-ray diffraction. ScRe 2O 6 (space group P2 1/ a, a=5.6176(9) Å, b=4.7970(9) Å, c=7.5143(16) Å, β=97.49(2)°, Z=2) crystallizes in a new rutile-type structure, derived from three formula units by splitting the cation site in ratio 1:2. Re 2O 10 clusters can be considered as structural units, in which the rhenium ions form pairs by metallic bonds with a Re-Re distance of 2.523(3) Å. No phase transition was observed in the temperature range of 295-930 K. The compound has a metallic character of conductivity in the temperature range of at least 4-950 K and displays a ferromagnetic ordering above room temperature ("unconventional Re-magnetism").

  4. Avance normativo del SC 8 de AENOR “Conservación, restauración y rehabilitación de edificios” = Standardisation Advance of AENOR SC 8 “Conservation, Restoration and Rehabilitation of Buildings”

    OpenAIRE

    Recopar, Editor

    2014-01-01

    Avance normativo del SC 8 de AENOR “Conservación, restauración y rehabilitación de edificios” = Standardisation Advance of AENOR SC 8 “Conservation, Restoration and Rehabilitation of Buildings”

  5. Radiolabeling of DOTATOC with the long-lived positron emitter {sup 44}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Pruszynski, Marek; Majkowska-Pilip, Agnieszka [Centre of Radiochemistry and Nuclear Chemistry, Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warszawa (Poland); Loktionova, Natalia S.; Eppard, Elisabeth [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany); Roesch, Frank, E-mail: frank.roesch@uni-mainz.de [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany)

    2012-06-15

    The positron-emitting radionuclide {sup 44}Sc with a half-life of 3.97 h and a {beta}{sup +} branching of 94.3% is of potential interest for clinical PET. As so far it is available from a {sup 44}Ti/{sup 44}Sc generator in Mainz, where long-lived {sup 44}Ti decays to no-carrier-added (nca) {sup 44}Sc. The {sup 44}Sc is a trivalent metal cation and should be suitable for complexation with many well established bifunctional chelators conjugated to peptides or other molecular targeting vectors. Thus, the aim of this work was to investigate the potential of {sup 44}Sc for labeling of DOTA-conjugated peptides. DOTA-D-Phe{sup 1}-Tyr{sup 3}-octreotide (DOTATOC) was used as a model molecule to study and optimize labeling procedure. Reaction parameters such as buffer conditions, concentration of peptide, pH range, reaction temperature and time were optimized. Addition of 21 nmol of DOTATOC to {sup 44}Sc in ammonium acetate buffer pH 4.0 provided labeling yields >98% within 25 min of heating in an oil-bath at 95 Degree-Sign C. This time can be reduced to 3 min only by applying microwave supported heating. {sup 44}Sc-DOTATOC was found to be stable in 0.9% NaCl, PBS pH 7.4, fetal calf and human serums, and also in the presence of competing metal cations (Fe{sup 3+}, Ca{sup 2+}, Cu{sup 2+}, Mg{sup 2+}), as well as other ligand competitors, like EDTA and DTPA, even after almost 25 h incubation at 37 Degree-Sign C. Present study shows that nca {sup 44}Sc forms stable complexes with the macrocyclic ligand DOTA and that {sup 44}Sc-DOTATOC and analog targeting vectors may be synthesized for further preclinical and clinical investigations. - Highlights: Black-Right-Pointing-Pointer Labeling of somatostatin analouges with positron emitter {sup 44}Sc was tested. Black-Right-Pointing-Pointer DOTATOC was labeled with {sup 44}Sc isotope. Black-Right-Pointing-Pointer Optimal conditions for {sup 44}Sc-DOTATOC synthesis were found. Black-Right-Pointing-Pointer Stability of {sup 44}Sc

  6. Surface morphological changes and magnetic properties of Sc-substituted Y 3Fe 5O 12 epitaxial films deposited on the GGG substrate

    Science.gov (United States)

    Syvorotka, I. I.; Syvorotka, I. M.; Kityk, I. V.

    2010-11-01

    Sc-doped YIG films were grown on (1 1 1) oriented GGG crystalline substrate with disorientation angle within the range 0-25'. Sc 3+ ion substitution was varied within the range 0.25-0.3 per formula unit. The films demonstrate different types of surface morphology versus film growth rate and substrate disorientation. Conditions for existence of these types of the surface morphology were defined. The field dependence of magnetic susceptibility at magnetization reversal in film plane and Faraday rotation at wavelength 633 nm for a magnetic field applied in perpendicular direction were measured to characterize the films grown. Films with "mirror-like" surface demonstrate a planar magnetization at room temperature.

  7. 超导ECR离子源DECRIS-SC2%Project of the Superconducting ECR Ion Source DECRIS-SC2

    Institute of Scientific and Technical Information of China (English)

    V.V.Bekhterev; V.V.Seleznev; A.Shishov; G.P.Tsvineva; N.YU.Yazvitsky; B.I.Yakovlev; S.L.Bogomolov; V.I.Datskov; V.M.Drobin; S.N.Dmitriev; A.A.Efremov; V.N.Loginov; A.N.Lebedev; H.Malinowski

    2007-01-01

    A new compact version of the"liquid He-free"superconducting Electron Cyclotron Resonance Ion Source,to be used as an injector for the U-400M cyclotron,is presently under construction at the FLNR in collaboration with LHE(JINR).The axial magnetic field of the source is created by the superconducting magnet,and the NdFeB hexapole is used for the radial plasma confinement.The microwave frequency of 14GHz will be used for ECR plasma heating.The DECRIS-SC2 superconducting magnet is designed for the induction of a magnetic field on the axis of the source of up to 1.4T (extraction side) and 1.9T (injection side) at nominal current of 75A.Cooling of the coils is carried out by GM cryocooler with cooling power of 1W at the temperature 4.5K.The basic design features of the superconducting magnet and of the ion source are presented.The main parts of the source are in production.The first beam test of the source is expected in the beginning of 2007.

  8. A {sup 44}Ti/{sup 44}Sc radionuclide generator for potential application of {sup 44}Sc-based PET-radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Filosofov, D.V. [Joint Institute of Nuclear Research, Dubna (Russian Federation). DLNP; Loktionova, N.S.; Roesch, F. [University of Mainz (Germany). Institute of Nuclear Chemistry

    2010-07-01

    {sup 44}Ti/{sup 44}Sc radionuclide generators are of interest for molecular imaging. The 3.97 h half-life of {sup 44}Sc and its high positron branching of 94% may stimulate the application of {sup 44}Sc labelled PET radiopharmaceuticals. However, both {sup 44}Ti production and {sup 44}Ti/{sup 44}Sc generator design represent challenges for basic radiochemistry. About 5 mCi (185 MBq) of {sup 44}Ti were obtained via the Sc(p, 2n) nuclear reaction. {sup 44}Ti was separated from 1.5 g of massive scandium targets in multi-step procedures, including exchange chromatography on cation exchange resin (AG 50W-X8, 200-400 mesh, H{sup +}-form). In order to design a robust {sup 44}Ti/{sup 44}Sc generator concept, distribution coefficients of Ti(IV) and Sc(III) on both AG 1-X8 (200-400 mesh, Cl{sup -}-form) and AG 50W-X8 (200-400 mesh, H{sup +}-form) resins eluted with HCl and HCl/H{sub 2}C{sub 2}O{sub 4} solution of various concentrations were investigated systematically. Optimal conditions for efficient separations of both radionuclides have been determined for AG 1-X8 resin and mixtures of 0.07 M HCl and 0.005 M H{sub 2}C{sub 2}O{sub 4}. A 5 mCi generator was prepared on an AG 1-X8 column (H=150 mm, D=3 mm, V{sub 0}=0.55 mL). The system achieved elution of 180 MBq {sup 44}Sc in 20 mL of eluate solution. The breakthrough of {sup 44}Ti is 90 Bq. This corresponds to an excellent separation factor of 2 x 10{sup 6}. In the context of long-term stability of {sup 44}Ti/{sup 44}Sc generators, a ''reverse'' type of washing steps after each elution using 0.07 M HCl/0.005 M H{sub 2}C{sub 2}O{sub 4} mixtures appeared to be essential. (orig.)

  9. Authenticated, private, and secured smart cards (APS-SC)

    Science.gov (United States)

    Szu, Harold; Mehmood, Amir

    2006-04-01

    From historical perspective, the recent advancements in better antenna designs, low power circuitry integrations and inexpensive fabrication materials have made possible a miniature counter-measure against Radar, a clutter behaving like a fake target return called Digital Reflection Frequency Modulation (DRFM). Such a military counter-measure have found its way in the commerce as a near field communication known as Radio Frequency Identification (RFID), a passive or active item tag T attached to every readable-writable Smart Card (SC): Passports ID, medical patient ID, biometric ID, driver licenses, book ID, library ID, etc. These avalanche phenomena may be due to the 3 rd Gen phones seeking much more versatile & inexpensive interfaces, than the line-of-sight bar-code optical scan. Despite of the popularity of RFID, the lacking of Authenticity, Privacy and Security (APS) protection restricted somewhat the wide spread commercial, financial, medical, legal, and militarily applications. Conventional APS approach can obfuscate a private passkey K of SC with the tag number T or the reader number R, or both, i.e. only T*K or R*K or both will appear on them, where * denotes an invertible operation, e.g. EXOR, but not limited to it. Then, only the authentic owner, knowing all, can inverse the operation, e.g. EXOR*EXOR= I to find K. However, such an encryption could be easily compromised by a hacker seeking exhaustively by comparison based on those frequently used words. Nevertheless, knowing biological wetware lesson for power of pairs sensors and Radar hardware counter-measure history, we can counter the counter-measure DRFM, instead using one RFID tag per SD, we follow the Nature adopting two ears/tags, e.g. each one holding portions of the ID or simply two different ID's readable only by different modes of the interrogating reader, followed by brain central processor in terms of nonlinear invertible shufflers mixing two ID bits. We prefer to adopt such a hardware

  10. Synthesis and Isolation of the Titanium-Scandium Endohedral Fullerenes-Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 and Sc2 TiC2 @Ih -C80 : Metal Size Tuning of the Ti(IV) /Ti(III) Redox Potentials.

    Science.gov (United States)

    Junghans, Katrin; Ghiassi, Kamran B; Samoylova, Nataliya A; Deng, Qingming; Rosenkranz, Marco; Olmstead, Marilyn M; Balch, Alan L; Popov, Alexey A

    2016-09-05

    The formation of endohedral metallofullerenes (EMFs) in an electric arc is reported for the mixed-metal Sc-Ti system utilizing methane as a reactive gas. Comparison of these results with those from the Sc/CH4 and Ti/CH4 systems as well as syntheses without methane revealed a strong mutual influence of all key components on the product distribution. Whereas a methane atmosphere alone suppresses the formation of empty cage fullerenes, the Ti/CH4 system forms mainly empty cage fullerenes. In contrast, the main fullerene products in the Sc/CH4 system are Sc4 C2 @C80 (the most abundant EMF from this synthesis), Sc3 C2 @C80 , isomers of Sc2 C2 @C82 , and the family Sc2 C2 n (2 n=74, 76, 82, 86, 90, etc.), as well as Sc3 CH@C80 . The Sc-Ti/CH4 system produces the mixed-metal Sc2 TiC@C2 n (2 n=68, 78, 80) and Sc2 TiC2 @C2 n (2 n=80) clusterfullerene families. The molecular structures of the new, transition-metal-containing endohedral fullerenes, Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 , and Sc2 TiC2 @Ih -C80 , were characterized by NMR spectroscopy. The structure of Sc2 TiC@Ih -C80 was also determined by single-crystal X-ray diffraction, which demonstrated the presence of a short Ti=C double bond. Both Sc2 TiC- and Sc2 TiC2 -containing clusterfullerenes have Ti-localized LUMOs. Encapsulation of the redox-active Ti ion inside the fullerene cage enables analysis of the cluster-cage strain in the endohedral fullerenes through electrochemical measurements.

  11. Compuestos perazufrados de platino(II) con ditioéteres y tiolatos fluorados. Estructuras cristalinas de [Pt(SC6F5)2 (p-C6H4FSCH2CH2-p-SC6H4F)], [Pt(p-SC6HF4)...

    OpenAIRE

    Jorge Bautista; Agusti Bertran; Sylvain Bernès; Ubaldo Duran; Hugo Torrens

    2003-01-01

    En este articulo se describen la síntesis y caracterización de los compuestos cis-[PtCl2(RfSCH2CH2SRf)], Rf = C6F5, p-SC6HF4, o-SC6H4F, m-SC6H4F, p-SC6H4F, m-SC6H4(CF3), y las reacciones de estos compuestos con (SC6F5)– y (p-SC6HF4)– que generan cis- [Pt(SC6F5)2(RfSCH2CH2SRf)] y cis-[Pt(p-SC6HF4) 2(RfSCH2CH2 SRf)], Rf = o-SC6H4F, m-SC6H4F, p-SC6H4F, m-SC6H4(CF3). Para estos compuestos, los datos de RMN de 19F obtenidos a diferentes temperaturas, muestran la presencia e interconversion de isóm...

  12. One-neutron knockout from {sup 51-55}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Schwertel, S.; Maierbeck, P.; Gernhaeuser, R.; Bildstein, V.; Boehmer, M.; Eppinger, K.; Faestermann, T.; Friese, J.; Fabbietti, L.; Maier, L.; Winkler, S. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Kruecken, R. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); TRIUMF, Vancouver (Canada); University of British Columbia, Department of Physics and Astronomy, Vancouver (Canada); Kroell, T. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Alvarez-Pol, H.; Benjamim, E.A.; Benlliure, J.; Caamano, M.; Cortina-Gil, D.; Gascon, M.; Kurtukian, T.; Perez, D.; Rodriguez-Tajes, C. [Universidade de Santiago de Compostela, Departamento de Fisica de Particulas, Santiago de Compostela (Spain); Aksouh, F.; Aumann, T.; Behr, K.; Boretzky, K.; Bruenle, A.; Chatillon, A.; Chulkov, L.V.; Geissel, H.; Gerl, J.; Gorska, M.; Kojouharov, I.; Klimkiewicz, A.; Kurz, N.; Nociforo, C.; Schaffner, H.; Simon, H.; Stanoiu, M.; Suemmerer, K.; Weick, H. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Borge, M.J.G.; Pascual-Izarra, C.; Perea, A.; Tengblad, O. [CSIC, Instituto de Estructura de la Materia, Madrid (Spain); Buerger, A. [University of Oslo, SAFE/OCL, Oslo (Norway); CEA, Gif-sur-Yvette (France); Casarejos, E.; Brown, B.A. [University of Vigo, Vigo (Spain); Enders, J.; Schrieder, G. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Hansen, P.G. [Michigan State University, NSCL, East Lansing, Michigan (United States); Jonson, B.; Nyman, G. [Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Kanungo, R. [TRIUMF, Vancouver (Canada); GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Saint Mary' s University, Halifax (Canada); Kiselev, O. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Johannes Gutenberg Universitaet, Mainz (Germany); Paul Scherrer Institut, Villigen (Switzerland); Larsson, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Le Bleis, T. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); IN2P3-CNRS/Universite Louis Pasteur, Institut Pluridisciplinaire Hubert Curien, Strasbourg Cedex 2 (France); Mahata, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Paul Scherrer Institut, Villigen (Switzerland); Nilsson, T. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Prochazka, A. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Comenius University, Faculty of Mathematics and Physics, Bratislava (Slovakia); Rossi, D. [Johannes Gutenberg Universitaet, Mainz (Germany); Sitar, B. [Comenius University, Faculty of Mathematics and Physics, Bratislava (Slovakia); Otsuka, T. [University of Tokyo, Hongo, Bunkyo-ku, Department of Physics, Tokyo (Japan); Tostevin, J.A. [University of Surrey, Department of Physics, Faculty of Engineering and Physical Sciences, Guildford (United Kingdom); Rae, W.D.M. [Garsington, Oxfordshire (United Kingdom)

    2012-12-15

    Results are presented from a one-neutron knockout experiment at relativistic energies of {approx} 420 A MeV on {sup 51-55}Sc using the GSI Fragment Separator as a two-stage magnetic spectrometer and the MINIBALL array for gamma-ray detection. Inclusive longitudinal momentum distributions and cross-sections were measured enabling the determination of the contributions corresponding to knockout from the {nu}p{sub 1/2}, {nu}p{sub 3/2}, (L = 1) and {nu}f{sub 7/2}, {nu}f{sub 5/2} (L = 3) neutron orbitals. The observed L = 1 and L = 3 contributions are compared with theoretical cross-sections using eikonal knockout theory and spectroscopic factors from shell model calculations using the GXPF1A interaction. The measured inclusive knockout cross-sections generally follow the trends expected theoretically and given by the spectroscopic strength predicted from the shell model calculations. However, the deduced L = 1 cross-sections are generally 30-40% higher while the L = 3 contributions are about a factor of two smaller than predicted. This points to a promotion of neutrons from the {nu}f{sub 7/2} to the {nu}p{sub 3/2} orbital indicating a weakening of the N = 28 shell gap in these nuclei. While this is not predicted for the phenomenological GXPF1A interaction such a weakening is predicted by recent calculations using realistic low-momentum interactions V{sub low} {sub k} obtained by evolving a chiral N3LO nucleon-nucleon potential. (orig.)

  13. Validity evaluation of Sc x Al1-x N material constants based on SAW characteristics

    Science.gov (United States)

    Tang, Gongbin; Han, Tao; Zhang, Qiaozhen; Yamazaki, Kenta; Omori, Tatsuya; Hashimoto, Ken-ya

    2016-11-01

    This paper is aimed at examining the validity of material constants reported for use in surface acoustic wave (SAW) device simulations. First, based on the full set of material constants calculated by first principle, bulk acoustic wave velocities are calculated for Sc x Al1-x N and compared with published experimental results. Then, the effects of the Sc x Al1-x N material constants with different Sc content on acoustic characteristics are calculated and the influence of shear vibrations on SAW characteristics are recognized. Then, a series of SAW devices are fabricated on Sc x Al1-x N film/Si substrate structure with various Cu and ScAlN thicknesses h Cu and h ScAlN, respectively, and measured variations of phase velocity V and effective electromechanical coupling factor K\\text{e}2 with these parameters are compared with the calculation. The fairly well-agreed results indicate a reliable set of Sc x Al1-x N material constants for SAW device simulations.

  14. Production, purification, and characterization of scFv TNF ligand fusion proteins.

    Science.gov (United States)

    Fick, Andrea; Wyzgol, Agnes; Wajant, Harald

    2012-01-01

    Single-chain variable fragments (scFvs) specific for tumor-associated cell surface antigens are the most broadly used reagents to direct therapeutic or diagnostic effector molecules, such as toxins, radioisotopes, and CD3-stimulating scFvs, to tumors. One novel class of effector molecules that can be targeted to tumors by scFvs are ligands of the tumor necrosis factor (TNF) family. Typically, these molecules have apoptosis inducing and/or immune stimulating properties and are therefore highly attractive for cancer treatment. N-terminal fusion of scFvs does not interfere with the receptor binding capabilities of TNF ligands and thus allows the straightforward generation of scFv TNF ligand fusion proteins. We report here a protocol for the purification of eukaryotically produced scFv TNF ligand fusion proteins based on affinity chromatography on anti-Flag agarose and further describe assays for the determination of the targeting index of this type of scFv-targeted proteins.

  15. Differential dynamics of splicing factor SC35 during the cell cycle

    Indian Academy of Sciences (India)

    Kaushlendra Tripathi; Veena K Parnaik

    2008-09-01

    Pre-mRNA splicing factors are enriched in nuclear domains termed interchromatin granule clusters or nuclear speckles. During mitosis, nuclear speckles are disassembled by metaphase and reassembled in telophase in structures termed mitotic interchromatin granules (MIGs). We analysed the dynamics of the splicing factor SC35 in interphase and mitotic cells. In HeLa cells expressing green fluorescent protein (GFP)-SC35, this was localized in speckles during interphase and dispersed in metaphase. In telophase, GFP-SC35 was highly enriched within telophase nuclei and also detected in MIGs. Fluorescence recovery after photobleaching (FRAP) experiments revealed that the mobility of GFP-SC35 was distinct in different mitotic compartments. Interestingly, the mobility of GFP-SC35 was 3-fold higher in the cytoplasm of metaphase cells compared with interphase speckles, the nucleoplasm or MIGs. Treatment of cells with inhibitors of cyclin-dependent kinases (cdks) caused changes in the organization of nuclear compartments such as nuclear speckles and nucleoli, with corresponding changes in the mobility of GFP-SC35 and GFP-fibrillarin. Our results suggest that the dynamics of SC35 are significantly influenced by the organization of the compartment in which it is localized during the cell cycle.

  16. Growth and Holographic Storage Properties of Sc, Fe Co-Doped Lithium Niobate Crystals

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The holographic storage properties of Fe (0.03% (mass fraction) Fe2O3):LiNbO3 doped with Sc at different levels (0, 1%, 2%, 3%) were investigated.The Sc threshold concentration in Fe:LiNbO3 was implied to be about 3%(mole fraction) because O-H vibration absorption peak of Sc (3%):Fe:LiNbO3 was at 3508 cm-1, compared with 3484 cm-1 of crystals with lower Sc doping level.Sc(3%):Fe:LiNbO3 exhibited higher optical damage resistance ability.The threshold intensity (wavelength 488 nm) of Sc (3%):Fe:LiNbO3 was 2.2×102 W·cm-2, two orders of magnitude higher than that of Fe:LiNbO3.Holographic storage properties of the crystals were determined in an extraordinary polarized laser of wavelength 632.8 nm by a two-wave coupling method.It was found that in terms of holographic storage properties, the optimal doping concentration of Sc was 2%(mole fraction) among this crystal series.

  17. CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and she...

  18. CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 22.10.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 22.10.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and...

  19. Technical Training: CERN Technical Training 2004 - New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and s...

  20. CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 22.10.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 22.10.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and...

  1. New separation method of no-carrier-added {sup 47}Sc from titanium targets

    Energy Technology Data Exchange (ETDEWEB)

    Bartos, B.; Majkowska, A.; Kasperek, A.; Krajewski, S.; Bilewicz, A. [Institute of Nuclear Chemistry and Technology, Warszawa (Poland). Nuclear Chemistry and Radiochemistry Center

    2012-07-01

    Radionuclides with medium energy beta emission and a several day half-life are attractive candidates for radioimmunotherapy. Among the most promising in this category is {sup 47}Sc produced by fast neutron irradiation (E{sub n} > 1 MeV) of titanium target with high energy neutrons in {sup 47}Ti(n,p){sup 47}Sc nuclear reaction. In the previously reported production scheme the dissolution of the TiO{sub 2} target in hot concentrated H{sub 2}SO{sub 4} and evaporation of the resulting solution were the most time-consuming steps. The present paper describes new, simple and efficient production method of {sup 47}Sc, where the slow dissolution of the target is avoided. After irradiation in fast neutron flux {sup 47}TiO{sub 2} and Li{sub 2}{sup 47}TiF{sub 6} targets were dissolved in HF solutions. Next {sup 47}Sc was separated from the target using anion exchange resin Dowex 1 with 0.4 M HF + 0.06 M HNO{sub 3} solution as eluent. The eluted {sup 47}Sc was adsorbed on cation exchange resin and eluted with 0.5 M of ammonium acetate. The 47Sc separation yield in the proposed procedure is about 90% with the separation time less than 2 h. The obtained no-carrier-added {sup 47}Sc was used to label DOTATATE conjugate with 96% labeling yield. (orig.)

  2. Differential Attack on Five Rounds of the SC2000 Block Cipher

    Institute of Scientific and Technical Information of China (English)

    Ji-Qiang Lv

    2011-01-01

    The SC2000 block cipher has a 128-bit block size and a user key of 128,192 or 256 bits,which employs a total of 6.5 rounds if a 128-bit user key is used.It is a CRYPTREC recommended e-government cipher in Japan.In this paper we address how to recover the user key from a few subkey bits of SC2000,and describe two 4.75-round differential characteristics with probability 2-126 of SC2000 and seventy-six 4.75-round differential characteristics with probability 2-127.Finally,we present a differential cryptanalysis attack on a 5-round reduced version of SC2000 when used with a 128-bit key; the attack requires 2125.68 chosen plaintexts and has a time complexity of 212575 5-round SC2000 encryptions.The attack does not threat the security of the full SC2000 cipher,but it suggests for the first time that the safety margin of SC2000 with a 128-bit key decreases below one and a half rounds.

  3. Chronic Hypoxia Suppresses the Co2 Response of Solitary Complex (Sc) Neurons from Rats

    Science.gov (United States)

    Nichols, Nicole L.; Wilkinson, Katherine A.; Powell, Frank L.; Dean, Jay B.; Putnam, Robert W.

    2009-01-01

    We studied the effect of chronic hypobaric hypoxia (CHx; 10-11% O2) on the response to hypercapnia (15% CO2) of individual solitary complex (SC) neurons from adult rats. We simultaneously measured the intracellular pH and firing rate responses to hypercapnia of SC neurons in superfused medullary slices from control and CHx-adapted adult rats using the blind whole cell patch clamp technique and fluorescence imaging microscopy. We found that CHx caused the percentage of SC neurons inhibited by hypercapnia to significantly increase from about 10% up to about 30%, but did not significantly alter the percentage of SC neurons activated by hypercapnia (50% in control versus 35% in CHx). Further, the magnitudes of the responses of SC neurons from control rats (chemosensitivity index for activated neurons of 166±11% and for inhibited neurons of 45±15%) were the same in SC neurons from CHx-adapted rats. This plasticity induced in chemosensitive SC neurons by CHx appears to involve intrinsic changes in neuronal properties since they were the same in synaptic blockade medium. PMID:19619674

  4. Radiolabeling of DOTATOC with the long-lived positron emitter 44Sc.

    Science.gov (United States)

    Pruszyński, Marek; Majkowska-Pilip, Agnieszka; Loktionova, Natalia S; Eppard, Elisabeth; Roesch, Frank

    2012-06-01

    The positron-emitting radionuclide (44)Sc with a half-life of 3.97 h and a β(+) branching of 94.3% is of potential interest for clinical PET. As so far it is available from a (44)Ti/(44)Sc generator in Mainz, where long-lived (44)Ti decays to no-carrier-added (nca) (44)Sc. The (44)Sc is a trivalent metal cation and should be suitable for complexation with many well established bifunctional chelators conjugated to peptides or other molecular targeting vectors. Thus, the aim of this work was to investigate the potential of (44)Sc for labeling of DOTA-conjugated peptides. DOTA-D-Phe(1)-Tyr(3)-octreotide (DOTATOC) was used as a model molecule to study and optimize labeling procedure. Reaction parameters such as buffer conditions, concentration of peptide, pH range, reaction temperature and time were optimized. Addition of 21 nmol of DOTATOC to (44)Sc in ammonium acetate buffer pH 4.0 provided labeling yields >98% within 25 min of heating in an oil-bath at 95°C. This time can be reduced to 3 min only by applying microwave supported heating. (44)Sc-DOTATOC was found to be stable in 0.9% NaCl, PBS pH 7.4, fetal calf and human serums, and also in the presence of competing metal cations (Fe(3+), Ca(2+), Cu(2+), Mg(2+)), as well as other ligand competitors, like EDTA and DTPA, even after almost 25 h incubation at 37°C. Present study shows that nca (44)Sc forms stable complexes with the macrocyclic ligand DOTA and that (44)Sc-DOTATOC and analog targeting vectors may be synthesized for further preclinical and clinical investigations. Copyright © 2012 Elsevier Ltd. All rights reserved.

  5. Synergistic capture of Clostridium botulinum Type A neurotoxin by scFv antibodies to novel epitopes

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Sean A.; Barr, John R.; Kalb, Suzanne R.; Marks, James D.; Baird, Cheryl L.; Cangelosi, Gerard A.; Miller, Keith D.; Feldhaus, Michael J.

    2011-10-01

    A non-immune library of human single chain fragment variable (scFv) antibodies displayed on Saccharomyces cerevisiae was screened for binding to the Clostridium botulinum neurotoxin serotype A binding domain [BoNT/A (Hc)] with the goal of identifying scFv to novel epitopes. To do this, an antibody-mediated labeling strategy was used in which antigen-binding yeast clones were selected after labeling with previously characterized monoclonal antibodies (MAbs) specific to the Hc. Twenty unique scFv clones were isolated that bound Hc. Of these, three also bound to full-length BoNT/A toxin complex with affinities ranging from 5 nM to 170 nM. Epitope binning showed that the three unique clones recognized at least two epitopes that were distinct from one another and from the detection MAbs. After production in E. coli, the scFv were coupled to magnetic particles and tested for their ability to capture BoNT/A holotoxin using an Endopep-MS assay. In this assay, toxin captured by scFv coated magnetic particles was detected by incubation of the complex with a peptide containing a BoNT/A-specific cleavage sequence. Mass spectrometry was used to detect the ratio of intact peptide to cleavage products as evidence for toxin capture. When tested individually, each of the scFv showed a weak positive Endopep-MS result. However, when the particles were coated with all three scFv simultaneously, they exhibited significantly higher Endopep-MS activity, consistent with synergistic binding. These results demonstrate novel approaches toward the isolation and characterization of scFv antibodies specific to unlabeled antigen. They also provide evidence that distinct scFv antibodies can work synergistically to increase the efficiency of antigen capture onto a solid support.

  6. Flow cytometry-based methods for assessing soluble scFv activities and detecting pathogen antigens in solution

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Sean; Weigel, Kris M.; Miller, Keith D.; Ndung' u, Joseph; Buscher, Philippe; Tran, Thao N.; Baird, Cheryl L.; Cangelosi, Gerard A.

