WorldWideScience

Sample records for underwood edie 2-regime

  1. EDI.

    Science.gov (United States)

    Bluh, Pamela; And Others

    1996-01-01

    This special section on EDI (Electronic Data Interchange) in libraries includes eight articles that discuss experiences in libraries in the United Kingdom, EDI and the acquisitions process in Europe, a Canadian viewpoint, the ILS (Integrated Library Systems) vendor and EDI, public libraries, and EDI in the information services industry. (LRW)

  2. Where's the War? A Response to Meredith and Underwood.

    Science.gov (United States)

    Tucker, James A.; Champagne, Jeffrey F.

    1996-01-01

    In the Spring 1995 "JLE" issue, Meredith and Underwood say conflict (over shrinking resources) is inevitable between regular and special education. This article disagrees. Even if special education costs were escalating as a percentage of all education costs, changes in funding systems are making educator wars less likely. In many…

  3. Projekt EDI / Priit Põdra

    Index Scriptorium Estoniae

    Põdra, Priit, 1963-

    2000-01-01

    Projekt EDI töötab välja programmisüsteemi rahvusvaheliste kaubavedude korraldamiseks, dokumentide vormistamiseks ja firmade arvutiprogrammide koostöö korraldamiseks. Projekti tutvustab AS-i EDI VEKTOR juhatuse esimees Priit Põdra

  4. EDIS Investigation Filing Information

    Data.gov (United States)

    US International Trade Commission — This dataset contains investigation, document and attachment metadata from the USITC's Electronic Document Information System (EDIS), as well as access to attached...

  5. EDI-The Future.

    Science.gov (United States)

    Rusk, Harriet J.

    1991-01-01

    Considered are standardization efforts of the American National Standards Institute's Accredited Standards Committee X12 concerned with electronic data interchange (EDI). These efforts will effect dentistry first in the transmission of academic records, and then in communications between dental offices and businesses, including major insurance…

  6. EDI in the Public Sector

    DEFF Research Database (Denmark)

    Falch, Morten

    1998-01-01

    Introduction of EDI in the public administration is apriority for the Danish Government. EDI is both seen as a catlyst for development towards an information society ans as a means for more efficient use of scarce resources. EDI in the banking sector and the retail sector is reviewed, drivers...

  7. Introduction of EDI in the public sector

    DEFF Research Database (Denmark)

    Falch, Morten

    1997-01-01

    Reviews the status of EDI in the sectors of health, public transport and taxation and public administration. The impact of this on the diffusion of EDI in other sectors is analysed.......Reviews the status of EDI in the sectors of health, public transport and taxation and public administration. The impact of this on the diffusion of EDI in other sectors is analysed....

  8. EDI and the Technical Communicator.

    Science.gov (United States)

    Eiler, Mary Ann

    1994-01-01

    Assesses the role of technical communicators in electronic data interchange (EDI). Argues that, as experts in information design, human factors, instructional theory, and professional writing, technical communicators should be advocates of standard documentation protocols and should rethink the traditional concepts of "document" to…

  9. Environmental Assessment for Lignite Fuel Enhancement Project, Coal Creek Station, Great River Energy, Underwood, North Dakota

    Energy Technology Data Exchange (ETDEWEB)

    N/A

    2004-01-16

    The US Department of Energy (DOE) has prepared this EA to assess the environmental impacts of the commercial application of lignite fuel enhancement. The proposed demonstration project would be implemented at Great River Energy's Coal Creek Station near Underwood, North Dakota. The proposed project would demonstrate a technology to increase the heating value of lignite and other high-moisture coals by reducing the moisture in the fuels. Waste heat that would normally be sent to the cooling towers would be used to drive off a percentage of the moisture contained within the lignite. Application of this technology would be expected to boost power-generating efficiencies, provide economic cost savings for lignite and sub-bituminous power plants, and reduce air emissions. The proposed project would be constructed on a previously disturbed site within the Coal Creek Station and no negative impacts would occur in any environmental resource area.

  10. Internal control in an EDI environment.

    OpenAIRE

    Bae, Dal Hyeoung

    1991-01-01

    Approved for public release; distribution in unlimited. Electronic Data Interchange(EDI) is the electronic transmission of standard business documents in machine-readable format between parent companies and respective trading partners. As the use of EDI has grown, there have been the associated risks due to an uncontrolled environment. Accordingly, the necessity for effective internal controls in an EDI environment is on the rise. This thesis evaluates and analyzes the feasi...

  11. Efficient Processing Of Voluminous EDI Documents

    NARCIS (Netherlands)

    Risse, T.; Wombacher, Andreas; Aberer, K.

    Business data is frequently exchanged between heterogeneous information systems using standard EDI formats like EDIFACT, X12 and in the future also XML/EDI. For inhouse use, data represented in these formats must be converted to inhouse data formats by message converters. With the growing usage of

  12. Wind River Watershed Restoration Project; Underwood Conservation District, Annual Report 2002-2003.

    Energy Technology Data Exchange (ETDEWEB)

    White, Jim

    2004-02-01

    The goal of the Wind River project is to preserve, protect and restore Wind River steelhead. In March, 1998, the National Marine Fisheries Service listed the steelhead of the lower Columbia as 'threatened' under the Endangered Species Act. In 1997, the Washington Department of Fish and Wildlife rated the status of the Wind River summer run steelhead as critical. Due to the status of this stock, the Wind River summer steelhead have the highest priority for recovery and restoration in the state of Washington's Lower Columbia Steelhead Conservation Initiative. The Wind River Project includes four cooperating agencies. Those are the Underwood Conservation District (UCD), United States Geological Service (USGS), US Forest Service (USFS), and Washington State Department of Fish & Wildlife (WDFW). Tasks include monitoring steelhead populations (USGS and WDFW), Coordinating a Watershed Committee and Technical Advisory Group (UCD), evaluating physical habitat conditions (USFS and UCD), assessing watershed health (all), reducing road sediments sources (USFS), rehabilitating riparian corridors, floodplains, and channel geometry (UCD, USFS), evaluate removal of Hemlock Dam (USFS), and promote local watershed stewardship (UCD, USFS). UCD's major efforts have included coordination of the Wind River Watershed Committee and Technical Advisory Committee (TAC), water temperature and water chemistry monitoring, riparian habitat improvement projects, and educational activities. Our coordination work enables the local Watershed Committee and TAC to function and provide essential input to Agencies, and our habitat improvement work focuses on riparian revegetation. Water chemistry and temperature data collection provide information for monitoring watershed conditions and fish habitat, and are comparable with data gathered in previous years. Water chemistry information collected on Trout Creek should, with 2 years data, determine whether pH levels make conditions

  13. Electronic Transcripts--EDI in Academic Administration.

    Science.gov (United States)

    Carson, E. W.

    1991-01-01

    Newly developed electronic data interchange (EDI) standards for exchanging academic records between colleges and universities are explained. It is argued that implementation of the new standards in college registrar and admissions offices can improve speed, costs, and accuracy and provide a prototype for a variety of campus business applications.…

  14. Ability of EDI-2 and EDI-3 to correctly identify patients and subjects at risk for eating disorders.

    Science.gov (United States)

    Segura-García, Cristina; Aloi, Matteo; Rania, Marianna; Ciambrone, Paola; Palmieri, Antonella; Pugliese, Valentina; Ruiz Moruno, Antonio José; De Fazio, Pasquale

    2015-12-01

    The prevention and early recognition of eating disorders (EDs) are important topics in public health. This study aims to compare the efficacy of the Eating Disorder Inventory 2 (EDI-2) with the new version, EDI-3 in recognising patients and identifying subjects at risk for EDs. The EDI-2 and EDI-3 were administered to 92 female patients with ED and 265 females from a population at risk for EDs. Experienced psychiatrists in this field held blind interviews with participants by means of the SCID-I to determine the diagnosis. According to the cut-offs suggested by the authors, the EDI-3 correctly identified nearly all of the ED patients (99%), while the EDI-2 divulged less than half (48%). Both versions of the test showed comparable capability to identify participants at risk for EDs but the EDI-3 seemed slightly more reliable than the EDI-2. The EDI-2 remains a valid and very specific test. However, the new EDI-3 seems to be experimentally superior, because it typifies nearly all patients across the ED span, including those with Binge Eating Disorder and Eating Disorder Not Otherwise Specified. In addition, it appears to be more reliable. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Electronic Data Interchange (EDI) for Libraries and Publishers.

    Science.gov (United States)

    Santosuosso, Joe

    1992-01-01

    Defines electronic data interchange (EDI) as the exchange of data between computer systems without human intervention or interpretation. Standards are discussed; and the implementation of EDI in libraries and the serials publishing community in the areas of orders and acquisitions, claims, and invoice processing is described. (LRW)

  16. Cinco translações, 10 edições

    OpenAIRE

    Ângela Tonietto; Bruno Telles; Charles A. Andrade; Claudemir R. Dias Filho; Juliano A. Gomes

    2016-01-01

    Após cinco translações em torno da estrela do Sistema Solar e nove edições publicadas, a Revista Brasileira de Criminalística entrega hoje o terceiro número do seu quinto volume, completando assim cinco anos ininterruptos de publicações com sua décima edição.

  17. Business Process Redesign Using EDI: the BHP steel experience

    Directory of Open Access Journals (Sweden)

    Paula Swatman

    1994-05-01

    Full Text Available EDI should not be seen as a competitive weapon - it does not offer a sustainable competitive advantage to its users as did the earlier inter-organisational systems (such as the various airline reservation systems. Instead EDI provides a standardised infrastructure upon which an adopting organisation can reengineer its business processes and thus confers a long-term, strategic and comparative advantage upon such an adopter. The potential for sustained competitive advantage to be derived from EDI arises from its integration with the organisational structure of its implementor, depending upon the implementing organisation's ability to redesign its business processes appropriately. This paper examines the case of (arguably the most sophisticated EDI-using company in Australia, BHP Steel, demonstrating the advantages obtainable by an organisation using EDI as a foundation for its reengineered organisational structure and business processes and concludes that: • there are real benefits to be obtained from an inter organisational electronic trading strategy founded on EDI as the enabling mechanism - benefits which are considerably more extensive than EDI's comparatively simple technical nature would appear to offer; • organisational gateways utilising an Application Generic approach to system integration and isolating the communications issue by insisting on the use of international data communications standards do offer a realistic and successful solution to the problem of internal and external trade for large and sophisticated organisations; • the majority of these achievements would have been either unlikely or totally impossible without BHP Steel's commitment to organisation-wide Business Process Redesign.

  18. Development of the Electron Drift Instrument (EDI) for Cluster

    Science.gov (United States)

    Quinn, Jack; Christensen, John L. (Technical Monitor)

    2001-01-01

    The Electron Drift Instrument (EDI) is a new technique for measuring electric fields in space by detecting the effect on weak beams of test electrons. This U.S. portions of the technique, flight hardware, and flight software were developed for the Cluster mission under this contract. Dr. Goetz Paschmann of the Max Planck Institute in Garching, Germany, was the Principle Investigator for Cluster EDI. Hardware for Cluster was developed in the U.S. at the University of New Hampshire, Lockheed Palo Alto Research Laboratory, and University of California, San Diego. The Cluster satellites carrying the original EDI instruments were lost in the catastrophic launch failure of first flight of the Arianne-V rocket in 1996. Following that loss, NASA and ESA approved a rebuild of the Cluster mission, for which all four satellites were successfully launched in the Summer of 2000. Limited operations of EDI were also obtained on the Equator-S satellite, which was launched in December, 1997. A satellite failure caused a loss of the Equator-S mission after only 5 months, but these operations were extremely valuable in learning about the characteristics and operations of the complex EDI instrument. The Cluster mission, satellites, and instruments underwent an extensive on-orbit commissioning phase in the Fall of 2000, carrying over through January 2001. During this period all elements of the instruments were checked and careful measurements of inter-experiments interferences were made. EDI is currently working exceptionally well in orbit. Initial results verify that all aspects of the instrument are working as planned, and returning highly valuable scientific information. The first two papers describing EDI on-orbit results have been submitted for publication in April, 2001. The principles of the EDI technique, and its implementation on Cluster are described in two papers by Paschmann et al., attached as Appendices A and B. The EDI presentation at the formal Cluster Commissioning

  19. Binary trading relations and the limits of EDI standards

    DEFF Research Database (Denmark)

    Damsgaard, Jan; Truex, D.

    2000-01-01

    This paper provides a critical examination of electronic data interchange (EDI) standards and their application in different types of trading relationships. It argues that EDI standards are not directly comparable to more stable sets of technical standards in that they are dynamically tested...... and negotiated in use with each trading exchange. It takes the position that EDI standards are an emergent language form and must mean different things at the institutional and local levels. Using the lens of emergent linguistic analysis it shows how the institutional and local levels must always be distinct...... and yet can coexist. EDI standards can never represent the creation of an 'Esperanto of institutional communication'. Instead we believe that standards must be developed such that they support and accommodate general basic grammatical forms that can be customised to individual needs. The analysis...

  20. [A German version of the Eating Disorder Inventory EDI-2].

    Science.gov (United States)

    Thiel, A; Jacobi, C; Horstmann, S; Paul, T; Nutzinger, D O; Schüssler, G

    1997-01-01

    The paper presents a German version of the second revised edition of the Eating Disorder Inventory EDI-2 (Garner 1991). The EDI-2 is a self-rating inventory (self-report measure) with 91 items and 11 subscales designed for the assessment of attitudinal and behavioural dimensions relevant to anorexia and bulimia nervosa. It consists of the eight original subscales: drive for thinness, bulimia, body dissatisfaction, ineffectiveness, perfectionism, interpersonal distrust, interoception and maturity fears, and the three new subscales: asceticism, impulse regulation and social insecurity. The German EDI-2 was given to 71 patients with anorexia or bulimia nervosa, 30 patients with binge eating disorder, a control group of 186 women and a further control group of 102 men. In comparison to the female control group, patient groups showed significantly elevated means on all subscales. Item analysis revealed sufficient internal consistencies for all subscales except subscale 9 (asceticism) with Cronbachs alpha ranging from 0.58 to 0.90. Twelve of the 91 items showed poor item total scale correlations below 0.40. Factor analysis supported a six-factor-structure. Hence, the reliability and validity of the three new subscales was confirmed only partially. The use of the EDI-2 in therapy research and clinical practice is critically discussed.

  1. The ISO Edi Conceptual Model Activity and Its Relationship to OSI.

    Science.gov (United States)

    Fincher, Judith A.

    1990-01-01

    The edi conceptual model is being developed to define common structures, services, and processes that syntax-specific standards like X12 and EDIFACT could adopt. Open Systems Interconnection (OSI) is of interest to edi because of its potential to help enable global interoperability across Electronic Data Interchange (EDI) functional groups. A…

  2. Optomechanical fabrication of EDiFiSE spectrometer

    Science.gov (United States)

    Arredondo-Vega, Luis; Pérez-Santos, Carlos; Pompa-Carrera, Octavio; Ruiz-Márquez, Armando; Hurtado-Ortega, José; Paez, Gonzalo

    2011-09-01

    The purpose of this work is to describe some optical and mechanical issues relating to the fabrication of the camera and the collimator of the Equalized and Diffraction-Limited Field Spectrograph Experiment (EDiFiSE), an instrument which forms part of a bigger project of the Instituto de Astrofísica de Canarias (IAC), Spain, and that was designed and manufactured within the facilities of Centro de Investigaciones en Óptica in León, México.

  3. Edição Especial: 6 V-EEGAM

    OpenAIRE

    João Cândido André da Silva Neto; Thiago Oliveira Neto

    2017-01-01

    A sexta edição especial da Revista Geonorte acaba de ser publicada, contemplando os trabalhos submetidos e aceitos ao V Encontro dos Estudantes de Geografia do Amazonas-EEGAM com o tema: Geografia da Circulação, realizado nas dependências do Instituto de Ciências Humanas e Letras-ICHL entre 29 e 30 de novembro e 01 e 02 de dezembro de 2016.