    2010-04-01

    Novel methods are reported for evaluating and utilizing single chain fragment variable (scFv) antibodies derived from yeast-display libraries. Yeast-display was used to select scFv specific to invariant surface glycoproteins (ISG) of Trypanosoma brucei. A limiting step in the isolation of scFv from nonimmune libraries is the conversion of highly active yeast-displayed scFv into soluble antibodies that can be used in standard immunoassays. Challenges include limited solubility or activity following secretion and purification of scFv. For this reason, few scFv derived from yeast-display platforms have moved into development and implementation as diagnostic reagents. To address this problem, assays were developed that employ both yeastdisplayed and secreted scFv as analytical reagents. The first is a competitive inhibition flow cytometry (CIFC) assay that detects secreted scFv by virtue of its ability to competitively inhibit the binding of biotinylated antigen to yeast-displayed scFv. The second is an epitope binning assay that uses secreted scFv toidentify additional yeast-displayed scFv that bind nonoverlapping or noncompeting epitopes on an antigen. The epitope binning assay was used not only to identify sandwich assay pairs with yeast-displayed scFv, but also to identify active soluble scFv present in low concentration in a crude expression extract. Finally, a CIFC assay was developed that bypasses entirely the need for soluble scFv expression, by using yeast displayed scFv to detect unlabeled antigen in samples. These methods will facilitate the continued development and practical implementation of scFv derived from yeast-display libraries.

  7. Promising electron mobility and high thermal conductivity in Sc2CT2 (T = F, OH) MXenes.

    Science.gov (United States)

    Zha, Xian-Hu; Zhou, Jie; Zhou, Yuhong; Huang, Qing; He, Jian; Francisco, Joseph S; Luo, Kan; Du, Shiyu

    2016-03-21

    MXenes, the new 2D transition metal carbides and nitrides, have recently attracted extensive attention due to their diverse applications and excellent performances. However, the thermal and electrical properties of most MXene materials are yet to be studied. In this work, we investigate the electrical and thermal properties of semiconducting Sc2CT2 (T = F, OH) MXenes using first-principles calculations. Both of the Sc2CT2 (T = F, OH) MXenes are determined to show excellent carrier mobilities. The electron mobility in the Sc2CF2 MXene is found to be strongly anisotropic at room temperature, with values of 5.03 × 10(3) and 1.07 × 10(3) cm(2) V(-1) s(-1) in the zigzag and armchair directions, respectively. The predicted electron mobility in the zigzag direction of the Sc2CF2 is nearly four-fold that in the armchair direction of the promising semiconductor phosphorene. In contrast to Sc2CF2, Sc2C(OH)2 presents approximately isotropic electron mobility. The values at room temperature in the zigzag and armchair directions are calculated as 2.06 × 10(3) cm(2) V(-1) s(-1) and 2.19 × 10(3) cm(2) V(-1) s(-1), respectively. In regard to the thermal properties, the thermal conductivities of the Sc2CT2 (T = F, OH) MXenes have been determined. The predicted values are higher than those of most metals and semiconducting low-dimensional materials, such as monolayer MoS2 and phosphorene. In particular, the room-temperature thermal conductivity along the Sc2CF2 armchair direction has been determined to be as high as 472 W m(-1) K(-1) based on a flake length of 5 μm, which is even higher than that of the best traditional conductor silver. The corresponding value in the zigzag direction of Sc2CF2 is calculated to be 178 W m(-1) K(-1). The thermal conductivity in Sc2C(OH)2 is less anisotropic and lower compared to that in Sc2CF2. The room-temperature value in the armchair (zigzag) direction is determined to be 173 W m(-1) K(-1) (107 W m(-1) K(-1)). Based on their excellent

  8. The Fifth Annual Sc2.0 and Synthetic Genomes Conference: Synthetic Genomes in High Gear.

    Science.gov (United States)

    Walker, Roy S K; Cai, Yizhi

    2016-09-16

    The Sc2.0 project is perhaps the largest synthetic biology project in the public domain, and ultimately aims to construct a new version of the humble brewer's yeast, Saccharomyces cerevisiae. Each year, the Sc2.0 consortium gather to discuss progress in this ambitious project and highlight new developments at the forefront of synthetic genome engineering. This viewpoint summarizes some of the key moments of the 2016 conference, including updates on the Sc2.0 project itself, mammalian synthetic biology, DNA assembly automation, HGP-Write and a panel discussion on the social and ethical perspectives of synthetic biology.

  9. Sc-Si normal incidence mirrors for a VUV interval of 35-50 nm

    CERN Document Server

    Uspenskii, Y A; Vinogradov, A V; Fedorenko, A I; Kondratenko, V V; Pershin, Y P; Zubarev, E N; Mrowka, S; Schäfers, F

    2000-01-01

    The Sc/Si multilayers are suggested as high-reflectivity coatings for a VUV interval of 35-50 nm. Fabricated mirrors show the normal incidence reflectivity of 30-50% which is high enough to effectively manipulate the beams of synchrotron radiation and compact discharge and laser-driven X-ray lasers. The obtained values are not, however, limiting for the Sc/Si coatings. Theoretical estimations as well as electron microscopy studies of Sc-Si interfaces indicate a large potential for further raising the reflectivity.

  10. Assembly of a supercrystal (SC) of the CMS endcap electromagnetic calorimeter

    CERN Multimedia

    J. Williams et al., RAL

    2004-01-01

    The first three pictures show the insertion of the first three rows of crystals into the supercrystal SC03 on Jan. 2004 and the completion of the SC endstops. Fig. 4 shows a complete supercrystal and Fig. 5 its components (alveolar, interface plate, housing, optical fibre, insert, crystal and VPT, endstop). A set of 25 inserts is shown in Fig. 6, while Fig. 7 shows housing, interface plates and inserts. Finally, a SC rear view showing the Vacum Phototriode (VPT) wires through the inserts can be seen in Fig. 8. Fig. 9 and 10 show two supercrystals under test on Dee F and R, respectively.

  11. Valence electron structure analysis of refining mecha-nism of Sc and Ti additions on aluminum

    Institute of Scientific and Technical Information of China (English)

    LI PieJie; YE YiCong; HE LiangJu

    2009-01-01

    The mechanism of the difference of refining effect between Sc and Ti adding to aluminum can not be explained substantially with traditional theory. Valence electron structures of AI-Ti and Al-Sc alloys have been studied by using the empirical electron theory of solids and molecules (EET). The covalent bond electron numbers and interfacial electron density differences are calculated. The conclusion is that, in the two alloys, different covalent bond electron numbers of nucleation particles, and different electron densities on the interface between the second phase particles and the matrix, fundamentally lead to the difference of refining effect between Sc and Ti adding to aluminum.

  12. Ionic conductivity of co-doped Sc2O3-ZrO2 ceramics

    DEFF Research Database (Denmark)

    Omar, Shobit; bin Najib, Waqas; Chen, Weiwu

    2012-01-01

    The oxide ionic conductivity of Sc0.18Zr0.82O1.91 doped with 0.5 mol.% of both Yb2O3 and In2O3 is evaluated at various temperatures in air. Among various co-doped compositions, In0.02Sc0.18Zr0.80O1.90 exhibits the highest grain ionic conductivity followed by Yb0.02Sc0.18Zr0.80O1.90 at 500°C. Howe...

  13. AAZTA: an ideal chelating agent for the development of {sup 44}Sc PET imaging agents

    Energy Technology Data Exchange (ETDEWEB)

    Nagy, Gabor; Szikra, Dezso; Trencsenyi, Gyoergy [Scanomed Ltd., Debrecen (Hungary); University of Debrecen, Medical Imaging Clinic (Hungary); Fekete, Aniko [University of Debrecen, Medical Imaging Clinic (Hungary); Garai, Ildiko [Scanomed Ltd., Debrecen (Hungary); Giani, Arianna M.; Negri, Roberto [Dipartimento di Scienze del Farmaco, Universita del Piemonte Orientale, Novara (Italy); Masciocchi, Norberto [Dipartimento di Scienza e Alta Tecnologia e To.Sca.Lab, Universita degli Studi dell' Insubria, Como (Italy); Maiocchi, Alessandro; Uggeri, Fulvio [Bracco Imaging spa, Bracco Research Centre, Colleretto Giacosa (Italy); Toth, Imre [Department of Inorganic and Analytical Chemistry, University of Debrecen (Hungary); Aime, Silvio [Dipartimento di Biotecnologie Molecolari e Scienze della Salute, Centro di Imaging Molecolare e Preclinico, Universita degli Studi di Torino (Italy); Giovenzana, Giovanni B. [Dipartimento di Scienze del Farmaco, Universita del Piemonte Orientale, Novara (Italy); CAGE Chemicals srl, Novara (Italy); Baranyai, Zsolt [Bracco Imaging spa, Bracco Research Centre, Colleretto Giacosa (Italy); Department of Inorganic and Analytical Chemistry, University of Debrecen (Hungary)

    2017-02-13

    Unprecedented fast and efficient complexation of Sc{sup III} was demonstrated with the chelating agent AAZTA (AAZTA=1,4-bis(carboxymethyl)-6-[bis(carboxymethyl)] amino-6-methylperhydro-1,4-d iazepine) under mild experimental conditions. The robustness of the {sup 44}Sc(AAZTA){sup -} chelate and conjugated biomolecules thereof is further shown by in vivo PET imaging in healthy and tumor mice models. The new results pave the way towards development of efficient Sc-based radiopharmaceuticals using the AAZTA chelator. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  14. Upper boundary of the Pacific plate subducting beneath Hokkaido, Japan, estimated from ScSp phase

    OpenAIRE

    Osada, Kinue; Yoshizawa, Kazunori; YOMOGIDA, Kiyoshi

    2010-01-01

    Three-dimensional geometry of the upper boundary of the Pacific plate subducting beneath Hokkaido, Japan, was obtained using the ScSp phase: the phase converted from ScS (S wave reflected at the core-mantle boundary) to P wave at the plate boundary. Taking the advantage of a dense seismic network, "Hi-net", recently deployed across the Japanese islands, we applied several seismic array analyses to the recorded waveform data for a large nearby deep earthquake, in order to enhance very weak ScS...

  15. Synthesis of Perovskite ScMnO3 under High Temperature and Pressure

    Science.gov (United States)

    Yu, Tian; Gao, Peng; Tyson, Trevor A.

    2012-02-01

    Perovskite type ScMnO3 was synthesized under high temperature and pressure starting with hexagonal ScMnO3. The detail of the structure is examined by synchrotron x-ray diffraction and IR spectroscopy at room temperature. A highly distorted perovskite phase which is similar to the structure of LaMnO3 is identified by XRD Rietveld Refinement. Due to the small Sc ion radius, each Mn site has a distorted MnO6 polyhedron. This work is supported by DOE Grant DE-FG02-07ER46402.

  16. Magnetic properties of Sc{sub x}Ti{sub 1-x}Fe{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Kessler, M. [Lab. de Cristallographie, CNRS, 38 - Grenoble (France); Deportes, J. [Lab. Louis Neel, CNRS, 38 - Grenoble (France); Ouladdiaf, B. [Institut Laue-Langevin, 38 - Grenoble (France); Sayetat, F. [Lab. de Cristallographie, CNRS, 38 - Grenoble (France)

    1995-02-09

    The magnetic properties and their thermal dependences of Sc{sub 0.1}Ti{sub 0.9}Fe{sub 1.96}, Sc{sub 0.1}Ti{sub 0.9}Fe{sub 2} and Sc{sub 0.1}Ti{sub 0.9}Fe{sub 2.04} are compared with those of TiFe{sub 2}. The substitution changes the iron-iron distances. Consequently, the Fe atoms on the 6h site show in addition to the antiferromagnetic component a small ferromagnetic one, and a weak magnetic moment appears on the 2a site. ((orig.)).

  17. Lanthanide-doped NaScF4 nanoprobes: crystal structure, optical spectroscopy and biodetection

    Science.gov (United States)

    Ai, Yu; Tu, Datao; Zheng, Wei; Liu, Yongsheng; Kong, Jintao; Hu, Ping; Chen, Zhuo; Huang, Mingdong; Chen, Xueyuan

    2013-06-01

    Trivalent lanthanide ions (Ln3+)-doped inorganic nanoparticles (NPs) as potential luminescent bioprobes have been attracting tremendous interest because of their unique upconversion (UC) and downconversion (DC) luminescence properties. NaScF4, as an important host material, has been rarely reported and its crystal structure remains unclear. Herein, based on the single crystal X-ray diffraction, the space group of NaScF4 crystals was determined to be P31 containing multiple sites of Sc3+ with crystallographic site symmetry of C1, which was verified by high-resolution photoluminescence spectroscopy of Eu3+ at low temperature (10 K). Furthermore, monodisperse and size-controllable NaScF4:Ln3+ NPs were synthesized via a facile thermal decomposition method. The biotinylated NaScF4:Er3+/Yb3+ NPs were demonstrated for their applications as a heterogeneous UC luminescence bioprobe to detect avidin with a detection limit of 180 pM. After bioconjugation with amino-terminal fragment (ATF) of urokinase plasminogen activator (uPA), NaScF4:Ln3+ NPs also exhibited specific recognition of cancer cells overexpressed with uPA receptor (uPAR, an important marker of tumor biology and metastasis), showing great potentials in tumor-targeted bioimaging.Trivalent lanthanide ions (Ln3+)-doped inorganic nanoparticles (NPs) as potential luminescent bioprobes have been attracting tremendous interest because of their unique upconversion (UC) and downconversion (DC) luminescence properties. NaScF4, as an important host material, has been rarely reported and its crystal structure remains unclear. Herein, based on the single crystal X-ray diffraction, the space group of NaScF4 crystals was determined to be P31 containing multiple sites of Sc3+ with crystallographic site symmetry of C1, which was verified by high-resolution photoluminescence spectroscopy of Eu3+ at low temperature (10 K). Furthermore, monodisperse and size-controllable NaScF4:Ln3+ NPs were synthesized via a facile thermal

  18. Guest-induced SC-SC transformation within the first K/Cd heterodimetallic triazole complex: a luminescent sensor for high-explosives and cyano molecules.

    Science.gov (United States)

    Wang, Ying; Jia, Wei; Chen, Ran; Zhao, Xiao-Jun; Wang, Zhong-Liang

    2017-01-03

    The first K/Cd heterodimetallic complex {[Cd1.5(TTPE)1.5Cl3K(H2O)3]·3H2O}n (1b) based on triazole has been generated from {[Cd(TTPE)(HCOO)](NO3)·3DMAC·H2O}n (1) during the ion- and solvent-exchange experiment in an irreversible SC-SC transformation. Based on its luminescence properties, we have, for the first time, demonstrated that 1b is a heterodimetallic sensor for detection of high-explosives and cyano molecules.

  19. Cyclotron production of high purity (44m,44)Sc with deuterons from (44)CaCO3 targets.

    Science.gov (United States)

    Alliot, C; Kerdjoudj, R; Michel, N; Haddad, F; Huclier-Markai, S

    2015-06-01

    Due to its longer half-life, (44)Sc (T1/2 = 3.97 h) as a positron emitter can be an interesting alternative to (68)Ga (T1/2 = 67.71 min). It has been already proposed as a PET radionuclide for scouting bone disease and is already available as a (44)Ti/(44)Sc generator. (44)Sc has an isomeric state, (44 m)Sc (T1/2 = 58.6 h), which can be co-produced with (44)Sc and that has been proved to be considered as an in-vivo PET generator (44 m)Sc/(44)Sc. This work presents the production route of (44 m)Sc/(44)Sc generator from (44)Ca(d,2n), its extraction/purification process and the evaluation of its performances. Irradiation was performed in a low activity target station using a deuteron beam of 16 MeV, which favors the number of (44 m)Sc atoms produced simultaneously to (44)Sc. Typical irradiation conditions were 60 min at 0.2 μA producing 44 MBq of (44)Sc with a (44)Sc/(44 m)Sc activity ratio of 50 at end of irradiation. Separations of the radionuclides were performed by means of cation exchange chromatography using a DGA® resin (Triskem). Then, the developed process was applied with bigger targets, and could be used for preclinical studies. The extraction/purification process leads to a radionucleidic purity higher than 99.99% ((43)Sc, (46)Sc, (48)Sc < DL). (44 m)Sc/(44)Sc labeling towards DOTA moiety was performed in order to get an evaluation of the specific activities that could be reached with regard to all metallic impurities from the resulting source. Reaction parameters of radiolabeling were optimized, reaching yields over 95%, and leading to a specific activity of about 10-20 MBq/nmol for DOTA. A recycling process for the enriched (44)Ca target was developed and optimized. The quality of the final batch with regard to radionucleidic purity, specific activity and metal impurities allowed a right away use for further radiopharmaceutical evaluation. This radionucleidic pair of (44 m)Sc/(44)Sc offers a quite interesting PET radionuclide for being further

  20. Growth and Characterization of y-Nd3+: LaSc3(BO3)4 Crystal

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A new laser crystal Nd005La0.95Sc3(BO3)4 up to 50mm×38mm×7 mn was grown by top-seeded solution growth method from a Li6B4O9 flux. The grown crystal was characterized by X-ray powder diffraction. Its crystal structure is monoclinic with space group Cc and the unit cell dimensions: a=12.066(5), b=9.864(2), c=7.740(3) A, β= 105.48(5)°, V=887.8(6)A3, Z=4, Dc=3.81g/cm3, which belongs to low-temperature phase. The optical absorption of the crystal shows that NLSB has a strong absorption band at 807.7 nm, which is suitable for laser-diode pumping.

  1. Formation Processes of Nanocomposite Strengthening Particles in Rapidly Quenched Al-Sc-Zr Alloys

    Directory of Open Access Journals (Sweden)

    A.V. Kotko

    2012-03-01

    Full Text Available Decomposition processes of supersaturated solid solution of aluminium alloys alloyed with Sc and Zr have been studied in the work. The binary hypereutectic Al-Sc alloys, hyperperitectic Al-Zr alloys and ternary Al-Sc-Zr alloys were chosen. Alloys were obtained by the melt-spinning. Melts were quenched from temperatures of Т = 1000 C and Т = 1400 ºC. The study of the structure of rapidly solidifyed binary Al alloys alloyed with Sc and Zr showed that the crystallization of anomalously supersaturated solid solution (Tquen. = 1400 ºC or the crystallization with the formation of "fan" structure (Tquen. = 1000 ºC are possible depending on the quenching temperature of the melt. The decomposition of anomalously supersaturated solid solution is continuous, with the precipitation of nano-sized spherical Al3X (X-Sc, Zr particles of L12-ordered phase which is isomorphous to matrix. It was found that the loss of thermal stability of Al-Sc alloys is due to the loss of coherence of the strengthening Al3Sc phase. In Al-Zr alloys the loss of strength is due to the formation of a stable tetragonal DO23-ordered A13Zr phase. After co-alloying of Al by Sc and Zr a bimodal grained structure was observed for the hypereutectic ternary alloy (Tquen. = 400ºC. Nano-sized grains of 50-60 nm were present on the boundaries of 1-2 µm large-sized grains. TEM shows the formation of nanocomposite Al3Zr/Al3Sc particles. The formation of Al3Zr shell changes the nature of the interfacial fit of the particle with the matrix and slows down the decomposition during the coalescence. Ternary Al-Sc-Zr alloys have significantly higher thermal stability during aging as compared to binary Al-Sc and Al-Zr alloys. Decomposition processes of supersaturated solid solution of aluminium alloys alloyed with Sc and Zr have been studied in the work. The binary hypereutectic Al-Sc alloys, hyperperitectic Al-Zr alloys and ternary Al-Sc-Zr alloys were chosen. Alloys were

  2. Synthesis and properties of Yb:Sc2O3 transparent ceramics

    Institute of Scientific and Technical Information of China (English)

    JIANG Benxue; HU Chen; LI Jiang; KOU Huamin; SHI Yun; LIU Wenbin; PAN Yubai

    2011-01-01

    Yb:Sc2O3 transparent ceramics were fabricated by solid-state reaction and vacuum sintering method.CaO was added as sintering aids by a high energy ball milling.Transparent nearly-fully dense samples were obtained after 1840 ℃ sintering.Using transmitted-light microscope we get the grain sizes are more than 1 00 μm.Using spectrophotometer we get the absorption coefficient centered at 975 nm was 2.65 cm-1.The phosphorescence spectra showed that the line-widths (FWHM) at 975 and 1041 nm were about 4 and 10 nm and the lifetime of Yb ions in Sc2O3 transparent ceramics was about 883 μs.According to the absorption and fluorescence band centers of Yb:Sc2O3 transparent ceramics,the level scheme of Yb3+ ions in Sc2O3 ceramics could be gotten.

  3. DiSC aitab käitumist parandada / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

  4. DiSC aitab käitumist parandada / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

  5. 76 FR 23331 - Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session

    Science.gov (United States)

    2011-04-26

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management, Regulation and Enforcement Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session AGENCY: Bureau of Ocean Energy Management, Regulation...

  6. 77 FR 4056 - Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session

    Science.gov (United States)

    2012-01-26

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session AGENCY: Bureau of Ocean Energy Management (BOEM), Interior. ACTION: Notice...

  7. Local Impact Simulation of SC Wall Structures using Aircraft Engine Projectile

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Chulhun; Lee, Jungwhee; Lee, Hanjoo [Dankook Univ., Yongin (Korea, Republic of); Jung, Raeyoung; Hyun, Changhun [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2013-05-15

    SC wall structure developed for nuclear power plant buildings consists of plain concrete and two steel plates on both surface of the concrete, while RC structure consists of re bar and concrete. SC structure has higher scabbing resistance than RC structure due to the action of steel plate on the rear side of impact. Therefore SC structure is known as more effective structure from the viewpoint of aircraft crash than RC structure. However, most of the recent researches and experiments about local impact damage deal with RC structures, and the effect of re bar and steel plate is not considered reasonably. Although Walter et al. and Make-work et al. suggested a formula for evaluating perforation depth of steel plate covered RC walls, most of the previous researches about SC structure are focused on perforation and scabbing due to the impact of hard projectile, rather than soft projectile such as an aircraft. In this research a soft projectile, i. e. aircraft engine, is utilized for impact simulation of RC and SC walls. To evaluate local damage of SC wall structures, parametric study with the variables of wall thickness and steel ratio of the cover plate is performed, and the results are compared with those of RC structures. Since scabbing was prevented by the steel plates, penetration mode of damage was observed in SC walls while scabbing damage was occurred in RC walls. It is confirmed that the rear steel plate not only contains concrete debris, but also reduces the internal damage of the concrete walls. Penetration depth of SC walls did not largely vary due to the increasing steel ratio, and similar results to RC walls were observed when the wall thickness is larger than a certain value since the impact resistance of SC wall is mainly governed by the thickness of concrete part. Therefore, it is expected that similar level of impact resistance to RC structure can be produced with the minimum thickness of steel plates of SC structure. According to these results, SC

  8. Magnetic dipole moment of the doubly closed-shell plus one proton nucleus $^{49}$Sc

    CERN Multimedia

    Gaulard, C V; Walters, W; Nishimura, K; Muto, S; Bingham, C R

    It is proposed to measure the magnetic moment of $^{49}$Sc by the Nuclear Magnetic Resonance on Oriented Nuclei (NMR-ON) method using the NICOLE on-line nuclear orientation facility. $^{49}$Sc is the neutron rich, doubly closed-shell, nucleus $^{48}$Ca plus one proton. Results will be used to deduce the effective g-factors in the $^{48}$Ca region with reference to nuclear structure and meson exchange current effects.

  9. Influence of Sc on high temperature strengthening behavior of Ti-6Al-4V alloy

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Vacuum arc melting technique was used to prepare Ti-6Al-4V alloy containing Sc (0.3% and 0.5%, mass fraction). The ingots were melted twice by vacuum self-consumable electrode arc furnace. Forging of ingots was started in β-phase region and finished in high (α+β)-phase region. Annealing after forging was performed in low (α+β)-phase region for 30 min. Isothermal high temperature compression tests were conducted using thermal simulation machine under Ar atmosphere at 850 ℃ and 1 000 ℃, and the strain rate were 0.001, 0.01, 0.1 and 1.0 s-1. Optical microscope(OM), scanning electron microscopy(SEM), energy dispersive spectrum(EDS) and transmission electron microscope(TEM) were used to study the microstructure evolution during high temperature deformation. The results show that, the peak stress value of alloys increases with increasing Sc content after deformation at 850 ℃,however, there is no obvious strengthening of Sc when the alloys are deformed at 1 000 ℃. Sc exists as Sc2O3 forms by internal oxidation during forging procedure, only minor Sc solutes in matrix. At 850 ℃, the interaction between dislocation and participated particles and twinning mechanism controls the deformation procedure accompanied recrystallization. At 1 000 ℃, the deformation of alloys containing Sc is mainly controlled by twinning, while the deformation of alloy without Sc is not only controlled by twinning,but also the interaction between dislocation and precipitated particles inside the twinning lamellar.

  10. CMS ECAL Endcap (EE) Dee Assembly - SC mounting on Dee 1

    CERN Document Server

    Cockerill, D

    2007-01-01

    Protection panels on back of Dee 1, Completion of SC mounting, 03/10/2007: Completion of SC mounting (aart from the inner 3-2-1)on the first quadrant of Dee 1 and subsequent survey. 22-28/08/2007: The first supercrystals on Dee1, Dee1 in 867 with the first column of SCs ready for mounting, Dee1 with its protection panels over the laser monitoring fibre system

  11. Early Stages of Precipitation Process in Al-(Mn-)Sc-Zr Alloy Characterized by Positron Annihilation

    KAUST Repository

    Vlach, Martin

    2015-01-29

    Thermal effects on the precipitation stages in as-cast Al-0.70 at. pct Mn-0.15 at. pct Sc-0.05 at. pct Zr alloy were studied. The role of lattice defects was elucidated by positron annihilation spectroscopy (lifetime and coincidence Doppler broadening) enabling investigation of solutes clustering at the atomic scale. This technique has never been used in the Al-Sc- and/or Al-Zr-based alloys so far. Studies by positron annihilation were combined with resistometry, hardness measurements, and microstructure observations. Positrons trapped at defects are preferentially annihilated by Sc electrons. Lifetime of trapped positrons indicates that Sc atoms segregate at dislocations. Maximum fraction of positrons annihilated by Sc electrons occurring at 453 K (180 °C) suggests that clustering of Sc bound with vacancies takes place. It is followed by peak of this fraction at 573 K (300 °C). A rise of the contribution of trapped positrons annihilated by Zr electrons starting at 513 K (240 °C) and attaining maximum also at 573 K (300 °C) confirms that Zr participates in precipitation of the Al3Sc particles already at these temperatures. The pronounced hardening at 573 K (300 °C) has its nature in the precipitation of the Al3Sc particles with a Zr-rich shell. The contribution of trapped positrons annihilated by Mn electrons was found to be negligible. © 2015, The Minerals, Metals & Materials Society and ASM International.

  12. Die 3SC Trendforschung : ein kontinuierliches Programm zur Beobachtung des soziokulturellen Wandels von Sinus Sociovision

    OpenAIRE

    Appel, Cornelia

    2003-01-01

    Die 3SC Trendforschung ist neben der Lebensweltforschung und dem daraus hervorgegangenen Modell der Sinus-Milieus ein zentraler Forschungsansatz des Heidelberger Instituts Sinus Sociovision. Sinus Sociovision, Mitglied des ADM (Arbeitskreis Deutscher Markt- und Sozialforschungsinstitute e.V.), ist eines der führenden Institute für angewandte soziokulturelle Forschung in Deutschland. Die 3SC Trendforschung ist eine von drei Säulen des Forschungs- und Beratungsangebotes von Sinus Sociovision. H...

  13. RlSC & DSP Advanced Microprocessor System Design; Sample Projects, Fall 1991

    OpenAIRE

    Fredine, John E.; Goeckel, Dennis L.; Meyer, David G.; Sailer, Stuart E.; Schmottlach, Glenn E.

    1992-01-01

    RlSC & DSP Microprocessor System Design (EE 595M) provides students with an overview of reduced instruction set (RISC) microprocessors and digital signal processing (DSP) microprocessors, with emphasis on incorporating these devices in general purpose and embedded system designs, respectively. The first half of the course emphasizes design considerations for RlSC microprocessor based computer systems; a half-semester design project focuses on design principles that could be utilized in a gene...

  14. Detergents modify proteinase K resistance of PrP Sc in different transmissible spongiform encephalopathies (TSEs).

    Science.gov (United States)

    Breyer, Johanna; Wemheuer, Wiebke M; Wrede, Arne; Graham, Catherine; Benestad, Sylvie L; Brenig, Bertram; Richt, Jürgen A; Schulz-Schaeffer, Walter J

    2012-05-25

    Prion diseases are diagnosed by the detection of their proteinase K-resistant prion protein fragment (PrP(Sc)). Various biochemical protocols use different detergents for the tissue preparation. We found that the resistance of PrP(Sc) against proteinase K may vary strongly with the detergent used. In our study, we investigated the influence of the most commonly used detergents on eight different TSE agents derived from different species and distinct prion disease forms. For a high throughput we used a membrane adsorption assay to detect small amounts of prion aggregates, as well as Western blotting. Tissue lysates were prepared using DOC, SLS, SDS or Triton X-100 in different concentrations and these were digested with various amounts of proteinase K. Detergents are able to enhance or diminish the detectability of PrP(Sc) after proteinase K digestion. Depending on the kind of detergent, its concentration - but also on the host species that developed the TSE and the disease form or prion type - the detectability of PrP(Sc) can be very different. The results obtained here may be helpful during the development or improvement of a PrP(Sc) detection method and they point towards a detergent effect that can be additionally used for decontamination purposes. A plausible explanation for the detergent effects described in this article could be an interaction with the lipids associated with PrP(Sc) that may stabilize the aggregates.

  15. Structures and phase transitions of ScH3 under high pressure

    Institute of Scientific and Technical Information of China (English)

    Kong Bo; Zhou Zhu-Wen; Chen De-Liang; Ling-hu Rong-Feng

    2013-01-01

    The structures and the phase transitions of ScH3 under high pressure are investigated using first-principles calculations.The calculated structural parameters at zero pressure agree well with the available experimental data.With increasing pressure,the transition sequence hcp (GdH3-type)→ C2/m →fcc→hcp (YH3-type)→Cmcm of ScH3 is predicted first; the corresponding transition pressures at 0 K are 23 GPa,25 GPa,348 GPa,and 477 GPa,respectively.The C2/m symmetry structure is a possible candidate but not a good one as the intermediate state from hexagonal to cubic in ScH3.On the other hand,via the analysis of the structures of hexagonal ScH2.9,cubic ScH3,and cubic ScH2,we find that the repulsive interactions of H-H atoms must play an important role in the transition from hexagonal to cubic.

  16. Precise ab initio calculations of the 3d transition-metal clusters: Sc2

    Directory of Open Access Journals (Sweden)

    Ilya G. Kaplan

    2011-06-01

    Full Text Available The ground 5Σu− state of Sc2 was studied by the valence multireference configuration interaction method with single and double excitations plus Davidson correction (MRCISD(+Q at the complete basis set limit. The calculations were made under C2v symmetry restrictions, which allowed us to obtain at the dissociation limit the Sc atoms in different states (in all previous studies of Sc2 the D2h symmetry group was employed. From the Mulliken population analysis and energy calculations follows that in the ground state Sc2 dissociates in one Sc in the ground state and the other in the second excited quartet state, 4Fu. The corrected parameters of the ground potential curve are the following: Re = 5.2 bohr, De = 50.37 kcal/mol, and ωe = 234.5 cm-1. The dissociation energy in respect to the dissociation on two Sc in the ground states was estimated as De = 9.98 kcal/mol.

  17. Corrosion behavior of an Al-6Mg-Sc-Zr alloy

    Institute of Scientific and Technical Information of China (English)

    XU Guangxing; TAO Binwu; LIU Jianhua; LI Songmei

    2005-01-01

    The corrosion behavior of an Al-6Mg-Sc-Zr alloy was studied and compared with that of an Al-6Mg-Zr alloy.The addition of scandium into the Al-6Mg-Zr alloy reduced the susceptibility to exfoliation corrosion. By using the constant load tensile method in a 3.5 wt.% NaCl solution, the resistance to SCC of the Al-6Mg-Sc-Zr alloy was higher than that of the Al-6Mg-Zr alloy. When the specimens were not applied with an anodic current, the Al-6Mg-Sc-Zr alloy was resistance to SCC and no brittle cracking was found on the fracture surface. When an anodic current was applied, the Al-6Mg-Sc-Zr alloy specimens failed as a result of accelerated corrosion rather than SCC. It was believed that the addition of scandium resulted in (Al3Sc, Zr) particles that greatly refmed grains and promoted the formation of homogeneous discontinuous distribution of β-phase in the alloy base, which much contributed to good corrosion resistance of the Al-6Mg-Sc-Zr alloy.

  18. The role of interplanetary shock orientation on SC/SI rise time and geoeffectiveness

    Science.gov (United States)

    Selvakumaran, R.; Veenadhari, B.; Ebihara, Y.; Kumar, Sandeep; Prasad, D. S. V. V. D.

    2017-03-01

    Interplanetary (IP) shocks interact with the Earth's magnetosphere, resulting in compression of the magnetosphere which in turn increases the Earth's magnetic field termed as Sudden commencement/Sudden impulse (SC/SI). Apart from IP shock speed and solar wind dynamic pressure, IP shock orientation angle also plays a major role in deciding the SC rise time. In the present study, the IP shock orientation angle and SC/SI rise time for 179 IP shocks are estimated which occurred during solar cycle 23. More than 50% of the Shock orientations are in the range of 140°-160°. The SC/SI rise time decreases with the increase in the orientation angle and IP shock speed. In this work, the type of IP shocks i.e., Radio loud (RL) and Radio quiet (RQ) are examined in connection with SC/SI rise time. The RL associated IP shock speeds show a better correlation than RQ shocks with SC/SI rise time irrespective of the orientation angle. Magnetic Cloud (MC) associated shocks dominate in producing less rise time when compared to Ejecta (EJ) shocks. Magneto hydrodynamic (MHD) simulations are used for three different IP shock orientation categories to see the importance of orientation angle in determining the geoeffectiveness. Simulations results reveal that shocks hitting parallel to the magnetosphere are more geoeffective as compared to oblique shocks by means of change in magnetic field, pressure and Field Aligned Current (FAC).

  19. Unraveling the Sc(3+) Hydration Geometry: The Strange Case of the Far-Coordinated Water Molecule.

    Science.gov (United States)

    Migliorati, Valentina; D'Angelo, Paola

    2016-07-05

    The hydration structure and dynamics of Sc(3+) in aqueous solution have been investigated using a combined approach based on quantum mechanical (QM) calculations, molecular dynamics (MD) simulations, and extended X-ray absorption fine structure (EXAFS) spectroscopy. An effective Sc-water two-body potential has been generated from QM calculations and then used in the MD simulation of Sc(3+) in water, and the reliability of the entire procedure has been assessed by comparing the theoretical structural results with the EXAFS experimental data. The outstanding outcome of this work is that the Sc(3+) ion forms a well-defined capped square antiprism (SAP) complex in aqueous solution, where the eight water molecules closest to the ion are located at the vertexes of a SAP polyhedron, while the ninth water molecule occupying the capping position is unusually found at a very long distance from the ion. This far-coordinated water molecule possesses a degree of structure comparable with the other first shell molecules surrounding the ion at much shorter distances, and its presence gave us the unique opportunity to easily identify the geometry of the Sc(3+) coordination polyhedron. Despite very strong ion-water interactions, the Sc(3+) hydration shell is very labile, as the far-coordinated ligand allows first shell water molecules to easily exchange their positions both inside the solvation shell and with the rest of the solvent molecules.

  20. Theoretical design of high-spin biradical molecules with heterocycles as coupling unit

    Institute of Scientific and Technical Information of China (English)

    WANG Li-min; CHU De-qing; ZHANG Jing-ping; WANG Rong-shun

    2006-01-01

    Computational studies of a class of potentially stable high-spin biradicals that two-atom-three-electron spin centers SC units connected by heterocycles FC and phenyl EG were described. The geometry and character of the spin exchange interaction were obtained by means of UB3LYP/6-31G*. The results show that the molecules possessing three different arranged fashions are designed with—·N—S as SC fragment,pyridine as FC and phenyl as EG,the spin densities on the two atoms of the SC fragment are different from the delocalization results in the specific stability of—·N—S. In these molecules,the stabilities of the triplet states decrease when the distance between the atoms of central SC (—N—) increases. Molecules with—·N—S as SC fragment,pyridine,pyrazine and triazine as FC and phenyl as EG are designed,the stability of triplet states for the molecule with pyridine as FC is the highest,and that for the molecule with pyrazine as FC is the lowest. Molecules with—·N—S,— ··N—O and—·N—NH as SC fragment,pyridine as FC and phenyl as EG are designed,the stability of triplet states for the molecule with—·N—S as SC is the highest,that for the molecule with—·N—NH as SC is the lowest.

  1. S.C. Advanced Training Aircraft IAR 99 (A SOIM

    Directory of Open Access Journals (Sweden)

    Ioan STEFANESCU

    2012-06-01

    Full Text Available The use of subsonic single control aircraft and especially of double–control ones, instead of supersonic combat aircraft in the military pilot training programs in the operational units, has be-come a necessity due to the economic and financial world-wide crisis which began during the 70’s-80’s, with the advent of the oil crisis, affecting many countries, which have their own Military Air Forces.

  2. Two-gap superconductivity in R2Fe3Si5 (R=Lu, Sc and Sc5Ir4Si10

    Directory of Open Access Journals (Sweden)

    Tsuyoshi Tamegai, Yasuyuki Nakajima, Tsuyoshi Nakagawa, Guoji Li and Hisatomo Harima

    2008-01-01

    Full Text Available R2Fe3Si5 (R= Sc, Y, Lu contains nonmagnetic iron and has a relatively high superconducting transition temperature Tc among iron-containing superconductors. An anomalous temperature dependence of specific heat C(T has been reported for polycrystalline samples down to 1 K. We have grown R2Fe3Si5 single crystals, confirmed the anomalous C(T dependence, and found a second drop in specific heat below 1 K. In Lu2Fe3Si5, we can reproduce C(T below Tc, assuming two distinct energy gaps 2Δ 1/kBTc = 4.4 and 2Δ 2/kBTc = 1.1, with nearly equal weights, indicating that Lu2Fe3Si5 is a two-gap superconductor similar to MgB2. Hall coefficient measurements and band structure calculation also support the multiband contributions to the normal-state properties. The specific heat in the Sc2Fe3Si5 single crystals also shows the two-gap feature. R5Ir4Si10 (R = Sc, rare earth is also a superconductor where competition between superconductivity and the charge-density wave is known for rare earths but not for Sc. We have performed detailed specific heat measurements on Sc5Ir4Si10 single crystals and found that C(T deviates slightly from the behavior expected for weak-coupling superconductors. C(T for these superconductors can also be reproduced well by assuming two superconducting gaps.

  3. Structural elucidation of b-(Y,Sc){sub 2}Si{sub 2}O{sub 7} : combined use of {sub 89}Y MAS NMR and powder diffraction.

    Energy Technology Data Exchange (ETDEWEB)

    Allix, M.; Alba, M. D.; Florian, P.; Fernandez-Carrion, A. J.; Suchomel, M. R.; Escudero, A.; Suard, E.; Becerro, A. I. (X-Ray Science Division); (CNRS); (Univ. d' Orleans); (Inst de Ciencia de Materiales de Sevilla); (Inst. Laue-Langevin)

    2011-08-01

    Although the structures of pure Sc{sub 2}Si{sub 2}O{sub 7} and {beta}-Y{sub 2}Si{sub 2}O{sub 7} have been described in the literature using the C2/m space group, {sup 29}Si magic angle spinning (MAS) NMR measurements of the intermediate members of the Sc{sub 2}Si{sub 2}O{sub 7}-{beta}-Y{sub 2}Si{sub 2}O{sub 7} system indicate a lowering of the symmetry to the C2 space group. Indeed, these compositions exhibit a unique Si crystallographic site and an Si-O-Si angle lower than 180{sup o}, incompatible with the C2/m space group. C2 is the only possible alternative. Space group Cm can be discarded with regard to its two different Si sites per unit cell. Moreover, {sup 89}Y MAS NMR data have revealed the existence of two different Y sites in the structure of the intermediate members of the Sc{sub 2}Si{sub 2}O{sub 7}-{beta}-Y{sub 2}Si{sub 2}O{sub 7} system, confirming the lowering of the symmetry to the C2 space group. The viability of the C2 model has therefore been tested and confirmed by refinement of synchrotron and neutron powder diffraction data for the different members of the system. The structural evolutions across the Sc{sub 2}Si{sub 2}O{sub 7}-{beta}-Y{sub 2}Si{sub 2}O{sub 7} system are discussed.

  4. Structural elucidation of {beta}-(Y,Sc){sub 2}Si{sub 2}O{sub 7}. Combined use of {sup 89}Y MAS NMR and powder diffraction

    Energy Technology Data Exchange (ETDEWEB)

    Allix, M.; Florian, P. [CNRS UPR3079 CEMHTI, Orleans (France); Orleans Univ. (France); Alba, M.D.; Fernandez-Carrion, A.J.; Escudero, A.; Becerro, A.I. [CSIC-Universidad de Sevilla (Spain). Inst. de Ciencia de Materiales de Sevilla; Suchomel, M.R. [Argonne National Laboratory, Argonne, IL (United States). Advanced Photon Source; Suard, E. [Institut Laue-Langevin, Grenoble (France)

    2011-08-15

    Although the structures of pure Sc{sub 2}Si{sub 2}O{sub 7} and {beta}-Y{sub 2}Si{sub 2}O{sub 7} have been described in the literature using the C2/m space group, {sup 29}Si magic angle spinning (MAS) NMR measurements of the intermediate members of the Sc{sub 2}Si{sub 2}O{sub 7}-{beta}-Y{sub 2}Si{sub 2}O{sub 7} system indicate a lowering of the symmetry to the C2 space group. Indeed, these compositions exhibit a unique Si crystallographic site and an Si-O-Si angle lower than 180, incompatible with the C2/m space group. C2 is the only possible alternative. Space group Cm can be discarded with regard to its two different Si sites per unit cell. Moreover, {sup 89}Y MAS NMR data have revealed the existence of two different Y sites in the structure of the intermediate members of the Sc{sub 2}Si{sub 2}O{sub 7}-{beta}-Y{sub 2}Si{sub 2}O{sub 7} system, confirming the lowering of the symmetry to the C2 space group. The viability of the C2 model has therefore been tested and confirmed by refinement of synchrotron and neutron powder diffraction data for the different members of the system. The structural evolutions across the Sc{sub 2}Si{sub 2}O{sub 7}-{beta}-Y{sub 2}Si{sub 2}O{sub 7} system are discussed. (orig.)

  5. TSE strain differentiation in mice by immunohistochemical PrP(Sc) profiles and triplex Western blot.

    Science.gov (United States)

    van Keulen, Lucien J M; Langeveld, Jan P M; Dolstra, Corry H; Jacobs, Jorg; Bossers, Alex; van Zijderveld, Fred G

    2015-10-01

    TSE strains are routinely identified by their incubation period and vacuolation profile in the brain after intracerebral inoculation and serial passaging in inbred mouse lines. There are some major drawbacks to this method that are related to the variation in vacuolation that exists in the brains of mice infected with the same TSE strain and to variation between observers and laboratories in scoring vacuolation and determining the final incubation period. We investigated the potential of PrP(Sc) immunohistochemistry and triplex Western blotting as possible alternative methods to differentiate between TSE strains. TSE reference strains ME7, 87A/87V, 22A/22C, 79A/79V and 301C/301V were intracerebrally inoculated in RIII or VM inbred mice that differ in their PrP genotype. Immunohistochemical PrP(Sc) profiles were drawn up by scanning light microscopy both on coronal and sagittal sections. On the basis of the localization of PrP(Sc) in the cerebral cortex, hippocampus, and cerebellar cortex and the overall type of PrP(Sc) staining, all TSE strains could be well differentiated from each other through their typical strain dependent characteristics. In addition, Western blot showed that the combination of glycosylation profile and 12B2 epitope content of PrP(Sc) allowed to distinguish between all reference strains except for ME7 and 22A in VM mice. TSE strains in mice can be identified on the basis of their PrP(Sc) profile alone. The potential to identify TSE strains in ruminants with these PrP(Sc) profiles after a single primary passage in mice will be the topic of future studies. © 2014 British Neuropathological Society.

  6. Enrichment of Sc2O3 and TiO2 from bauxite ore residues.

    Science.gov (United States)

    Deng, Bona; Li, Guanghui; Luo, Jun; Ye, Qing; Liu, Mingxia; Peng, Zhiwei; Jiang, Tao

    2017-06-05

    As a major byproduct generated in the alumina industry, bauxite ore residue is an important reserve of scandium and titanium. In this study, the feasibility and mechanism of enriching Sc2O3 and TiO2 from a non-magnetic material, which was obtained from carbothermal reductive roasting and magnetic separation of bauxite ore residue, were investigated based on a two-step (acidic and alkali) leaching process. It was revealed that approximately 78% SiO2 and 30-40% of CaO, FeO and Al2O3 were removed from a non-magnetic material with 0.0134wt.% Sc2O3 and 7.64wt.% TiO2 by phosphoric acidic leaching, while about 95% Al2O3 and P2O5 were further leached by subsequent sodium hydroxide leaching of the upper-stream leach residue. A Sc2O3-, TiO2- rich material containing 0.044wt.% Sc2O3 and 25.5wt.% TiO2 was obtained, the recovery and the enrichment factor of Sc2O3 and TiO2 were about 85% and 5, respectively. The enrichment of Sc2O3 was attributed to higher pH (>3.3) of phosphoric acid solution than its dissolution pH(0), and the enrichment of TiO2 was mainly associated with the insoluble perovskite (CaTiO3) in the acidic solution at ambient temperature. As Sc2O3 and TiO2 cannot be dissolved in the alkali solution, they were further enriched in the leach residue.

  7. Evaluation of the difficulty of crystallization of organic compounds using the critical supersaturation ratio (Sc)

    Science.gov (United States)

    Nagamatsu, Daiki; Ida, Yasuo; Takiyama, Hiroshi

    2014-11-01

    In the case of solvent selection, supersolubility is an index for improving crystallization behavior. However, supersolubility is affected by kinetic factors such as the cooling rate. An index for suitable solvent selection is needed. The supersaturation ratio (S) is one of the operation design indices of controlling crystallization behavior such as supersolubility. The S at 298 K (S298) of the pharmaceutical compounds theophylline, noscapine, clotrimazole, indomethacin, carbamazepine, naproxene and tolbutamide were measured in ethanol using a polythermal method. If the compound had a large lnS298, the cooling rate strongly affected the temperature of the cloud point in the cooling crystallization method. In order to estimate the crystallization behavior without the cooling rate effect, the critical supersaturation ratio (Sc) was proposed. Sc at 298 K (Sc298) was calculated from dissolution/cloud points at 0 K/min extrapolated from that of several heating/cooling rates to remove the kinetic effects on S. The lnSc298 values of theophylline, noscapine and clotrimazole were estimated in acetonitrile, methyl ethyl ketone, tetrahydrofuran, ethyl acetate, methanol, ethanol and isopropanol. The lnSc298 value of clotrimazole was the largest in all solvents. The results showed that lnSc298 was a simple index which could be used to evaluate the crystallization behavior resulting from the interaction between the solvent and the compound. In conclusion, the proposed lnSc298 should be useful for comparing the difficulty of crystallization which indicates how we should obtain desired crystals within a certain finite time period for development API in the manufacturing field without considering the effect of the heating/cooling rate.

  8. The inhibition of lung cancer cell growth by intracellular immunization with LC-1 ScFv

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A monoclonal antibody, LC-l, recognizing lung cancer associated common antigens was obtained in authors' laboratory. Its single chain Fv fragment (ScFv) named LC-1 ScFv was constructed based on recombinant phage displayed techniques. For expression on cell membrane, LC-1 ScFv was cloned into pDisplay vector, which directed the cloned gene to express as cell membrane bound protein. The resulting plasmid was sequenced and then introduced by the lipofectin method into a lung adenocarcinoma cell line SPC-A-1. G418 resistant cells were obtained by G418 selection. After transfection, LC-1 ScFv expression was observed by Western blot analysis and the expression of cognate antigens was down-regulated as shown in ELISA assay. SPC-A-1-pDisplay-ScFv cells grew in vitro at lower speed than the control intact cells and the cells transfected with vacant vector. Flow cytometry analysis detected a substantial increase in G1 phase and decrease in S phase in population of SPC-A-1-pDisplay-ScFv cells compared to SPC-A-1 and SPC-A1-pDisplay cells. Semi-quantitative RT-PCR analysis showed that c-myc expression was down-regulated in SPC-A-1-pDisplay-ScFv cells. It seems that the antigens recognized by LC-1 may be in some way involved in a growth stimulating pathway and the antibody blocking of the function of the antigens shut down the pathway and thus down-regulate the expression of c-myc and growth of the cells.

  9. Conductivity ageing studies on 1M10ScSZ (M4+=Ce, Hf)

    DEFF Research Database (Denmark)

    Omar, Shobit; Bin Najib, Waqas; Bonanos, Nikolaos

    2011-01-01

    The long-term conductivity stability is tested on zirconia based electrolyte materials for solid oxide fuel cell applications. The ageing studies have been performed on the samples of ZrO2 co-doped with 10mol% of Sc2O3 and 1mol% MO2, where M = Ce or Hf (denoted respectively 1Ce10ScSZ and 1Hf10Sc......SZ) in oxidising and reducing atmospheres, at 600°C for 3000h. At 600°C, these compositions show initial conductivity of around 9–12mS∙cm−1 in air. After 3000h of ageing, no phase transitions are observed in any of the samples. For the first 1000h, the degradation rate is higher than in the subsequent 2000h......; thereafter, conductivity degrades linearly with time for all samples. In air, the loss in the conductivity is lower than in reducing conditions. The 1Ce10ScSZ shows the highest degradation rate of 3.8%/1000h in wet H2/N2 after the first 1000h of ageing. A colour change of the 1Ce10ScSZ sample from white...

  10. Integrating scFv into xMAP Assays for the Detection of Marine Toxins

    Directory of Open Access Journals (Sweden)

    Lisa C. Shriver-Lake

    2016-11-01

    Full Text Available Marine toxins, such as saxitoxin and domoic acid are associated with algae blooms and can bioaccumulate in shell fish which present both health and economic concerns. The ability to detect the presence of toxin is paramount for the administration of the correct supportive care in case of intoxication; environmental monitoring to detect the presence of toxin is also important for prevention of intoxication. Immunoassays are one tool that has successfully been applied to the detection of marine toxins. Herein, we had the variable regions of two saxitoxin binding monoclonal antibodies sequenced and used the information to produce recombinant constructs that consist of linked heavy and light variable domains that make up the binding domains of the antibodies (scFv. Recombinantly produced binding elements such as scFv provide an alternative to traditional antibodies and serve to “preserve” monoclonal antibodies as they can be easily recreated from their sequence data. In this paper, we combined the anti-saxitoxin scFv developed here with a previously developed anti-domoic acid scFv and demonstrated their utility in a microsphere-based competitive immunoassay format. In addition to detection in buffer, we demonstrated equivalent sensitivity in oyster and scallop matrices. The potential for multiplexed detection using scFvs in this immunoassay format is demonstrated.

  11. Semisolid slurry of 7A04 aluminum alloy prepared by electromagnetic stirring and Sc, Zr additions

    Directory of Open Access Journals (Sweden)

    Jun-wen Zhao

    2017-05-01

    Full Text Available Slurry preparation is one of the most critical steps for semisolid casting, and its primary goal is to prepare slurry with uniformly distributed fine globules. In this work, electromagnetic stirring (EMS and the addition of Sc and Zr elements were used to prepare semisolid slurry of 7A04 aluminum alloy in a large diameter slurry maker. The effects of different treatments on the microstructure, composition and their radial homogeneity were investigated. The results show that, compared to the slurry without any treatment, large volume slurry with finer and more uniform microstructure can be obtained when treated by EMS, Sc, or Zr additions individually. EMS is more competent in the microstructural and chemical homogenization of the slurry while Sc and Zr additions are more excellent in its microstructural refinement. The combined treatment of EMS, Sc and Zr produces premium 7A04 aluminum alloy slurry with uniformly distributed fine α-Al globules and composition. The interaction mechanism between EMS and Sc and Zr additions was also discussed.

  12. Spectral embedding based probabilistic boosting tree (ScEPTre): classifying high dimensional heterogeneous biomedical data.

    Science.gov (United States)

    Tiwari, Pallavi; Rosen, Mark; Reed, Galen; Kurhanewicz, John; Madabhushi, Anant

    2009-01-01

    The major challenge with classifying high dimensional biomedical data is in identifying the appropriate feature representation to (a) overcome the curse of dimensionality, and (b) facilitate separation between the data classes. Another challenge is to integrate information from two disparate modalities, possibly existing in different dimensional spaces, for improved classification. In this paper, we present a novel data representation, integration and classification scheme, Spectral Embedding based Probabilistic boosting Tree (ScEPTre), which incorporates Spectral Embedding (SE) for data representation and integration and a Probabilistic Boosting Tree classifier for data classification. SE provides an alternate representation of the data by non-linearly transforming high dimensional data into a low dimensional embedding space such that the relative adjacencies between objects are preserved. We demonstrate the utility of ScEPTre to classify and integrate Magnetic Resonance (MR) Spectroscopy (MRS) and Imaging (MRI) data for prostate cancer detection. Area under the receiver operating Curve (AUC) obtained via randomized cross validation on 15 prostate MRI-MRS studies suggests that (a) ScEPTre on MRS significantly outperforms a Haar wavelets based classifier, (b) integration of MRI-MRS via ScEPTre performs significantly better compared to using MRI and MRS alone, and (c) data integration via ScEPTre yields superior classification results compared to combining decisions from individual classifiers (or modalities).

  13. Fast conversion of scFv to Fab antibodies using type IIs restriction enzymes.

    Science.gov (United States)

    Sanmark, Hanna; Huovinen, Tuomas; Matikka, Tero; Pettersson, Tiina; Lahti, Maria; Lamminmäki, Urpo

    2015-11-01

    Single chain variable fragment (scFv) antibody libraries are widely used for developing novel bioaffinity reagents, although Fab or IgG molecules are the preferred antibody formats in many final applications. Therefore, rapid conversion methods for combining multiple DNA fragments are needed to attach constant domains to the scFv derived variable domains. In this study we describe a fast and easy cloning method for the conversion of single framework scFv fragments to Fab fragments using type IIS restriction enzymes. All cloning steps excluding plating of the Fab transformants can be done in 96 well plates and the procedure can be completed in one working day. The concept was tested by converting 69 scFv clones into Fab format on 96 well plates, which resulted in 93% success rate. The method is particularly useful as a high-throughput tool for the conversion of the chosen scFv clones into Fab molecules in order to analyze them as early as possible, as the conversion can significantly affect the binding properties of the chosen clones.

  14. ScVO4 under non-hydrostatic compression: a new metastable polymorph

    Science.gov (United States)

    Garg, Alka B.; Errandonea, D.; Rodríguez-Hernández, P.; Muñoz, A.

    2017-02-01

    The high-pressure (HP) behaviour of scandium vanadate (ScVO4) is investigated under non-hydrostatic compression. The compound is studied by means of synchrotron-based powder x-ray diffraction (XRD) and optical-absorption techniques. The occurrence of a non-reversible phase transition is detected. The transition is from the zircon structure to the fergusonite-type structure and takes place around 6 GPa with nearly 10% volume discontinuity. XRD measurements on the pressure cycled sample confirm for the first time that the fergusonite-type ScVO4 can be recovered as the metastable phase at ambient conditions. Raman spectroscopic measurements verify the metastable phase to be of a fergusonite-type phase. Theoretical calculations also corroborate the experimental findings. The fergusonite phase is found to be stiffer than the ambient-pressure zircon phase, as indicated by the observed experimental and theoretical bulk moduli. The optical properties and lattice-dynamics calculation of the fergusonite ScVO4 are discussed. At ambient pressure the band gap of the zircon (fergusonite)-type ScVO4 is 2.75 eV (2.3 eV). This fact suggests that the novel metastable polymorph of ScVO4 can have applications in green technologies; for instance, it can be used as photocatalytic material for hydrogen production by water splitting.

  15. Influence of Sc3+ on LiMn2O4 cathode materials at elevated temperature

    Institute of Scientific and Technical Information of China (English)

    LIU Huiyong; DENG Ganqun; GUO Yonglang

    2008-01-01

    Sc3+-doped lithium manganese oxides were synthesized by solid-state reaction. The influences of doping element on structure,mean valence of manganese, and electrochemical performances were studied by X-ray diffraction (XRD), galvanostatic charge-discharge and cyclic voltammetric tests, and also electrochemical impedance spectroscopy (EIS). XRD tests showed that doped lithium manganese oxides were pure spinel structure without other phases. Redox titration and visible spectrophotometry tests indicated that the mean valence of man-ganese in doped lithium manganese oxides was higher than that of pure one. LiSc0.02Mn1.98O4 remained 92.9% of the initial specific discharge capacity after 50th cycle at a constant current of 50 m/g, and the reversibility of LiSc0.02Mn1.98O4 was improved in comparison with pure LiMn2O4 at 50 ℃. EIS indicated that film deposition on spinel particles was suppressed because of Sc3+ doping, and the charge transfer be-tween the surface film and spinel particles with increasing temperature for Sc3+-doped materials became easier as compared with undoped one.

  16. AlScN thin film based surface acoustic wave devices with enhanced microfluidic performance

    Science.gov (United States)

    Wang, W. B.; Fu, Y. Q.; Chen, J. J.; Xuan, W. P.; Chen, J. K.; Wang, X. Z.; Mayrhofer, P.; Duan, P. F.; Bittner, A.; Schmid, U.; Luo, J. K.

    2016-07-01

    This paper reports the characterization of scandium aluminum nitride (Al1-x Sc x N, x  =  27%) films and discusses surface acoustic wave (SAW) devices based on them. Both AlScN and AlN films were deposited on silicon by sputtering and possessed columnar microstructures with (0 0 0 2) crystal orientation. The AlScN/Si SAW devices showed improved electromechanical coupling coefficients (K 2, ~2%) compared with pure AlN films (droplets, and the acoustic streaming and pumping velocities were 2  ×  and 3  ×  those of the AlN/Si SAW devices, respectively. Mechanical characterization showed that the Young’s modulus and hardness of the AlN film decreased significantly when Sc was doped, and this was responsible for the decreased acoustic velocity and resonant frequency, and the increased temperature coefficient of frequency, of the AlScN SAW devices.