  4. Edição Especial: 6 V-EEGAM

    Directory of Open Access Journals (Sweden)

    João Cândido André da Silva Neto

    2017-05-01

    Full Text Available A sexta edição especial da Revista Geonorte acaba de ser publicada, contemplando os trabalhos submetidos e aceitos ao V Encontro dos Estudantes de Geografia do Amazonas-EEGAM com o tema: Geografia da Circulação, realizado nas dependências do Instituto de Ciências Humanas e Letras-ICHL entre 29 e 30 de novembro e 01 e 02 de dezembro de 2016.

  5. Determinants of EDI (Electronic Data Interchange) Adoption and Integration in the US and Japanese Automobile Suppliers

    OpenAIRE

    Sam Kurokawa; Seiji Manabe

    2002-01-01

    This paper examines determinants of EDI adoption and integration in the US and Japanese automobile suppliers. The paper constructs several hypotheses based on the transaction-cost and resource- dependence approaches, and tests these hypotheses by using data from the automobile suppliers. Our study shows: (1) the resource-dependence approach seemed more effective in explaining EDI adoption, while the transaction-cost approach seemed more effective in explaining EDI integration; (2) the transac...

  6. Pro EDI in BizTalk Server 2006 R2 electronic document interchange solutions

    CERN Document Server

    Beckner, Mark

    2008-01-01

    As business becomes more dependent on working with partners, suppliers, and other organizations in a streamlined way, Electronic Data Interchange (EDI) is one of the next big waves in connected systems. Microsoft BizTalk Server 2006 R2 offers an efficient, integrated way to deploy EDI solutions, and with the help of this book, readers will see how EDI can be used in their business and how best to get it set up with BizTalk. This book offers insights into the brand-new Biztalk 2006 R2--based EDI functionality, including the far greater flexibility in handling interchange. It gives advice coveri

  7. The new Exponential Directional Iterative (EDI) 3-D Sn scheme for parallel adaptive differencing

    International Nuclear Information System (INIS)

    Sjoden, G.E.

    2005-01-01

    The new Exponential Directional Iterative (EDI) discrete ordinates (Sn) scheme for 3-D Cartesian Coordinates is presented. The EDI scheme is a logical extension of the positive, efficient Exponential Directional Weighted (EDW) Sn scheme currently used as the third level of the adaptive spatial differencing algorithm in the PENTRAN parallel discrete ordinates solver. Here, the derivation and advantages of the EDI scheme are presented; EDI uses EDW-rendered exponential coefficients as initial starting values to begin a fixed point iteration of the exponential coefficients. One issue that required evaluation was an iterative cutoff criterion to prevent the application of an unstable fixed point iteration; although this was needed in some cases, it was readily treated with a default to EDW. Iterative refinement of the exponential coefficients in EDI typically converged in fewer than four fixed point iterations. Moreover, EDI yielded more accurate angular fluxes compared to the other schemes tested, particularly in streaming conditions. Overall, it was found that the EDI scheme was up to an order of magnitude more accurate than the EDW scheme on a given mesh interval in streaming cases, and is potentially a good candidate as a fourth-level differencing scheme in the PENTRAN adaptive differencing sequence. The 3-D Cartesian computational cost of EDI was only about 20% more than the EDW scheme, and about 40% more than Diamond Zero (DZ). More evaluation and testing are required to determine suitable upgrade metrics for EDI to be fully integrated into the current adaptive spatial differencing sequence in PENTRAN. (author)

  8. Measurement Invariance of Early Development Instrument (EDI) Domain Scores across Gender and ESL Status

    Science.gov (United States)

    Mousavi, Amin; Krishnan, Vijaya

    2016-01-01

    The Early Development Instrument (EDI) is a widely used teacher rating tool to assess kindergartners' developmental outcomes in Canada and a number of other countries. This paper examines the measurement invariance of EDI domains across ESL status and gender by means of multi-group confirmatory factor analysis. The results suggest evidence of…

  9. Does the EDI Equivalently Measure Facets of School Readiness for Aboriginal and Non-Aboriginal Children?

    Science.gov (United States)

    Muhajarine, Nazeem; Puchala, Chassidy; Janus, Magdalena

    2011-01-01

    The aim of the current paper was to examine the equivalence of the Early Development Instrument (EDI), a teacher rating measure of school readiness, for Aboriginal and non-Aboriginal children. The current study used an approach, which analyzes the structure and properties of the EDI at the subdomain level. Similar subdomain score distributions…

  10. 41 CFR 102-118.550 - How does a TSP file an administrative claim using EDI or other electronic means?

    Science.gov (United States)

    2010-07-01

    ... administrative claim using EDI or other electronic means? 102-118.550 Section 102-118.550 Public Contracts and... EDI or other electronic means? The medium and precise format of data for an administrative claim filed electronically must be approved in advance by the GSA Audit Division. GSA will use an authenticating EDI...

  11. Statistical properties of effective drought index (EDI) for Seoul, Busan, Daegu, Mokpo in South Korea

    Science.gov (United States)

    Park, Jong-Hyeok; Kim, Ki-Beom; Chang, Heon-Young

    2014-08-01

    Time series of drought indices has been considered mostly in view of temporal and spatial distributions of a drought index so far. Here we investigate the statistical properties of a daily Effective Drought Index (EDI) itself for Seoul, Busan, Daegu, Mokpo for the period of 100 years from 1913 to 2012. We have found that both in dry and wet seasons the distribution of EDI as a function of EDI follows the Gaussian function. In dry season the shape of the Gaussian function is characteristically broader than that in wet seasons. The total number of drought days during the period we have analyzed is related both to the mean value and more importantly to the standard deviation. We have also found that according to the distribution of the number of occasions where the EDI values of several consecutive days are all less than a threshold, the distribution follows the exponential distribution. The slope of the best fit becomes steeper not only as the critical EDI value becomes more negative but also as the number of consecutive days increases. The slope of the exponential distribution becomes steeper as the number of the city in which EDI is simultaneously less than a critical EDI in a row increases. Finally, we conclude by pointing out implications of our findings.

  12. Magnetic field gradients inferred from multi-point measurements of Cluster FGM and EDI

    Science.gov (United States)

    Teubenbacher, Robert; Nakamura, Rumi; Giner, Lukas; Plaschke, Ferdinand; Baumjohann, Wolfgang; Magnes, Werner; Eichelberger, Hans; Steller, Manfred; Torbert, Roy

    2013-04-01

    We use Cluster data from fluxgate magnetometer (FGM) and electron drift instrument (EDI) to determine the magnetic field gradients in the near-Earth magnetotail. Here we use the magnetic field data from FGM measurements as well as the gyro-time data of electrons determined from the time of flight measurements of EDI. The results are compared with the values estimated from empirical magnetic field models for different magnetospheric conditions. We also estimated the spin axis offset of FGM based on comparison between EDI and FGM data and discuss the possible effect in determining the current sheet characteristics.

  13. Interhemispheric differences in ionospheric convection: Cluster EDI observations revisited

    Science.gov (United States)

    Förster, M.; Haaland, S.

    2015-07-01

    The interaction between the interplanetary magnetic field and the geomagnetic field sets up a large-scale circulation in the magnetosphere. This circulation is also reflected in the magnetically connected ionosphere. In this paper, we present a study of ionospheric convection based on Cluster Electron Drift Instrument (EDI) satellite measurements covering both hemispheres and obtained over a full solar cycle. The results from this study show that average flow patterns and polar cap potentials for a given orientation of the interplanetary magnetic field can be very different in the two hemispheres. In particular during southward directed interplanetary magnetic field conditions, and thus enhanced energy input from the solar wind, the measurements show that the southern polar cap has a higher cross polar cap potential. There are persistent north-south asymmetries, which cannot easily be explained by the influence of external drivers. These persistent asymmetries are primarily a result of the significant differences in the strength and configuration of the geomagnetic field between the Northern and Southern Hemispheres. Since the ionosphere is magnetically connected to the magnetosphere, this difference will also be reflected in the magnetosphere in the form of different feedback from the two hemispheres. Consequently, local ionospheric conditions and the geomagnetic field configuration are important for north-south asymmetries in large regions of geospace.

  14. An arithmetic transference proof of a relative Szemer\\'edi theorem

    OpenAIRE

    Zhao, Yufei

    2013-01-01

    Recently Conlon, Fox, and the author gave a new proof of a relative Szemer\\'edi theorem, which was the main novel ingredient in the proof of the celebrated Green-Tao theorem that the primes contain arbitrarily long arithmetic progressions. Roughly speaking, a relative Szemer\\'edi theorem says that if S is a set of integers satisfying certain conditions, and A is a subset of S with positive relative density, then A contains long arithmetic progressions, and our recent results show that S only ...

  15. Rancang Bangun Aplikasi Transaksi Elektronik Ritel Pupuk Dengan Metode Electronic Data Interchange (EDI

    Directory of Open Access Journals (Sweden)

    Nelly Oktavia Adiwijaya

    2015-03-01

    Full Text Available Fertilizer distribution from distributor to agents, are required to be responsive in addressing the demand for fertilizers. Distributors are also required to be able to manage inventory in the warehouse, to avoid overstocking of fertilizer. Design and implementation of a fertilizer retail electronic commerce applications using electronic data interchange (EDI method is applied in this study. The system is built to help distributors to control the existence of the stock of fertilizer so no excess stock. In addition, the use of EDI can provide information quickly (real-time without having to go directly to the warehouse locations.

  16. The EDIE method – towards an approach to collaboration-based persuasive design

    DEFF Research Database (Denmark)

    Hansen, Sandra Burri Gram

    2016-01-01

    This paper presents the initial steps towards a collaboration-based method for persuasive design – the EDIE method (Explore, Design, Implement, Evaluate). The method is inspired by Design-Based Research, but developed to combine different design approaches that have dominated the persuasive...... technology field over the past decade. The rhetorical notion of Kairos is considered a key element in the EDIE method, resulting in a distinct focus on participatory design and constructive ethics. The method is explained through a practical example of developing persuasive learning designs in collaboration...

  17. JST Thesaurus Headwords and Synonyms: EDI [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term EDI 名詞 一般 * * * * EDI【情報交換】 EDI イーディーアイ Thesaurus2015 200906091295492920 C EG01 UNKNOWN_1 EDI

  18. Numerical simulation of the electrodeionization (EDI) process accounting for water dissociation

    International Nuclear Information System (INIS)

    Lu Jun; Wang Yuxin; Zhu Jia

    2010-01-01

    The electrodeionization process (EDI) is usually operated at overlimiting current density, and is thus characterized by water dissociation and concentration polarization. We attempt to study the useful and harmful effects of water dissociation on the EDI process. A numerical steady state model was established to simulate the process of EDI, accounting for the effects of water dissociation. The differences in concentration polarization of membranes were investigated to study the effects of water dissociation on cation and anion membranes. Protons produced by water dissociation caused the resin to transform into the H-form. The H-form resin, which has high conductivity and high transport number, depletes protons in the interstitial solution. This explains the experimentally detected phenomenon that at high current densities, the pH value of the effluency of the dilute compartment (DC) stops decreasing when current increases. We suggest that the useful role of water dissociation in EDI is due to the H-form resin bringing more salt cations of the interstitial solution into the resin phase, thus producing a high conductivity channel for the electro-migration of the salt cations. This mechanism avoids the decrease in salt ion conductivity brought about by concentration polarization. The disadvantageous effect of concentration polarization on the transportation of salt ions in interstitial solution is thus lessened. An intermediate point between the useful and harmful effects of water dissociation was determined by the dependence of current efficiency and removal rate for both cations and anions as a function of current density.

  19. Identification of Disciplines and Fields. Edis Task I Report, Work Unit 1.4.

    Science.gov (United States)

    Howard Research Co., Arlington, VA.

    This report presents the identification and definitions of subject oriented engineering and scientific disciplines and fields which are included in the EDIS Subject Categories. The discussion is extended to include the mix of subjects with other orientations, such as Item, Mission-Project, Expertise and Data Bank Categories. Sample queries are…

  20. Validation of Multilevel Constructs: Validation Methods and Empirical Findings for the EDI

    Science.gov (United States)

    Forer, Barry; Zumbo, Bruno D.

    2011-01-01

    The purposes of this paper are to highlight the foundations of multilevel construct validation, describe two methodological approaches and associated analytic techniques, and then apply these approaches and techniques to the multilevel construct validation of a widely-used school readiness measure called the Early Development Instrument (EDI;…

  1. EdiPy: a resource to simulate the evolution of plant mitochondrial genes under the RNA editing.

    Science.gov (United States)

    Picardi, Ernesto; Quagliariello, Carla

    2006-02-01

    EdiPy is an online resource appropriately designed to simulate the evolution of plant mitochondrial genes in a biologically realistic fashion. EdiPy takes into account the presence of sites subjected to RNA editing and provides multiple artificial alignments corresponding to both genomic and cDNA sequences. Each artificial data set can successively be submitted to main and widespread evolutionary and phylogenetic software packages such as PAUP, Phyml, PAML and Phylip. As an online bioinformatic resource, EdiPy is available at the following web page: http://biologia.unical.it/py_script/index.html.

  2. Ediţii ale Clasificării Zecimale Dewey

    Directory of Open Access Journals (Sweden)

    Zenovia Niculescu

    2009-01-01

    Full Text Available Studiul abordează evoluţia ediţiilor C.Z.D. din perspective actualizării terminologiei, realocărilor şi extinderii structurii principale şi auxiliare a limbajului de indexare Dewey. Analiza comparativă a ediţiilor C.Z.D. reflectă amplificarea şi eficientizarea schemei Dewey din punct de vedere al îmbunătăţirii ofertei informaţionale, prin indici de bază revizuiţi şi dezvoltaţi, precum şi a valorizării notaţiilor auxiliare.

  3. Choroidal Thickness Analysis in Patients with Usher Syndrome Type 2 Using EDI OCT

    OpenAIRE

    Colombo, L.; Sala, B.; Montesano, G.; Pierrottet, C.; De Cillà, S.; Maltese, P.; Bertelli, M.; Rossetti, L.

    2015-01-01

    To portray Usher Syndrome type 2, analyzing choroidal thickness and comparing data reported in published literature on RP and healthy subjects. Methods. 20 eyes of 10 patients with clinical signs and genetic diagnosis of Usher Syndrome type 2. Each patient underwent a complete ophthalmologic examination including Best Corrected Visual Acuity (BCVA), intraocular pressure (IOP), axial length (AL), automated visual field (VF), and EDI OCT. Both retinal and choroidal measures were measured. Stati...

  4. DOD Electronic Commerce (EC)/Electronic Data Interchange (EDI) in contracting report

    Science.gov (United States)

    1993-12-01

    Use of Electronic Commerce (EC)/Electronic Data Interchange (EDI) to support Department of Defense (DoD) procurement processes has been under consideration for some time. A 1988 Deputy Secretary of Defense memo calls for maximum use of EDI, based on 10 years of DoD EDI investigation and experiments. In 1990, Defense Management Review Decision 941 stated, 'The strategic goal of DoD's current efforts is to provide the department with the capability to initiate, conduct, and maintain its external business related transactions and internal logistics, contracting, and financial activities without requiring the use of hard copy media.' The EC in Contracting PAT membership reflected a broad cross section of Military Services and Defense Agencies working on a full-time basis for 60 days. The diversity of the EC in Contracting PAT ensured that the needs and concerns of all DoD components were addressed during the creation of the report. The resultant plan, therefore, represents a comprehensive approach for implementing EC throughout the DoD.