  17. Unexpected magnetic behavior in amorphous Co{sub 90}Sc{sub 10} alloy

    Energy Technology Data Exchange (ETDEWEB)

    Ghafari, M., E-mail: mohammad.ghafari@kit.edu, E-mail: skamali@utsi.edu; Gleiter, H. [Herbert Gleiter Institute of Nanoscience, Nanjing University of Science and Technology, Nanjing 210094 (China); Institute of Nanotechnology, Karlsruhe Institute of Technology (KIT), 76344 Eggenstein-Leopoldshafen (Germany); Sakurai, Y.; Itou, M. [Japan Synchrotron Radiation Research Institute (JASRI), SPring-8, 1-1-1 Kouto, Sayo, Sayo, Hyogo (Japan); Peng, G.; Fang, Y. N.; Feng, T. [Herbert Gleiter Institute of Nanoscience, Nanjing University of Science and Technology, Nanjing 210094 (China); Hahn, H. [Herbert Gleiter Institute of Nanoscience, Nanjing University of Science and Technology, Nanjing 210094 (China); Institute of Nanotechnology, Karlsruhe Institute of Technology (KIT), 76344 Eggenstein-Leopoldshafen (Germany); KIT-TUD Joint Research Laboratory Nanomaterials, Institute of Materials Science, Technische Universität Darmstadt (TUD), Jovanka-Bontschits-Str. 2, 64287 Darmstadt (Germany); Kamali, S., E-mail: mohammad.ghafari@kit.edu, E-mail: skamali@utsi.edu [Department of Mechanical, Aerospace and Biomedical Engineering, University of Tennessee Space Institute, Tullahoma, Tennessee 37388 (United States)

    2015-09-28

    An amorphous alloy Co{sub 90}Sc{sub 10} has been prepared by rapid quenching from the melt. The results of magnetization measurements show that this alloy has the highest Curie temperature reported for any amorphous transition metal based alloys. Furthermore, for a Co based amorphous alloy, the magnetic moment is remarkably high. Moreover, the alloy exhibits soft magnetic properties. Based on the findings, amorphous Co{sub 90}Sc{sub 10} appears to be an attractive candidate for applications as a soft magnetic material. The temperature dependence of the reduced magnetization can be described by the Bloch power law. The results show that the B coefficient of the amorphous Co{sub 90}Sc{sub 10} alloy, which is a measure of the rigidity of spin waves, exhibits the lowest value observed until now for any amorphous alloy and is comparable to crystalline alloys. It is found that the Sc atoms in the Co{sub 90}Sc{sub 10} alloy lead to an increase of the itinerant spin moment of Co atoms, and, in contrast to this behaviour, to a decrease of the local 3d-electrons of Co.

  18. SC83288 is a clinical development candidate for the treatment of severe malaria

    Science.gov (United States)

    Pegoraro, Stefano; Duffey, Maëlle; Otto, Thomas D; Wang, Yulin; Rösemann, Roman; Baumgartner, Roland; Fehler, Stefanie K; Lucantoni, Leonardo; Avery, Vicky M; Moreno-Sabater, Alicia; Mazier, Dominique; Vial, Henri J; Strobl, Stefan; Sanchez, Cecilia P; Lanzer, Michael

    2017-01-01

    Severe malaria is a life-threatening complication of an infection with the protozoan parasite Plasmodium falciparum, which requires immediate treatment. Safety and efficacy concerns with currently used drugs accentuate the need for new chemotherapeutic options against severe malaria. Here we describe a medicinal chemistry program starting from amicarbalide that led to two compounds with optimized pharmacological and antiparasitic properties. SC81458 and the clinical development candidate, SC83288, are fast-acting compounds that can cure a P. falciparum infection in a humanized NOD/SCID mouse model system. Detailed preclinical pharmacokinetic and toxicological studies reveal no observable drawbacks. Ultra-deep sequencing of resistant parasites identifies the sarco/endoplasmic reticulum Ca2+ transporting PfATP6 as a putative determinant of resistance to SC81458 and SC83288. Features, such as fast parasite killing, good safety margin, a potentially novel mode of action and a distinct chemotype support the clinical development of SC83288, as an intravenous application for the treatment of severe malaria. PMID:28139658

  19. Construction of Human ScFv Phage Display Library against Ovarian Tumor

    Institute of Scientific and Technical Information of China (English)

    XIA Jinsong; BI Hao; YAO Qin; QU Shen; ZONG Yiqiang

    2006-01-01

    In order to construct a single chain fragment variable (ScFv) phage display library against ovarian tumor, by using RT-PCR, the human heavy chain variable region genes (VH) and light chain variable region genes (VL) were amplified from lymphocytes of ovarian tumor patients and subsequently assembled into ScFv genes by SOE. The resulting ScFv genes were electrotransformed into E.coli TG1 and amplified with the co-infection of helper phage M13KO7 to obtain phage display library. The capacity and titer of the resulting library were detected. The phage antibody library with a capacity of approximately 3 × 109 cfu/μg was obtained. After amplification with helper phage, the titer of antibody library reached 5 × 1012 cfu/mL. Human ScFv library against ovarian tumor was constructed successfully, which laid a foundation for the screening of ovarian tumor specific ScFv for the radioimmunoimaging diagnosis of ovarian tumor.

  20. Microstructure dependent fatigue crack growth in Al–Mg–Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Li, Mengjia [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Pan, Qinglin, E-mail: csupql@163.com [The Key Laboratory of Nonferrous Materials Science and Engineering of Ministry of Education, Central South University, Changsha 410083 (China); Shi, Yunjia; Wang, Ying [School of Materials Science and Engineering, Central South University, Changsha 410083 (China)

    2014-08-12

    The fatigue crack growth behavior of Al–Mg–Sc alloy was investigated by tensile testing and fatigue testing. Different annealing treatments were applied to the alloy. Microstructure characterization of the alloy was carried out by means of transmission electron microscopy (TEM), scanning electron microscopy (SEM) and optical microscopy (OM). The size of Al{sub 3}(Sc{sub 1−x}Zr{sub x}) particle was calculated by software. The fatigue crack growth (FCG) rate (da/dN) was discussed with stress intensity factor range (ΔK) in Paris's region. The Paris exponent m and constants C were used to calculate the fatigue life. The fatigue process and crack closure effects were discussed with the yield strength and tensile strength of Al–Mg–Sc alloy. Results show that the microstructure, tensile strength and fatigue crack growth rate were greatly dependent on the annealing temperature, and the high resistance of Al–Mg–Sc alloy was mainly due to the combination microstructures of sub-grains, dislocations and these Al{sub 3}(Sc{sub 1−x}Zr{sub x}) precipitates.

  1. Isolation of anti-T cell receptor scFv mutants by yeast surface display.

    Science.gov (United States)

    Kieke, M C; Cho, B K; Boder, E T; Kranz, D M; Wittrup, K D

    1997-11-01

    Yeast surface display and sorting by flow cytometry have been used to isolate mutants of an scFv that is specific for the Vbeta8 region of the T cell receptor. Selection was based on equilibrium binding by two fluorescently labeled probes, a soluble Vbeta8 domain and an antibody to the c-myc epitope tag present at the carboxy-terminus of the scFv. The mutants that were selected in this screen included a scFv with threefold increased affinity for the Vbeta8 and scFv clones that were bound with reduced affinities by the anti-c-myc antibody. The latter finding indicates that the yeast display system may be used to map conformational epitopes, which cannot be revealed by standard peptide screens. Equilibrium antigen binding constants were estimated within the surface display format, allowing screening of isolated mutants without necessitating subcloning and soluble expression. Only a relatively small library of yeast cells (3 x 10[5]) displaying randomly mutagenized scFv was screened to identify these mutants, indicating that this system will provide a powerful tool for engineering the binding properties of eucaryotic secreted and cell surface proteins.

  2. Preliminary Analysis of the Social and Scientific Impact of the UAEM-ININ M.Sc. and D.Sc. Graduate Programme in Medical Physics

    Science.gov (United States)

    Mitsoura, Eleni; Isaac-Olive, Keila; Torres-Garcia, Eugenio; Camacho-Lopez, Miguel Angel; Hardy-Perez, Alberto

    2010-12-01

    Sponsored by the International Atomic Energy Agency (IAEA) in 1994, the Instituto Nacional de Investigaciones Nucleares (ININ) started in Mexico a teaching and training programme (Diplomado) in Radiotherapy Medical Physics. Based on this experience, the Universidad Autónoma del Estado de México (UAEM) and the Instituto Nacional de Investigaciones Nucleares (ININ) launched two years later, the first Graduate Programme in Science (M.Sc. and D.Sc.), specialised in Medical Physics in Mexico. A preliminary analysis of the social and scientific impact of the UAEM-ININ Programme is presented in this work based on the achievements attained, regarding the number of graduated Medical Physicists, their geographic and academic origin, their current professional activities and the number of scientific publications produced as a result of the thesis, as well as their citations.

  3. Phase relations of Al-4Mg-Sc-Zr quaternary system in Al-rich range at 430 ℃

    Institute of Scientific and Technical Information of China (English)

    夏长清; 曾凡浩; 古一

    2003-01-01

    The 430 ℃ isothermal section of the Al-4Mg-Sc-Zr quaternary system in the Al-rich range was determined by means of equilibrium alloys with the use of microstructure, X-ray diffraction analysis and electron probe microanalysis. There coexist three single-phase fields, two two-phase fields and one three-phase field. It is established that the phase Al3Sc1-0.5Zr0-0.5 with L12 structure and Al3Zr1-0.8Sc0-0.2 with DO23 structure are in equilibrium with the α solid solution, Zr being dissolved in Al3Sc, further substituting for about 50% Sc(mole fraction) whilst Sc is present in the phase Al3Zr and the maximum substitution for Zr is about 20%.

  4. Comparison of Response between RC and SC Containment Structures Subjected to Aircraft Impact

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Sang Shup; Choi, In Kil [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Park, Tae Hyo [Hanyang University, Seoul (Korea, Republic of)

    2012-05-15

    Since the aircraft terror to the World Trade Center (WTC) on September 11, 2001, an aircraft impact problem has been increasingly interested. The possibilities of aircraft impacts against nuclear power plants are one of important category. To date, the impact load of the analysis on aircraft impacts has been applied to target structures in local areas by using the impact force-time history function of Riera. However, Riera forcing function is not recommended at the expectation of unreasonable damage or perforation to target structures. The numerical analysis of rc and sc containment structures subjected to aircraft impact is performed by using the AUTODYN-3D. It is carried out the four different types for RC and SC structures. Thus, in this study, the different behaviors of containment structures and the safety of SC structure are expected

  5. Laboratory oscillator strengths of Sc I in the near-infrared region for astrophysical applications

    CERN Document Server

    Pehlivan, A; Hartman, H

    2015-01-01

    Context. Atomic data is crucial for astrophysical investigations. To understand the formation and evolution of stars, we need to analyse their observed spectra. Analysing a spectrum of a star requires information about the properties of atomic lines, such as wavelengths and oscillator strengths. However, atomic data of some elements are scarce, particularly in the infrared region, and this paper is part of an effort to improve the situation on near-IR atomic data. Aims. This paper investigates the spectrum of neutral scandium, Sc i, from laboratory measurements and improves the atomic data of Sc i lines in the infrared region covering lines in R, I, J, and K bands. Especially, we focus on measuring oscillator strengths for Sc i lines connecting the levels with 4p and 4s configurations. Methods. We combined experimental branching fractions with radiative lifetimes from the literature to derive oscillator strengths (f - values). Intensity-calibrated spectra with high spectral resolution were recorded with Fouri...

  6. Dislocation Core Structure and Peierls Stress of B2-Based AlSc in {110} Plane

    Science.gov (United States)

    Li, S. R.; Wu, X. Z.; Zhang, T.; Tian, Y. X.; Yan, Z. X.; Zhu, H. Z.

    2016-10-01

    The core structure and Peierls stress of , , and dislocations in {110} plane of B2-based AlSc (B2-AlSc) have been investigated using improved dislocation equations combined with the generalized stacking fault (GSF) energy. The truncated approximation method is utilized to construct the dissociated and undissociated dislocations in AlSc, then the effects of dislocation angles on the elastic strain energy and misfit energy are presented. Specifically, with increasing dislocation angle, the misfit energy, elastic strain energy, and total energy, and their corresponding stresses, decrease on the {110} and {110} slip systems. However, for {110} dislocation, all energies and corresponding stresses exhibit the relationship 0° > 54.7° > 35.3° > 90°. The misfit energy is always smaller than the elastic strain energy, even by one or two orders of magnitude, and their phases are always opposite.

  7. Scénario pédagogique et efficacité des instruments de communication

    Directory of Open Access Journals (Sweden)

    Stéphane Simonian

    2008-01-01

    Full Text Available Cette recherche traite de l’efficacité des scénarii pédagogiques au sein de deux formations universitaires en ligne et à distance, en se basant sur une approche enseignement. La littérature positionne de plus en plus les scénarii pédagogiques dans le modèle socioconstructiviste pour favoriser les interactions. Notre question porte alors sur la pertinence des instruments de communication (courriel, forum, clavardage en fonction des usages. Notre étude tend à montrer qu’une affordance dans l’usage des instruments de communication dépend d’un scénario pédagogique, lui-même basé sur une activité collaborative dans une durée assez courte.

  8. Density functional study of $\\rm{AgScO_2}$: Electronic and optical properties

    Indian Academy of Sciences (India)

    K C BHAMU; JAGRATI SAHARIYA; RISHI VYAS; K R PRIOLKAR

    2017-07-01

    This paper focusses on the electronic and optical properties of scandium-based silver delafossite $\\rm{(AgScO_2)}$ semiconductor. The density functional theory (DFT) in the framework of full potential linearized augmented plane wave (FP-LAPW) scheme has been used for the present calculations with local densityapproximation (LDA) and generalized gradient approximation (GGA). Electronic properties deal with energy bands and density of states (DOSs), while optical properties describe refractive index and absorption coefficient.The energy bands are interpreted in terms of DOSs. The computed value of band gap is in agreement with that reported in the literature. Our results predict $\\rm{AgScO_2}$ as indirect band-gap semiconductor. Our calculated value of the refractive index in zero frequency limits is 2.42. The absorption coefficient predicts the applicability of $\\rm{AgScO_2}$ in solar cells and flat panel liquid crystal display as a transparent top window layer.

  9. High efficiency recovery and epitope specific sorting of an scFv yeast display library

    Energy Technology Data Exchange (ETDEWEB)

    Siegel, Robert W.; Coleman, James R.; Miller, Keith D.; Feldhaus, Michael

    2004-03-01

    In order to more productively utilize the rich source of antigen specific reagents present in the previously described non-immune scFv yeast display library (Feldhaus et al., 2003) one must be able to efficiently isolate and characterize clones within the library. To this end, we have developed and validated a magnetic bead sorting technique utilizing the Miltenyi MacsTm system to recover greater than 90% of the antigen specific clones present in the library. In combination with flow cytometry, we rapidly reduced diversity and enriched for antigen specific clones in three rounds of selection. Furthermore, we demonstrate the use of pre-existing monoclonal antibodies (mAbs) for antigen labeling and subsequent flow cytometric sorting and characterization of epitope specific scFv. Combining these two improvements in library screening allowed isolation and characterization of 3 epitope specific scFv (including a previously uncharacterized epitope) to a 6 kd protein, epidermal growth factor EGF.

  10. Density functional study of AgScO_2: Electronic and optical properties

    Science.gov (United States)

    Bhamu, K. C.; Sahariya, Jagrati; Vyas, Rishi; Priolkar, K. R.

    2017-07-01

    This paper focusses on the electronic and optical properties of scandium-based silver delafossite (AgScO_2) semiconductor. The density functional theory (DFT) in the framework of full potential linearized augmented plane wave (FP-LAPW) scheme has been used for the present calculations with local density approximation (LDA) and generalized gradient approximation (GGA). Electronic properties deal with energy bands and density of states (DOSs), while optical properties describe refractive index and absorption coefficient. The energy bands are interpreted in terms of DOSs. The computed value of band gap is in agreement with that reported in the literature. Our results predict AgScO_2 as indirect band-gap semiconductor. Our calculated value of the refractive index in zero frequency limits is 2.42. The absorption coefficient predicts the applicability of AgScO_2 in solar cells and flat panel liquid crystal display as a transparent top window layer.

  11. Normal-2SC mixed phase of quark matter in compact stars for large coupling constant

    CERN Document Server

    Aguilera, D N; Grigorian, H

    2004-01-01

    We study the consequences of changing the ratio $\\eta$ between the coupling constant in the diquark channel and the coupling constant in the messon channel to a quark matter equation of state under compact stars constraints. A nonlocal chiral quark model is used and the quark interaction is represented via formfactor functions. We found that a mixed phase of 2SC quark matter and normal quark matter (N-2SC) is likely to occur for rather large $\\eta$, 0.86 $\\leq \\eta \\leq$ 1.1 in the interior of compact stars for Gaussian formfactor. For the two other formfactors the range of the mixed phase is shifted to lower values of $\\eta$. This result leads us to suggest that, if the coupling is not so large, spin-1 channels may be more likely to occur rather than the 2SC phase for intermediate densities in the interior of compact stars.

  12. Gyrase-dependent stabilization of pSC101 plasmid inheritance by transcriptionally active promoters.

    Science.gov (United States)

    Beaucage, S L; Miller, C A; Cohen, S N

    1991-09-01

    The pSC101 plasmid encodes a cis-acting genetic locus termed par that ensures the stable inheritance of plasmids in a population of dividing cells. In the absence of selection, par-defective plasmids are lost rapidly from the bacterial population. We report here that the stability of par-deleted pSC101 derivatives is restored by introducing certain adventitious bacterial promoters onto the plasmid. Stabilization requires active transcription from the inserted promoter and is affected by the site and orientation of the insertion, the length of the nascent transcript and DNA gyrase activity. While a promotor-associated overall increase in negative superhelicity of plasmid DNA was observed, stabilized inheritance appeared to be dependent on localized rather than generalized supercoiling. Our demonstration that promoter-induced DNA supercoiling can mimic the effects of the pSC101 par locus provides evidence that the previously reported superhelicity-generating effects of par are intrinsic to its function.

  13. Thermodynamics-Based Computational Design of Al-Mg-Sc-Zr Alloys

    Science.gov (United States)

    Haidemenopoulos, G. N.; Katsamas, A. I.; Kamoutsi, H.

    2010-04-01

    Alloying additions of Sc and Zr raise the yield strength of Al-Mg alloys significantly. We have studied the effects of Sc and Zr on the grain refinement and recrystallization resistance of Al-Mg alloys with the aid of computational alloy thermodynamics. The grain refinement potential has been assessed by Scheil-Gulliver simulations of solidification paths, while the recrystallization resistance (Zener drag) has been assessed by calculation of the precipitation driving forces of the Al3Sc and Al3Zr intermetallics. Microstructural performance indices have been derived, used to rank several alloy composition variants, and finally select the variant with the best combination of grain refinement and recrystallization resistance. The method can be used, with certain limitations, for a thermodynamics-based design of Al-Mg and other alloy compositions.

  14. Magnetic anisotropy in the incommensurate ScFe{sub 4}Al{sub 8} system

    Energy Technology Data Exchange (ETDEWEB)

    Rećko, K., E-mail: k.recko@uwb.edu.pl [Faculty of Physics, University of Białystok, K. Ciołkowskiego 1L, 15-245 Białystok (Poland); Dobrzyński, L. [National Centre for Nuclear Research, A. Soltan 7, 05-400 Otwock-Świerk (Poland); Waliszewski, J.; Szymański, K. [Faculty of Physics, University of Białystok, K. Ciołkowskiego 1L, 15-245 Białystok (Poland)

    2015-08-15

    Neutron scattering and magnetization data are used for estimation of the spin ordering in ScFe{sub 4}Al{sub 8}. Results of experimental measurements are compared with the ground state configurations obtained by simulated annealing algorithms. The origins of the magnetocrystalline anisotropy of the scandium intermetallic alloy and the conditions of the coexistence of two different magnetic modulations as a function of the exchange integrals are discussed. The influence of the dipolar interactions for the noncollinearity and incommensurability in ScFe{sub 4}Al{sub 8} was determined. - Highlights: • We found dipolar and DM interactions as the anisotropy origins of 3d–3d–3p alloy. • We covered the explanation of incommensurability and noncollinearity of ScFe{sub 4}Al{sub 8}. • We discussed the magnetism resulting from competitiveness of exchange effects.

  15. The luminescence of arsenic(III) in the cubic elpasolite Cs2NaScCl6

    NARCIS (Netherlands)

    Oomen, E.W.J.L.; Smit, W.M.A.; Blasse, G.

    1987-01-01

    Luminescence spectra and decay time measurements of the 4s2 ion As3+ in CS2NaScCl6 are presented. A dynamical Jahn-Teller effect is observed in the excitation spectrum of the As3+ ion. The luminescence properties of Cs2NaScCl6-As3+ are comparable to those of Cs2NaScCl6-Sb3+ taking into account the

  16. Local character of the highest antiferromagnetic Ce-system CeTi{1-x}Sc{x} Ge

    OpenAIRE

    2014-01-01

    The highest antiferromagnetic (AFM) temperature in Ce based compounds has been reported for CeScGe with Tn=47K, but its local or itinerant nature was not deeply investigated yet. In order to shed more light into this unusually high ordering temperature we have investigated structural, magnetic, transport and thermal properties of CeTi{1-x}Sc{x}Ge alloys within the range of stability of the CeScSi-type structure: 0.25

  17. Thermal neutron capture and resonance integral cross sections of 45Sc

    Science.gov (United States)

    Van Do, Nguyen; Duc Khue, Pham; Tien Thanh, Kim; Thi Hien, Nguyen; Kim, Guinyun; Kim, Kwangsoo; Shin, Sung-Gyun; Cho, Moo-Hyun; Lee, Manwoo

    2015-11-01

    The thermal neutron cross section (σ0) and resonance integral (I0) of the 45Sc(n,γ)46Sc reaction have been measured relative to that of the 197Au(n,γ)198Au reaction by means of the activation method. High-purity natural scandium and gold foils without and with a cadmium cover of 0.5 mm thickness were irradiated with moderated pulsed neutrons produced from the Pohang Neutron Facility (PNF). The induced activities in the activated foils were measured with a high purity germanium (HPGe) detector. In order to improve the accuracy of the experimental results the counting losses caused by the thermal (Gth) and resonance (Gepi) neutron self-shielding, the γ-ray attenuation (Fg) and the true γ-ray coincidence summing effects were made. In addition, the effect of non-ideal epithermal spectrum was also taken into account by determining the neutron spectrum shape factor (α). The thermal neutron cross-section and resonance integral of the 45Sc(n,γ)46Sc reaction have been determined relative to the reference values of the 197Au(n,γ)198Au reaction, with σo,Au = 98.65 ± 0.09 barn and Io,Au = 1550 ± 28 barn. The present thermal neutron cross section has been determined to be σo,Sc = 27.5 ± 0.8 barn. According to the definition of cadmium cut-off energy at 0.55 eV, the present resonance integral cross section has been determined to be Io,Sc = 12.4 ± 0.7 barn. The present results are compared with literature values and discussed.

  18. Isolation and characterization of anti c-met single chain fragment variable (scFv) antibodies.

    Science.gov (United States)

    Qamsari, Elmira Safaie; Sharifzadeh, Zahra; Bagheri, Salman; Riazi-Rad, Farhad; Younesi, Vahid; Abolhassani, Mohsen; Ghaderi, Sepideh Safaei; Baradaran, Behzad; Somi, Mohammad Hossein; Yousefi, Mehdi

    2017-12-01

    The receptor tyrosine kinase (RTK) Met is the cell surface receptor for hepatocyte growth factor (HGF) involved in invasive growth programs during embryogenesis and tumorgenesis. There is compelling evidence suggesting important roles for c-Met in colorectal cancer proliferation, migration, invasion, angiogenesis, and survival. Hence, a molecular inhibitor of an extracellular domain of c-Met receptor that blocks c-Met-cell surface interactions could be of great thera-peutic importance. In an attempt to develop molecular inhibitors of c-Met, single chain variable fragment (scFv) phage display libraries Tomlinson I + J against a specific synthetic oligopeptide from the extracellular domain of c-Met receptor were screened; selected scFv were then characterized using various immune techniques. Three c-Met specific scFv (ES1, ES2, and ES3) were selected following five rounds of panning procedures. The scFv showed specific binding to c-Met receptor, and significantly inhibited proliferation responses of a human colorectal carcinoma cell line (HCT-116). Moreover, anti- apoptotic effects of selected scFv antibodies on the HCT-116 cell line were also evaluated using Annexin V/PI assays. The results demonstrated rates of apoptotic cell death of 46.0, 25.5, and 37.8% among these cells were induced by use of ES1, ES2, and ES3, respectively. The results demonstrated ability to successfully isolate/char-acterize specific c-Met scFv that could ultimately have a great therapeutic potential in immuno-therapies against (colorectal) cancers.

  19. Thermal neutron capture and resonance integral cross sections of {sup 45}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Van Do, Nguyen; Duc Khue, Pham; Tien Thanh, Kim [Institute of Physics, Vietnam Academy of Science and Technology, 10 Dao Tan, Hanoi (Viet Nam); Thi Hien, Nguyen [Institute of Physics, Vietnam Academy of Science and Technology, 10 Dao Tan, Hanoi (Viet Nam); Department of Physics and Center for High Energy Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Kim, Guinyun, E-mail: gnkim@knu.ac.kr [Department of Physics and Center for High Energy Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Kim, Kwangsoo [Department of Physics and Center for High Energy Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Shin, Sung-Gyun; Cho, Moo-Hyun [Department of Advanced Nuclear Engineering, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Lee, Manwoo [Research Center, Dongnam Institute of Radiological and Medical Science, Busan 619-953 (Korea, Republic of)

    2015-11-01

    The thermal neutron cross section (σ{sub 0}) and resonance integral (I{sub 0}) of the {sup 45}Sc(n,γ){sup 46}Sc reaction have been measured relative to that of the {sup 197}Au(n,γ){sup 198}Au reaction by means of the activation method. High-purity natural scandium and gold foils without and with a cadmium cover of 0.5 mm thickness were irradiated with moderated pulsed neutrons produced from the Pohang Neutron Facility (PNF). The induced activities in the activated foils were measured with a high purity germanium (HPGe) detector. In order to improve the accuracy of the experimental results the counting losses caused by the thermal (G{sub th}) and resonance (G{sub epi}) neutron self-shielding, the γ-ray attenuation (F{sub g}) and the true γ-ray coincidence summing effects were made. In addition, the effect of non-ideal epithermal spectrum was also taken into account by determining the neutron spectrum shape factor (α). The thermal neutron cross-section and resonance integral of the {sup 45}Sc(n,γ){sup 46}Sc reaction have been determined relative to the reference values of the {sup 197}Au(n,γ){sup 198}Au reaction, with σ{sub o,Au} = 98.65 ± 0.09 barn and I{sub o,Au} = 1550 ± 28 barn. The present thermal neutron cross section has been determined to be σ{sub o,Sc} = 27.5 ± 0.8 barn. According to the definition of cadmium cut-off energy at 0.55 eV, the present resonance integral cross section has been determined to be I{sub o,Sc} = 12.4 ± 0.7 barn. The present results are compared with literature values and discussed.

  20. Structure and magnetic properties of a new anion-deficient perovskite Pb{sub 2}Ba{sub 2}BiFe{sub 4}ScO{sub 13} with crystallographic shear structure

    Energy Technology Data Exchange (ETDEWEB)

    Batuk, Maria, E-mail: Maria.Batuk@ua.ac.be [Electron Microscopy for Materials Research (EMAT), University of Antwerp, Groenenborgerlaan 171, B-2020, Antwerp (Belgium); Tyablikov, Oleg A. [Department of Chemistry, Moscow State University, 119991 Moscow (Russian Federation); Tsirlin, Alexander A. [National Institute of Chemical Physics and Biophysics, 12618 Tallinn (Estonia); Max Planck Institute for Chemical Physics of Solids, Nöthnitzer Str. 40, 01187 Dresden (Germany); Kazakov, Sergey M.; Rozova, Marina G.; Pokholok, Konstantin V.; Filimonov, Dmitry S.; Antipov, Evgeny V. [Department of Chemistry, Moscow State University, 119991 Moscow (Russian Federation); Abakumov, Artem M. [Electron Microscopy for Materials Research (EMAT), University of Antwerp, Groenenborgerlaan 171, B-2020, Antwerp (Belgium); Department of Chemistry, Moscow State University, 119991 Moscow (Russian Federation); Hadermann, Joke [Electron Microscopy for Materials Research (EMAT), University of Antwerp, Groenenborgerlaan 171, B-2020, Antwerp (Belgium)

    2013-09-01

    Graphical abstract: - Highlights: • Pb{sub 2}Ba{sub 2}BiFe{sub 4}ScO{sub 13} was obtained by solid state synthesis. • Its structure was refined from combination of XPD and TEM. • It is a new member of the perovskite-related homologous series A{sub n}B{sub n}O{sub 3n−2} with n = 5. • Pb{sub 2}Ba{sub 2}BiFe{sub 4}ScO{sub 13} is antiferromagnetically ordered below T{sub N} ≈350 K. - Abstract: Pb{sub 2}Ba{sub 2}BiFe{sub 4}ScO{sub 13}, a new n = 5 member of the oxygen-deficient perovskite-based A{sub n}B{sub n}O{sub 3n−2} homologous series, was synthesized using a solid-state method. The crystal structure of Pb{sub 2}Ba{sub 2}BiFe{sub 4}ScO{sub 13} was investigated by a combination of synchrotron X-ray powder diffraction, electron diffraction, high-angle annular dark-field scanning transmission electron microscopy and Mössbauer spectroscopy. At 900 K, it crystallizes in the Ammm space group with the unit cell parameters a = 5.8459(1) Å, b = 4.0426(1) Å, and c = 27.3435(1) Å. In the Pb{sub 2}Ba{sub 2}BiFe{sub 4}ScO{sub 13} structure, quasi-two-dimensional perovskite blocks are periodically interleaved with ½[1 1 0] (1{sup ¯}01){sub p} crystallographic shear (CS) planes. At the CS planes, the corner-sharing FeO{sub 6} octahedra are transformed into chains of edge-sharing FeO{sub 5} distorted tetragonal pyramids. B-positions of the perovskite blocks between the CS planes are jointly occupied by Fe{sup 3+} and Sc{sup 3+}. The chains of the FeO{sub 5} pyramids and (Fe,Sc)O{sub 6} octahedra delimit six-sided tunnels that are occupied by double columns of cations with a lone electron pair (Pb{sup 2+}). The remaining A-cations (Bi{sup 3+}, Ba{sup 2+}) occupy positions in the perovskite block. According to the magnetic susceptibility measurements, Pb{sub 2}Ba{sub 2}BiFe{sub 4}ScO{sub 13} is antiferromagnetically ordered below T{sub N} ≈350 K.

  1. Synergistic Antivascular and Antitumor Efficacy with Combined Cediranib and SC6889 in Intracranial Mouse Glioma.

    Directory of Open Access Journals (Sweden)

    Merryl R Lobo

    Full Text Available Prognosis remains extremely poor for malignant glioma. Targeted therapeutic approaches, including single agent anti-angiogenic and proteasome inhibition strategies, have not resulted in sustained anti-glioma clinical efficacy. We tested the anti-glioma efficacy of the anti-angiogenic receptor tyrosine kinase inhibitor cediranib and the novel proteasome inhibitor SC68896, in combination and as single agents. To assess anti-angiogenic effects and evaluate efficacy we employed 4C8 intracranial mouse glioma and a dual-bolus perfusion MRI approach to measure Ktrans, relative cerebral blood flow and volume (rCBF, rCBV, and relative mean transit time (rMTT in combination with anatomical MRI measurements of tumor growth. While single agent cediranib or SC68896 treatment did not alter tumor growth or survival, combined cediranib/SC68896 significantly delayed tumor growth and increased median survival by 2-fold, compared to untreated. This was accompanied by substantially increased tumor necrosis in the cediranib/SC68896 group (p<0.01, not observed with single agent treatments. Mean vessel density was significantly lower, and mean vessel lumen area was significantly higher, for the combined cediranib/SC68896 group versus untreated. Consistent with our previous findings, cediranib alone did not significantly alter mean tumor rCBF, rCBV, rMTT, or Ktrans. In contrast, SC68896 reduced rCBF in comparison to untreated, but without concomitant reductions in rCBV, rMTT, or Ktrans. Importantly, combined cediranib/SC68896 substantially reduced rCBF, rCBV. rMTT, and Ktrans. A novel analysis of Ktrans/rCBV suggests that changes in Ktrans with time and/or treatment are related to altered total vascular surface area. The data suggest that combined cediranib/SC68896 induced potent anti-angiogenic effects, resulting in increased vascular efficiency and reduced extravasation, consistent with a process of vascular normalization. The study represents the first demonstration

  2. Renormalized molecular levels in a Sc3N@C-80 molecular electronic device

    DEFF Research Database (Denmark)

    Larade, Brian; Taylor, Jeremy Philip; Zheng, Q. R.

    2001-01-01

    We address several general questions about quantum transport through molecular systems by an ab initio analysis of a scandium-nitrogen doped C-80 metallofullerene device. Charge transfer from the Sc3N is found to drastically change the current-voltage characteristics: the current through the Sc3N...... @ C-80 device is double that through a bare C-80 device. We provide strong evidence that transport in such molecular devices is mediated by molecular electronic states which have been renormalized by the device environment, such as the electrodes and external bias V-b. The renormalized molecular...

  3. Preparation, microstructure and properties of Al-Zn-Mg-Sc alloy tubes

    Institute of Scientific and Technical Information of China (English)

    何振波; 尹志民; 林森; 邓英; 商宝川; 周向

    2010-01-01

    The Al-6.0Zn-2.0Mg-0.2Sc-0.10Zr hollow tube ingots, prepared by semi-continuous casting technology, were subjected to ho- mogenization treatment, hot extrusion, intermediate annealing, tension, solution and aging treatment. The microstructures and properties of as-cast Al-Zn-Mg-Sc alloy at different homogenization treatment conditions were studied using hardness measurement, X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM) analysis. The results showed th...

  4. Roberts-SC syndrome, a rare syndrome and cleft palate repair

    Directory of Open Access Journals (Sweden)

    Murthy Jyotsna

    2008-01-01

    Full Text Available Roberts SC syndrome is a rare syndrome with only 17 previously recognized patients reported in medical literature. The syndrome is characterized by multiple malformations, particularly, symmetrical limb reduction, craniofacial anomalies such as bilateral cleft lip and palate, micrognathia, and severe growth and mental retardation. Our patient, a young child of five years having Roberts-SC, was successfully operated for cleft palate under general anesthesia. The main features of the syndrome and the technical problems of anesthesia and surgery are discussed in this report.

  5. Radiation-Resistant Micrococcus luteus SC1204 and Its Proteomics Change Upon Gamma Irradiation.

    Science.gov (United States)

    Deng, Wuyuan; Yang, Yang; Gao, Peng; Chen, Hao; Wen, Wenting; Sun, Qun

    2016-06-01

    To explore the radiation-resistance mechanisms in bacteria, a radiation-resistant strain SC1204 was isolated from the surrounding area of a (60)Co-γ radiation facility. SC1204 could survive up to 8 kGy dose of gamma irradiation and was identified as Micrococcus luteus by phylogenetic analysis of 16S rRNA gene sequences. Its proteomic changes under 2-kGy irradiation were examined by two-dimensional electrophoresis followed by MALDI-TOF-TOF/MS analysis. The results showed that at least 24 proteins displayed significant changes (p changing significantly (p resistance in M. luteus.

  6. Supervising M.Sc. Students working in the 100 Gigabit Ethernet field using OPNET Modeler

    DEFF Research Database (Denmark)

    Ruepp, Sarah Renée; Berger, Michael Stübert; Wessing, Henrik

    2010-01-01

    This paper deals with supervision methods for M.Sc. students who are using OPNET Modeler for their thesis work within the field of 100 Gigabit Ethernet. We detail how we use OPNET Modeler in our M.Sc. projects at the Technical University of Denmark. In particular, we discuss on how we teach...... students to learn OPNET independently and in a short timeframe, and we outline what students find challenging and rewarding by using OPNET Modeler. Furthermore, we show some cases on how OPNET was applied in specific projects within the field of 100 Gigabit Ethernet....

  7. Population of positive-parity states in Sc53 through one-proton knockout

    Science.gov (United States)

    McDaniel, S.; Gade, A.; Janssens, R. V. F.; Bazin, D.; Brown, B. A.; Campbell, C. M.; Carpenter, M. P.; Cook, J. M.; Deacon, A. N.; Dinca, D.-C.; Freeman, S. J.; Glasmacher, T.; Hansen, P. G.; Kay, B. P.; Mantica, P. F.; Mueller, W. F.; Terry, J. R.; Tostevin, J. A.; Zhu, S.

    2010-02-01

    The one-proton knockout reaction Be9(Ti54,Sc53+γ)X at 72 MeV/nucleon has been measured. The location of the first 3/2- state at 2110(3) keV was confirmed, and new γ-ray transitions were observed at 1111(2), 1273(2), 1539(4), and 2495(5) keV. Large spectroscopic strength to excited states in Sc53 was found and attributed to the knockout of sd-shell protons.

  8. Structure of singly terminated DyScO3 (110) surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Kleibeuker, Josee [University of Twente, Enschede, Netherlands; Kuiper, Bouwe [University of Twente, Enschede, Netherlands; Harkema, S. [University of Twente, Enschede, Netherlands; Blank, Dave H. A. [University of Twente, Enschede, Netherlands; Koster, Gertjan [University of Twente, Enschede, Netherlands; Rijnders, Guus [MESA+ University of Twente, Enschede, Netherlands; Tinnemans, P. [Radboud University Nijmegen, The Netherlands; Vlieg, E. [Radboud University Nijmegen, The Netherlands; Rossen, P. B. [University of California, Berkeley; Siemons, Wolter [ORNL; Portale, G. [European Synchrotron Radiation Facility (ESRF); Ravichandran, Jayakanth [University of California, Berkeley; Ramesh, R. [University of California, Berkeley

    2012-01-01

    We have studied the polar surface of singly terminated DyScO{sub 3} (110) crystals by reflective high-energy electron diffraction, surface x-ray diffraction and angle-resolved mass spectroscopy of recoiled ions. These techniques show that the surfaces are (1 x 1) reconstructed, which points to the absence of ordered cation vacancies at the surface. The best surfaces were obtained after a selective chemical wet etch. We suggest that for ScO{sub 2} terminated surfaces, adsorbates, or oxygen vacancies are most likely to occur in order to overcome the polarity difference between stoichiometric bulk crystal and vacuum.

  9. A Saccharomyces cerevisiae mitochondrial transcription factor, sc-mtTFB, shares features with sigma factors but is functionally distinct.

    Science.gov (United States)

    Shadel, G S; Clayton, D A

    1995-04-01

    In Saccharomyces cerevisiae mitochondria, sc-mtTFB is a 341-amino-acid transcription factor required for initiation of transcription from mitochondrial DNA promoters. Specific transcription in vitro requires only sc-mtTFB and the bacteriophage-related core sc-mtRNA polymerase. Mutational analysis of sc-mtTFB has defined two regions of the protein that are important for normal function both in vivo and in vitro. These regions overlap portions of the protein that exhibit similarity to conserved region 2 of bacterial sigma factors. One mutation in this region of sc-mtTFB (tyrosine 108 to arginine [Y108R]) has a defective phenotype that matches that observed for mutations in the corresponding residue of Bacillus subtilis sigma A and sigma E proteins. However, mutations in the sigma 2.4-like region, including a 5-amino-acid deletion corresponding to crucial promoter-contacting amino acids of sigma factors, did not eliminate the ability of sc-mtTFB to initiate transcription specifically in vitro. This suggests a mechanism of promoter recognition for sc-mtRNA polymerase different from that used by bacterial RNA polymerases. Two mutations in a basic region of sc-mtTFB resulted in defective proteins that were virtually dependent on supercoiled DNA templates in vitro. These mutations may have disrupted a DNA-unwinding function of sc-mtTFB that is only manifested in vitro and is partially rescued by DNA supercoiling.

  10. The half-metallicity of LiMgPdSn-type quaternary Heusler alloys FeMnScZ (Z=Al, Ga, In): A first-principle study

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Y. C., E-mail: gaoyc1963@126.com [Department of Physics, college of science, North China University of Science And Technology (former Hebei United University), Tangshan, 063009 (China); Gao, X. [Department of Mechanical and Electrical Engineering, Hebei University of Science and Technology, Tangshan Branch, TangShan, 063000 (China)

    2015-05-15

    Based on the first-principles calculations, quaternary Heusler alloys FeMnScZ (Z=Al, Ga, In) including its phase stability, band gap, the electronic structures and magnetic properties has been studied systematically. We have found that, in terms of the equilibrium lattice constants, FeMnScZ (Z=Al, Ga, In) are half-metallic ferrimagnets, which can sustain the high spin polarization under a very large amount of lattice distortions. The half-metallic band gap in FeMnScZ (Z=Al, Ga, In) alloys originates from the t{sub 1u}-t{sub 2g} splitting instead of the e{sub u}-t{sub 1u} splitting. The total magnetic moments are 3μB per unit cell for FeMnScZ (Z=Al, Ga, In) alloys following the Slater–Pauling rule with the total number of valence electrons minus 18 rather than 24. According to the study, the conclusion can be drawn that all of these compounds which have a negative formation energy are possible to be synthesized experimentally.

  11. The half-metallicity of LiMgPdSn-type quaternary Heusler alloys FeMnScZ (Z=Al, Ga, In: A first-principle study

    Directory of Open Access Journals (Sweden)

    Y. C. Gao

    2015-05-01

    Full Text Available Based on the first-principles calculations, quaternary Heusler alloys FeMnScZ (Z=Al, Ga, In including its phase stability, band gap, the electronic structures and magnetic properties has been studied systematically. We have found that, in terms of the equilibrium lattice constants, FeMnScZ (Z=Al, Ga, In are half-metallic ferrimagnets, which can sustain the high spin polarization under a very large amount of lattice distortions. The half-metallic band gap in FeMnScZ (Z=Al, Ga, In alloys originates from the t1u-t2g splitting instead of the eu-t1u splitting. The total magnetic moments are 3μB per unit cell for FeMnScZ (Z=Al, Ga, In alloys following the Slater–Pauling rule with the total number of valence electrons minus 18 rather than 24. According to the study, the conclusion can be drawn that all of these compounds which have a negative formation energy are possible to be synthesized experimentally.

  12. 75 FR 69475 - Notice of Public Meeting

    Science.gov (United States)

    2010-11-12

    ... location are listed below: Date: Monday, November 15, 2010. Time: 7 p.m. to 10 p.m. Location: The Aiken Municipal Building Conference Center, 215 The Alley, Aiken, SC 29801, Phone: 803-642-7654. Draft Agenda: 7-7...

  13. Automatic symbolic analysis of SC networks using a modified nodal approach

    NARCIS (Netherlands)

    Zivkovic, V.A.; Petkovic, P.M.; Milanovic, D.P.

    1998-01-01

    This paper presents a symbolic analysis of Switched-Capacitor (SC) circuits in the z-domain using Modified Nodal Approach (MNA). We have selected the MNA method as one of the widely established approaches in circuit analysis. The analyses are performed using SymsimC symbolic simulator which also ena

  14. Thermography of semi-transparent materials by a FLIR ThermaCAM SC3000 infrared camera

    NARCIS (Netherlands)

    Van der Tempel, L.

    2011-01-01

    An acceptance test for thermography of semi-transparent materials by a FLIR ThermaCAM SC3000 infrared camera with 8.0 µm low-wavelength-pass filter has been developed and performed on polycarbonate, PEN, quartz, Corning 1737 glass, G427 cone glas, G443 screen glass, Schott Zerodur, silicon and a

  15. SC-FDE for MMF short reach optical interconnects using directly modulated 850 nm VCSELs

    DEFF Research Database (Denmark)

    Teichmann, Victor S. C.; Barreto, Andre N.; Pham, Tien Thang

    2012-01-01

    We propose the use of single-carrier frequency-domain equalization (SC-FDE) for the compensation of modal dispersion in short distance optical links using multimode fibers and 850 nm VCSELs. By post-processing of experimental data, we demonstrate, at 7.9% overhead, the error-free transmission (ov...

  16. Thermography of semi-transparent materials by a FLIR ThermaCAM SC3000 infrared camera

    NARCIS (Netherlands)

    Van der Tempel, L.

    2011-01-01

    An acceptance test for thermography of semi-transparent materials by a FLIR ThermaCAM SC3000 infrared camera with 8.0 µm low-wavelength-pass filter has been developed and performed on polycarbonate, PEN, quartz, Corning 1737 glass, G427 cone glas, G443 screen glass, Schott Zerodur, silicon and a bl

  17. Natural moisturizing factors (NMF) in the stratum corneum (SC). I. Effects of lipid extraction and soaking.

    Science.gov (United States)

    Robinson, Marisa; Visscher, Marty; Laruffa, Angela; Wickett, Randy

    2010-01-01

    Natural moisturizing factor (NMF) is essential for appropriate stratum corneum hydration, barrier homeostasis, desquamation, and plasticity. It is formed from filaggrin proteolysis to small, hygroscopic molecules including amino acids. We hypothesized that common lipid extraction and soaking in water would alter the level of NMF in the upper SC and its biophysical properties. A novel method of measuring and quantifying the amino acid components of NMF is presented. Adhesive tapes were used to collect samples of the stratum corneum (SC) and were extracted with 6mM perchloric acid for analysis by reverse-phase HPLC. HPLC results were standardized to the amount of protein removed by the tapes. An increase in NMF was found with increased SC depth. Also, the combination of extraction and soaking was found to increase NMF loss relative to control or to extraction or soaking alone. Our results indicate that common skin care practices significantly influence the water binding materials in the upper SC. The findings have implications for the evaluation and formulation of skin care products.

  18. Sc and neutron-capture abundances in Galactic low- and high-alpha field halo stars

    DEFF Research Database (Denmark)

    Fishlock, Cherie K.; Yong, D.; Karakas, Amanda I.

    2017-01-01

    We determine relative abundance ratios for the neutron-capture elements Zr, La, Ce, Nd and Eu for a sample of 27 Galactic dwarf stars with -1.5 <[Fe/H] <-0.8. We also measure the iron-peak element Sc. These stars separate into three populations (low-and high-a halo and thick-disc stars) based on ...

  19. Spatial Frequency Scheduling for Uplink SC-FDMA based Linearly Precoded LTE Multiuser MIMO Systems

    DEFF Research Database (Denmark)

    Lin, Zihuai; Xiao, Pei; Sørensen, Troels Bundgaard;

    2010-01-01

    This paper investigates the performance of the 3GPP Long Term Evolution (LTE) uplink Single Carrier (SC) Frequency Division Multiple Access (FDMA) based linearly precoded multiuserMultiple InputMultiple Output (MIMO) systems with frequency domain packet scheduling. A mathematical expression...

  20. Dynamics of self-directed learning in M.Sc. nursing students: A qualitative research

    Science.gov (United States)

    SHIRAZI, FATEMEH; SHARIF, FARKHONDEH; MOLAZEM, ZAHRA; ALBORZI, MAHBOOBEH

    2017-01-01

    Introduction: Working in the complex and ever changing healthcare settings forces the nurses and nursing students to be equipped with lifelong learning skills. One of the lifelong learning skills is self-directed learning. This study aimed to explore the M.Sc. nursing students’ self-directed learning activities. Methods: A qualitative design using conventional content analysis approach was used in this study. Semi-structured interviews were conducted with twelve Iranian M.Sc. nursing students who were selected using purposive sampling. Results: Data analysis indicated that the M.Sc. nursing students performed different activities in their self-directed learning. These activities were categorized into four main themes and ten subthemes. The main themes were “sensory perceptions”, “knowledge construction”, “problem-centered orientation”, and “interaction with others”. Conclusion: According to the findings, the M.Sc. nursing students performed different intellectual and experiential self-directed activities for promoting their learning. Besides, the students’ perseverance and inquisitiveness played an important role in their self-directed learning in the challenging clinical environments. PMID:28124019

  1. Texture and grain structure of Al-Li-Mg-Zr-Sc alloy sheets

    Energy Technology Data Exchange (ETDEWEB)

    Fridlyander, J.N.; Kolobnev, N.I.; Khokhlatova, L.B. [All-Russian Inst. of Aviation Mater., Moscow (Russian Federation); Berezina, A.L.; Katko, A.V.; Haszler, A.; Keidel, C.

    2000-07-01

    Change of a grain structure nature, of crystallographic texture and of a phase composition in dependence of thermal-mechanical parameters of sheets manufacture was shown with X-ray and electron-microscopic investigations of Al-Li-Mg-Zr-Sc sheets. (orig.)

  2. 75 FR 34170 - Plastic Omnium Automotive Exteriors, LLC, Anderson, SC; Plastic Omnium Automotive Exteriors, LLC...

    Science.gov (United States)

    2010-06-16

    ... Employment and Training Administration Plastic Omnium Automotive Exteriors, LLC, Anderson, SC; Plastic Omnium... Assistance on March 18, 2010, applicable to workers of Plastic Omnium Automotive Exteriors, LLC, Anderson... have occurred involving workers in support of the Anderson, South Carolina location of Plastic...

  3. Iron Store of Pregnant Women with Hemoglobin SS and SC in Benin ...

    African Journals Online (AJOL)

    The mean age, educational status, and the social class of both the test group and the control group were comparable. There was a ... Conclusion: This study demonstrated higher serum iron levels in Hb SS / SC pregnant women than in the ...

  4. Rheological Modeling with Hookean Bead-Spring Cubes (SC, BBC and FCC)

    NARCIS (Netherlands)

    Denneman, A.I.M.; Jongschaap, R.J.J.; Mellema, J.

    1998-01-01

    In this study a general bead-spring model is used for predicting some rheological properties of a cubic bead-spring structure of arbitrary size immersed in a Newtonian solvent. The topology of this bead-spring structure is based upon the well-known cubic crystals (SC, BCC or FCC) and it consists of

  5. Far infrared transmittance of Sc2@C84 and Er2@C82

    NARCIS (Netherlands)

    Grannan, S.M.; Birmingham, J.T.; Richards, P.L.; Bethune, D.S.; Vries, M.S. de; Loosdrecht, P.H.M. van; Dorn, H.C.; Burbank, P.; Bailey, J.; Stevenson, S.

    1997-01-01

    We have measured the far infrared transmittance of Sc2@C84 and Er2@C82 at 1.5 K between 30 and 200 cm-1. Both materials are observed to have a large primary absorption feature centered at 95 cm-1 with a width of approximately 50 cm-1, as well as a number of secondary absorption features which are di

  6. Final Report for Research supported by US DoE grant DE-SC0006721

    Energy Technology Data Exchange (ETDEWEB)

    Brizard, Alain J. [Saint Michael' s College

    2014-08-27

    A final report is presented on research carried out by Alain J. Brizard (Principal Investigator) with funding provided by the U.S. DoE grant No. DE-SC0006721 during the period of 08/01/2011 to 07/31/2014.

  7. High-performance Cr/Sc multilayers for the soft x-ray range

    Science.gov (United States)

    Yulin, Sergiy A.; Schaefers, Franz; Feigl, Torsten; Kaiser, Norbert

    2004-01-01

    Results of soft x-ray reflection measurements of Cr/Sc multilayer mirrors close to the Sc absorption edge at 3.11 nm are presented. Improvements in the deposition technology and the adjustment of the multilayer period with an accuracy of better than 0.01 nm to this absorption edge enabled a step forward towards soft x-ray mirrors with an adequate reflectance that allow the realization of normal incidence optical components in the water window. In particular, reflectivity measurements performed at the PTB reflectometer at BESSY II in Berlin revealed a reflectivity of R = 14.8% at an incidence angle of θ = 1.5° and R = 15.0% at θ = 5°. Simulation results show that the interface widths between the Cr and Sc nanolayers are less than 0.4 nm. The annealing effect in short-period Cr/Sc multilayers was studied in the temperature range from 50°C to 500°C by X-ray scattering and transmission electron microscopy. Structural and phase transformations and the corresponding changes of the optical properties are presented and discussed.

  8. Last 3 years of the SC-ISOLDE and move to PS-Booster

    CERN Document Server

    CERN. Geneva

    2014-01-01

    Thus in the years 1989 and 1990 a special effort was made to supply beam to as many research projects as possible, resulting in a record number of beam shifts from the ISOLDE separators. The collaboration even had to partially support the last year of SC running before the final shutdown in December 1990.

  9. Genome Sequence of Pantoea sp. Strain Sc 1, an Opportunistic Cotton Pathogen

    OpenAIRE

    Medrano, Enrique G.; Bell, Alois A.

    2012-01-01

    Pantoea is comprised of a broad spectrum of species, including plant pathogens. Here, we provide an annotated genome sequence of Pantoea sp. strain Sc 1, which was isolated from a diseased cotton boll. This research provides the first genome sequence of a bona fide Pantoea sp. insect-vectored cotton pathogen.

  10. 75 FR 67968 - Arkwright Dump Site, Spartanburg, Spartanburg County, SC; Notice of Settlement

    Science.gov (United States)

    2010-11-04

    ...] Arkwright Dump Site, Spartanburg, Spartanburg County, SC; Notice of Settlement AGENCY: Environmental... Dump Site located in Spartanburg, Spartanburg County, South Carolina for publication. DATES: The Agency..., identified by Docket ID No. EPA-RO4- SFUND-2010-0892 or Site name Arkwright Dump Site by one of the...

  11. CERN Technical Training 2004: New Short Course III (SC III) on Microsoft Outlook - Meetings and Delegation

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled session of the 3rd module will take place as follows: Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14:00-16:00) SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and she will be available some time after each session to answer specific questions, or provide further explanations following demand. The cost of attending any SC module on Outlook is 70.- CHF. The above session will be confirmed if there are enough participants, and the attendance costs will be lower in case of a full class. If you are interested in...

  12. Electronic Bands of ScC in the Region 620 - 720 NM

    Science.gov (United States)

    Chen, Chiao-Wei; Merer, Anthony; Hsu, Yen-Chu

    2016-06-01

    ScC molecules have been observed by laser-induced fluorescence, following the reaction of laser-ablated scandium metal with acetylene under supersonic jet-cooled conditions. Rotational analyses have been carried out for about 40 bands of Sc{}12C and Sc{}13C in the region 14000 - 16000 cm-1. Two lower states are found, with Ω = 3/2 and 5/2, indicating that the ground state is ^4Π_i or ^2Δ. As yet we cannot distinguish between these alternatives, but note that the ground state of the isoelectronic YC molecule is ^4Π_i. The ground state bond length in ScC is 1.95{}_5 Å, and the vibrational frequency is 712 cm-1. At least eight electronic transitions occur in the region studied, the majority obeying the selection rule ΔΩ = +1. Rotational perturbations are widespread, consistent with a high density of excited electronic states. B. Simard, P.A. Hackett and W.J. Balfour, Chem. Phys. Lett., 230, 103 (1994).

  13. 76 FR 9221 - Special Local Regulations; Patriot Challenge Kayak Race, Ashley River, Charleston, SC

    Science.gov (United States)

    2011-02-17

    ... SECURITY Coast Guard 33 CFR Part 100 RIN 1625-AA08 Special Local Regulations; Patriot Challenge Kayak Race... Guard is establishing special local regulations for the Patriot Challenge Kayak Race in Charleston, SC... this rule because the Coast Guard did not receive notice of the Patriot Challenge Kayak Race...

  14. 78 FR 21258 - Special Local Regulations; Patriot Challenge Kayak Race, Ashley River; Charleston, SC

    Science.gov (United States)

    2013-04-10

    ... SECURITY Coast Guard 33 CFR Part 100 RIN 1625-AA08 Special Local Regulations; Patriot Challenge Kayak Race... Guard is establishing a special local regulation for the Patriot Challenge Kayak Race in Charleston, SC... 13, 2013, the Patriot Challenge Kayak Race is scheduled to take place on the waters of the...

  15. Pressure-induced structural transformations in the molybdate Sc-2(MoO4)(3)

    DEFF Research Database (Denmark)

    Paraguassu, W.; Maczka, M.; Filho, A. G. Sonza

    2004-01-01

    . The crystal to amorphous transition is irreversible. Our results point out that the amorphization process in Sc-2(MoO4)(3) may be due to a kinetic hindrance of a phase transition rather than due to chemical decomposition effects as have been proposed to occur for some molybdates and tungstates....

  16. Response of SC704 maize hybrid seed production to planting pattern

    African Journals Online (AJOL)

    Mohammed Reza

    2012-05-08

    May 8, 2012 ... 1Safiabad Research Center, Dezful, Iran. 2Department of ... Key words: Planting pattern, seed produce, corn grain, S.C.704 hybrid. INTRODUCTION ... plants for light, moisture and food would decrease and plants will have a ...

  17. Electronic structure and physical properties of ScN in pressure: density-functional theory calculations

    Institute of Scientific and Technical Information of China (English)

    Guan Peng-Fei; Wang Chong-Yu; Yu Tao

    2008-01-01

    Local density functional is investigated by using the full-potential linearized augmented plane wave (FP-LAPW) method for ScN in the hexagonal structure and the rocksalt structure and for hexagonal structures linking a layered hexagonal phase with wurtzite structure along a homogeneous strain transition path. It is found that the wurtzite ScN is unstable and the layered hexagonal phase, labelled as ho, in which atoms are approximately fivefold coordinated,is metastable, and the rocksalt ScN is stable. The electronic structure, the physical properties of the intermediate structures and the energy band structure along the transition are presented. It is found that the band gaps change from 4.0 to 1.0eV continuously when c/a value varies from 1.68 to 1.26. It is noticeable that the study of ScN provides an opportunity to apply this kind of material (in wurtzite[h]-derived phase).

  18. Supercritical carbon dioxide (scCO(2)) induced gelatinization of potato starch

    NARCIS (Netherlands)

    Muljana, Henky; Picchioni, Francesco; Heeres, Hero J.; Janssen, Leon P. B. M.

    2009-01-01

    The degree of gelatinization (DG) of potato starch after treatment with scCO(2) Was investigated. A broad range of experimental conditions were applied, including variations in temperature (50-90 degrees C), pressure (0.1-25 MPa), and the starch water content (16.2-40% wt/wt). Changes in the DG were

  19. Dynamics of self-directed learning in M.Sc. nursing students: A qualitative research

    Directory of Open Access Journals (Sweden)

    FATEMEH SHIRAZI

    2017-01-01

    Full Text Available Introduction: Working in the complex and ever changing healthcare settings forces the nurses and nursing students to be equipped with lifelong learning skills. One of the lifelong learning skills is self-directed learning. This study aimed to explore the M.Sc. nursing students’ self-directed learning activities. Methods: A qualitative design using conventional content analysis approach was used in this study. Semi-structured interviews were conducted with twelve Iranian M.Sc. nursing students who were selected using purposive sampling. Results: Data analysis indicated that the M.Sc. nursing students performed different activities in their self-directed learning. These activities were categorized into four main themes and ten subthemes. The main themes were “sensory perceptions”, “knowledge construction”, “problem-centered orientation”, and “interaction with others”. Conclusion: According to the findings, the M.Sc. nursing students performed different intellectual and experiential self-directed activities for promoting their learning. Besides, the students’ perseverance and inquisitiveness played an important role in their self-directed learning in the challenging clinical environments.