  5. Investigation of the effect of heated ethanol fuel on combustion and emissions of an ethanol direct injection plus gasoline port injection (EDI + GPI) engine

    International Nuclear Information System (INIS)

    Huang, Yuhan; Hong, Guang

    2016-01-01

    Highlights: • Effect of EDI heating on the EDI + GPI engine performance was investigated. • CO and HC were significantly reduced and NO was slightly increased by EDI heating. • IMEP and combustion speed were slightly reduced by EDI heating. • EDI heating is effective to address the evaporation and over-cooling issues of EDI + GPI engine. - Abstract: Ethanol direct injection plus gasoline port injection (EDI + GPI) is a new technology to utilise ethanol fuel more efficiently and flexibly in spark ignition engines. One issue needs to be addressed in the development of EDI + GPI is the ethanol fuel’s low vapour pressure and large latent heat which slow down the ethanol’s evaporation and result in the mixture unready for combustion by the time of spark ignition and the consequent increase of CO and HC emissions. Heating the ethanol fuel to be directly injected (EDI heating) has been proposed to address this issue. This paper reports the investigation of the effect of EDI heating on the combustion and emissions of a research engine equipped with EDI + GPI. The results showed that EDI heating effectively reduced the CO and HC emissions of the engine due to the increase of evaporation rate and reduced fuel impingement and local over-cooling. The reduction of CO and HC became more significant with the increase of ethanol ratio. When the temperature of the ethanol fuel was increased by 40 °C, the CO and HC were reduced by as much as 43% and 51% respectively in EDI only condition at the original spark timing of 15 CAD BTDC, and 15% and 47% respectively at the minimum spark advance for best torque (MBT) timing of 19 CAD BTDC. On the other hand, the NO emission was slightly increased, but still much smaller than that in GPI only condition due to the strong cooling effect and low combustion temperature of EDI. The IMEP and combustion speed were slightly reduced by EDI heating due to the decrease of injector fuel flow rate and spray collapse of flash-boiling. The

  6. Direct Observations of ULF and Whistler-Mode Chorus Modulation of 500eV EDI Electrons by MMS

    Science.gov (United States)

    Paulson, K. W.; Argall, M. R.; Ahmadi, N.; Torbert, R. B.; Le Contel, O.; Ergun, R.; Khotyaintsev, Y. V.; Strangeway, R. J.; Magnes, W.; Russell, C. T.

    2016-12-01

    We present here direct observations of chorus-wave modulated field-aligned 500 eV electrons using the Electron Drift Instrument (EDI) on board the Magnetospheric Multiscale mission. These periods of wave activity were additionally observed to be modulated by Pc5-frequency magnetic perturbations, some of which have been identified as drifting mirror-mode structures. The spacecraft encountered these mirror-mode structures just inside of the duskside magnetopause. Using the high sampling rate provided by EDI in burst sampling mode, we are able to observe the individual count fluctuations of field-aligned electrons in this region up to 512 Hz. We use the multiple look directions of EDI to generate both pitch angle and gyrophase plots of the fluctuating counts. Our observations often show unidirectional flow of these modulated electrons along the background field, and in some cases demonstrate gyrophase bunching in the wave region.

  7. Research-Based Teacher Education and Professional Development. Achievements and Contributions of EDiTE

    Directory of Open Access Journals (Sweden)

    Rozalia Małgorzata Ligus

    2013-12-01

    Full Text Available This article’s aim is to describe some of the sources of the European debate over the third cycle studies in teacher education in Europe. Then it will introduce the international Project EDiTE as one of the collaborative initiatives concerning the European scientific proposal of the teachers’ lifelong learning development. Next, some good practices of promoting the doctoral research based teacher education on national levels will be presented. Finally, in the article, there will be revealed selected findings of the EDiTE team that are focused on the current needs in teacher education that have been pointed by different stakeholders of five European countries represented by the project consortium, while interviewing them in 2013 y. The main goal of this article is to involve the stakeholders in a thought provoking debate for future roles of teachers in Europe, but not through looking for a ‘standardized teacher model’ or to create a ‘European super teacher’, but to see the dilemmas that should be shared while questioning ‘What makes a teacher European?,’ as Michael Schratz underlines, in a diversity of national identities and in the face of challenges of 21st century.

  8. Conventional resin cation exchangers versus EDI for CACE measurement in power plants. Feasibility and practical field results

    Energy Technology Data Exchange (ETDEWEB)

    Sigrist, Manuel [Swan Systeme AG, Hinwil (Switzerland)

    2017-10-15

    The conductivity measurement after a cation exchanger in power plants with steam turbines was introduced soon after 1950 by Larson and Lane. Due to the simple measuring principle, the sensitivity to ionic contaminations and to its high reliability, the conductivity measurement after a cation exchanger (CACE) has become the most commonly used online analytical method in power plants with steam generators. Swan has investigated electro deionisation (EDI) as substitution of the conventional cation exchange resin and has developed a new conductivity instrument using this principle. This paper provides a description of the conventional method for cation conductivity measurements as well as of the new AMI CACE using EDI method.

  9. Conventional resin cation exchangers versus EDI for CACE measurement in power plants. Feasibility and practical field results

    International Nuclear Information System (INIS)

    Sigrist, Manuel

    2017-01-01

    The conductivity measurement after a cation exchanger in power plants with steam turbines was introduced soon after 1950 by Larson and Lane. Due to the simple measuring principle, the sensitivity to ionic contaminations and to its high reliability, the conductivity measurement after a cation exchanger (CACE) has become the most commonly used online analytical method in power plants with steam generators. Swan has investigated electro deionisation (EDI) as substitution of the conventional cation exchange resin and has developed a new conductivity instrument using this principle. This paper provides a description of the conventional method for cation conductivity measurements as well as of the new AMI CACE using EDI method.

  10. Analysis of Dream in Gholamhossein Sa'edi's Short Stories: A Model for Dream Analysis in Literary Works

    Science.gov (United States)

    Veskari, Hassan; Pouralkhas, Shokrollah; Moharrami, Ramin; Ranjbar, Ebrahim

    2017-01-01

    Gholam Hussein Sa'edi is one of the greatest Iranian writers of short stories in the present era. Sa'edi's stories are based on the existence of fanciful and dreamlike settings in which he attempts to establish the endings of the stories to be the direct result of the characters' psychological reaction against their dreams. The linguistic and…

  11. Mining inter-organizational business process models from EDI messages : a case study from the automotive sector

    NARCIS (Netherlands)

    Engel, R.; Aalst, van der W.M.P.; Zapletal, M.; Pichler, C.; Werthner, H.; Ralyté, J.; Franch, X.; Brinkkemper, S.; Wrycza, S.

    2012-01-01

    Traditional standards for Electronic Data Interchange (EDI), such as EDIFACT and ANSI X12, have been employed in Business-to-Business (B2B) e-commerce for decades. Due to their wide industry coverage and long-standing establishment, they will presumably continue to play an important role for some

  12. Inter-Organizational Trust in EDI Adoption: The Case of Ford Motor Company and PBR Limited in Australia.

    Science.gov (United States)

    Ratnasingam, Pauline

    2001-01-01

    This study examines behavioral dimensions of trading partner trust in EDI (electronic data interchange) adoption via a qualitative interpretative case study conducted between an automotive manufacturer (Ford Motor Company) in Australia and their first tier supplier, PBR Limited. Findings suggest that trust is important for cooperative long-term…

  13. O Encheirídion de Epicteto: Edição Bilíngue

    Directory of Open Access Journals (Sweden)

    Aldo Lopes Dinucci

    2012-02-01

    Full Text Available Edição bilíngue do Encheirídion de Epicteto, obra do aluno de Epicteto (55-135 e cidadão romano de origem grega Lúcio Flávio Arriano de Nicomédia (86-160. Tal tradução, produzida por Aldo Dinucci (doutor em filosofia pela PUC-RJ e professor associado do Departamento de Filosofia da UFS e Alfredo Julien (doutor em história pela USP e professor adjunto do Departamento de História da UFS, foi financiada pelo CNPq (edital MCT/CNPq 02/2009 - Ciências Humanas, Sociais e Sociais Aplicadas.

  14. Millisecond resolution electron fluxes from the Cluster satellites: Calibrated EDI ambient electron data

    Science.gov (United States)

    Förster, Matthias; Rashev, Mikhail; Haaland, Stein

    2017-04-01

    The Electron Drift Instrument (EDI) onboard Cluster can measure 500 eV and 1 keV electron fluxes with high time resolution during passive operation phases in its Ambient Electron (AE) mode. Data from this mode is available in the Cluster Science Archive since October 2004 with a cadence of 16 Hz in the normal mode or 128 Hz for burst mode telemetry intervals. The fluxes are recorded at pitch angles of 0, 90, and 180 degrees. This paper describes the calibration and validation of these measurements. The high resolution AE data allow precise temporal and spatial diagnostics of magnetospheric boundaries and will be used for case studies and statistical studies of low energy electron fluxes in the near-Earth space. We show examples of applications.

  15. Drought severity in intensive agricultural areas by means of the EDI index

    Science.gov (United States)

    Procházková, Petra; Chuchma, Filip; Středa, Tomáš

    2016-12-01

    The aim of this work was the evaluation of drought severity development in the Czech Republic for the period 1971-2015 by the means of the Effective Drought Index (EDI). Annual values of the EDI index were determined using the method of effective precipitation for 14 localities spread throughout the Czech Republic (Central Europe). The seven categories were created according to obtained index values for the drought conditions determination for years during the period 1971-2015 through the percentile method. The annual index values were compared with acquired 2nd, 15th, 45th, 55th, 85th and 98th percentiles. Both the years with precipitation unfavourable conditions: 1972, 1973, 1984, 1990, 1991, 1992, 1993 and 2015 and the years with precipitation favourable conditions: 1977, 1987, 1995, 2001, 2002 and 2010 were determined. Precipitation conditions in the growing season from 61st to 180th day of the year were also analysed. This evaluation was conducted during the period 1971-2015 through the ten-day index values which were compared with acquired 2nd, 15th, 45th, 55th, 85th and 98th percentiles. Dry growing seasons occurred in 1973, 1974, 1976 and 1993. Wet growing seasons occurred in 1987, 2006 and 2010. Trend analysis of annual index values was performed through the Mann-Kendall test. Highly statistically significant increasing linear trends (P < 0.01) were found for four localities (Uherský Ostroh, Vysoká, Znojmo-Oblekovice and Žatec); statistically significant increasing trends (P < 0.05) were found for three localities (Brno-Chrlice, Lednice and Lípa). Based on the extrapolation of the trend, a slightly higher effective precipitation can be expected during the year in a substantial part of the country. However, these findings do not necessarily mean an optimal supply of agricultural land with water. Precipitation exhibits considerable unevenness of distribution through time. Given the increasing evapotranspiration demands of the environment their

  16. Transfer of Air Force technical procurement bid set data to small businesses, using CALS and EDI: Test report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-08-15

    This report documents a test transfer of three Air Force technical procurement bid sets to one large and twelve small businesses, using the Department of Defense (DoD) Continuous Acquisition and Life-cycle Support (CALS) and ANSI ASC X12 Electronic Data Interchange (EDI) standards. The main goal of the test was to evaluate the effectiveness of using CALS technical data within the context of the DoD`s EDI-based standard approach to electronic commerce in procurement, with particular emphasis on receipt and use of the data by small contractors. Air Force procurement data was provided by the Sacramento Air Logistics Center at McClellan Air Force Base; the manufacturing participants were selected from among McClellan`s ``Blue Ribbon`` contractors, located throughout the US. The test was sponsored by the Air Force CALS Test Network, headquartered at Wright-Patterson Air Force Base. The test successfully demonstrated the technical feasibility of including CALS MIL-R-28002 (Raster) engineering data in an EDI Specification/Technical Information transaction set (ANSI ASC X12 841) when issuing electronic requests for quotation to small businesses. In many cases, the data was complete enough for the contractor participant to feel comfortable generating a quote. Lessons learned from the test are being fed back to the CALS and EDI standards organizations, and to future implementors of CALS-EDI based acquisition or contracting systems, which require the transfer of technical information, such as engineering data, manufacturing process data, quality test data, and other product or process data, in the form of a CALS or other digital datafile.

  17. Transfer of Air Force technical procurement bid set data to small businesses, using CALS and EDI. Summary report. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-01-10

    This report provides a summary of the Air Force CALS Test Network (AFCTN) Test Report Transfer of Air Force Technical Procurement Bid Set Data to Small Businesses, Using CALS and EDI (AFCTN Test Report 94-034, UCRL-ID-118619). It represents a synthesis of the results, conclusions, and recommendations, as well as a more concise presentation of the issues and strategies as viewed from AFCTN`s perspective. This report documents a test transfer of three Air Force technical procurement bid sets to one large and twelve small businesses, using the Department of Defense (DoD) Continuous Acquisition and Life-cycle Support (CALS) and ANSI ASC X12 Electronic Data Interchange (EDI) standards. The main goal of the test was to evaluate the effectiveness of using CALS technical data within the context of the DoD`s EDI-based standard approach to electronic commerce in procurement, with particular emphasis on receipt and use of the data by small contractors. Air Force procurement data was provided by the Sacramento Air Logistics Center at McClellan Air Force Base; the manufacturing participants were selected from among McClellan`s {open_quote}Blue Ribbon{close_quote} contractors, located throughout the United States. The test was sponsored by the Air Force CALS Test Network, headquartered at Wright-Patterson Air Force Base. The test successfully demonstrated the technical feasibility of including CALS MIL-R-28002 (Raster) engineering data in an EDI Specification/Technical Information transaction set (ANSI ASC X12 841) when issuing electronic requests for quotation to small businesses. In many cases, the data was complete enough for the contractor participant to feel comfortable generating a quote.

  18. Calibrating MMS Electron Drift Instrument (EDI) Ambient Electron Flux Measurements and Characterizing 3D Electric Field Signatures of Magnetic Reconnection

    Science.gov (United States)

    Shuster, J. R.; Torbert, R. B.; Vaith, H.; Argall, M. R.; Li, G.; Chen, L. J.; Ergun, R. E.; Lindqvist, P. A.; Marklund, G. T.; Khotyaintsev, Y. V.; Russell, C. T.; Magnes, W.; Le Contel, O.; Pollock, C. J.; Giles, B. L.

    2015-12-01

    The electron drift instruments (EDIs) onboard each MMS spacecraft are designed with large geometric factors (~0.01cm2 str) to facilitate detection of weak (~100 nA) electron beams fired and received by the two gun-detector units (GDUs) when EDI is in its "electric field mode" to determine the local electric and magnetic fields. A consequence of the large geometric factor is that "ambient mode" electron flux measurements (500 eV electrons having 0°, 90°, or 180° pitch angle) can vary depending on the orientation of the EDI instrument with respect to the magnetic field, a nonphysical effect that requires a correction. Here, we present determinations of the θ- and ø-dependent correction factors for the eight EDI GDUs, where θ (ø) is the polar (azimuthal) angle between the GDU symmetry axis and the local magnetic field direction, and compare the corrected fluxes with those measured by the fast plasma instrument (FPI). Using these corrected, high time resolution (~1,000 samples per second) ambient electron fluxes, combined with the unprecedentedly high resolution 3D electric field measurements taken by the spin-plane and axial double probes (SDP and ADP), we are equipped to accurately detect electron-scale current layers and electric field waves associated with the non-Maxwellian (anisotropic and agyrotropic) particle distribution functions predicted to exist in the reconnection diffusion region. We compare initial observations of the diffusion region with distributions and wave analysis from PIC simulations of asymmetric reconnection applicable for modeling reconnection at the Earth's magnetopause, where MMS will begin Science Phase 1 as of September 1, 2015.