  20. Two-photon excitation spectra of Cr3 :K2NaScF6

    Science.gov (United States)

    Bartram, R. H.; Wein, G. R.; Hamilton, D. S.; Sliwczuk, U.; Rinzler, A. G.

    Two-photon excitation (TPE) spectra of Cr3+:K2NaScF6 exhibit unexpected features including a forbidden transition, extended progressions, a split zero-phonon line and anomalous polarization anisotropy. These features are explained by departures from standard approximations.

  1. Genome sequence of Pantoea sp. strain Sc 1, an opportunistic cotton pathogen.

    Science.gov (United States)

    Medrano, Enrique G; Bell, Alois A

    2012-06-01

    Pantoea is comprised of a broad spectrum of species, including plant pathogens. Here, we provide an annotated genome sequence of Pantoea sp. strain Sc 1, which was isolated from a diseased cotton boll. This research provides the first genome sequence of a bona fide Pantoea sp. insect-vectored cotton pathogen.

  2. The SC3 hydrophobin self-assembles into a membrane with distinct mass transfer properties

    NARCIS (Netherlands)

    Wang, [No Value; Shi, FX; Wosten, HAB; Hektor, H; Poolman, B; Robillard, GT; Wang, X.; Shi, Fuxin; Wösten, H.A.B.

    Hydrophobins are a class of small proteins that fulfill a wide spectrum of functions in fungal growth and development. They do so by self-assembling into an amphipathic membrane at hydrophilic-hydrophobic interfaces. The SC3 hydrophobin of Schizophyllum commune is the best-studied hydrophobin. It

  3. 33 CFR 334.460 - Cooper River and tributaries at Charleston, SC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Cooper River and tributaries at... ARMY, DEPARTMENT OF DEFENSE DANGER ZONE AND RESTRICTED AREA REGULATIONS § 334.460 Cooper River and tributaries at Charleston, SC. (a) The areas: (1) That portion of the Cooper River beginning on the west...

  4. 33 CFR 334.470 - Cooper River and Charleston Harbor, S.C.; restricted areas.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Cooper River and Charleston....470 Cooper River and Charleston Harbor, S.C.; restricted areas. (a) The restricted areas. (1) Area No. 1 is that portion of the Cooper River beginning near the westerly shore north of Shipyard Creek...

  5. Dynamics of self-directed learning in M.Sc. nursing students: A qualitative research.

    Science.gov (United States)

    Shirazi, Fatemeh; Sharif, Farkhondeh; Molazem, Zahra; Alborzi, Mahboobeh

    2017-01-01

    Working in the complex and ever changing healthcare settings forces the nurses and nursing students to be equipped with lifelong learning skills. One of the lifelong learning skills is self-directed learning. This study aimed to explore the M.Sc. nursing students' self-directed learning activities. A qualitative design using conventional content analysis approach was used in this study. Semi-structured interviews were conducted with twelve Iranian M.Sc. nursing students who were selected using purposive sampling. Data analysis indicated that the M.Sc. nursing students performed different activities in their self-directed learning. These activities were categorized into four main themes and ten subthemes. The main themes were "sensory perceptions", "knowledge construction", "problem-centered orientation", and "interaction with others". According to the findings, the M.Sc. nursing students performed different intellectual and experiential self-directed activities for promoting their learning. Besides, the students' perseverance and inquisitiveness played an important role in their self-directed learning in the challenging clinical environments.

  6. Data of evolutionary structure change: 1A4SC-2ONNF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A4SC-2ONNF 1A4S 2ONN C F AQLVDSMPSASTGSVVVTDDLNYWGGRRIKSKDGATTEP...KVMEMSAK-TVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVG...ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEA...----- EEE EEEEEE HHHHHHHH EEEE HHHHHHHHHH EEE GGG EEE GGG EEEEEEEEE -- EVID>...hain> 2ONN F 2ONNF

  7. Self-assembly of the hydrophobin SC3 proceeds via two structural intermediates

    NARCIS (Netherlands)

    Vocht, Marcel L. de; Reviakine, Ilya; Ulrich, Wolf-Peter; Bergsma-Schutter, Wilma; Wösten, Han A.B.; Vogel, Horst; Brisson, Alain; Wessels, Joseph G.H.; Robillard, George T.

    2002-01-01

    Hydrophobins self assemble into amphipathic films at hydrophobic–hydrophilic interfaces. These proteins are involved in a broad range of processes in fungal development. We have studied the conformational changes that accompany the self-assembly of the hydrophobin SC3 with polarization-modulation in

  8. The Conundrum about the United Nations Security Council: A Guardian of Peace or Cause for Concern?

    Directory of Open Access Journals (Sweden)

    Berdal Aral

    2016-02-01

    Full Text Available This paper seeks to find out whether the United Nations Security Council (UN SC has been perfoming its primary task of safeguarding international peace and security effectively since the Cold War has become a matter of history. It argues that, contrary to expectations, the SC has failed to confront all credible threats to regional or international peace in a consistent and convincing manner which has dramatically diminished the reliability of this powerful UN body. This paper argues that the problem lies in the problematical structure of, and decision-making in, the SC and in its instrumentalisation at the hands of a handful of states seeking hegemony, inter alia, through this body. The Darfur and East Timor cases, taken up by the SC after the Cold War through a series of resolutions under Chapter VII of the UN Charter, are taken as test cases indicating the extent of politicisation in this organ.

  9. The Conundrum about the United Nations Security Council: A Guardian of Peace or Cause for Concern?

    Directory of Open Access Journals (Sweden)

    Berdal Aral

    2010-05-01

    Full Text Available This paper seeks to find out whether the United Nations Security Council (UN SC has been perfoming its primary task of safeguarding international peace and security effectively since the Cold War has become a matter of history. It argues that, contrary to expectations, the SC has failed to confront all credible threats to regional or international peace in a consistent and convincing manner which has dramatically diminished the reliability of this powerful UN body. This paper argues that the problem lies in the problematical structure of, and decision-making in, the SC and in its instrumentalisation at the hands of a handful of states seeking hegemony, inter alia, through this body. The Darfur and East Timor cases, taken up by the SC after the Cold War through a series of resolutions under Chapter VII of the UN Charter, are taken as test cases indicating the extent of politicisation in this organ.

  10. Recombinant norovirus-specific scFv inhibit virus-like particle binding to cellular ligands

    Directory of Open Access Journals (Sweden)

    Hardy Michele E

    2008-01-01

    Full Text Available Abstract Background Noroviruses cause epidemic outbreaks of gastrointestinal illness in all age-groups. The rapid onset and ease of person-to-person transmission suggest that inhibitors of the initial steps of virus binding to susceptible cells have value in limiting spread and outbreak persistence. We previously generated a monoclonal antibody (mAb 54.6 that blocks binding of recombinant norovirus-like particles (VLP to Caco-2 intestinal cells and inhibits VLP-mediated hemagglutination. In this study, we engineered the antigen binding domains of mAb 54.6 into a single chain variable fragment (scFv and tested whether these scFv could function as cell binding inhibitors, similar to the parent mAb. Results The scFv54.6 construct was engineered to encode the light (VL and heavy (VH variable domains of mAb 54.6 separated by a flexible peptide linker, and this recombinant protein was expressed in Pichia pastoris. Purified scFv54.6 recognized native VLPs by immunoblot, inhibited VLP-mediated hemagglutination, and blocked VLP binding to H carbohydrate antigen expressed on the surface of a CHO cell line stably transfected to express α 1,2-fucosyltransferase. Conclusion scFv54.6 retained the functional properties of the parent mAb with respect to inhibiting norovirus particle interactions with cells. With further engineering into a form deliverable to the gut mucosa, norovirus neutralizing antibodies represent a prophylactic strategy that would be valuable in outbreak settings.

  11. 2D-ELDOR using full Sc- fitting and absorption lineshapes

    Science.gov (United States)

    Chiang, Yun-Wei; Costa-Filho, Antonio; Freed, Jack H.

    2007-10-01

    Recent progress in developing 2D-ELDOR (2D electron-electron double resonance) techniques to better capture molecular dynamics in complex fluids, particularly in model and biological membranes, is reported. The new "full Sc- method", which corrects the spectral analysis for the phase distortion effects present in the experiments, is demonstrated to enhance the sensitivity of 2D-ELDOR in reporting on molecular dynamics in complex membrane environments. That is, instead of performing spectral fitting in the magnitude mode, our new method enables simultaneous fitting of both the real and imaginary components of the Sc- signal. The full Sc- fitting not only corrects the phase distortions in the experimental data but also more accurately determines instrumental dead times. The phase corrections applied to the Sc- spectrum enable the extraction of the pure absorption-mode spectrum, which is characterized by much better resolution than the magnitude-mode spectrum. In the absorption mode, the variation of homogeneous broadening, which reports on the dynamics of the spin probe, can even be observed by visual inspection. This new method is illustrated with results from model membranes of dipalmitoyl-sn-glycero-phosphatidylcholine (DPPC)-cholesterol binary mixtures, as well as with results from plasma membrane vesicles of mast cells. In addition to the dynamic parameters, which provide quantitative descriptions for membranes at the molecular level, the high-resolution absorption spectra themselves may be used as a "fingerprint" to characterize membrane phases and distinguish coexisting components in biomembranes. Thus we find that 2D-ELDOR is greatly improved with the new "full Sc- method" especially for exploring the complexity of model and biological membranes.

  12. 2D-ELDOR using full S(c-) fitting and absorption lineshapes.

    Science.gov (United States)

    Chiang, Yun-Wei; Costa-Filho, Antonio; Freed, Jack H

    2007-10-01

    Recent progress in developing 2D-ELDOR (2D electron-electron double resonance) techniques to better capture molecular dynamics in complex fluids, particularly in model and biological membranes, is reported. The new "full S(c-) method", which corrects the spectral analysis for the phase distortion effects present in the experiments, is demonstrated to enhance the sensitivity of 2D-ELDOR in reporting on molecular dynamics in complex membrane environments. That is, instead of performing spectral fitting in the magnitude mode, our new method enables simultaneous fitting of both the real and imaginary components of the S(c-) signal. The full S(c-) fitting not only corrects the phase distortions in the experimental data but also more accurately determines instrumental dead times. The phase corrections applied to the S(c-) spectrum enable the extraction of the pure absorption-mode spectrum, which is characterized by much better resolution than the magnitude-mode spectrum. In the absorption mode, the variation of homogeneous broadening, which reports on the dynamics of the spin probe, can even be observed by visual inspection. This new method is illustrated with results from model membranes of dipalmitoyl-sn-glycero-phosphatidylcholine (DPPC)-cholesterol binary mixtures, as well as with results from plasma membrane vesicles of mast cells. In addition to the dynamic parameters, which provide quantitative descriptions for membranes at the molecular level, the high-resolution absorption spectra themselves may be used as a "fingerprint" to characterize membrane phases and distinguish coexisting components in biomembranes. Thus we find that 2D-ELDOR is greatly improved with the new "full S(c-) method" especially for exploring the complexity of model and biological membranes.

  13. Structural, electrical and magnetic properties of Sc3+ doped Mn-Zn ferrite nanoparticles

    Science.gov (United States)

    Angadi, V. Jagdeesha; Choudhury, Leema; Sadhana, K.; Liu, Hsiang-Lin; Sandhya, R.; Matteppanavar, Shidaling; Rudraswamy, B.; Pattar, Vinayak; Anavekar, R. V.; Praveena, K.

    2017-02-01

    Sc3+ doped Mn0.5Zn0.5ScyFe2-yO4 (y=0.00, 0.01, 0.03 and 0.05) nanoparticles were synthesized by solution combustion method using mixture of fuels were reported for the first time. The mixture of fuels plays an important role in obtaining nano crystalline, single phase present without any heat treatment. X-ray diffraction (XRD) results confirm the formation of the single-phase ferrites which crystallize in cubic spinel structure. The Fourier transform infrared spectra (FTIR) exhibit two prominent bands around 360 cm-1 and 540 cm-1 which are characteristic feature of spinel ferrite. The transmission electron microscope (TEM) micrographs revealed the nanoparticles to be nearly spherical in shape and of fairly uniform size. The room temperature impedance spectra (IS) and vibrating sample magnetometry (VSM) measurements were carried out in order to study the effect of doping (Sc3+) on the characteristic properties of Mn-Zn ferrites. Further, the frequency dependent dielectric constant and dielectric loss were found to decrease with increasing multiple Sc3+ concentration. Nyquist plot in the complex impedance spectra suggest the existence of multiple electrical responses. Magnetic measurements reveals that saturation magnetization (Ms), remnant magnetization (Mr), magnetic moment (ηB) and magnetic particle size (Dm) increase with Sc3+ ion concentration up to x=0.03 and then decrease. The values of spin canting angle (αY-K) and the magnetic particle size (Dm) are found to be in the range of 68-75° and 10-19 nm respectively with Sc3+ concentration. The room temperature Mössbauer spectra were fitted with two sextets corresponding to ions at tetrahedral (A-) and octahedral (B-) sites confirms the spinel lattice. The ferromagnetic resonance (FMR) spectra's has shown that high concentration of scandium doping leads to an increase in dipolar interaction and decrease in super exchange interaction.

  14. Naked (C5Me5)(2)M cations (M = Sc, Ti, and V) and their fluoroarene complexes

    NARCIS (Netherlands)

    Bouwkamp, MW; Budzelaar, PHM; Gercama, J; Morales, ID; de Wolf, J; Meetsma, A; Troyanov, SI; Teuben, JH; Hessen, B; Budzelaar, Peter H.M.; Hierro Morales, Isabel Del; Troyanov, Sergei I.

    2005-01-01

    The ionic metallocene complexes [Cp*M-2][BPh4] (CP* = C5Me5) of the trivalent 3d metals Sc, Ti, and V were synthesized and structurally characterized. For M Sc, the anion interacts weakly with the metal center through one of the phenyl groups, but for M = Ti and V, the cations are naked. They each c

  15. Effect of minor Sc and Zr addition on microstructures and mechanical properties of Al-Zn-Mg-Cu alloys

    Institute of Scientific and Technical Information of China (English)

    ZOU Liang; PAN Qing-lin; HE Yun-bin; WANG Chang-zhen; LIANG Wen-jie

    2007-01-01

    Three kinds of Al-Zn-Mg-Cu based alloys with 0.22%, 0.36%(Sc+Zr) (mass fraction, %), and without Sc, Zr addition were prepared by ingot metallurgy. By using optical microscopy, transmission electronic microscopy and scanning electron microscopy, the effects of microalloying elements of Sc, Zr on the microstructure of super-high-strength Al-Zn-Mg-Cu alloys related to mechanical properties were investigated. The tensile properties and microstructures of the studied alloys under different heat treatment conditions were studied. The addition of minor Sc, Zr results in the formation of Al3(Sc,Zr) particles. These particles are highly effective in refining the microstructures, retarding recrystallization, pinning dislocations and subboundaries. The strength of Al-Zn-Mg-Cu alloys was greatly improved by simultaneously adding minor Sc, Zr, meanwhile the ductility of the studied alloys remains at a higher level. The 0.36%(Sc+Zr) alloys gain the optimal properties after 465 ℃/h solution and 120 ℃/24 h aging. The increment of strength is mainly due to strengthening of fine grain and substructure and precipitation of Al3(Sc, Zr) particles.

  16. SC1, an immunoglobulin-superfamily cell adhesion molecule, is involved in the brain metastatic activity of lung cancer cells

    Science.gov (United States)

    KUBOTA, YUKA; KIRIMURA, NAOKI; SHIBA, HATSUKI; ADACHI, KAZUHIDE; TSUKAMOTO, YASUHIRO

    2015-01-01

    SC1 is a cell adhesion molecule that belongs to the immunoglobulin superfamily; this molecule was initially purified from the chick embryonic nervous system and was reported to exhibit homophilic adhesion activity. SC1 is transiently expressed in various organs during development and has been identified in numerous neoplastic tissues, including lung cancer and colorectal carcinomas. The present study focused on the encephalic metastasis of lung cancer cells with respect to the potential function of SC1, as this molecule is known to be consistently expressed in the central nervous system as well as lung cancers. SC1 complementary DNA was introduced into A549 cells, a human lung cancer-derived cell line. The stable overexpression of the SC1 protein in A549 cells was demonstrated to enhance the self-aggregation of the cells. In addition, the SC1 transfectants enhanced the metastatic and invasive potential to the encephalic parenchyma following implantation into nude mice. In conclusion, the results of the present study demonstrated that cell adhesion due interactions between SC1 on brain tissue and SC1 on lung cancer cells was involved in the malignant aspects of lung cancer, including invasion and metastasis to the brain. PMID:26622821

  17. Curriculum (Study Programme) for the 3rd to 6th semester of the B.Sc., Medialogy, at Aalborg University

    DEFF Research Database (Denmark)

    Nordahl, Rolf; Serafin, Stefania; Lavatino, Salvatore

    2004-01-01

    Major revision of the original curriculum of the B.Sc., Medialogy. Significant changes (extensive restructuring) in comparison with the first version of the curriculum.......Major revision of the original curriculum of the B.Sc., Medialogy. Significant changes (extensive restructuring) in comparison with the first version of the curriculum....

  18. Identification of the Most Stable Sc2C80 Isomers: Structure, Electronic Property, and Molecular Spectra Investigations

    Institute of Scientific and Technical Information of China (English)

    吴静怡; 王太山; 舒春英; 吕鑫; 王春儒

    2012-01-01

    A systematic density functional theory investigation has been carried out to explore the possible structures of Sc2C80 at the BMK/6-31 G(d) level. The results clearly show that Sc2@C80-Ih, Sc2@Cso-Dsh, and Sc2C2@C78-C2v can be identified as three isomers of Sc2C80 metallofullerene with the lowest energy. Frontier molecular orbital analysis indicates that the two Sc2@C80 isomers have a charge state as (Sc〉)2@ C60 and the Sc2C2@C78 has a charge state of (Sc3+)2 C22- @ C784-. Moreover, the metal-cage covalent interactions have been studied to reveal the dynamics of endohedral moiety. The vertical electron affinity, vertical ionization potential, infrared spectra and 13C nuclear mag- netic resonance spectra have been also computed to further disclose the molecular structures and properties.

  19. Medialogi (Dansk informations brochure om Medialogi-uddannelsen, 1. til 10. semester (B.Sc. & Cand.Scient))

    DEFF Research Database (Denmark)

    Andersen, Hans Jørgen

    2006-01-01

    Informationsbrochure, 28 sider, om Medialogi uddannelsen (Cand. Scient.), der udbydes af Aalborg Universitet i Aalborg, Esbjerg og København. Brochuren beskriver 1. til 10. semester af uddannelsen (B.Sc. og M.Sc.). Informationen er primært rettet mod potentielle ansøgere til Medialogi uddannelsen...

  20. Medialogi (Dansk informations brochure om Medialogi-uddannelsen, 1. til 10. semester (B.Sc. & Cand.Scient))

    DEFF Research Database (Denmark)

    Andersen, Hans Jørgen

    2006-01-01

    Informationsbrochure, 28 sider, om Medialogi uddannelsen (Cand. Scient.), der udbydes af Aalborg Universitet i Aalborg, Esbjerg og København. Brochuren beskriver 1. til 10. semester af uddannelsen (B.Sc. og M.Sc.). Informationen er primært rettet mod potentielle ansøgere til Medialogi uddannelsen...

  1. Síndrome hemofagocítico y salmonelosis en un paciente con hemoglobinopatía SC Hemophagocytic syndrome and salmonellosis in a patient with SC hemoglobinipathy

    OpenAIRE

    Luis Fernando Pinto; Javier Molina; Francisco Cuellar; Amado Karduss

    1989-01-01

    Se informa el caso de un joven de 14 años con hemoglobinopatía SC que tuvo un síndrome hemofagocítico (SH) secundario a salmonelosis. Se discuten las características de este síndrome y su diagnóstico diferencial. Se hace énfasis en la importancia de considerarlo entre las posibilidades diagnósticas dada la frecuencia en Colombia de las infecciones que pueden desencadenarlo, a saber: tuberculosis, salmonelosis y ...

  2. 链霉菌SC120细胞毒活性代谢产物的研究%A CYTOTOXIC METABOLITE OF STREPTOMYCES SP. SC120

    Institute of Scientific and Technical Information of China (English)

    王继栋; 魏孝义; 朱西儒; 谢海辉; 陈贻竹

    2003-01-01

    在研究链霉菌Streptomyces sp. SC120抗荔枝霜疫霉菌活性代谢产物的过程中,分离得到一对人鼻咽癌细胞具有细胞毒作用的抗生素.通过UV、IR、HR-MS、1H-NMR、13C-NMR、DEPT、1H-1H COSY、HMQC、HMBC等波谱分析,鉴定其结构与Pimprinine相同.首次报道Pimprinine对人鼻咽癌细胞具有细胞毒作用.

  3. D2d(23)-C84 versus Sc2C2@D2d(23)-C84: Impact of Endohedral Sc2C2 Doping on Chemical Reactivity in the Photolysis of Diazirine.

    Science.gov (United States)

    Yamada, Michio; Tanabe, Yukiko; Dang, Jing-Shuang; Sato, Satoru; Mizorogi, Naomi; Hachiya, Makoto; Suzuki, Mitsuaki; Abe, Tsuneyuki; Kurihara, Hiroki; Maeda, Yutaka; Zhao, Xiang; Lian, Yongfu; Nagase, Shigeru; Akasaka, Takeshi

    2016-12-21

    We compared the chemical reactivity of D2d(23)-C84 and that of Sc2C2@D2d(23)-C84, both having the same carbon cage geometry, in the photolysis of 2-adamantane-2,3'-[3H]-diazirine, to clarify metal-atom doping effects on the chemical reactivity of the carbon cage. Experimental and computational studies have revealed that the chemical reactivity of the D2d(23)-C84 carbon cage is altered drastically by endohedral Sc2C2 doping. The reaction of empty D2d(23)-C84 with the diazirine under photoirradiation yields two adamantylidene (Ad) adducts. NMR spectroscopic studies revealed that the major Ad monoadduct (C84(Ad)-A) has a fulleroid structure and that the minor Ad monoadduct (C84(Ad)-B) has a methanofullerene structure. The latter was also characterized using X-ray crystallography. C84(Ad)-A is stable under photoirradiation, but it interconverted to C84(Ad)-B by heating at 80 °C. In contrast, the reaction of endohedral Sc2C2@D2d(23)-C84 with diazirine under photoirradiation affords four Ad monoadducts (Sc2C2@C84(Ad)-A, Sc2C2@C84(Ad)-B, Sc2C2@C84(Ad)-C, and Sc2C2@C84(Ad)-D). The structure of Sc2C2@C84(Ad)-C was characterized using X-ray crystallography. Thermal interconversion of Sc2C2@C84(Ad)-A and Sc2C2@C84(Ad)-B to Sc2C2@C84(Ad)-C was also observed. The reaction mechanisms of the Ad addition and thermal interconversion were elucidated from theoretical calculations. Calculation results suggest that C84(Ad)-B and Sc2C2@C84(Ad)-C are thermodynamically favorable products. Their different chemical reactivities derive from Sc2C2 doping, which raises the HOMO and LUMO levels of the D2d(23)-C84 carbon cage.

  4. Generation of a recombinant single-chain variable fragment (scFv) targeting 5-methyl-2'-deoxycytidine.

    Science.gov (United States)

    Ohshima, Motohiro; Tadakuma, Tomomi; Hayashi, Hideki; Inoue, Kazuyuki; Itoh, Kunihiko

    2010-01-01

    We generated a single-chain variable fragment (scFv) against 5-methyl-2'-deoxycytidine (m(5)dCyd) using phage display technology. The heavy and light chain variable region genes were amplified by the polymerase chain reaction (PCR) from hybridoma cell line FMC9 and assembled as an scFv fragment with a flexible linker (Gly(4)-Ser)(3). The scFv DNA fragment was then cloned into pCANTAB-5E, and a phage displaying the scFv was produced. Antigen-positive phage clones were successfully selected by enzyme-linked immunosorbent assay (ELISA). The scFv was modified with FLAG and His tags for detection and purification. The scFv reacted strongly with m(5)dCyd and weakly with 5-methylcytidine (m(5)Cyd) but not with cytidine (Cyd) and 1-methyladenosine in a manner similar to the monoclonal antibody (MoAb). Although the specificities of scFv and MoAb were almost identical, the sensitivity of the scFv (IC(50) 0.054 microg/ml) was approximately 80 times higher than that of the parent MoAb (IC(50) 4.27 microg/ml), determined by inhibition ELISA. As a biochemical application of this scFv, we quantified the m(5)dCyd content of genomic DNA by enzymatic hydrolysis using inhibition ELISA. The cancer cell lines HeLa, HeLa S3 and MDA-MB-453 contained approximately 1% of the methylated DNA in total genomic DNA, as did peripheral blood cell genomic DNA from healthy volunteers, but HT29 and T-47D showed hypomethylation compared with the HeLa, HeLa S3 and MDA-MB-453 cell lines. The scFv generated here may be applicable to the assessment of cellular DNA methylation levels and is more sensitive than the MoAb.

  5. Construction, Expression and In Vitro Biological Behaviors of Ig scFv Fragment in Patients with Chronic B Cell Leukemia

    Institute of Scientific and Technical Information of China (English)

    ZHU Lijuan; LIAO Wenjun; ZHU Huifen; LEI Ping; WANG Zhihua; SHAO Jingfang; ZHANG Yue; SHEN Guanxin

    2006-01-01

    The expression vector of SmIg scFv fragment was constructed in patient with B cell chronic lymphocyte leukemia (B-CLL) and expressed in E. coli to obtain scFv fragment, and the effect of the protein on the proliferation of stimulated peripheral blood mononuclear cells (PBMC) was investigated in vitro. Two pairs of primers were designed, and variable region genes of light chain and heavy chain were amplified by PCR respectively from the pGEM-T vectors previously constructed in our laboratory which containing light chain gene or Fd fragment of heavy chain gene. The PCR product was digested, purified and inserted into pHEN2 vector to construct the soluble expression vector pHEN2-scFv. After the induction by IPTG, the scFv protein was identified by SDSPAGE electrophoresis and purified by Ni-NTA-Chromatography. MTT was used to determine the effect of purified protein on the proliferation of stimulated PBMC in vitro. Plasmid PCR and restriction enzyme digestion of pHEN2-scFv revealed the pHEN2-scFv vector was constructed successfully. Id-scFv protein was expressed in positive clone after induced by IPTG. SDS-PAGE analysis showed that the relative molecular weight of fusion protein was about 30 kD (1 kD=0.9921 ku),which was consistent with the theoretically predicted value. Proliferation of PBMC could be induced by purified Id-scFv. It was suggested that the expression vector of SmIg scFv fragment was constructed successfully, and scFv protein was expressed and secreted from E. coli, which could induce proliferation of PBMC. This may lay an experimental foundation for further research of IdHSP complex vaccine for B-CLL.

  6. Pressure effect on electronic properties of Sc{sub 0.5}In{sub 0.5}N compound

    Energy Technology Data Exchange (ETDEWEB)

    Perez, William Lopez [Departamento de Fisica, Universidad del Norte, Barranquilla (Colombia); Rodriguez M., Jairo Arbey; Gonzalez, Rafael; Fajardo, Fabio [Departamento de Fisica, Universidad Nacional de Colombia, Bogota (Colombia); Mancera, Luis [Nachwuchsgruppe Theorie, University of Ulm (Germany)

    2009-03-15

    We have applied the full potential linearized augmented plane wave method (FP-LAPW) within the density functional theory to investigate the structural and electronic properties of the Sc{sub 0.5}In{sub 0.5}N compound in the wurtzite and sodium chloride structures. We have analyzed the relative stability of this ternary compound in the two studied phases. We found that the wurtzite structure is the most stable phase, with the minimum {proportional_to}0.14 eV/(unit cell) lower than in the sodium chloride phase. A phase transition from wurtzite to sodium chloride structure was observed, with transition pressure {proportional_to}1.9 GPa. Our results predict a direct semiconductor in wurtzite structure and an indirect semiconductor in sodium chloride phase. We investigate the pressure effect on the electronic properties of this ternary compound in the two phases studied. (copyright 2009 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  7. Dangerous waste incineration and its impact on air quality. Case study: the incinerator SC Mondeco SRL Suceava

    Directory of Open Access Journals (Sweden)

    Dumitru MIHĂILĂ

    2015-03-01

    Full Text Available Dangerous waste, such as oil residues, pesticides, lacquers, stains, glues, organic solvents, hospital and food industry residues represent a major risk for all components of the environment (water, air, earth, soil, flora, fauna, people as well. Consequently, their incineration with high-performance burning installations lessens the impact on the environment, especially on the air quality, and it gives the possibility to recuperate the warmth of the incineration. This research presents a representative technique of incineration of dangerous waste at S.C. Mondeco S.R.L. Suceava, which runs according to the European standards, located in the industrial zone of Suceava, on the Suceava river valley Suceava. Also it is analysed the impact of this unit on the quality of nearby air. Moreover, not only the concentrations of gases and powders during the action of the incineration process (paramaters that are continuously monitored by highly methods are analysed, but also here are described the dispersions of those pollutants in the air, taking into account the characteristics of the source and the meteorological parametres that are in the riverbed. 

  8. Fungicide rotation schemes for managing Phytophthora fruit rot of watermelon across Southeastern United States (NC, SC, and GA)

    Science.gov (United States)

    Phytophthora capsici has been documented as a pathogen on a wide variety of vegetable crops in the family Solanaceae, Cucurbitaceae, Fabaceae, and plants belonging to 23 other families. Phytophthora fruit rot of watermelons caused by P. capsici is particularly severe in southeastern U.S where optima...