  19. Choroidal Thickness Analysis in Patients with Usher Syndrome Type 2 Using EDI OCT.

    Science.gov (United States)

    Colombo, L; Sala, B; Montesano, G; Pierrottet, C; De Cillà, S; Maltese, P; Bertelli, M; Rossetti, L

    2015-01-01

    To portray Usher Syndrome type 2, analyzing choroidal thickness and comparing data reported in published literature on RP and healthy subjects. Methods. 20 eyes of 10 patients with clinical signs and genetic diagnosis of Usher Syndrome type 2. Each patient underwent a complete ophthalmologic examination including Best Corrected Visual Acuity (BCVA), intraocular pressure (IOP), axial length (AL), automated visual field (VF), and EDI OCT. Both retinal and choroidal measures were measured. Statistical analysis was performed to correlate choroidal thickness with age, BCVA, IOP, AL, VF, and RT. Comparison with data about healthy people and nonsyndromic RP patients was performed. Results. Mean subfoveal choroidal thickness (SFCT) was 248.21 ± 79.88 microns. SFCT was statistically significant correlated with age (correlation coefficient -0.7248179, p patients (p = 0.2138). Conclusions. Our study demonstrated in vivo choroidal thickness reduction in patients with Usher Syndrome type 2. These data are important for the comprehension of mechanisms of disease and for the evaluation of therapeutic approaches.

  20. Plasma convection in the magnetotail lobes: statistical results from Cluster EDI measurements

    Directory of Open Access Journals (Sweden)

    S. Haaland

    2008-08-01

    Full Text Available A major part of the plasma in the Earth's magnetotail is populated through transport of plasma from the solar wind via the magnetotail lobes. In this paper, we present a statistical study of plasma convection in the lobes for different directions of the interplanetary magnetic field and for different geomagnetic disturbance levels. The data set used in this study consists of roughly 340 000 one-minute vector measurements of the plasma convection from the Cluster Electron Drift Instrument (EDI obtained during the period February 2001 to June 2007. The results show that both convection magnitude and direction are largely controlled by the interplanetary magnetic field (IMF. For a southward IMF, there is a strong convection towards the central plasma sheet with convection velocities around 10 km s−1. During periods of northward IMF, the lobe convection is almost stagnant. A By dominated IMF causes a rotation of the convection patterns in the tail with an oppositely directed dawn-dusk component of the convection for the northern and southern lobe. Our results also show that there is an overall persistent duskward component, which is most likely a result of conductivity gradients in the footpoints of the magnetic field lines in the ionosphere.

  1. Choroidal Thickness Analysis in Patients with Usher Syndrome Type 2 Using EDI OCT

    Directory of Open Access Journals (Sweden)

    L. Colombo

    2015-01-01

    Full Text Available To portray Usher Syndrome type 2, analyzing choroidal thickness and comparing data reported in published literature on RP and healthy subjects. Methods. 20 eyes of 10 patients with clinical signs and genetic diagnosis of Usher Syndrome type 2. Each patient underwent a complete ophthalmologic examination including Best Corrected Visual Acuity (BCVA, intraocular pressure (IOP, axial length (AL, automated visual field (VF, and EDI OCT. Both retinal and choroidal measures were measured. Statistical analysis was performed to correlate choroidal thickness with age, BCVA, IOP, AL, VF, and RT. Comparison with data about healthy people and nonsyndromic RP patients was performed. Results. Mean subfoveal choroidal thickness (SFCT was 248.21±79.88 microns. SFCT was statistically significant correlated with age (correlation coefficient −0.7248179, p<0.01. No statistically significant correlation was found between SFCT and BCVA, IOP, AL, VF, and RT. SFCT was reduced if compared to healthy subjects (p<0.01. No difference was found when compared to choroidal thickness from nonsyndromic RP patients (p=0.2138. Conclusions. Our study demonstrated in vivo choroidal thickness reduction in patients with Usher Syndrome type 2. These data are important for the comprehension of mechanisms of disease and for the evaluation of therapeutic approaches.

  2. A novel PSB-EDI system for high ammonia wastewater treatment, biomass production and nitrogen resource recovery: PSB system.

    Science.gov (United States)

    Wang, Hangyao; Zhou, Qin; Zhang, Guangming; Yan, Guokai; Lu, Haifeng; Sun, Liyan

    A novel process coupling photosynthetic bacteria (PSB) with electrodeionization (EDI) treatment was proposed to treat high ammonia wastewater and recover bio-resources and nitrogen. The first stage (PSB treatment) was used to degrade organic pollutants and accumulate biomass, while the second stage (EDI) was for nitrogen removal and recovery. The first stage was the focus in this study. The results showed that using PSB to transform organic pollutants in wastewater into biomass was practical. PSB could acclimatize to wastewater with a chemical oxygen demand (COD) of 2,300 mg/L and an ammonia nitrogen (NH4(+)-N) concentration of 288-4,600 mg/L. The suitable pH was 6.0-9.0, the average COD removal reached 80%, and the biomass increased by an average of 9.16 times. The wastewater COD removal was independent of the NH4(+)-N concentration. Moreover, the PSB functioned effectively when the inoculum size was only 10 mg/L. The PSB-treated wastewater was then further handled in an EDI system. More than 90% of the NH4(+)-N was removed from the wastewater and condensed in the concentrate, which could be used to produce nitrogen fertilizer. In the whole system, the average NH4(+)-N removal was 94%, and the average NH4(+)-N condensing ratio was 10.0.

  3. Inter-instrument calibration using magnetic field data from Flux Gate Magnetometer (FGM) and Electron Drift Instrument (EDI) onboard Cluster

    Science.gov (United States)

    Nakamura, R.; Plaschke, F.; Teubenbacher, R.; Giner, L.; Baumjohann, W.; Magnes, W.; Steller, M.; Torbert, R. B.; Vaith, H.; Chutter, M.; Fornaçon, K.-H.; Glassmeier, K.-H.; Carr, C.

    2013-07-01

    We compare the magnetic field data obtained from the Flux-Gate Magnetometer (FGM) and the magnetic field data deduced from the gyration time of electrons measured by the Electron Drift Instrument (EDI) onboard Cluster to determine the spin axis offset of the FGM measurements. Data are used from orbits with their apogees in the magnetotail, when the magnetic field magnitude was between about 20 nT and 500 nT. Offset determination with the EDI-FGM comparison method is of particular interest for these orbits, because no data from solar wind are available in such orbits to apply the usual calibration methods using the Alfvén waves. In this paper, we examine the effects of the different measurement conditions, such as direction of the magnetic field relative to the spin plane and field magnitude in determining the FGM spin-axis offset, and also take into account the time-of-flight offset of the EDI measurements. It is shown that the method works best when the magnetic field magnitude is less than about 128 nT and when the magnetic field is aligned near the spin-axis direction. A remaining spin-axis offset of about 0.4 ~ 0.6 nT was observed between July and October 2003. Using multi-point multi-instrument measurements by Cluster we further demonstrate the importance of the accurate determination of the spin-axis offset when estimating the magnetic field gradient.

  4. Interinstrument calibration using magnetic field data from the flux-gate magnetometer (FGM) and electron drift instrument (EDI) onboard Cluster

    Science.gov (United States)

    Nakamura, R.; Plaschke, F.; Teubenbacher, R.; Giner, L.; Baumjohann, W.; Magnes, W.; Steller, M.; Torbert, R. B.; Vaith, H.; Chutter, M.; Fornaçon, K.-H.; Glassmeier, K.-H.; Carr, C.

    2014-01-01

    We compare the magnetic field data obtained from the flux-gate magnetometer (FGM) and the magnetic field data deduced from the gyration time of electrons measured by the electron drift instrument (EDI) onboard Cluster to determine the spin-axis offset of the FGM measurements. Data are used from orbits with their apogees in the magnetotail, when the magnetic field magnitude was between about 20 and 500 nT. Offset determination with the EDI-FGM comparison method is of particular interest for these orbits, because no data from solar wind are available in such orbits to apply the usual calibration methods using the Alfvén waves. In this paper, we examine the effects of the different measurement conditions, such as direction of the magnetic field relative to the spin plane and field magnitude in determining the FGM spin-axis offset, and also take into account the time-of-flight offset of the EDI measurements. It is shown that the method works best when the magnetic field magnitude is less than about 128 nT and when the magnetic field is aligned near the spin-axis direction. A remaining spin-axis offset of about 0.4 ∼ 0.6 nT was observed for Cluster 1 between July and October 2003. Using multipoint multi-instrument measurements by Cluster we further demonstrate the importance of the accurate determination of the spin-axis offset when estimating the magnetic field gradient.

  5. Assisted editing od SensorML with EDI. A bottom-up scenario towards the definition of sensor profiles.

    Science.gov (United States)

    Oggioni, Alessandro; Tagliolato, Paolo; Fugazza, Cristiano; Bastianini, Mauro; Pavesi, Fabio; Pepe, Monica; Menegon, Stefano; Basoni, Anna; Carrara, Paola

    2015-04-01

    Sensor observation systems for environmental data have become increasingly important in the last years. The EGU's Informatics in Oceanography and Ocean Science track stressed the importance of management tools and solutions for marine infrastructures. We think that full interoperability among sensor systems is still an open issue and that the solution to this involves providing appropriate metadata. Several open source applications implement the SWE specification and, particularly, the Sensor Observation Services (SOS) standard. These applications allow for the exchange of data and metadata in XML format between computer systems. However, there is a lack of metadata editing tools supporting end users in this activity. Generally speaking, it is hard for users to provide sensor metadata in the SensorML format without dedicated tools. In particular, such a tool should ease metadata editing by providing, for standard sensors, all the invariant information to be included in sensor metadata, thus allowing the user to concentrate on the metadata items that are related to the specific deployment. RITMARE, the Italian flagship project on marine research, envisages a subproject, SP7, for the set-up of the project's spatial data infrastructure. SP7 developed EDI, a general purpose, template-driven metadata editor that is composed of a backend web service and an HTML5/javascript client. EDI can be customized for managing the creation of generic metadata encoded as XML. Once tailored to a specific metadata format, EDI presents the users a web form with advanced auto completion and validation capabilities. In the case of sensor metadata (SensorML versions 1.0.1 and 2.0), the EDI client is instructed to send an "insert sensor" request to an SOS endpoint in order to save the metadata in an SOS server. In the first phase of project RITMARE, EDI has been used to simplify the creation from scratch of SensorML metadata by the involved researchers and data managers. An interesting by

  6. Numerical investigation to the dual-fuel spray combustion process in an ethanol direct injection plus gasoline port injection (EDI + GPI) engine

    International Nuclear Information System (INIS)

    Huang, Yuhan; Hong, Guang; Huang, Ronghua

    2015-01-01

    Highlights: • A 5D PDF table was used to model the dual-fuel turbulence–chemistry interactions. • The cooling effect of ethanol direct injection (EDI) was examined. • The higher flame speed of ethanol in EDI + GPI increased the thermal efficiency. • The partially premixed combustion in EDI + GPI reduced the combustion temperature. • Ethanol’s low evaporation rate in low temperature led to incomplete combustion. - Abstract: Ethanol direct injection plus gasoline port injection (EDI + GPI) is a new technology to make the use of ethanol fuel more effective and efficient in spark ignition engines. Multi-dimensional computational fluid dynamics modelling was conducted on an EDI + GPI engine in both single and dual fuelled conditions. The in-cylinder flow field was solved in the realizable k−ε turbulence model with detailed engine geometry. The temporal and spatial distributions of the liquid and vapour fuels were simulated with the spray breakup and evaporation models. The combustion process was modelled with the partially premixed combustion concept in which both mixture fraction and progress variable were solved. The three-dimensional and five-dimensional presumed Probability Density Function (PDF) look-up tables were used to model the single-fraction-mixture and two-fraction-mixture turbulence–chemistry interactions respectively. The model was verified by comparing the numerical and experimental results of spray pattern and cylinder pressure. The simulation results showed that the combustion process of EDI + GPI dual-fuelled condition was partially premixed combustion because of the low evaporation rate of ethanol spray in low temperature environment before combustion. Compared with GPI only, the higher flame speed of ethanol fuel contributed to the greater pressure rise rate and maximum cylinder pressure in EDI + GPI condition, which consequently resulted in higher power output and thermal efficiency. The lower adiabatic flame temperature of

  7. Livros do Brasil e a edição de romances brasileiros em Portugal nos anos 1940

    Directory of Open Access Journals (Sweden)

    Thiago Mio Salla

    2017-12-01

    Full Text Available Enquanto esforço de historiografia literária e editorial, o presente artigo tem como objetivo lançar luz sobre as edições portuguesas de romances brasileiros realizadas pela editora Livros do Brasil, casa fundada em Lisboa, em 1944, por António de Sousa Pinto. A partir da recuperação de fontes primárias (com destaque para cartas e contratos, examinam-se, sobretudo, as negociações travadas entre Sousa Pinto e José Olympio no que diz respeito à edição, em Portugal, de títulos de dois importantes autores de nossa chamada geração de 1930: José Lins do Rego e Rachel de Queiroz. Mais especificamente, recupera-se o embate travado entre a atitude interventiva do editor luso, que defendia a necessidade de se ajustar o texto das obras de ambos os escritores à variante europeia do idioma, de modo a aproximá-las do leitorado português, e a recusa inicial dos romancistas, que exigiam o respeito estrito aos “brasileirismos” por eles empregados.

  8. Omnidirectional Internal Fixation by Double Approaches for Treating Rüedi-Allgöwer Type III Pilon Fractures.

    Science.gov (United States)

    Dai, Chong-Hua; Sun, Jun; Chen, Kun-Quan; Zhang, Hui-Bo

    In the present study, we explored the effectiveness and complications of omnidirectional internal fixation using a double approach for treating Rüedi-Allgöwer type III pilon fractures. A retrospective analysis was performed of 19 cases of Rüedi-Allgöwer type III unilateral closed pilon fracture. With preoperative preparation and correct surgical timing, the reduction was performed using anteromedial and posterolateral approaches, and the fracture fragments were fixed by omnidirectional internal fixation. Imaging evaluation was performed using the Burwell-Charnley scoring system. The Johner-Wruhs scoring system was used to assess the functional status of the patients. A comprehensive evaluation of efficacy was performed using a 5-point Likert score. The complications were also recorded and analyzed. All patients were followed up for an average of 16.2 months. The operative incisions of 15 cases healed by primary intent and with delayed healing in 4. All patients had achieved bony union at an average of 16 weeks postoperatively. No deep infection, broken nail or withdrawn nail, exposed plate, or skin flap necrosis occurred. The Burwell-Charnley imaging evaluation showed that 14 patients had anatomic reduction of the articular surface and 5 had acceptable reduction. Using the Johner-Wruhs scoring system, the results were excellent for 8, good for 7, fair for 2, and poor for 2 patients; the combined rate of excellent and good results was 78.9%. The Likert score of efficacy self-reported by the patients was 3 to 4 points for 12 patients, 2 points for 4 patients, and 0 to 1 point for 3 patients. The Likert score of therapeutic efficacy reported by the physicians was 3 to 4 points for 10 patients, 2 points for 5 patients, and 0 to 1 point for 4 patients. Omnidirectional internal fixation using double approaches was an effective method to treat Rüedi-Allgöwer type III pilon fractures with satisfactory reduction and rigid fixation, good joint function recovery, and

  9. Tulevast aastast alustab tööd elektrooniline andmevahetussüsteem EDI : piiriületus muutub kiiremaks / Margo Kokerov

    Index Scriptorium Estoniae

    Kokerov, Margo, 1978-

    2001-01-01

    Eesti kaubaveo logistika elektroonilise andmevahetussüsteemi EDI (Electronic Data Interchange) projekti esimese etapina käivitub piiriületuse dokumentatsiooni ja kaubadeklaratsioonide elektroonilise esitamise võimalus. Toivo Jürgenson ja Jaan Pillesaar e-piiriületuse eelistest

  10. High-latitude plasma convection during Northward IMF as derived from in-situ magnetospheric Cluster EDI measurements

    Directory of Open Access Journals (Sweden)