  9. Síndrome hemofagocítico y salmonelosis en un paciente con hemoglobinopatía SC Hemophagocytic syndrome and salmonellosis in a patient with SC hemoglobinipathy

    Directory of Open Access Journals (Sweden)

    Luis Fernando Pinto

    1989-02-01

    Full Text Available

    Se informa el caso de un joven de 14 años con hemoglobinopatía SC que tuvo un síndrome hemofagocítico (SH secundario a salmonelosis. Se discuten las características de este síndrome y su diagnóstico diferencial. Se hace énfasis en la importancia de considerarlo entre las posibilidades diagnósticas dada la frecuencia en Colombia de las infecciones que pueden desencadenarlo, a saber: tuberculosis, salmonelosis y leishmaniasis.

    We report a case of hemophagocytlc syndrome occurrlng In a 14 year old boy with SC hemoglobinopathy and salmonellosis; the clinical features of the syndrome are discussed; the need to consider this syndrome In the differential diagnosis is emphazised, since several of the infections that may lead to It- tuberculosis, salmonellosis, lelsmaniasis. are frequently found in colombian patients

  10. Performance analysis of combined transmit SC/Receive MRC in Nakagami fading channels%Nakagami衰落信道上组合SC/MRC的性能分析

    Institute of Scientific and Technical Information of China (English)

    李光球

    2007-01-01

    研究Nakagami衰落信道上组合发射机选择合并(SC)/接收机最大比合并(MRC)天线分集系统的性能.使用矩生成函数方法,推导采用组合SC/MRC天线分集和相干检测的MPSK(M进制相移键控)、MQAM(M进制正交幅度调制)、MPAM(M进制脉冲幅度调制)、BFSK(二进制频移键控)、最小相关BFSK(BFSKmin)、差分编码BPSK(DE-BPSK)和预编码MSK(最小频移键控)等几种M进制数字调制方式在Nakagami衰落信道上的误符号率性能,获得了M进制数字调制系统误符号率性能的精确数学表达式.数值计算结果阐明了发射天线和接收天线数目以及衰落参数对数字调制系统误符号率性能的影响.

  11. Generating Units

    Data.gov (United States)

    Department of Homeland Security — Generating Units are any combination of physically connected generators, reactors, boilers, combustion turbines, and other prime movers operated together to produce...

  12. Hydroxyurea decreases hospitalizations in pediatric patients with Hb SC and Hb SB+ thalassemia

    Directory of Open Access Journals (Sweden)

    Lebensburger JD

    2015-12-01

    Full Text Available Jeffrey D Lebensburger, Rakeshkumar J Patel, Prasannalaxmi Palabindela, Christina J Bemrich-Stolz, Thomas H Howard, Lee M HilliardDivision of Pediatric Hematology Oncology, University of Alabama at Birmingham, Birmingham, AL, USAPurpose: Patients with hemoglobin SC (Hb SC and hemoglobin SB+ (Hb SB+ thalassemia suffer from frequent hospitalizations yet strong evidence of a clinical benefit of hydroxyurea (HU in this population is lacking. Patients with recurrent hospitalizations for pain crisis are offered HU at our institution based on small cohort data and anecdotal benefit. This study identifies outcomes from a large cohort of patients with Hb SC and SB+ thalassemia who were treated with HU for 2 years.Materials and methods: A retrospective review was conducted of 32 patients with Hb SC and SB+ thalassemia who were treated with HU. We reviewed the number, and reasons for hospitalization in the 2 years prior to, and 2 years post-HU treatment as well as laboratory changes from baseline, over 1 year.Results: Patients with Hb SC and SB+ thalassemia started on HU for frequent pain, had a significant reduction in hospitalizations over 2 years as compared to the 2 years prior to HU initiation (mean total hospitalizations/year: pre-HU: 1.6 vs post-HU 0.4 hospitalizations, P<0.001; mean pain hospitalizations/year: pre-HU 1.5 vs post-HU 0.3 hospitalizations, P<0.001. Patients demonstrated hematologic changes including an increase in percent fetal hemoglobin (%HbF pre–post HU (4.5% to 7.7%, P=0.002, mean corpuscular volume (74 to 86 fL, P<0,0001, and decrease in absolute neutrophil count (5.0 to 3.2×109/L, P=0.007. Patients with higher doses of HU demonstrated the greatest reduction in hospitalizations but this was unrelated to absolute neutrophil count.Conclusion: This cohort of patients with Hb SC and SB+ thalassemia provides additional support for using HU in patients with recurrent hospitalizations for pain. A large randomized multicenter trial of

  13. Investigation on Mg and Sc co-doped Ceria electrolyte for IT-SOFC

    Directory of Open Access Journals (Sweden)

    P.Ravi Chandran

    2014-07-01

    Full Text Available Nanocrystalline form of pure ceria (CeO2 and metal (Mg or Sc doped ceria was attempted for 10 mol %. Also, Mg and Sc co-doped ceria with Ce1-x(Mg0.5Sc0.5xO2 (x=0-0.24 was prepared as an electrolyte for intermediate temperature solid oxide fuel cells (IT-SOFCs by co-precipitation method. The synthesized different compositions of pure and doped nanocrystalline powders were then subjected to powder X-ray diffraction (XRD for phase and structural identification. All the nanocrystalline samples were found to be ceria based solid solutions of fluorite type structures. A.C. impedance spectroscopy measurements in the frequency range of 50Hz to 5MHz was carried out to study the grain, grain boundary and ionic conductivity of doped ceria samples in the temperature range of 400-600oC. The sample Ce0.84(Mg0.5Sc0.50.16O2 composition showed highest ionic conductivity i.e., 1.923 x 10-2 S/cm at 500oC. Its morphology and composition was investigated using scanning electron microscopic analysis (SEM and energy dispersive X-ray spectrometry (EDS and conductivity behavior was compared with those of pure ceria and singly doped ceria electrolytes namely Ce0.9Mg0.1O2 and Ce0.9Sc0.1O2. The impedance analysis reveals that the sample Ce0.9Mg0.1O2 was found to have higher ionic conductivity compared to Ce0.9Sc0.1O2 in the temperature range of 400–600°C. The co-doped ceria showed a much higher conductivity in air at 500oC in comparison to that of singly doped ceria. Therefore, these co-doped ceria are also the more ideal electrolyte materials for IT-SOFCs. Nyquist plot shows the major contributions were due to the grain boundary resistance contributions which accounts for the higher ionic conductivity in case of the dopants. These dopant effect on the ceria is discussed in detail.

  14. L-Arginine ethylester enhances in vitro amplification of PrP(Sc) in macaques with atypical L-type bovine spongiform encephalopathy and enables presymptomatic detection of PrP(Sc) in the bodily fluids.

    Science.gov (United States)

    Murayama, Y; Ono, F; Shimozaki, N; Shibata, H

    2016-02-12

    Protease-resistant, misfolded isoforms (PrP(Sc)) of a normal cellular prion protein (PrP(C)) in the bodily fluids, including blood, urine, and saliva, are expected to be useful diagnostic markers of prion diseases, and nonhuman primate models are suited for performing valid diagnostic tests for human Creutzfeldt-Jakob disease (CJD). We developed an effective amplification method for PrP(Sc) derived from macaques infected with the atypical L-type bovine spongiform encephalopathy (L-BSE) prion by using mouse brain homogenate as a substrate in the presence of polyanions and L-arginine ethylester. This method was highly sensitive and detected PrP(Sc) in infected brain homogenate diluted up to 10(10) by sequential amplification. This method in combination with PrP(Sc) precipitation by sodium phosphotungstic acid is capable of amplifying very small amounts of PrP(Sc) contained in the cerebrospinal fluid (CSF), saliva, urine, and plasma of macaques that have been intracerebrally inoculated with the L-BSE prion. Furthermore, PrP(Sc) was detectable in the saliva or urine samples as well as CSF samples obtained at the preclinical phases of the disease. Thus, our novel method may be useful for furthering the understanding of bodily fluid leakage of PrP(Sc) in nonhuman primate models.

  15. Surface morphological changes and magnetic properties of Sc-substituted Y{sub 3}Fe{sub 5}O{sub 12} epitaxial films deposited on the GGG substrate

    Energy Technology Data Exchange (ETDEWEB)

    Syvorotka, I.I.; Syvorotka, I.M. [R and D Institute for Materials, SRC ' Carat' , Stryjska 202, Lviv (Ukraine); Kityk, I.V., E-mail: ikityk@el.pcz.czest.p [Institute of Physics, King Saud University, Riyadh, Saudi Arbia (Saudi Arabia)

    2010-11-15

    Sc-doped YIG films were grown on (1 1 1) oriented GGG crystalline substrate with disorientation angle within the range 0-25'. Sc{sup 3+} ion substitution was varied within the range 0.25-0.3 per formula unit. The films demonstrate different types of surface morphology versus film growth rate and substrate disorientation. Conditions for existence of these types of the surface morphology were defined. The field dependence of magnetic susceptibility at magnetization reversal in film plane and Faraday rotation at wavelength 633 nm for a magnetic field applied in perpendicular direction were measured to characterize the films grown. Films with 'mirror-like' surface demonstrate a planar magnetization at room temperature.

  16. Aptamers, antibody scFv, and antibody Fab' fragments: An overview and comparison of three of the most versatile biosensor biorecognition elements.

    Science.gov (United States)

    Crivianu-Gaita, Victor; Thompson, Michael

    2016-11-15

    The choice of biosensing elements is crucial for the development of the optimal biosensor. Three of the most versatile biosensing elements are antibody single-chain Fv fragments (scFv), antibody fragment-antigen binding (Fab') units, and aptamers. This article provides an overview of these three biorecognition elements with respects to their synthesis/engineering, various immobilization techniques, and examples of their use in biosensors. Furthermore, the final section of the review compares and contrasts their characteristics (time/cost of development, ease and variability of immobilization, affinity, stability) illustrating their advantages and disadvantages. Overall, scFv fragments are found to display the highest customizability (i.e. addition of functional groups, immobilizing peptides, etc.) due to recombinant synthesis techniques. If time and cost are an issue in the development of the biosensor, Fab' fragments should be chosen as they are relatively cheap and can be developed quickly from whole antibodies (several days). However, if there are sufficient funds and time is not a factor, aptamers should be utilized as they display the greatest affinity towards their target analytes and are extremely stable (excellent biosensor regenerability).

  17. Establishment of minimum operational parameters for a high-volume static chamber steam pasteurization system (SPS 400-SC) for beef carcasses to support HACCP programs.

    Science.gov (United States)

    Retzlaff, Deanna; Phebus, Randall; Kastner, Curtis; Marsden, James

    2005-01-01

    A static chamber steam pasteurization unit (SPS 400-SC()) was installed in a high-volume commercial beef slaughter facility. The SPS 400-SC consists of a three-phase carcass treatment cycle of water removal, steam pasteurization, and water chilling. Seven chamber temperatures (71.1, 73.9, 76.7, 79.4, 82.2, 85.0, and 87.8 degrees C) were evaluated at the midline area of pre-rigor beef carcasses. For each temperature evaluated, 20 carcass sides were randomly selected and aseptically sampled by tissue excision immediately before and after steam pasteurization to determine total aerobic bacteria, Enterobacteriaceae, generic E. coli, and total coliform populations. The 87.8 and 85.0 degrees C treatment temperatures were highly effective at reducing total aerobic bacterial populations, with log(10) reductions of 1.4 and 1.5 CFU/cm(2), respectively, from pretreatment mean population levels of 1.7 and 1.9 log10 CFU/cm(2). These temperatures also reduced Enterobacteriaceae, total coliforms, and generic E. coli to undetectable levels (HACCP)-based system employing steam pasteurization of carcasses as a critical control point, a critical limit of 85.0 degrees C as a minimum chamber temperature should be established, with a targeted operating temperature of 87.8 degrees C providing optimum antimicrobial activity.

  18. In-situ high-pressure X-ray diffraction on the Zn{sub 6}Sc 1/1 periodic cubic approximant to a quasicrystal

    Energy Technology Data Exchange (ETDEWEB)

    Yamada, Tsunetomo; Boissieu, Marc de [Tokyo University of Science, Noda (Japan). Dept. of Materials Science and Technology; Grenoble-INP, CNRS, UJF, St Martin d' Heres (France). Sciences et Ingeenierie des Materiaux et Procees; Garbarino, Gaston [European Synchrotron Radiation Facility (ESRF), Grenoble (France); Takakura, Hiroyuki [Hokkaido Univ., Sapporo (Japan). Div. of Applied Physics; Pay Gomez, Cesar [Uppsala Univ. (Sweden). Dept. of Chemistry; Tamura, Ryuji [Tokyo University of Science, Noda (Japan). Dept. of Materials Science and Technology

    2014-04-01

    The Zn{sub 6}Sc 1/1 cubic approximant to a quasicrystal has been studied in-situ at high pressures by single-crystal X-ray diffraction. This phase can be described as a bcc packing of Tsai-type icosahedral clusters whose center is occupied by a disordered Zn{sub 4} tetrahedron. At ambient pressure the Zn{sub 6}Sc undergoes a structural phase transition at 159 K to a monoclinic superstructure in which the Zn{sub 4} tetrahedra are orientationally ordered along the direction of the high-temperature bcc phase. In the pressure range up to 35 GPa, two new superstructures have been observed. The second phase corresponds to a four-fold pseudo cubic superstructure, i.e. a very large unit cell with a lattice parameter of about 5.5 nm. The resulting pressure-temperature phase diagram is different from that of Cd{sub 6}Yb, which was reported by Watanuki et al. (2006). (orig.)

  19. UNIT, TIBET.

    Science.gov (United States)

    Louisiana Arts and Science Center, Baton Rouge.

    THE UNIT OF STUDY DESCRIBED IN THIS BOOKLET DEALS WITH THE GEOGRAPHY AND HISTORY OF TIBET. THE UNIT COVERS SOME OF THE GENERAL FEATURES OF THE COUNTRY AND THEIR EFFECT UPON THE LIVES OF THE TIBETAN PEOPLE. DISCUSSION QUESTIONS ARE INSERTED TO STIMULATE THOUGHT. THE RELIGION OF TIBET IS DISCUSSED IN RELATION TO ITS INFLUENCE ON THE ART AND CULTURE…

  20. Pressure-induced phase transition for ScVO{sub 4}: A first-principles study

    Energy Technology Data Exchange (ETDEWEB)

    Sheng, Shu-Fang, E-mail: shengshf@gmail.com [School of Physical Science and Information Engineering, Liaocheng University, Liaocheng 252059 (China); Shandong Provincial Key Laboratory of Optical Communication Science and Technology, Liaocheng 252059 (China)

    2013-10-01

    We theoretically investigated the structural stability and electronic properties of ScVO{sub 4} by the first-principles pseudopotential method. The tetragonal zircon-type and scheelite-type structures, LaTaO{sub 4}-type structure of ScVO{sub 4} have been considered. The calculations indicate that the LaTaO{sub 4}-type phase is not stable in the pressure 0–100 GPa, and the structural phase transformation from zircon to scheelite-type structure occurs at 5.4 GPa. The band structure shows that zircon-type structure at zero pressure and scheelite-type structure at transition pressure have direct gaps of 2.58 eV and 2.35 eV, respectively. The detailed volume changes during the phase transition were analyzed.

  1. Anomalously high thermoelectric power factor in epitaxial ScN thin films

    DEFF Research Database (Denmark)

    Kerdsongpanya, Sit; Van Nong, Ngo; Pryds, Nini;

    2011-01-01

    Thermoelectric properties of ScN thin films grown by reactive magnetron sputtering on Al2O3(0001) wafers are reported. X-ray diffraction and elastic recoil detection analyses show that the composition of the films is close to stoichiometry with trace amounts (∼1 at. % in total) of C, O, and F. We...... found that the ScN thin-film exhibits a rather low electrical resistivity of ∼2.94 μΩm, while its Seebeck coefficient is approximately ∼−86 μV/K at 800 K, yielding a power factor of ∼2.5 × 10−3 W/mK2. This value is anomalously high for common transition-metal nitrides. © 2011 American Institute...

  2. Magnetoelectric coupling in the type-I multiferroic ScFeO3

    Science.gov (United States)

    Giovannetti, G.; Puggioni, D.; Barone, P.; Picozzi, S.; Rondinelli, J. M.; Capone, M.

    2016-11-01

    We investigate the electronic structure and the ferroelectric properties of the recently discovered multiferroic ScFeO3 by means of ab initio calculations. The 3 d manifold of Fe in the half-filled configuration naturally favors an antiferromagnetic ordering, with a theoretical estimate of the antiferromagnetic Néel temperature in good agreement with the experimental values. We find that the inversion symmetry breaking is driven by the off-centering of Sc atoms, which results in a large ferroelectric polarization of ˜105 μ C /cm2. Surprisingly the ferroelectric polarization is sensitive to the local magnetization of the Fe atoms resulting in a large negative magnetoelectric interaction. This behavior is unexpected in type-I multiferroic materials because the magnetic and ferroelectric orders are of different origins.

  3. A Differential MIMO SC-FDE Transceiver Design over Multipath Fast Fading Channels

    Science.gov (United States)

    Deng, Juinn-Horng; Hwang, Jeng-Kuang

    In this paper, we propose a new differential MIMO single-carrier system with frequency-domain equalization (SC-FDE) aided by the insertion of cyclic prefix. This block transmission system not only inherits all the merits of the SISO SC-FDE system, but is also equipped with a differential space-time block coding (DSTBC) such as to combat the fast-changing frequency selective fading channels without the needs to estimate and then compensate the channel effects. Hence, for practical applications, it has the additional merits of decoding simplicity and robustness against high mobility transmission environments. Computer simulations show that the proposed system can provide diversity benefit as the non-differential system does, while greatly reducing the receiver complexity.

  4. Extinction in SC galaxies - an analysis of the ESO-LV data

    Science.gov (United States)

    Huizinga, J. E.; van Albada, T. S.

    1992-02-01

    The surface photometry of Sc galaxies in the ESO-LV database in view of recent claims by Valentijn that spiral galaxies are opaque over their entire disks is analyzed. Using diameter-limited and magnitude-limited subsamples, it can discriminate between the opaque and transparent cases with the axis-ratio distribution test. Results support the traditional view that Sc galaxies are semitransparent, but the brightness difference between face-on and edge-on can be as large as 1.0 to 1.5 mag. Analyzing surface-brightness profiles at various radii, it is seen that the central regions are essentially opaque, and the outer regions nearly fully transparent. It is shown that conclusions differ from those of Valentijn, because of neglect to take secondary inclination effects into account.

  5. Anomalously high thermoelectric power factor in epitaxial ScN thin films

    Energy Technology Data Exchange (ETDEWEB)

    Kerdsongpanya, Sit; Zukauskaite, Agne; Jensen, Jens; Birch, Jens; Lu Jun; Hultman, Lars; Wingqvist, Gunilla; Eklund, Per [Thin Film Physics Division, Department of Physics, Chemistry, and Biology (IFM), Linkoeping University, SE-581 83 Linkoeping (Sweden); Van Nong, Ngo; Pryds, Nini [Fuel Cells and Solid State Chemistry Division, Risoe National Laboratory for Sustainable Energy, Technical University of Denmark, DK-4000 Roskilde (Denmark)

    2011-12-05

    Thermoelectric properties of ScN thin films grown by reactive magnetron sputtering on Al{sub 2}O{sub 3}(0001) wafers are reported. X-ray diffraction and elastic recoil detection analyses show that the composition of the films is close to stoichiometry with trace amounts ({approx}1 at. % in total) of C, O, and F. We found that the ScN thin-film exhibits a rather low electrical resistivity of {approx}2.94 {mu}{Omega}m, while its Seebeck coefficient is approximately {approx}-86 {mu}V/K at 800 K, yielding a power factor of {approx}2.5 x 10{sup -3} W/mK{sup 2}. This value is anomalously high for common transition-metal nitrides.

  6. Special Issue: SC13 – The International Conference for High Performance Computing, Networking, Storage and Analysis

    Directory of Open Access Journals (Sweden)

    William Gropp

    2014-01-01

    Full Text Available The technical papers program for SC13 received 449 submissions of which 90 where selected for the program giving an acceptance rate of 20%. A rigorous peer review process, including author rebuttals and a 1.5 day face-to-face program committee meeting ensured that selected papers were the very best in our field. One of the tasks at the face-to-face meeting was also to select finalists for the best paper award, from which one is selected by a committee during the conference. To further highlight their achievement of being selected as the very top tier of all the submitted papers to SC13, the authors of these finalist papers were offered the opportunity to publish extended versions of their papers in this special issue journal; all eight authors accepted.

  7. Structural characterization and ytterbium spectroscopy in Sc{sub 2}O{sub 3} nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Galceran, M. [Fisica i Cristal.lografia de Materials i Nanomaterials (FiCMA-FiCNA), Universitat Rovira i Virgili (URV), Campus Sescelades, c/ Marcel. li Domingo, s/n, E-43007 Tarragona (Spain); Pujol, M.C., E-mail: mariacinta.pujol@urv.ca [Fisica i Cristal.lografia de Materials i Nanomaterials (FiCMA-FiCNA), Universitat Rovira i Virgili (URV), Campus Sescelades, c/ Marcel. li Domingo, s/n, E-43007 Tarragona (Spain); Carvajal, J.J.; Mateos, X. [Fisica i Cristal.lografia de Materials i Nanomaterials (FiCMA-FiCNA), Universitat Rovira i Virgili (URV), Campus Sescelades, c/ Marcel. li Domingo, s/n, E-43007 Tarragona (Spain); Zaldo, C. [Instituto de Ciencia de Materiales de Madrid (ICMM), Consejo Superior de Investigaciones Cientificas (CSIC), c/ Sor Juana Ines de la Cruz 3, E-28049 Madrid (Spain); Aguilo, M.; Diaz, F. [Fisica i Cristal.lografia de Materials i Nanomaterials (FiCMA-FiCNA), Universitat Rovira i Virgili (URV), Campus Sescelades, c/ Marcel. li Domingo, s/n, E-43007 Tarragona (Spain)

    2010-08-15

    Ytterbium-doped scandium oxide nanocrystals measuring less than 25 nm with compositions of Sc{sub 2-x}Yb{sub x}O{sub 3} (x=0.001-1) were prepared using the modified Pechini method. The Yb:Sc{sub 2}O{sub 3} nanocrystals were obtained by calcination at low temperature such as 1073 K for 2 h. X-ray powder diffraction (XRD) and transmission electronic microscopy (TEM) were used to perform the structural characterization of nanocrystals; these studies indicated that the nanocrystals have high crystalline quality with cubic structure and Ia3-bar space group. The morphology and particle size were studied using electron microscopy. A detailed study of the effect of the nanodimension and the ytterbium concentration on the spectroscopic characteristics of Yb{sup 3+} as an active ion was carried out in terms of optical absorption, optical emission and fluorescence decay time at room and low temperature.

  8. Generation and Characterization of an scFv Directed against Site II of Rabies Glycoprotein

    Directory of Open Access Journals (Sweden)

    Shukra M. Aavula

    2011-01-01

    Full Text Available Recombinant antibody phage display technology is a vital tool that facilitates identification of specific binding molecules to a target enabling the rapid generation and selection of high affinity, fully human, or mouse antibody product candidates essentially directed towards disease target appropriate for antibody therapy. In this study, a recombinant single-chain Fv antibody fragment (scFv A11 was isolated from immune spleen cells obtained from mice immunized with inactivated rabies virus (Pasteur strain using standard methodology and was characterized for its specificity towards the rabies virus glycoprotein. Epitope mapping using peptide libraries and truncated glycoprotein polypeptides suggested that A11 bound to the antigenic site II of rabies glycoprotein against which a majority of rabies virus neutralizing antibodies are directed. The use of the above technology could, therefore, allow development of scFvs with different specificities against the rabies glycoprotein as an alternative to the more cumbersome protocols used for the development of monoclonal antibodies.

  9. Atomic physics modeling of transmission spectra of Sc-doped aerogel foams to support OMEGA experiments

    Science.gov (United States)

    Johns, H. M.; Lanier, N. E.; Kline, J. L.; Fontes, C. J.; Perry, T. S.; Fryer, C. L.; Brown, C. R. D.; Morton, J. W.; Hager, J. D.; Sherrill, M. E.

    2016-11-01

    We present synthetic transmission spectra generated with PrismSPECT utilizing both the ATBASE model and the Los Alamos opacity library (OPLIB) to evaluate whether an alternative choice in atomic data will impact modeling of experimental data from radiation transport experiments using Sc-doped aerogel foams (ScSi6O12 at 75 mg/cm3 density). We have determined that in the 50-200 eV Te range there is a significant difference in the 1s-3p spectra, especially below 100 eV, and for Te = 200 eV above 5000 eV in photon energy. Examining synthetic spectra generated using OPLIB with 300 resolving power reveals spectral sensitivity to Te changes of ˜3 eV.

  10. mini Style 松下直板手机SC3评测

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    松下2005年最拉风的产品莫过于6系列和7系列的折叠机.屏幕清晰靓丽.可谓出尽风头。同时.松下还发布了两款低端直板手机.使得产品线更趋丰富,A210和SC3造型小巧到极至.一规矩方正一可爱圆润.是非常不错的学生机。尽管上市有些时日.仍得到用户关注.其中SC3更是得到师哥靓妹的青睐。

  11. Spectroscopy of the odd-odd fp-shell nucleus 52Sc from secondary fragmentation

    CERN Document Server

    Gade, A; Brown, B A; Campbell, C M; Carpenter, M P; Cook, J M; Deacon, A N; Dinca, D C; Freeman, S J; Glasmacher, T; Janssens, R V F; Kay, B P; Mantica, P F; Müller, W F; Terry, J R; Zhu, S

    2006-01-01

    The odd-odd fp-shell nucleus 52Sc was investigated using in-beam gamma-ray spectroscopy following secondary fragmentation of a 55V and 57Cr cocktail beam. Aside from the known gamma-ray transition at 674(5)keV, a new decay at E_gamma=212(3) keV was observed. It is attributed to the depopulation of a low-lying excited level. This new state is discussed in the framework of shell-model calculations with the GXPF1, GXPF1A, and KB3G effective interactions. These calculations are found to be fairly robust for the low-lying level scheme of 52Sc irrespective of the choice of the effective interaction. In addition, the frequency of spin values predicted by the shell model is successfully modeled by a spin distribution formulated in a statistical approach with an empirical, energy-independent spin-cutoff parameter.

  12. Fatigue Performance of Friction-Stir-Welded Al-Mg-Sc Alloy

    Science.gov (United States)

    Zhemchuzhnikova, Daria; Mironov, Sergey; Kaibyshev, Rustam

    2017-01-01

    Fatigue behavior of a friction-stir-welded Al-Mg-Sc alloy was examined in cast and hot-rolled conditions. In both cases, the joints failed in the base material region and therefore the joint efficiency was 100 pct. The specimens machined entirely from the stir zone demonstrated fatigue strength superior to that of the base material in both preprocessed tempers. It was shown that the excellent fatigue performance of friction-stir joints was attributable to the ultra-fine-grained microstructure, the low dislocation density evolved in the stir zone, and the preservation of Al3Sc coherent dispersoids during welding. The formation of such structure hinders the initiation and growth of fatigue microcracks that provides superior fatigue performance of friction-stir welds.

  13. Two-dimensional nanoscale correlations in the strong negative thermal expansion material ScF3

    Science.gov (United States)

    Handunkanda, Sahan U.; Occhialini, Connor A.; Said, Ayman H.; Hancock, Jason N.

    2016-12-01

    We present diffuse x-ray scattering data on the strong negative thermal expansion (NTE) material ScF3 and find that two-dimensional nanoscale correlations exist at momentum-space regions associated with possibly rigid rotations of the perovskite octahedra. We address the extent to which rigid octahedral motion describes the dynamical fluctuations behind NTE by generalizing a simple model supporting a single floppy mode that is often used to heuristically describe instances of NTE. We find this model has tendencies toward dynamic inhomogeneities and its application to recent and existing experimental data suggest an intricate link between the nanometer correlation length scale, the energy scale for octahedral tilt fluctuations, and the coefficient of thermal expansion in ScF3. We then investigate the breakdown of the rigid limit and propose a resolution to an outstanding debate concerning the role of molecular rigidity in strong NTE materials.

  14. Improving SC-FDMA performance by Turbo Equalization in UTRA LTE Uplink

    DEFF Research Database (Denmark)

    Berardinelli, Gilberto; Priyanto, Basuki Endah; Sørensen, Troels Bundgaard;

    2008-01-01

    does not have stringent power constraints. In this paper, a turbo equalization technique to improve Single Carrier Frequency Division Multiple Access (SC-FDMA) performance is proposed. A new adaptive coefficients solution for frequency domain equalization is considered. The work is in the context...... that the turbo equalizer can improve the BLER performance around 1 dB with only a few iterations, and improve the SC-FDMA performance over OFDM, especially at high coding rate.......Turbo equalization is known as an advanced iterative equalization and decoding technique that allows to enhance the performance of the data transmission over a frequency selective fading channel. The turbo equalizer will result in extra receiver complexity, but isolated to the base-station, which...