    M. Förster

    2008-09-01

    Full Text Available In this study, we investigate statistical, systematic variations of the high-latitude convection cell structure during northward IMF. Using 1-min-averages of Cluster/EDI electron drift observations above the Northern and Southern polar cap areas for six and a half years (February 2001 till July 2007, and mapping the spatially distributed measurements to a common reference plane at ionospheric level in a magnetic latitude/MLT grid, we obtained regular drift patterns according to the various IMF conditions. We focus on the particular conditions during northward IMF, where lobe cells at magnetic latitudes >80° with opposite (sunward convection over the central polar cap are a permanent feature in addition to the main convection cells at lower latitudes. They are due to reconnection processes at the magnetopause boundary poleward of the cusp regions. Mapped EDI data have a particular good coverage within the central part of the polar cap, so that these patterns and their dependence on various solar wind conditions are well verified in a statistical sense. On average, 4-cell convection pattern are shown as regular structures during periods of nearly northward IMF with the tendency of a small shift toward negative clock angles. The positions of these high-latitude convection foci are within 79° to 85° magnetic latitude and 09:00–15:00 MLT. The MLT positions are approximately symmetric ±2 h about 11:30 MLT, i.e. slightly offset from midday toward prenoon hours, while the maximum (minimum potential of the high-latitude cells is at higher magnetic latitudes near their maximum potential difference at ≈−10° to −15° clock angle for the North (South Hemisphere. With increasing clock angle distances from ≈IMFBz+, a gradual transition occurs from the 4-cell pattern via a 3-cell to the common 2-cell convection pattern, in the course of which one of the medium-scale high-latitude dayside cells diminishes and disappears while the

  11. Interhemispheric differences and solar cycle effects of the high-latitude ionospheric convection patterns deduced from Cluster EDI observations

    Science.gov (United States)

    Förster, Matthias; Haaland, Stein

    2015-04-01

    Here, we present a study of ionospheric convection at high latitudes that is based on satellite measurements of the Electron Drift Instrument (EDI) on-board the Cluster satellites, which were obtained over a full solar cycle (2001-2013). The mapped drift measurements are covering both hemispheres and a variety of different solar wind and interplanetary magnetic field (IMF) conditions. The large amount of data allows us to perform more detailed statistical studies. We show that flow patterns and polar cap potentials can differ between the two hemispheres on statistical average for a given IMF orientation. In particular, during southward directed IMF conditions, and thus enhanced energy input from the solar wind, we find that the southern polar cap has a higher cross polar cap potential. We also find persistent north-south asymmetries which cannot be explained by external drivers alone. Much of these asymmetries can probably be explained by significant differences in the strength and configuration of the geomagnetic field between the Northern and Southern Hemisphere. Since the ionosphere is magnetically connected to the magnetosphere, this difference will also be reflected in the magnetosphere in the form of different feedback from the two hemispheres. Consequently, local ionospheric conditions and the geomagnetic field configuration are important for north-south asymmetries in large regions of geospace. The average convection is higher during periods with high solar activity. Although local ionospheric conditions may play a role, we mainly attribute this to higher geomagnetic activity due to enhanced solar wind - magnetosphere interactions.

  12. Variantes textuais no Livro do Desassossego: edição, codificação e interpretação

    Directory of Open Access Journals (Sweden)

    Diego Giménez

    2016-09-01

    Full Text Available http://dx.doi.org/10.5007/1807-9288.2016v12n1p54 Em 1988, Ivo Castro, responsável pela edição crítica da obra de Fernando Pessoa para a Imprensa Nacional Casa da Moeda, perguntava, numa comunicação intitulada “Edição Crítica de Pessoa: O Modelo Editorial Adoptado”: “como negar ao leitor o máximo de conhecimento sobre o que está escrito por Pessoa nos manuscritos, quando sabemos que dentro de uma geração, provavelmente, nem o leitor, nem nós, seremos ainda capazes de decifrar a tinta sumida dos papéis?”. Neste artigo mantenho que a codificação das fases de escrita no Livro do Desassossego permite representar o processo de composição textual que é interpretado de maneira diferente pelos especialistas. A especificidade da escrita pessoana presenta uma série de dificuldades que os especialistas enfrentam de forma diferente. Desta forma, a comparação entre o trabalho realizado com a edição crítica e o trabalho realizado com a codificação informática permite pôr em paralelo os problemas e soluções adotados em dois momentos diferenciados dos estudos pessoanos e dos estudos humanísticos em geral.

  13. A ansiedade da unidade: uma teoria da edição / L’ansia di unità: Una teoria dell’edizione

    Directory of Open Access Journals (Sweden)

    Jerónimo Pizarro

    2016-12-01

    Full Text Available Em 1973 Harold Bloom publicou o livro The Anxiety of Influence: A Theory of Poetry. Uma variação sobre este título poderá ser-nos hoje útil para abordar um outro tipo de ansiedade: o da unidade. Os campos da edição e da interpretação vivem imersos nesse outro tipo de ansiedade. Tanto a interpretação, preocupada com a intenção do autor, da obra ou do leitor, como a edição, angustiada com as intenções finais do autor e o estabelecimento do copy-text, parecem, por vezes, pouco capazes de se libertarem desse ensejo de unidade e de se adaptarem à existência da multiplicidade. Neste artigo, procuro fazer um novo apelo a uma necessária mudança de paradigma, atendendo, em especial, às novas e libertadoras possibilidades potenciadas pela edição electrónica. In 1973 Harold Bloom published his book The Anxiety of Influence: A Theory of Poetry. A variation on this title might be useful for us today to refer to another kind of anxiety: the anxiety of unity. The fields of editing and interpretation lie within this other kind of anxiety. Interpretation, concerned with the author’s, the reader’s or the work’s intention, and editing, worried about the author’s final intentions and the setting up of the copy-text, seem, at times, unable to free themselves from the need to attain unity and adapt to the existence of multiplicity. In this article I intend to make a new appeal on behalf of a change of paradigm, addressing, especially, the new and liberating possibilities of electronic editing

  14. The Psychology of Music, editado por Diana Deutsch, 3ª edição: resenha dos capítulos 10 a 13

    Directory of Open Access Journals (Sweden)

    Ricieri Carlini Zorzal

    2016-03-01

    Full Text Available O presente texto traz uma resenha de quatro capítulos da terceira edição do livro The Psychology of Music, editado por Diana Deutsch. Nominalmente, são analisados os seguintes capítulos: 10 Performance musical: movimento e coordenação, de autoria de Caroline Palmer; 11 Desenvolvimento musical, de autoria de Laurel Trainor e Erin Hannon; 12 Música e habilidades cognitivas, de autoria de Glenn Schellenberg e Michael Weiss; e 13 As fundações biológicas da música: insights da amusia congênita, de autoria de Isabelle Peretz.

  15. EDI Performance Statistics

    Data.gov (United States)

    U.S. Department of Health & Human Services — This section contains statistical information and reports related to the percentage of electronic transactions being sent to Medicare contractors in the formats...

  16. Um 13 de maio antecipado: edições temáticas, atualidade e memória no circuito TRIP e TPM

    Directory of Open Access Journals (Sweden)

    Frederico de Mello Brandão Tavares

    2016-05-01

    Full Text Available Em abril de 2014, as revistas brasileiras TRIP e TPM publicaram uma edição temática, sob o mesmo título base – “Ser negro/negra no Brasil é f*da”, e estabeleceram um diálogo editorial a partir de um gancho temporal: o dia 13 de maio, quando se comemora a abolição da escravatura no país. Com um mês de antecedência e a partir de coberturas estruturadas por conteúdos específicos, em contato ou não, as publicações anteciparam o acontecimento, previsto, encerrando-o em uma “totalidade” de pautas, acionada por seções e provocadora de um circuito que, antes do “acontecer do acontecimento”, atualizou-o como temática, indicando seus sentidos. Neste contexto, o presente artigo observa relações existentes em acionamentos acontecimentais no jornalismo, mesmo quando estes não partem de uma cobertura factual. Tendo como objeto as edições de TRIP e TPM indicadas, busca-se percorrer a transversalidade originada pela tematização das revistas e compreender as afetações e/ou “determinações” que nela aparecem.

  17. Edição Temática “Cidades inteligentes: planejamento e gestão da sustentabilidade”

    OpenAIRE

    Cláudia Terezinha Kniess

    2016-01-01

    É com satisfação que apresentamos a edição temática da revista Gestão e Secretariado – Revista GeSec - com foco em “Cidades inteligentes: planejamento e gestão da sustentabilidade”. Os estudos nesta temática respondem a uma forte demanda da sociedade para o enfrentamento dos desafios atuais relacionados à crescente concentração da população nos centros urbanos e à diversidade de problemas técnicos e políticos relacionados a esta dinâmica.   A revista GeSeC é classificada como Qualis B...

  18. Integrating effective drought index (EDI) and remote sensing derived parameters for agricultural drought assessment and prediction in Bundelkhand region of India

    Science.gov (United States)

    Padhee, S. K.; Nikam, B. R.; Aggarwal, S. P.; Garg, V.

    2014-11-01

    Drought is an extreme condition due to moisture deficiency and has adverse effect on society. Agricultural drought occurs when restraining soil moisture produces serious crop stress and affects the crop productivity. The soil moisture regime of rain-fed agriculture and irrigated agriculture behaves differently on both temporal and spatial scale, which means the impact of meteorologically and/or hydrological induced agriculture drought will be different in rain-fed and irrigated areas. However, there is a lack of agricultural drought assessment system in Indian conditions, which considers irrigated and rain-fed agriculture spheres as separate entities. On the other hand recent advancements in the field of earth observation through different satellite based remote sensing have provided researchers a continuous monitoring of soil moisture, land surface temperature and vegetation indices at global scale, which can aid in agricultural drought assessment/monitoring. Keeping this in mind, the present study has been envisaged with the objective to develop agricultural drought assessment and prediction technique by spatially and temporally assimilating effective drought index (EDI) with remote sensing derived parameters. The proposed technique takes in to account the difference in response of rain-fed and irrigated agricultural system towards agricultural drought in the Bundelkhand region (The study area). The key idea was to achieve the goal by utilizing the integrated scenarios from meteorological observations and soil moisture distribution. EDI condition maps were prepared from daily precipitation data recorded by Indian Meteorological Department (IMD), distributed within the study area. With the aid of frequent MODIS products viz. vegetation indices (VIs), and land surface temperature (LST), the coarse resolution soil moisture product from European Space Agency (ESA) were downscaled using linking model based on Triangle method to a finer resolution soil moisture product

  19. Estudo comparativo sobre as atividades experimentais em coleções de Física coincidentes recomendados nas edições 2012 e 2015 do PNLD

    Directory of Open Access Journals (Sweden)

    Wendel Fajardo Reis

    2016-09-01

    Full Text Available http://dx.doi.org/10.5007/2175-7941.2016v33n2p462   O Ensino Médio pressupõe uma aprendizagem abrangente e significativa dos conteúdos, em que o professor deve valer-se de recursos didáticos disponíveis e adequados à sua prática. Nessa perspectiva, a atividade experimental torna-se um importante instrumento de ensino a ser explorado no estudo da Física, que também pode ser vivenciado pelos alunos por meio do livro didático (LD. Nesta pesquisa, realiza-se uma análise comparativa das atividades experimentais nas coleções de Física coincidentes nas edições de 2012 e 2015 do Programa Nacional do Livro Didático (PNLD. Para isso, aplica-se a classificação proposta por Barros (2009, fundamentada em competências e habilidades dos Parâmetros Curriculares Nacionais para o Ensino Médio (PCNEM (BRASIL, 1999 e nos temas estruturadores de suas orientações educacionais complementares (PCN+ (BRASIL, 2002. Os resultados mostram uma distribuição não uniforme dos experimentos nos temas da Física, em que ainda prevalecem os arranjos relacionados aos movimentos dos corpos. Para as categorias e dimensões de análise, verifica-se que os autores procuram evidenciar as competências e habilidades do PCNEM, entretanto os aspectos históricos sociais continuam pouco contemplados nas duas edições do Programa. Por fim, espera-se que as informações apresentadas nesse trabalho possam contribuir para a prática docente, com foco nas atividades experimentais dos livros didáticos de Física.

  20. [Case-control study on effects of external fixation combined with limited internal fixation for the treatment of Pilon fractures of Rüedi-Allgower type III].

    Science.gov (United States)

    Duan, Da-Peng; You, Wu-Lin; Ji, Le; Zhang, Yong-Tao; Dang, Xiao-Qian; Wang, Kun-Zheng

    2014-01-01

    To analyze the effects of three surgical operations in the treatment of Pilon fracture of Rüedi-Allgower type III, and put forward the best therapeutic method. The clinical data of 33 patients with Pilon fracture who received surgical operations (plaster immobilization group, 10 cases; distal tibia anatomical plate group, 11 cases; external fixation with limited internal fixation group, 12 cases) from October 2009 to January 2012 were analyzed. There were 5 males and 5 females, ranging in age from 24 to 61 years in the plaster immobilization group. There were 7 males and 4 females, ranging in age from 21 to 64 years in the distal tibia anatomical plate group. There were 7 males and 5 females, ranging in age from 23 to 67 years in the external fixation with limited internal fixation group. The Ankle X-ray of Pilon fracture after operation, ankle score, early and late complications were collected. Bourne system was used to evaluate ankle joint function. After 8 months to 3 years follow-up, it was found that three kinds of treatment had significant differences in the outcomes and complications (P external fixation with limited internal fixation group got the best results. The number of anatomic reduction cases in the external fixation with limited internal fixation group (7 cases) and the distal tibia anatomical plate group (8 cases) was more than the plaster immobilization group (2 cases). According to the ankle score, 8 patients got an excellent result, 3 good and 1 poor in the limited internal fixation group ,which was better than those of distal tibia anatomical plate group (5 excellent, 4 good and 2 poor) and the plaster immobilization group (3 excellent, 4 good and 3 poor). The number of early and late complications in the external fixation with limited internal fixation group was more than those in the plaster immobilization group and the distal tibia anatomical plate group (Pexternal fixation with limited internal fixation in the treatment of Pilon fracture

  1. JAMSTEC E-library of Deep-sea Images (J-EDI) Realizes a Virtual Journey to the Earth's Unexplored Deep Ocean

    Science.gov (United States)

    Sasaki, T.; Azuma, S.; Matsuda, S.; Nagayama, A.; Ogido, M.; Saito, H.; Hanafusa, Y.

    2016-12-01

    The Japan Agency for Marine-Earth Science and Technology (JAMSTEC) archives a large amount of deep-sea research videos and photos obtained by JAMSTEC's research submersibles and vehicles with cameras. The web site "JAMSTEC E-library of Deep-sea Images : J-EDI" (http://www.godac.jamstec.go.jp/jedi/e/) has made videos and photos available to the public via the Internet since 2011. Users can search for target videos and photos by keywords, easy-to-understand icons, and dive information at J-EDI because operating staffs classify videos and photos as to contents, e.g. living organism and geological environment, and add comments to them.Dive survey data including videos and photos are not only valiant academically but also helpful for education and outreach activities. With the aim of the improvement of visibility for broader communities, we added new functions of 3-dimensional display synchronized various dive survey data with videos in this year.New Functions Users can search for dive survey data by 3D maps with plotted dive points using the WebGL virtual map engine "Cesium". By selecting a dive point, users can watch deep-sea videos and photos and associated environmental data, e.g. water temperature, salinity, rock and biological sample photos, obtained by the dive survey. Users can browse a dive track visualized in 3D virtual spaces using the WebGL JavaScript library. By synchronizing this virtual dive track with videos, users can watch deep-sea videos recorded at a point on a dive track. Users can play an animation which a submersible-shaped polygon automatically traces a 3D virtual dive track and displays of dive survey data are synchronized with tracing a dive track. Users can directly refer to additional information of other JAMSTEC data sites such as marine biodiversity database, marine biological sample database, rock sample database, and cruise and dive information database, on each page which a 3D virtual dive track is displayed. A 3D visualization of a dive

  2. The photographic edition as a visual narrative construction A edição fotográfica como construção de uma narrativa visual

    Directory of Open Access Journals (Sweden)

    Fernanda Jansen Mira Catanho

    2007-01-01

    Full Text Available This article, based on the concept of intellectual montage, developed by russian movie director Sergei Eisenstein, works in the premises that the photographic edition may be responsible for the construction of a visual narrative. Thus, it adopts a photographic essay composed of 26 pictures and sends it to three specialists for edition. The results are three different narratives. With this, it becomes evident that the photographic message may undergo a creative rearrange and compose distinctive enunciation discourses. At the end, the work shows that the differences between the discourses elaborated by the editors are captured by the receiver of the photographic message. Este artigo, baseado no conceito de montagem intelectual, desenvolvido pelo cineasta russo Sergei Eisenstein, trabalha com a premissa de que a edição fotográfica pode ser responsável pela construção de uma narrativa visual. Para tanto, adota um ensaio fotográfico composto por 26 fotografias e o passa para três especialistas editá-lo. O resultado são três narrativas diferentes. Com isso, torna-se evidente que a mensagem fotográfica pode passar por uma re-elaboração criativa e formar discursos enunciativos distintos. Ao final, o trabalho mostra que as diferenças entre os discursos elaborados pelos editores são apreendidos pelo receptor da mensagem fotográfica.

  3. Examining the extreme 2017 spring drought event in South Korea using a suite of drought indices (SPI, SC-PDSI, SPEI, EDI)

    Science.gov (United States)

    Nam, W. H.; Hayes, M. J.; Svoboda, M. D.; Fuchs, B.; Tadesse, T.; Wilhite, D. A.; Hong, E. M.; Kim, T.

    2017-12-01

    South Korea has experienced extreme droughts in 1994-1995, 2000-2001, 2012, 2015, and 2016-2017. The 2017 spring drought (with especially low winter precipitation recorded in winter 2016) affected a large portion of central and western South Korea, and was one of the most severe droughts in the region since the 2000-2001 drought. The spring drought of 2017 was characterized by exceptionally low precipitation with total precipitation from January to June being 50% lower than the mean normal precipitation record (1981-2010) over most of western South Korea. It was the climatologically driest spring over the 1961-2016 record period. Effective drought monitoring and management depends on which drought indices are selected because each drought index has different drought criteria or levels of drought severity, associated with drought responses. In this study, for the quantitative analysis of the spring 2017 drought event in South Korea, four widely-used drought indices, including the Standardized Precipitation Index (SPI), the Standardized Precipitation Evapotranspiration Index (SPEI), the Self-Calibrated Palmer Drought Severity Index (SC-PDSI), and the Effective Drought Index (EDI) are compared with observed drought damaged areas in the context of agricultural drought impacts. The South Korean government (Ministry of Agriculture, Food and Rural Affairs (MAFRA) and Korea Rural Community Corporation (KRC)) has been operating a government-level drought monitoring system since 2016. Results from this study can be used to improve the drought monitoring applications, as well as drought planning and preparedness in South Korea.

  4. Carta do editor de edições especiais da Encontros Bibli 10.5007/1518-2924.2011v16nesp1piv

    Directory of Open Access Journals (Sweden)

    Francisco das Chagas de Souza

    2011-06-01

    Full Text Available Dos horizontes arquivísticos e de seu sentido É significativo observar que a discussão sobre Arquivologia e sobre as práticas profissionais arquivisticas tem avançado muito nos últimos anos no Brasil, e as razões são claramente apontadas pelos organizadores desta edição especial de Encontros Bibli em seu texto editorial. Contendo sete artigos, esta edição temática traz o título Horizontes Arquivísticos.Para dar vida a este número, foi desenvolvido um trabalho de quase dois anos, liderado pelo pesquisador José Maria Jardim e colaboração de Renata Silva Borges. Aqui estão reunidos nove autores e seis avaliadores, todos vinculados a instituições de ensino e de pesquisa ligadas ao Serviço Público Federal, com sede nas cidades de Brasilia, Rio de Janeiro, Niteroi e Florianópolis: UNB, UNIRIO, UFF, UFRJ, UFSC, Arquivo Nacional e FIOCRUZ.Neste momento da história brasileira ─ em que se anunciam políticas governamentais em prol da cidadania, em que se diz da disposição de resgate da verdade sobre os fatos políticos acontecidos na gestão do estado brasileiro dos anos de 1964 a 1989 ─ os arquivos e seus profissionais passam a divisar um relevante protagonismo. Pode-se dizer que, de certa maneira, deu-se um movimento de preparação deste protagonismo e que, simultaneamente, essa preparação alicerçou a percepção de segmentos importantes do setor público para oferecer essa perspectiva para a sociedade nacional.Nesse sentido, tem peso relevante a instalação de novos cursos de bacharelado na área, totalizando, em 2011, o número de 14 universidades que os oferecem: UNIRIO, UFF, UFSM, UFES, UNB, UEL, UFBA ,UNESP/MARÍLIA, UFRGS, UEPB, UFAM, FURG, UFMG, UFSC. Uma nota marcante é que todas essas Instituições de Ensino Superior têm vínculos governamentais, sendo onze federais e três estaduais. Esse movimento não se faz por outro caminho senão o da pesquisa histórica e social. Em áreas como a História, Educa

  5. Impacto da tecnologia de informação no Supply Chain Management: um estudo multicaso sobre a adoção de EDI entre varejo e indústria agroalimentar The impact of information technology on the Supply Chain Management: a multicase study in EDI adoption between the agrifood industry and retailers

    Directory of Open Access Journals (Sweden)

    Andrea Lago da Silva

    1999-12-01

    Full Text Available As tecnologias de informação têm alterado as formas de coordenação entre os diferentes elos da cadeia de suprimentos. A coordenação pode ser entendida como a habilidade de transmitir informação, estímulos e controles ao longo das etapas seqüenciais que integram o conjunto de atividades necessárias para atender o mercado (FARINA & ZYLBERSZTAJN, 1994. O conjunto destas etapas é o que tem sido chamado de Supply Chain ou Cadeia de Suprimentos. Neste artigo, discute-se alguns casos de adoção de uma tecnologia de informação, o EDI (troca eletrônica de dados como ferramenta de coordenação entre varejistas e indústrias agroalimentares. Conclui-se que o processo de adoção é relativamente recente para que se possa mensurar resultados quantitativos e qualitativos significativos, mas já se observa alterações na freqüência de desabastecimento, em estoques melhor dimensionados e vendas maiores em decorrência da maior disponibilidade de mercadorias. Sinalizam-se também mudanças qualitativas, como alteração na função do vendedor tradicional, maior interação entre as áreas técnicas, com um aprendizado comum das novas formas de usar a tecnologia e o importante papel da confiança nos relacionamentos interorganizações.Information technology has changed the patterns of coordination among the different linkages of supply-chains. Coordination can be understood as the ability to transfer information, incentives and controls throughout the sequential stages which integrate the set of activities indispensable to serve the market (FARINA & ZYLBERSZTAJN, 1994. The sum of these stages is currently known as Supply-Chains. This paper discusses cases of adopting a specific information technology, EDI (Electronic Data Interchange, as an integration tool between the food industry and retailers. It was found that the adoption process is too recent to measure significative quantitative results, but it is possible to observe changes in the

  6. «Dos benefícios de Deus»: três edições de um capítulo do tratado medieval português

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Ribeiro Queiroz

    2010-12-01

    Full Text Available Resumo: O tratado “Dos benefícios de Deus” integra a obra da literatura medieval portuguesa intitulada Castelo perigoso, a qual é uma adaptação do texto francês escrito por Frère Robert, monge cartuxo, à sua prima Soeur Rose, da Ordem Fontevrault. A versão em língua portuguesa foi realizada no Mosteiro de Alcobaça, provavelmente no século XV, existindo dois códices (ALC 197 e ALC 214, os quais se encontram na Biblioteca Nacional de Portugal. O tratado “Dos benefícios de Deus” é o segundo na ordem dos textos que compõem a obra Castelo perigoso. Propõem-se, neste trabalho, três edições de um capítulo do tratado“Dos benefícios de Deus”, a saber: uma edição conservadora ou semidiplomática; uma edição crítica, executada a partir da collatio entre os códices ALC 197 e ALC 214 e a edição realizada por Augusto Magne na década de 1940; e, por último, uma edição modernizada. Palavras-chave: Crítica textual; edição; português medieval.  Résumé: Le traité “Dos benefícios de Deus” intègre l’oeuvre de la littérature médiévale potugaise Chastel périlleux, qui est une adaptation du texte français écrit par Robert Frère, moine chartreux, à sa cousine Soeur Rose, de l’Ordre Fontevrault. La version en langue portugaise a été réalisée au Monastère d’Alcobaça, probablement au XVe siècle: il y a deux codex (ALC 197 et ALC 214, qui sont à la Bibliothèque Nationale du Portugal. Le traité “Dos benefícios de Deus” est le deuxième dans l’ordre des textes qui constituent l’oeuvre Chastel périlleux. Sont proposées dans le présent travail trois éditions d’un chapitre du traité “Dos benefícios de Deus”, à savoir: une édition conservatrice ou semidiplomatique; une édition critique, faite à partir de la collation des manuscrits entre les codex 197 et 214 et l’édition faite par Augusto Magne en 1940; et, enfin, une édition modernisée. Mots-clés: Critique textuelle

  7. O Brasil através dos Para-brisas: O Turismo na Primeira Edição da Revista Quatro Rodas

    Directory of Open Access Journals (Sweden)

    Maria Henriqueta S. Garcia Gimenes-Minasse

    2014-07-01

    Full Text Available É grande a importância dos guias turísticos na construção da imagem de destinos turísticos, pois auxiliam a organização de viagens, selecionando o que merece ser visto e visitado. No Brasil, um dos mais respeitados pelos turistas domésticos é o Guia Quatro Rodas, publicado anualmente pela Editora Abril, desde setembro de 1965. Contudo, já em 1960 a revista Quatro Rodas, criada nesse ano, e da qual o Guia nasceu, já vinha desempenhando o papel de informar e orientar o leitor sobre passeios e roteiros que poderiam ser feitos de automóvel. Este artigo tem o objetivo de analisar o conteúdo relacionado ao Turismo da primeira edição da Revista Quatro Rodas. Os principais resultados encontrados evidenciam a transformação social do Brasil com o advento de uma matriz econômica pautada na indústria do automóvel e com a incorporação das viagens de lazer como uma forma de descoberta desse ‘novo’ país.  Brazil through the Windshield: Tourism in the First Edition of Quatro Rodas Magazine - Tour guides are very important in building the image of touristic attractions, as they help with travel arrangements and selection of attractions to be seen and visited. In Brazil Guia Quatro Rodas is one of the guides most respected by domestic tourists. It is annually published by Editora Abril, since September 1965. Nevertheless, since 1960 the newly formed Quatro Rodas magazine, and from which the Guia Quatro Rodas was borne, was already playing the role of informing and guiding its readers in relation to tours that could be made by car. The scope of this article is to analyze the first edition of Quatro Rodas magazine with respect to its tourism-related content. The main results show the social transformation of Brazil with the advent of an economic matrix based on the automotive industry and the incorporation of leisure travel as a way to discover the ‘new’ country.

  8. Esta tenzon fezeron Pero da Ponte e Afonso Anes do Coton. Edição e estudo do debate B969/V556

    Directory of Open Access Journals (Sweden)

    Déborah González Martínez

    2013-07-01

    Full Text Available Pero da Ponte e Afonso Eanes do Coton são dois destacados autores de cantigas transmitidas nos cancioneiros galego-portugueses: o Cancioneiro da Ajuda, o Cancioneiro da Biblioteca Nacional (Cód. 10991 e o Cancioneiro da Biblioteca Vaticana (Vat. Lat. 4803. A estreita relação entre estes dois trovadores confirma-se pelas menções a ambos no interior de vários textos de natureza satírica e pela interação em duas cantigas dialogadas. O presente trabalho consiste numa nova edição crítica da tenção entre Afonso Eanes do Coton e Pero da Ponte (Pero da Pont’, e[n] un vosso cantar, B969 / V556, oferecendo novas respostas a velhas dificuldades ecdóticas. O texto vai acompanhado de anotação e estudo, pois o diálogo desenvolve vários temas de especial interesse para os estudos trovadorescos: a classe social e a atividade profissional dos interlocutores.Pero da Ponte and Afonso Eanes do Coton are two renowned authors of cantigas contained in the galician-portuguese songbooks: the Cancioneiro da Ajuda, the Cancioneiro da Biblioteca Nacional (Cód. 10991 and the Cancioneiro da Biblioteca Vaticana (Vat. Lat. 4803. The close relationship between these troubadours is confirmed by some references in satirical texts and, mainly, by the dialogued song Pero da Pont’, e[n] un vosso cantar (B969 / V556. This work offers a new critical edition of this tenção with notes and literary study. The dialogue develops several topics of interest for the studies about troubadours: social class and professional activity of the interlocutors.  

  9. Employee-Driven Innovation (EDI)

    DEFF Research Database (Denmark)

    Kesting, Peter; Ulhøi, John Parm

      The responsibility to be innovative and think of useful ideas and the privilege of making decisions in processes of innovation are typically restricted to specifically assigned R&D functions and/or upper echelon managers. Given the importance of innovation to most organizations, it may seem...

  10. A gripe suína na Wikipédia em português: análise da dinâmica de edições e qualificação do conteúdo de dois artigos

    OpenAIRE

    Bernardo Esteves Gonçalves da Costa; Carlos Frederico de Brito d'Andréa

    2011-01-01

    Este artigo tem como objetivo analisar e comparar a edição colaborativa de dois artigos sobre pandemia de gripe A (H1N1) — ou gripe suína — na Wikipédia em português. Monitoramos as edições feitas nos dois artigos ao longo de um mês após a criação de ambos, em 25 de abril de 2009. Caracterizamos o processo de edição dos textos e a dinâmica de interações entre os editores e, de forma complementar, analisamos seu conteúdo a partir de três critérios: autoridade, verificabilidade e atualidade....

  11. Avaliação da anotação semântica do PALAVRAS e sua pós-edição manual para o Corpus Summ-it

    Directory of Open Access Journals (Sweden)

    Élen Cátia Tomazela

    2011-01-01

    Full Text Available Este artigo apresenta uma avaliação da anotação semântica automática do parser PALAVRAS e sua pós-edição manual para um corpus de textos em português – o Corpus Summ-it. Essa pós-edição visou ao aprimoramento de um modelo linguístico para a sumarização automática de textos e buscou atribuir  etiquetas semânticas mais adequadas aos itens lexicais, comparadas às empregadas pelo parser. Essa tarefa foi realizada por linguistas e os casos problemáticos são apresentados neste artigo, os quais levam a considerações sobre o próprio modelo de etiquetagem do PALAVRAS. O corpus revisado estará disponível para a comunidade e poderá ser útil para várias aplicações de Processamento de Línguas Naturais.

  12. Avaliação da anotação semântica do PALAVRAS e sua pós-edição manual para o Corpus Summ-it

    Directory of Open Access Journals (Sweden)

    Élen Cátia Tomazela

    2011-01-01

    Full Text Available Este artigo apresenta uma avaliação da anotação semântica automática do parser PALAVRAS e sua pós-edição manual para um corpus de textos em português – o Corpus Summ-it. Essa pós-edição visou ao aprimoramento de um modelo linguístico para a sumarização automática de textos e buscou atribuir  etiquetas semânticas mais adequadas aos itens lexicais, comparadas às empregadas pelo parser. Essa tarefa foi realizada por linguistas e os casos problemáticos são apresentados neste artigo, os quais levam a considerações sobre o próprio modelo de etiquetagem do PALAVRAS. O corpus revisado estará disponível para a comunidade e poderá ser útil para várias aplicações de Processamento de Línguas Naturais.