  15. Influence of electron irradiation on Al-Mg-Sc alloy decomposition

    Energy Technology Data Exchange (ETDEWEB)

    Repnikova, E.A.; Malinenko, I.A.; Chudinova, S.A.; Toropova, L.S.; Ustinovshchikov, V.M. (Petrozavodskij Gosudarstvennyj Univ. (USSR); AN SSSR, Moscow. Inst. Metallurgii)

    1984-03-01

    Methods of X-ray diffraction analysis have been used to investigate thermal and radiation structural and phase stability of Al-2.5% Mg-0.4%Sc alloy, irradiated with 2.3 MeV electrons (fluence - 2x10/sup 18/ cm/sup -1/). It is established that thermal treatment of alloys even without following irradiation stimulates the beginning of decomposition, which is the most clearly defined at 350 deg C. Presence of Mg/sub 2/Al/sub 3/, Mg/sub 3/Al/sub 4/ and Mg/sub 5/Al/sub 8/ is sufficiently positively revealed by the method of phase analysis. Electron irradiation results in developing of decomposition process in Al-Mg-Sc solid solutions that the most clearly manifests intself in the alloys, preliminary annealed at 350 deg C.

  16. [Human amniotic epithelium (HAE) as a possible source of stem cells (SC)].

    Science.gov (United States)

    García-López, Guadalupe; García-Castro, Irma Lydia; Avila-González, Daniela; Molina-Hernández, Anayansi; Flores-Herrera, Héctor; Merchant-Larios, Horacio; Díaz-Martínez, Fabián

    2015-01-01

    There have been major recent advances in the field of developmental biology due to the investigation on stem cells (SC). Stem cells are characterized by their capacity of auto-renewal and differentiation to different cellular phenotypes. Based on the developmental stage, they can be classified into two different types: embryonic SCs and adult SCs. It has been widely reported that several problems need to be resolved before their possible clinical applications. As a result, fetal membranes have been suggested as an alternative source of SCs. In the human amniotic epithelium, the presence of markers of pluripotent SC´s has been reported, and its capacity as a feeder layer for expansion of different SC types. Also, fetal membranes are a discarded product after delivery, and thus there are not any ethical issues related to its use. In conclusion, the human amniotic epithelium can be a strong candidate for regenerative medicine.

  17. Theoretical Calculations of Transition Probabilities and Oscillator Strengths for Sc(Ⅲ) and Y(Ⅲ)

    Institute of Scientific and Technical Information of China (English)

    Tian-yi Zhang; Neng-wu Zheng

    2009-01-01

    The Weakest Bound Electron Potential Model theory is used to calculate transition probability-values and oscillator strength-values for individual lines of Sc(Ⅲ) and Y(Ⅲ). In this method, by solving the SchrSdinger equation of the weakest bound electron, the expressions of energy eigenvalue and the radial function can be obtained. And a coupled equation is used to determine the parameters which are needed in the calculations. The ob-tained results of Sc(Ⅲ) from this work agree very well with the accepted values taken from the National Institute of Standards and Technoligy (NIST) data base, most deviations are within the accepted level. For Y(Ⅲ) there are no accepted values reported by the NIST data base. So we compared our results of Y(Ⅲ) with other theoretical results, good agreement is also obtained.

  18. Effects of SC-560 in Combination with Cisplatin or Taxol on Angiogenesis in Human Ovarian Cancer Xenografts

    Directory of Open Access Journals (Sweden)

    Wei Li

    2014-10-01

    Full Text Available This study was designed to evaluate the effect of cyclooxygenase-1 (COX-1 inhibitor, SC-560, combined with cisplatin or taxol, on angiogenesis in human ovarian cancer xenografts. Mice were treated with intraperitoneal (i.p. injections of SC-560 6 mg/kg/day, i.p. injections of cisplatin 3 mg/kg every other day and i.p. injections of taxol 20 mg/kg once a week for 21 days. Vascular endothelial growth factor (VEGF mRNA levels were detected by reverse transcription-polymerase chain reaction (RT-PCR; microvessel density (MVD was determined by immunohistochemistry; and prostaglandin E2 (PGE2 levels were determined using ELISA. Expression levels of VEGF mRNA and MVD in treatment groups were inhibited significantly when compared with the control group (p < 0.05 for all, and SC-560 combined with cisplatin displayed a greater reduction in the expression of VEGF and MVD than SC-560 or cisplatin alone (p < 0.05. SC-560 combined with taxol showed a greater inhibition on VEGF mRNA expression than SC-560 or taxol alone (p < 0.05. The level of PGE2 in treatment groups was significantly reduced when compared with the control group (p < 0.01 for all. These findings may indicate that cisplatin or taxol supplemented by SC-560 in human ovarian cancer xenografts enhances the inhibition effect of cisplatin or taxol alone on angiogenesis.

  19. Parameters of superfine interactions in Laves ScFe sub 2 alloy with hexagonal MnZn sub 2 structure

    CERN Document Server

    Pokatilov, V S

    2001-01-01

    The superfine fields, amplification coefficients and quadrupole splitting on the sup 4 sup 5 Sc nuclei in the ScFe sub 2 , Sc sub 0 sub . sub 9 sub 5 Fe sub 2 sub . sub 0 sub 5 and ScFe sub 1 sub . sub 9 sub 7 Al sub 0 sub . sub 0 sub 3 alloys are measured at the room temperature and 77 K through the method of the nuclear magnetic resonance (NMR). The NMR spectra peculiarities are studied and the superfine field shifts on the sup 4 sup 5 Sc nuclei in the considered alloys by appearance of the Fe atoms at the Sc atoms places and the Al atoms at the Fe atoms places in the Sc atoms nearest coordination sphere are determined. It is established that the electron quadrupole splitting in the considered alloys does not depend on the technology of obtaining the samples, on insignificant deviations from the alloy stoichiometric composition or on the minor additions of the Al atoms

  20. High performance AlScN thin film based surface acoustic wave devices with large electromechanical coupling coefficient

    Science.gov (United States)

    Wang, Wenbo; Mayrhofer, Patrick M.; He, Xingli; Gillinger, Manuel; Ye, Zhi; Wang, Xiaozhi; Bittner, Achim; Schmid, Ulrich; Luo, J. K.

    2014-09-01

    AlN and AlScN thin films with 27% scandium (Sc) were synthesized by DC magnetron sputtering deposition and used to fabricate surface acoustic wave (SAW) devices. Compared with AlN-based devices, the AlScN SAW devices exhibit much better transmission properties. Scandium doping results in electromechanical coupling coefficient, K2, in the range of 2.0% ˜ 2.2% for a wide normalized thickness range, more than a 300% increase compared to that of AlN-based SAW devices, thus demonstrating the potential applications of AlScN in high frequency resonators, sensors, and high efficiency energy harvesting devices. The coupling coefficients of the present AlScN based SAW devices are much higher than that of the theoretical calculation based on some assumptions for AlScN piezoelectric material properties, implying there is a need for in-depth investigations on the material properties of AlScN.

  1. Substance P Differentially Modulates Firing Rate of Solitary Complex (SC) Neurons from Control and Chronic Hypoxia-Adapted Adult Rats

    Science.gov (United States)

    Nichols, Nicole L.; Powell, Frank L.; Dean, Jay B.; Putnam, Robert W.

    2014-01-01

    NK1 receptors, which bind substance P, are present in the majority of brainstem regions that contain CO2/H+-sensitive neurons that play a role in central chemosensitivity. However, the effect of substance P on the chemosensitive response of neurons from these regions has not been studied. Hypoxia increases substance P release from peripheral afferents that terminate in the caudal nucleus tractus solitarius (NTS). Here we studied the effect of substance P on the chemosensitive responses of solitary complex (SC: NTS and dorsal motor nucleus) neurons from control and chronic hypoxia-adapted (CHx) adult rats. We simultaneously measured intracellular pH and electrical responses to hypercapnic acidosis in SC neurons from control and CHx adult rats using the blind whole cell patch clamp technique and fluorescence imaging microscopy. Substance P significantly increased the basal firing rate in SC neurons from control and CHx rats, although the increase was smaller in CHx rats. However, substance P did not affect the chemosensitive response of SC neurons from either group of rats. In conclusion, we found that substance P plays a role in modulating the basal firing rate of SC neurons but the magnitude of the effect is smaller for SC neurons from CHx adult rats, implying that NK1 receptors may be down regulated in CHx adult rats. Substance P does not appear to play a role in modulating the firing rate response to hypercapnic acidosis of SC neurons from either control or CHx adult rats. PMID:24516602

  2. Substance P differentially modulates firing rate of solitary complex (SC neurons from control and chronic hypoxia-adapted adult rats.

    Directory of Open Access Journals (Sweden)

    Nicole L Nichols

    Full Text Available NK1 receptors, which bind substance P, are present in the majority of brainstem regions that contain CO2/H(+-sensitive neurons that play a role in central chemosensitivity. However, the effect of substance P on the chemosensitive response of neurons from these regions has not been studied. Hypoxia increases substance P release from peripheral afferents that terminate in the caudal nucleus tractus solitarius (NTS. Here we studied the effect of substance P on the chemosensitive responses of solitary complex (SC: NTS and dorsal motor nucleus neurons from control and chronic hypoxia-adapted (CHx adult rats. We simultaneously measured intracellular pH and electrical responses to hypercapnic acidosis in SC neurons from control and CHx adult rats using the blind whole cell patch clamp technique and fluorescence imaging microscopy. Substance P significantly increased the basal firing rate in SC neurons from control and CHx rats, although the increase was smaller in CHx rats. However, substance P did not affect the chemosensitive response of SC neurons from either group of rats. In conclusion, we found that substance P plays a role in modulating the basal firing rate of SC neurons but the magnitude of the effect is smaller for SC neurons from CHx adult rats, implying that NK1 receptors may be down regulated in CHx adult rats. Substance P does not appear to play a role in modulating the firing rate response to hypercapnic acidosis of SC neurons from either control or CHx adult rats.

  3. Structural and Controllable Thermal Expansion Properties of Sc2-xAlxMo3O12

    Institute of Scientific and Technical Information of China (English)

    WU; Mei-mei; CHEN; Dong-feng

    2013-01-01

    Materials with controllable thermal expansion are the subject of fundamental studies because of the important applications in high-precision optical mirrors,fiber optic systems,and electronic materials.Samples Sc2-xAlxMo3O12(x=0.0,0.3,0.7,1.0,1.3,1.7,and 2.0)were prepared by the solid-state reaction,

  4. Thermodynamic modeling of the RE–Pb (RE = Sc, Dy, Gd) systems

    Energy Technology Data Exchange (ETDEWEB)

    Iddaoudi, A., E-mail: iddaoudi19@gmail.com [Laboratoire de Thermodynamique et Energétique, LTE, Université Ibn-Zohr, B.P. 8106 Agadir (Morocco); Servant, C., E-mail: colette.servant@orange.fr [Laboratoire de Physicochimie de l’Etat Solide, ICMMO, Université Paris-Sud, 91405 Orsay Cedex (France); Selhaoui, N.; Kardellass, S.; Mahdouk, K.; Bouirden, L. [Laboratoire de Thermodynamique et Energétique, LTE, Université Ibn-Zohr, B.P. 8106 Agadir (Morocco)

    2014-03-15

    Highlights: • Rare earth (RE) and Pb alloys or compounds are interesting as magnetic materials. • The phase diagrams and thermodynamic properties of RE–Pb (RE = Sc, Dy, Gd) systems have been assessed. • The CALPHAD method was used with the Redlich–Kister model to optimize the solution phases. • A self-consistent set of thermodynamic parameters has been evaluated. • A good agreement was found between the calculation and experiments. -- Abstract: The phase diagrams and thermodynamic properties of RE–Pb (RE = Sc, Dy, Gd) systems have been assessed by means of the CALPHAD method. The solution phases (liquid, fcc, bcc and hcp) were described by the sublattice formalism and the excess term of the Gibbs energy with the Redlich–Kister equation. The stoichiometric intermetallic compounds (Sc{sub 5}Pb{sub 3}, Sc{sub 6}Pb{sub 5}, Dy{sub 5}Pb{sub 4}, DyPb, DyPb{sub 2}, DyPb{sub 3}, β-Gd{sub 5}Pb{sub 4}, α-Gd{sub 5}Pb{sub 4}, Gd{sub 11}Pb{sub 10}, Gd{sub 6}Pb{sub 7}, GdPb{sub 2} and GdPb{sub 2}) were modeled as line compounds. The non-stoichiometric Dy{sub 5}Pb{sub 3} and Gd{sub 5}Pb{sub 3} phases with a narrow homogeneity range were modeled using a two-sublattice model with substitution. A consistent set of the thermodynamic parameters leading to a reasonable agreement between the calculated results and literature data was obtained.

  5. PrP(Sc) detection and infectivity in semen from scrapie-infected sheep.

    Science.gov (United States)

    Rubenstein, Richard; Bulgin, Marie S; Chang, Binggong; Sorensen-Melson, Sharon; Petersen, Robert B; LaFauci, Giuseppe

    2012-06-01

    A scrapie-positive ewe was found in a flock that had been scrapie-free for 13 years, but housed adjacent to scrapie-positive animals, separated by a wire fence. Live animal testing of the entire flock of 24 animals revealed seven more subclinical scrapie-positive ewes. We hypothesized that they may have contracted the disease from scrapie-positive rams used for breeding 4 months prior, possibly through the semen. The genotypes of the ewe flock were highly scrapie-susceptible and the rams were infected with the 'Caine' scrapie strain having a short incubation time of 4.3-14.6 months in sheep with 136/171 VQ/VQ and AQ/VQ genotypes. PrP(Sc) accumulates in a variety of tissues in addition to the central nervous system. Although transmission of prion diseases, or transmissible spongiform encephalopathies, has been achieved via peripheral organ or tissue homogenates as well as by blood transfusion, neither infectivity nor PrP(Sc) have been found in semen from scrapie-infected animals. Using serial protein misfolding cyclic amplification followed by a surround optical fibre immunoassay, we demonstrate that semen from rams infected with a short-incubation-time scrapie strain contains prion disease-associated-seeding activity that generated PrP(Sc) in sPMCA (serial protein misfolding cyclic amplification). Injection of the ovinized transgenic mouse line TgSShpPrP with semen from scrapie-infected sheep resulted in PrP(Sc)-seeding activity in clinical and, probably as a result of the low titre, non-clinical mouse brain. These results suggest that the transmissible agent, or at least the seeding activity, for sheep scrapie is present in semen. This may be a strain-specific phenomenon.

  6. Precise Determination of 40Ti Mass by Measuring the 40Sc Isospin Analogue State

    Institute of Scientific and Technical Information of China (English)

    LIU Wei-Ping(柳卫平); E. Roeckl; M. Pfützner; L. Chulkov; A. Piechaczek; R. Raabe; I. Reusen; G. Vancraeynest; A. Wohr; M. Hellstrom2; R. Collatz; J. Benlliure; D. Cortina Gil; F. Farget; H. Grawe; Z. Hu; N. Iwasa

    2001-01-01

    The mass of 40 Ti has been determined by using the isobaric multiplet mass equation method. The experimental data of the 40Tiβ-decay were used to determine the level of the isospin analogue state of 40Sc. The ground-state mass excess and the QEc value for 40 Ti were determined to be -9060 ± 12 keV and 11 466 ± 13keV, respectively.

  7. Experimental Investigation of Electrical Conductivity and Permittivity of SC-TiO 2 -EG Nanofluids

    Science.gov (United States)

    Fal, Jacek; Barylyak, Adriana; Besaha, Khrystyna; Bobitski, Yaroslav V.; Cholewa, Marian; Zawlik, Izabela; Szmuc, Kamil; Cebulski, Józef; żyła, Gaweł

    2016-08-01

    The paper presents experimental studies of dielectric properties of nanofluids based on ethylene glycol and SC-TiO2 nanoparticles with average size of 15-40 nm with various mass concentrations. The dielectric permittivity both real part and imaginary part as a function of temperature and frequency were measured. Also, dependence ac conductivity on frequency, temperature, and mass concentration were investigated. Based on the curves of ac conductivity, dc conductivity was calculated, and 400 % enhancement in dc conductivity was exposed.

  8. Fatal pulmonary thromboembolism associated with hemoglobin SC disease in a 15 year-old boy

    Directory of Open Access Journals (Sweden)

    Thiago Trolez Amancio

    2011-09-01

    Full Text Available We report a case of hemoglobin SC disease complicated by fatal pulmonarythromboembolism in a 15 year-old Brazilian boy, submitted to autopsy. Thiscase shows the importance of early diagnosis and treatment of sickle celldisease, which generates systemic involvement in youth and the importanceof considering the hypercoagulability in these patients. The autopsy was veryinstructive, revealing the florid morphologic aspect of sickle cell disease andits complications.

  9. Puzzling γ-ray strength functions in 44,45Sc and 50,51V

    Science.gov (United States)

    Larsen, A. C.; Guttormsen, M.; Chankova, R.; Ingebretsen, F.; Lönnroth, T.; Messelt, S.; Rekstad, J.; Schiller, A.; Siem, S.; Syed, N. U. H.; Voinov, A.

    2008-05-01

    The nuclear physics group at the Oslo Cyclotron Laboratory (OCL) has developed a method to extract nuclear level density and γ-ray strength function simultaneously from primary γ-ray spectra. The resulting γ-ray strength functions of 44,45Sc and 50,51V show an unexpected, large enhancement at low γ-ray energies, indicating an increased probability of emitting low-energy γ rays in the quasi-continuum.

  10. Experimental Investigation of Electrical Conductivity and Permittivity of SC-TiO 2 -EG Nanofluids.

    Science.gov (United States)

    Fal, Jacek; Barylyak, Adriana; Besaha, Khrystyna; Bobitski, Yaroslav V; Cholewa, Marian; Zawlik, Izabela; Szmuc, Kamil; Cebulski, Józef; Żyła, Gaweł

    2016-12-01

    The paper presents experimental studies of dielectric properties of nanofluids based on ethylene glycol and SC-TiO2 nanoparticles with average size of 15-40 nm with various mass concentrations. The dielectric permittivity both real part and imaginary part as a function of temperature and frequency were measured. Also, dependence ac conductivity on frequency, temperature, and mass concentration were investigated. Based on the curves of ac conductivity, dc conductivity was calculated, and 400 % enhancement in dc conductivity was exposed.

  11. Three-phase-boundary dynamics at the Ni/ScYSZ interface

    DEFF Research Database (Denmark)

    Schmidt, Michael Stenbæk; Hansen, Karin Vels; Norrman, Kion;

    2009-01-01

    Chronoamperometry using a three-electrode cell configuration was undertaken with a nickel point-electrode acting as the working electrode on a polished ScYSZ electrolyte in a hydrogen atmosphere at 750–850 °C. High anodic overpotentials resulted in the occurrence of distinct sawtooth oscillation...... of the current oscillations. A mechanism accounting for the observed phenomena and possible implications for solid oxide fuel cell operation are presented...

  12. Sickle Cell Disease: quality of life in patients with hemoglobin SS and SC disorders

    OpenAIRE

    2013-01-01

    OBJECTIVE Sickle cell disease comprises chronic, genetically determined disorders, presenting significant morbidity and high prevalence in Brazil. The goal of this study was to evaluate the quality of life of sickle cell disease patients (hemoglobin SS and SC) and their sociodemographic and clinical characteristics. METHODS Data was collected from clinical records and semi-structured interviews consisting of clinical questionnaires and the World Health Organization Quality of Life-brief qu...

  13. Peak effect of flux pinning in Sc5Ir4Si10 superconductors

    Science.gov (United States)

    Sun, Y.; Shi, Z. X.; Gu, D. M.; Miura, M.; Tamegai, T.

    2010-10-01

    Magnetic hysteresis loops (MHLs) have been comparatively measured on both textured and single crystalline Sc5Ir4Si10 superconductors. Critical current densities and flux pinning forces are calculated from MHLs by Bean model. Three kinds of peaks of the flux pinning force are found at low fields near zero, intermediated fields, and high fields near the upper critical field, respectively. The characters and origins of these peaks are studied in detail.

  14. Inhibition of the signal transduction through the AtoSC system by histidine kinase inhibitors in Escherichia coli.

    Science.gov (United States)

    Theodorou, Evaggelos C; Theodorou, Marina C; Kyriakidis, Dimitrios A

    2011-08-01

    AtoSC two-component system participates in many indispensable processes of Escherichia coli. We report here that the AtoSC signal transduction is inhibited by established histidine kinase inhibitors. Closantel, RWJ-49815 and TNP-ATP belonging to different chemical classes of inhibitors, abrogated the in vitro AtoS kinase autophosphorylation. However, when AtoS was embedded in the membrane fractions, higher inhibitor concentrations were required for total inhibition. When AtoS interacted with AtoC forming complex, the intrinsic histidine kinase was protected by the response regulator, requiring increased inhibitors concentrations for partially AtoS autophosphorylation reduction. The inhibitors exerted an additional function on AtoSC, blocking the phosphotransfer from AtoS to AtoC, without however, affecting AtoC~P dephosphorylation. Their in vivo consequences through the AtoSC inhibition were elucidated on atoDAEB operon expression, which was inhibited only in AtoSC-expressing bacteria where AtoSC was induced by acetoacetate or spermidine. The inhibitor effects were extended on the AtoSC regulatory role on cPHB [complexed poly-(R)-3-hydroxybutyrate] biosynthesis. cPHB was decreased upon the blockers only in acetoacetate-induced AtoSC-expressing cells. Increased ATP amounts during bacterial growth reversed the inhibitory TNP-ATP-mediated effect on cPHB. The alteration of pivotal E. coli processes as an outcome of AtoSC inhibition, establish this system as a target of two-component systems inhibitors.

  15. Inoculation with Metal-Mobilizing Plant-Growth-Promoting Rhizobacterium Bacillus sp. SC2b and Its Role in Rhizoremediation.

    Science.gov (United States)

    Ma, Ying; Oliveira, Rui S; Wu, Longhua; Luo, Yongming; Rajkumar, Mani; Rocha, Inês; Freitas, Helena

    2015-01-01

    A plant growth-promoting bacterial (PGPB) strain SC2b was isolated from the rhizosphere of Sedum plumbizincicola grown in lead (Pb)/zinc (Zn) mine soils and characterized as Bacillus sp. based on (1) morphological and biochemical characteristics and (2) partial 16S ribosomal DNA sequencing analysis. Strain SC2b exhibited high levels of resistance to cadmium (Cd) (300 mg/L), Zn (730 mg/L), and Pb (1400 mg/L). This strain also showed various plant growth-promoting (PGP) features such as utilization of 1-aminocyclopropane-1-carboxylate, solubilization of phosphate, and production of indole-3-acetic acid and siderophore. The strain mobilized high concentration of heavy metals from soils and exhibited different biosorption capacity toward the tested metal ions. Strain SC2b was further assessed for PGP activity by phytagar assay with a model plant Brassica napus. Inoculation of SC2b increased the biomass and vigor index of B. napus. Considering such potential, a pot experiment was conducted to assess the effects of inoculating the metal-resistant PGPB SC2b on growth and uptake of Cd, Zn and Pb by S. plumbizincicola in metal-contaminated agricultural soils. Inoculation with SC2b elevated the shoot and root biomass and leaf chlorophyll content of S. plumbizincicola. Similarly, plants inoculated with SC2b demonstrated markedly higher Cd and Zn accumulation in the root and shoot system, indicating that SC2b enhanced Cd and Zn uptake by S. plumbizincicola through metal mobilization or plant-microbial mediated changes in chemical or biological soil properties. Data demonstrated that the PGPB Bacillus sp. SC2b might serve as a future biofertilizer and an effective metal mobilizing bioinoculant for rhizoremediation of metal polluted soils.

  16. A combined ab initio and Franck-Condon factor simulation study on the photodetachment spectrum of ScO2(-).

    Science.gov (United States)

    Lee, Edmond P F; Mok, Daniel K W; Chau, Foo-Tim; Dyke, John M

    2009-02-01

    Restricted-spin coupled-cluster single-double plus perturbative triple excitation {RCCSD(T)} potential energy functions (PEFs) of the X(2)B2 state of ScO2 and the 1A1 state of ScO2(-) were computed, employing the augmented correlation-consistent polarized-weighted core-valence quadruple-zeta (aug-cc-pwCVQZ) basis set for Sc and augmented correlation-consistent polarized valence quadruple-zeta (aug-cc-pVQZ) basis set for O, and with the outer core Sc 3s(2)3p(6) electrons being explicitly correlated. Franck-Condon factors, which include allowance for Duschinsky rotation and anharmonicity, were calculated using the computed RCCSD(T) PEFs, and were used to simulate the first photodetachment band of ScO2(-). The simulated spectrum matches well with the corresponding experimental 355 nm photodetachment spectrum of Wu and Wang, J Phys Chem A 1998, 102, 9129, confirming the assignment of the photodetachment spectrum and the reliability of the RCCSD(T) PEFs used. Further calculations on low-lying electronic states of ScO2 gave adiabatic relative electronic energies (T(e)'s) of, and vertical excitation energies (T(v)'s) to, the 2A1, 2B1, and 2A2 states of ScO2 (from the X(2)B2 state of ScO2), as well as electron affinities (EAs) and vertical detachment energies (VDEs) to these neutral states from the 1A1 state of ScO2(-).

  17. Cereal crops as viable production and storage systems for pharmaceutical scFv antibodies.

    Science.gov (United States)

    Stöger, E; Vaquero, C; Torres, E; Sack, M; Nicholson, L; Drossard, J; Williams, S; Keen, D; Perrin, Y; Christou, P; Fischer, R

    2000-03-01

    This report describes the stable expression of a medically important antibody in the staple cereal crops rice and wheat. We successfully expressed a single-chain Fv antibody (ScFvT84.66) against carcinoembryonic antigen (CEA), a well characterized tumor-associated marker antigen. scFv constructs were engineered for recombinant antibody targeting to the plant cell apoplast and ER. Up to 30 microg/g of functional recombinant antibody was detected in the leaves and seeds of wheat and rice. We confirmed that transgenic dry seeds could be stored for at least five months at room temperature, without significant loss of the amount or activity of scFvT84.66. Our results represent the first transition from model plant expression systems, such as tobacco and Arabidopsis, to widely cultivated cereal crops, such as rice and wheat, for expression of an antibody molecule that has already shown efficacy in clinical applications. Thus, we have established that molecular pharming in cereals can be a viable production system for such high-value pharmaceutical macromolecules. Our findings provide a strong foundation for exploiting alternative uses of cereal crops both in industrialized and developing countries.

  18. Structural and magnetic properties of Ti12M clusters (M=Sc to Zn)

    Science.gov (United States)

    Sun, Houqian; Xu, Ning

    2016-12-01

    The geometries, electronic, and magnetic properties of the 3d atom doped icosahedron (ICO) Ti12M (M=Sc to Zn), where a dopant atom replaces either the centra l(Ti12Mc) or surface (Ti12Ms) Ti atom in ICO Ti13 cluster, have been systematically investigated by using the density functional theory. The structures of all the optimized Ti12Mc and Ti12Ms clusters are distorted ICO. Sc, Ni, Cu, and Zn atoms prefer to displace surface Ti atom, V, Cr, Mn, and Fe atoms prefer to displace central Ti atom. The position of impurity atom depends on the strength of the interaction between the central atom and the surface atoms. As compared to the pure Ti13 cluster, Ti12Mc and Ti12Ms (M=V, Fe, Co, and Ni) clusters are more stable, Ti12Mc and Ti12Ms (M=Sc, Cr, Mn, Cu, and Zn) are less stable. Both Ti12Nis and Ti12Nic are magic clusters, which originate from their electronic as well as geometric closed shells. Because the exchange interaction prevails over the crystal field in Ti12M clusters, the valence electrons fill molecular orbitals in terms of Hund's rule of maximum spin.

  19. Mechanical, electronic, optical, thermodynamic properties and superconductivity of ScGa3

    Science.gov (United States)

    Parvin, F.; Hossain, M. A.; Ali, M. S.; Islam, A. K. M. A.

    2015-01-01

    The rare occurrence of type-I superconductivity in binary system ScGa3 has experimentally been shown recently. In the present paper we study the electronic, optical, thermodynamic properties and some aspects of superconductivity of this compound using first-principles calculations. The mechanical properties like elastic constants, bulk modulus, shear modulus, Pugh's ductility index, Young's modulus, Poisson's ratio, elastic anisotropy factor, Peierls stress are calculated for the first time. The material is anisotropic and brittle. Electronic band structure, density of states, Fermi surfaces and bonding nature have also been studied. The optical functions are estimated and discussed for the first time. The high reflectivity is found in the ultraviolet regions up to ~13 eV and thus ScGa3 can serve as a possible shielding material for ultraviolet radiation. Thermal effects on some macroscopic properties of ScGa3 are predicted using the quasi-harmonic Debye model and phonon approximation in the temperature and hydrostatic pressure in the ranges of 0-1000 K and 0-40 GPa, respectively. The calculated electron-phonon coupling constant λ=0.52 yields Tc=2.6 K, which is in very good agreement with the experimentally observed value. The value of the coupling constant and the Ginzburg-Landau parameter (κ=0.09) indicate that the compound is a weak-coupled type-I rare binary BCS superconductor.

  20. Spectroscopic characterization of Yb:Sc2O3 transparent ceramics

    Institute of Scientific and Technical Information of China (English)

    Lu Shen-Zhou; Yang Qiu-Hong

    2012-01-01

    Yb:Sc2O3 transparent ceramics are fabricated by a conventional ceramic process and sintering in H2 atmosphere.The room-temperature spectroscopic properties are investigated,and the Raman spectrum shows an obvious vibration characteristic band centred at 415 cm-1. There are three broad absorption bands around 891,937,and 971 nm,respectively.The strongest emission peak is centred at 1.04 μm with a broad bandwidth (11 nm) and an emission cross-section of 1.8× 10-20 cm2.The gain coefficient implies a possible laser ability in a range from 990 nm to 1425 nm.The energy-level structure shows that Yb:Sc2O3 ceramics have large Stark splitting at the ground state level due to their strong crystal field.All the results show that Yb:Sc2Oa transparent ceramics are a promising material for short pulse lasers.