  13. "Economia e sociedade": a herança de Max Weber à luz da edição de sua Obra completa (MWG "Economy and society": Max Weber's legacy following the publication of his Complete works (MWG

    Directory of Open Access Journals (Sweden)

    M. Rainer Lepsius

    2012-01-01

    Full Text Available O artigo relata o entendimento atual do conjunto de textos conhecido como Economia e sociedade, procurando esclarecer em que consistia originalmente; como foi organizado nas edições anteriores por Marianne Weber e Johannes Winckelmann; como foi tratado no âmbito da nova edição da MWG. Para tanto, procura indicar como Max Weber situava os diversos textos, as diversas versões e fases de concepção e composição desses escritos. A partir daí, sistematiza os principais aspectos dos textos evidenciados na MWG, assim como os principais campos de discussão que se abrem para a pesquisa, em especial a sociologia econômica.The article reviews the current understanding of the set of texts known as Economy and Society, looking to identify the original content, how these texts were edited in previous editions by Marianne Weber and Johannes Winckelmann, and how they have been dealt with in the new edition of the MWG. These aims in mind, the text looks to show how Max Weber himself situated the various texts, including the different versions and phases of conception and composition of the writings. The article then summarizes the main aspects of the works, as evinced in the MWG, as well as the principal fields of discussion opened up for research, especially in economic sociology.

  14. O, 5 mm: a nova edição brasileira de Problemas da poética de Dostoiévski/0.5 mm: The New Brazilian Edition of Problems of Dostoevsky’s Poetics

    Directory of Open Access Journals (Sweden)

    Adriana Pucci Penteado de Faria e Silva

    2011-11-01

    Full Text Available RESUMO: Neste artigo, retomo brevemente a história da recepção de Problemas da poética de Dostoiévski, de Mikhail Bakhtin, no Brasil, estabelecendo alguns paralelos com aspectos da recepção da obra na Itália, na França e nos Estados Unidos, para, então, descrever os acréscimos da nova edição brasileira e analisar, considerando a relevância da obra para os estudos da linguagem, algumas modificações efetuadas pelo tradutor Paulo Bezerra na quarta edição da obra, lançada em 2008. ABSTRACT: In this article I briefly review the history of the Brazilian reception of Mikhail Bakhtin’s Problems of Dostoevsky’s Poetics, establishing a few parallels with aspects of this work’s reception in Italy, France, and the United States in order to describe the additions made to the new Brazilian edition and, considering the relevance of this work to Language Studies, analyze some changes proposed by translator Paulo Bezerra in its

  15. (Desmetaforizando significados na pós-edição: um estudo exploratório do esforço despendido por estudantes de tradução

    Directory of Open Access Journals (Sweden)

    Adriana Silvina Pagano

    2014-03-01

    Full Text Available Este artigo examina dados de um experimento-piloto e tem por objetivo investigar o esforço despendido por estudantes de tradução em uma tarefa de pós-edição, a partir da análise de pausas e movimentos recursivos registrados durante a produção textual em tempo real para instâncias gramaticalmente metafóricas (cf. HALLIDAY,1998. O estudo contempla o processo e o produto da pós-edição de três alunos de pós-graduação em tradução. Para se proceder à análise, foram observados os registros de uso de teclado e movimentos de cursor mapeados pelo programa Translog 2006 para a produção textual em tempo real. Como resultado, verificou-se um grande esforço para se processar algumas instâncias gramaticalmente metafóricas, sendo que esse esforço não resultou em uma maior adequação dos significados produzidos.

  16. O objecto dúctil: a emergência de uma sociologia histórica da edição The ductile object: emergency a historical sociology of publishing

    Directory of Open Access Journals (Sweden)

    Nuno Medeiros

    2010-12-01

    Full Text Available Localizada, desde o início das diligências explicativas para a apreender, numa matriz temática e disciplinar em que se multiplicam os cruzamentos, a edição de livros foi sendo construída como objeto para cuja captura e definição convergiu e converge sinuosamente um feixe de tradições e perspectivas, tanto na sociologia como na história. Este artigo procura estabelecer um percurso sistematizado que se possa constituir para o leitor interessado como baliza de entendimento de um campo de pesquisa teórica e empírica em construção, que aqui se denomina "sociologia histórica da edição". Projeto necessariamente parcelar, o propósito apresentado concretiza-se seletivamente, tentando proceder a uma exploração do tema a partir especificamente de duas tradições, a francesa e a anglo-saxônica, com enfoque particular na produção do último meio século.Since the first attempts to apprehend and explain the phenomenon, book publishing has been apprehended within a disciplinary and thematic context formed by a constellation of traditions and approaches in both sociology and history with multiple interconnections. This article looks to provide a systematic framework for the reader interested in gaining an understanding of one particular field of theoretical and empirical research, what I call here a historical sociology of publishing. A necessarily incomplete project, the approach is purposefully selective, examining the theme through the exploration of two specific traditions, French and Anglo-Saxon, with a particular focus on the last half century.

  17. Um estudo das edições de Ou isto ou aquilo, de Cecília Meireles A study of Cecília Meirelles' Ou isto ou aquilo editions

    Directory of Open Access Journals (Sweden)

    Norma Sandra de Almeida Ferreira

    2009-08-01

    Full Text Available Localizar em sua materialidade a obra Ou isto ou aquilo, de Cecília Meireles, em suas edições - 1964; 1969; 1977; 1987; 1990; 2002 -; cotejá-las para compreender as formas pelas quais os textos são apresentados aos seus leitores, em diferentes tempos; e indagar como e por que essas formas são pensadas e concretizadas são desafios deste artigo. Esta pesquisa de cunho exploratório, à luz, principalmente, dos estudos da História Cultural, privilegia, no exame das diferentes edições, as partes externas que envolvem os poemas (o texto propriamente dito e suas ilustrações. Identifica e discute a produção de sentidos e valores ligados à educação do leitor, ao reconhecimento de uma escritora consagrada pela tradição literária, à singularidade da linguagem, à importância de uma prática prazerosa da leitura.This article brings the challenges of locating Cecília Meireles' book Ou isto ou aquilo (Either this or that in its materialness, with considerations on its 1964, 1969, 1977, 1987, 1990 and 2002 editions, as well as comparing these editions in order to understand the forms in which texts are presented to their readers at different times, and questioning how and why these forms are conceived and put into practice. In the light of studies on cultural history, in the analysis of the different editions, this exploratory research prioritizes the external parts that involve poems (the texts themselves and their illustrations. It provides identification and a discussion on the production of senses and values related to readers' education, the recognition of a writer who is consecrated by literary tradition, the uniqueness of the language used, and the importance of pleasant reading practice.

  18. Digital TV: the aparattus and the representation of real on image edition in news casting TV Digital: o aparelho e a representação do real na edição de imagens no telejornalismo

    Directory of Open Access Journals (Sweden)

    Fernanda Aiex Boni

    2011-08-01

    Full Text Available This study investigates some changes on image edition due to the transfer of Analogic to Digital Television in Brazil. Beginning with Vilém Flusser’s Media Theory and its concept of “apparatus”, it develops a theoretical analysis of the new relationship between journalists and digital editing instruments, taking into account the concept of hyperreality proposed by Jean Baudrillard. Retrieving the philosophical discourse of “real” throughout History and also the positivist concepts, base of the journalistic activity, it discusses how digital image manipulation and the construction of graphic universes meddle with the new representation of real presented by television news casting. From interviews with Rede Globo editors in São Paulo, Rio de Janeiro and Curitiba (cities where digital television has already been implemented, it analyses how this new technology can hinder the main commitment of journalism, which is reporting facts as faithfully as possible. The discussion proposes an engagement of professionals and society regarding digital images in the search of greater critical conscience towards digital images in news casting, with an ethic view of the use of manipulation resources and scene construction on news editing. Este trabalho investiga algumas mudanças na edição de imagens com a passagem da TV Analógica para a Digital no Brasil. A partir da teoria da mídia de Vilém Flusser e seu conceito de “aparelho” desenvolve-se uma análise teórica da nova relação entre os jornalistas e os equipamentos digitais de edição, levando-se em conta o conceito de hiper-realidade, proposto por Jean Baudrillard. Retomando o percurso filosófico do real ao longo da história e ainda os conceitos positivistas, que embasam a atividade jornalística, discute-se de que maneira a manipulação das imagens digitais e a construção deuniversos gráficos interferem na nova representação do real apresentada pelo telejornalismo. Com base em

  19. Edição e tradução, entre a cultura e a política: Argentina e Brasil na Feira do Livro de Frankfurt

    Directory of Open Access Journals (Sweden)

    José de Souza Muniz Jr.

    Full Text Available Resumo Este artigo analisa a participação da Argentina e do Brasil como países convidados de honra (em 2010 e 2013, respectivamente na Feira do Livro de Frankfurt. Remetemos tais presenças à história recente da feira e ao seu papel na estrutura dos fluxos e circuitos de edição e tradução em nível mundial, estrutura esta regulada pelas relações desiguais entre distintos países e mercados linguísticos. Analisamos as negociações entre entidades do poder público e da política setorial que deram origem a tais participações; as ênfases temáticas escolhidas para compor os estandes; e as características socioprofissionais dos autores de cada delegação. A conclusão é que tais casos permitem observar relações específicas entre intelectuais e Estado em cada contexto, na medida em que fazem emergir não apenas as tensões entre cultura e economia, mas também os modos específicos como cada país “traduz” questões locais para um âmbito de trocas simbólicas transnacionais.

  20. A nova edição de Why Suyá Sing, de Anthony Seeger, e alguns estudos recentes sobre música indígena nas terras baixas da América do Sul

    Directory of Open Access Journals (Sweden)

    Luís Fernando Hering Coelho

    2007-04-01

    Full Text Available Lançado originalmente em 1987, Why Suya Sing? ganhou uma nova edição norte-americana em 2004. Apesar de constituir um marco teórico e etnográfico importante nos campos da etnologia indígena e da antropologia da música, o livro ainda não conta com uma tradução para o português. Neste ensaio, oferece-se uma leitura da obra, buscando resumir alguns de seus pontos principais, junto a uma contextualização geral sumária dos estudos sobre povos Gê, e uma nota breve sobre alguns desenvolvimentos recentes nas pesquisas sobre música indígena nas terras baixas da América do Sul.Originally published in 1987, Why Suyá Sing? acquired a new US edition in 2004. Despite constituting a theoretical and ethnographic landmark in the fields of indigenous ethnology and anthropology of music, Seeger’s book has yet to be translated into Portuguese. This essay offers a reading of the work, looking to resume some of its key points, along with a brief overall contextualization of the studies on Gê peoples, and a short note on some of the recent developments in the research on indigenous music in the South American lowlands.

  1. A construção sociológica de uma posição regionalista: Reflexões sobre a edição e recepção de Casa-grande & senzala de Gilberto Freyre

    Directory of Open Access Journals (Sweden)

    Sorá Gustavo

    1998-01-01

    Full Text Available Este artigo analisa disputas e momentos de inflexão no processo de autonomização das ciências sociais e das estruturas de produção e circulação de mensagens escritas sobre o Brasil, a partir da análise da edição e recepção de Casa-grande & senzala, de Gilberto Freyre. Entre os sucessivos prefácios do livro, da 1ª à 14ª edições, e a consagração de autores como Florestan Fernandes, desenvolve-se uma prolongada e violenta batalha simbólica para universalizar as formas legítimas (estilos narrativos, projetos institucionais, fórmulas editoriais, invenção e representação de comunidades de leitores para pensar o Brasil. Seguindo este percurso, o artigo mostra como as representações que pesam sobre Freyre e seu livro de estréia, como regionalista, derivam tanto das posições e concepções que Freyre foi assumindo em sua trajetória, quanto das posições que foram se impondo no campo intelectual a partir dos anos 40 em São Paulo, com o objetivo de consolidar a "Sociologia científica e nacional". Somando à interpretação dos discursos os princípios de sua dispersão, como a edição e a institucionalização dos saberes universitários, o artigo busca compreender como livro e autor chegaram a ser o que são hoje em dia à luz de mudanças nos mecanismos de seleção do panteão dos intérpretes do Brasil.

  2. Edição Inspiradora

    Directory of Open Access Journals (Sweden)

    Luciana Di Leone

    2012-12-01

    Full Text Available Embriaguez e engajamento (“Une ivresse belle m’engage” raramente se associam talvez por isso, quando a associação acontece a imagem que gera pode parecer imprevisível, fragmentada, inaudita com uma exceção discutida longamente desde a antiguidade: a do poeta ou artista inspirado. O poeta, para ser poeta, deve estar embriagado, deve ter bebido o elixir da musa. Inclusive, no seio da própria modernidade – que por todos os meios tentou afastar a arte de qualquer relação com o incompreensível – Mallarmé retoma, em “Brinde”, o gesto da inspiração, levanta a taça para beber, colocar o elemento estonteante dentro de si: e entusiasmar-se. Esse gesto complexo, pelo qual se interpenetram o eu e o outro, o poeta e os deuses, o dentro e o fora, sob diversos pontos de vistas e através de diversos objetos, é o foco da instigante coletânea organizada pelo professor de filosofia da Universidade Federal Fluminense, Fernando Muniz.

  3. Edição Inspiradora

    Directory of Open Access Journals (Sweden)

    Luciana Di Leone

    2012-03-01

    Full Text Available http://dx.doi.org/10.5007/1984-784X.2012v12n17p120 Embriaguez e engajamento (“Une ivresse belle m’engage” raramente se associam talvez por isso, quando a associação acontece a imagem que gera pode parecer imprevisível, fragmentada, inaudita com uma exceção discutida longamente desde a antiguidade: a do poeta ou artista inspirado. O poeta, para ser poeta, deve estar embriagado, deve ter bebido o elixir da musa. Inclusive, no seio da própria modernidade – que por todos os meios tentou afastar a arte de qualquer relação com o incompreensível – Mallarmé retoma, em “Brinde”, o gesto da inspiração, levanta a taça para beber, colocar o elemento estonteante dentro de si: e entusiasmar-se. Esse gesto complexo, pelo qual se interpenetram o eu e o outro, o poeta e os deuses, o dentro e o fora, sob diversos pontos de vistas e através de diversos objetos, é o foco da instigante coletânea organizada pelo professor de filosofia da Universidade Federal Fluminense, Fernando Muniz.

  4. EDI at the Jet Propulsion Laboratory Library

    Science.gov (United States)

    Amago, B.

    1994-01-01

    The JPL Library and Information Center orders and claims material elecronically whenever feasible. The NASA Aerospace Research Information Network (ARIN) is used to order books for the library collection; BIP Plus on CD-ROM is used to order office copies. Paper copies of invoices are processed when material is received. Subscriptions are ordered using the vendor's online system; monthly and annual invoices are received both in paper and electronic format (diskette of FTP). Library-developed dbase programs complement or duplicate functions available through ARIN and/or the JPL institutional accounting system.

  5. Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler), da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul

    OpenAIRE

    Piccinin,Marcos Rogério Mistro; Cunha,Juliana Ferrari; Almeida,Herbert Paulo de; Bach,Cleiton Cassio; Dossa,Andréa Cristina Grubits Gonçalves de Oliveira; Silva,Reinaldo Ferreira da; Pessoa,Valdir Filgueiras

    2007-01-01

    OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler) entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e ...

  6. HÉNAUX, Victor. De l’amour des femmes pour les sots / Queda que as mulheres têm para os tolos. Tradução de Machado de Assis. Edição Bilíngue. Organização: Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira. Campinas: Editora Unicamp. 2008.

    Directory of Open Access Journals (Sweden)

    Kall Lyws Barroso Sales

    2014-11-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2015v35n1p313   Em 2008, em comemoração ao centenário de Machado, as professoras Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira retomam as discussões sobre autoria, plágio e tradução, propondo uma edição bilíngue na qual cotejam a obra de Hénaux, De l'amour des femmes pour les sots de 1858 e a tradução de Machado Queda que as mulheres têm para os tolos de 1861. Assim, esta resenha analisa a tradução de Machado de Assis, cuja autoria da obra, durante muito tempo, foi atríbuida ao escritor brasileiro.

  7. HÉNAUX, Victor. De l’amour des femmes pour les sots / Queda que as mulheres têm para os tolos. Tradução de Machado de Assis. Edição Bilíngue. Organização: Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira. Campinas: Editora Unicamp. 2008.

    Directory of Open Access Journals (Sweden)

    Kall Lyws Barroso Sales

    2015-06-01

    Full Text Available Em 2008, em comemoração ao centenário de Machado, as professoras Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira retomam as discussões sobre autoria, plágio e tradução, propondo uma edição bilíngue na qual cotejam a obra de Hénaux, De l'amour des femmes pour les sots de 1858 e a tradução de Machado Queda que as mulheres têm para os tolos de 1861. Assim, esta resenha analisa a tradução de Machado de Assis, cuja autoria da obra, durante muito tempo, foi atríbuida ao escritor brasileiro.

  8. A queda da bancada e as mudanças na cena de apresentação dos telejornais: em busca da identidade e aproximação com o telespectador – uma análise do MGTV Primeira Edição

    OpenAIRE

    Pereira, Renata Venise Vargas

    2013-01-01

    Este trabalho teve como proposta investigar como as alterações na cena de apresentação do telejornal, que incluem a retirada da bancada como o principal elemento cênico e a circulação e posicionamento do apresentador no estúdio, constituem tentativas de aproximação com o telespectador, estabelecer vínculos de pertencimento e relações identitárias com seu público. Na pesquisa empírica avaliou-se as alterações adotadas pelo MGTV 1ª Edição, veiculado pela TV Integração de Juiz de Fora, emissora ...

  9. Final report for EDI energy conservation with diode light; Slutrapport for EDI energibesparelser med diodelys

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    The aim of this project has been to develop technological knowledge and a competence platform for utilization of new light emitting diode technology for general lighting purposes. Furthermore the project has aimed at developing a 3 W light diode bulb to replace 15-20 W filament bulbs and halogen spotlights, and thereby demonstrating a large energy conservation potential in the use of LED technology for lighting purposes. (BA)

  10. Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler), da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul Low prevalence of dyschromatopsia using the fourth edition of HRR (Hardy, Rand and Rittler) pseudoisochromatic plate test among the Indian population of Lalima village, Terena

    OpenAIRE

    Marcos Rogério Mistro Piccinin; Juliana Ferrari Cunha; Herbert Paulo de Almeida; Cleiton Cassio Bach; Andréa Cristina Grubits Gonçalves de Oliveira Dossa; Reinaldo Ferreira da Silva; Valdir Filgueiras Pessoa

    2007-01-01

    OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler) entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e ...

  11. Acta Unitatis Fratrum. Ediční projekt

    Czech Academy of Sciences Publication Activity Database

    Just, Jiří

    2014-01-01

    Roč. 29, č. 2 (2014), s. 451-462 ISSN 0231-7494 Institutional support: RVO:67985963 Keywords : The Bohemian Brethren * protestant historiography * manuscript sources * regesta edition * Acta Unitatis Fratrum Subject RIV: AB - History

  12. Identification of User Needs. EDIS Task I Report.

    Science.gov (United States)

    Howard Research Co., Arlington, VA.

    This report presents the identification of user needs in the Army research, development, test and evaluation (RDT&E) community. Two types of information are provided in this report. The first type includes discussions of the RDT&E cycle, the level of informational need, time response, item categories and other factors as they relate to the…

  13. From EDI to Internet Commerce: The BHP Steel Experience.

    Science.gov (United States)

    Chan, Caroline; Swatman, Paula M. C.

    2000-01-01

    Discusses the issue of business-to-business electronic commerce implementation and the factors affecting it. Discusses electronic data interchange technology, describes the results of a case study of BHP Steel (Australia), and considers paradigm shifts in implementation issues related to electronic commerce that occur over time. (Author/LRW)

  14. Análise da morfometria nuclear: descrição da metodologia e o papel dos softwares de edição de imagem Nuclear morphometric analysis: description of the methodology and the role of image-editing softwares

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo de Andrea

    2008-02-01

    Full Text Available A análise morfométrica de imagens é utilizada em patologia para se obter dados precisos de componentes celulares e teciduais, por meio da mensuração e contagem, que são importantes para o diagnóstico e prognóstico de vários tumores. Essa técnica, mesmo sendo ferramenta útil e de baixo custo, mantém-se restrita a poucos centros de diagnóstico ou pesquisa. O objetivo deste trabalho é apresentar e descrever o método de morfometria nuclear com a utilização complementar de softwares de edição de imagens, fazendo a análise detalhada das etapas críticas do processo. A correção de problemas encontrados durante a captura das imagens, como temperatura e matiz da cor erroneamente ajustados, e de imagens com iluminação desigual provenientes de microscópio mal regulado, é fundamental para a correta análise. Assim, utilizando o recurso máscara de cor disponível em vários softwares de editoração de imagens, é possível selecionar e separar objetos de cores semelhantes, resultando numa imagem final que apresenta somente os objetos de interesse para análise. A morfometria é realizada por meio de softwares específicos como o ImageTool (versão 3.0, que possibilitam a mensuração automática de um ou mais parâmetros, com precisão e em curto intervalo de tempo. A interface do ImageTool permite ainda trabalhar simultaneamente com a imagem original e a imagem processada em que se fez a seleção das cores semelhantes. Dessa forma, pode-se confrontar o objeto que está sendo selecionado com o mesmo objeto na sua imagem original, garantindo assim correta seleção. Esse sistema possibilita conferência interobservador de 100% dos objetos, o que permite desprezar aqueles que posteriormente constatou-se que não deveriam ter sido selecionados e mensurados.The morphometric analysis of images, which comprises measuring and counting, is used in pathology to obtain accurate data of cellular and tissue components that are important for

  15. Incidence of persistent postoperative pain after hepatectomies with 2 regimes of perioperative analgesia containing ketamine.

    Science.gov (United States)

    Masgoret, Paula; Gomar, Carmen; Tena, Beatriz; Taurá, Pilar; Ríos, José; Coca, Miquel

    2017-04-01

    Studies designed to assess persistent postoperative pain (PPP) incidence after hepatectomies are lacking. Our aim was to assess PPP incidence 6 months after hepatectomies with intravenous (IV) or epidural (EPI) analgesia containing ketamine.Prospective observational comparative study between 2 cohorts of patients submitted to hepatectomy. Patients received 1 of 2 analgesic regimes containing ketamine: EPI group or IV group. Visual analog scale (VAS), Neuropathic Pain Symptom Inventory (NPSI), Pain Catastrophizing Scale (PCS), and quantitative sensorial testing (QST: to determine area of hyperalgesia/allodynia) were assessed preoperatively and postoperatively at 2 h, 24 h, 7 days, 1 month, and 6 months. VAS ≥ 1 at 1 and 6 months was considered indicative of PPP and VAS > 3 was considered as not controlled pain. Side effects and complications were registered.Forty-four patients were included: 23 in EPI group and 21 in IV group. Patients in IV group were older and had more comorbidities. No patient presented VAS > 3 at 1 or 6 months. VAS ≥ 1 at 1 and 6 months was 36.4% and 22.7%, respectively. No differences in VAS, NPSI, or PCS were found between groups. Allodynia/hyperalgesia area did not differ between groups and was infrequent and slight. Pain pressure threshold in the wound vertical component was significantly higher in EPI group after 7 days. IV group showed more cognitive side effects.Incidence of PPP at 6 months after open hepatectomies with EPI or IV analgesia containing ketamine was lower than previously reported for other abdominal surgeries.Ketamine influence on low PPP incidence and hyperalgesia cannot be discarded.

  16. First report of metacestodes of Cyclustera ralli (Underwood and Dronen, 1986) (Cestoda: Cyclophyllidea) from the fish intermediate host, Fundulus heteroclitus (Linnaeus, 1766) (Cyprinodontiformes: Fundulidae) from Virginia, U.S.A

    Czech Academy of Sciences Publication Activity Database

    Scholz, Tomáš; Harris, C. E.

    2006-01-01

    Roč. 73, č. 1 (2006), s. 130-133 ISSN 1525-2647 R&D Projects: GA ČR GA524/04/0342; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : metacestodes * fish * morphology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.659, year: 2006

  17. Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler, da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul Low prevalence of dyschromatopsia using the fourth edition of HRR (Hardy, Rand and Rittler pseudoisochromatic plate test among the Indian population of Lalima village, Terena

    Directory of Open Access Journals (Sweden)

    Marcos Rogério Mistro Piccinin

    2007-03-01

    Full Text Available OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e Pesquisa, Fundação Nacional do Índio e do cacique da aldeia Lalima. O teste HRR foi aplicado em 226 índios após terem sido submetidos a exame oftalmológico para detecção de anormalidades que pudessem comprometer a aplicabilidade do teste. O teste foi realizado sob luz natural, em dias ensolarados, sem incidência direta de sol. O teste foi aplicado e interpretado pelo mesmo examinador em todos os índios. RESULTADOS: Realizaram-se 226 exames (60,1% de uma população de 376 homens entre 10 e 45 anos de idade, que vivem na Aldeia Lalima. Não foi encontrado nenhum caso de discromatopsia na população examinada com o teste HRR. CONCLUSÃO: O resultado do presente estudo mostra a baixa prevalência de discromatopsia nesta população indígena de etnia Terena, uma vez que não se detectou nenhum caso de discromatopsia na população estudada, sendo a prevalência de discromatopsia entre homens caucasianos de 6 a 8%. A ausência de discromatopsia na população estudada, no entanto, deve ser mais bem avaliada tentando aumentar o tamanho da amostra, utilização de outros testes e, principalmente, por estudos genéticos para verificar os genes codificadores dos fotopigmentos para melhor compreensão das condições relacionadas à visão de cores dessa comunidade indígena.PURPOSE: to evaluate the frequency of dyschromatopsias among the 10 to 45-year-old male Indian population of Lalima village, Terena ethnicity, in Miranda-MS, using

  18. Fosrenol for Enhancing Dietary Protein Intake in Hypoalbuminemic Dialysis Patients (FrEDI Study

    Directory of Open Access Journals (Sweden)

    Tara Koontz

    2012-06-01

    Full Text Available Protein-energy wasting (PEW, reflected by serum albumin 5.5 mg/dL is also common and is associated with high death risk. The traditional dietary approach to control hyperphosphatemia by limiting protein foods may cause or worsen PEW. We hypothesized that provision of a high protein diet including during HD treatment results in favorable outcomes if a potent phosphorus binder such as lanthanum carbonate (Fosrenol™ can control phosphorus simultaneously and conducted a pilot/feasibility randomized controlled trial in 110 hypoalbuminemic (<4.0 mg/dL MHD patients in several dialysis clinics. After a washout period and upon 1:1 randomization, we provided the INTERVENTION group with 8 weeks of high protein meals as prepared meal boxes (50 g protein, 850 Cal, phosphorus to protein ratio <10 mg/gm during each HD treatment, along with 0.5 to 1.5 g Fosrenol (titrated as needed plus dietary counseling to maintain a high dietary protein intake at home. The CONTROL group received meal boxes containing low calorie (<50 Cal and almost no protein (<1 g, such as salads during each HD treatment and continued non-Fosrenol binders. We examined combined change in serum albumin with remaining in target phosphorus range of 3.5-<5.5 mg/dL over the 8 weeks of intervention. Among the 51 intervention and 55 control subjects who qualified for the intention-to-treat analyses, the combined rise in albumin ≥0.2 g/dL while maintaining phosphorus in 3.5-<5.5 mg/dL range was achieved in 25.5% and 9.8%, respectively (χ² p-value 0.036. No serious adverse events were reported, and patients reported satisfaction with high protein meals during HD. Hence, provision of high protein meals combined with Fosrenol™ during HD is safe and may improve albumin while controlling serum phosphorus. ClinicalTrials.gov # NCT0111694

  19. A Study of EDI, Processes, Operations and How Employees are Motivated at a Kenyan Bank

    OpenAIRE

    Fazal, Waheed Sultanali Muradali

    2009-01-01

    According to Brabston, L. and Porter, (2004) Information system (IS) and business strategy are essential facets in any organization particularly a bank, we are interested in this sector because it is a major component in Kenya‟s growing economy and so far hardly any research has been done on the efficiency of a Kenyan banks. This dissertation concentrates on a small service enterprise and how IS/IT as well as work motivation strategy can influence the business strategy; we also study how the ...

  20. Analisis Koalisi Lukman Edy dan Suryadi Khusaini pada Pemilihan Gubernur dan Wakil Gubernur Riau Tahun 2013

    OpenAIRE

    ", ISHAK; YULIANSYAH, HADI

    2014-01-01

    A political party is an organized group, whose members have orientation, values and ideals are the same. Political Recruitment is the process by which individuals enroll warrant or to occupy a position. Recruitment is a two way process , and its nature can be formal or informal. Recruitment candidates are strongly associated with the selection of leadership, both internal party leadership and the broader national leadership.The coalition formation occurs at the end of the second second, at wh...

  1. Predicting Early School Achievement with the EDI: A Longitudinal Population-Based Study

    Science.gov (United States)

    Forget-Dubois, Nadine; Lemelin, Jean-Pascal; Boivin, Michel; Dionne, Ginette; Seguin, Jean R.; Vitaro, Frank; Tremblay, Richard E.

    2007-01-01

    School readiness tests are significant predictors of early school achievement. Measuring school readiness on a large scale would be necessary for the implementation of intervention programs at the community level. However, assessment of school readiness is costly and time consuming. This study assesses the predictive value of a school readiness…

  2. Does the EDI Measure School Readiness in the Same Way across Different Groups of Children?

    Science.gov (United States)

    Guhn, Martin; Gadermann, Anne; Zumbo, Bruno D.

    2007-01-01

    The present study investigates whether the Early Development Instrument (Offord & Janus, 1999) measures school readiness similarly across different groups of children. We employ ordinal logistic regression to investigate differential item functioning, a method of examining measurement bias. For 40,000 children, our analysis compares groups…

  3. Application of the EDYS Model to Evaluate Control Methods for Invasive Plants at Fort Carson, Colorado

    National Research Council Canada - National Science Library

    Hunter, Rachael G

    2004-01-01

    .... Non-indigenous invasive plants can also reduce and destroy forage for livestock and wildlife, displace native plant species, increase fire frequency, reduce recreational opportunities, and can poison domestic animals...

  4. Supply Chain Management: A Case Study of Using EDI and Bar Code Information Technology

    National Research Council Canada - National Science Library

    Wu, Wei-Ya

    1997-01-01

    .... Together, these two business solutions, targeted at purchasing, receiving and shipping systems, allow everyone to operate more efficiently and profitably, while reacting more quickly and providing...

  5. Application of the EDYS Model to Evaluate Control Methods for Invasive Plants at Fort Carson, Colorado

    Science.gov (United States)

    2004-12-01

    increase fire frequency, reduce recreational opportunities, and can poison domestic animals. It is imperative to find economical , ecologically sound...Technology 15:257-269. Childress, W. Michael, Terry McLendon, and David L. Price. 1999a. A Multiscale Ecological Model for Allocation of Training...of some ecologically distinct plant species to nitrate and to ammonium nitrogen. Journal of Ecology 60: 93-102. Gould, Frank W. 1975. The Grasses

  6. Acordo ortográfico: o discurso governamental da 5ª Edição

    Directory of Open Access Journals (Sweden)

    Indianara Luzia Peron

    2014-07-01

    Full Text Available O presente artigo é o resultado de uma análise sobre o novo acordo ortográfico, visando o discurso governamental. Desde a colonização linguística tenta-se unificar a língua dos países lusófonos, tendo o poder político como impulsionador desta unificação. O novo acordo ortográfico gera muitas mudanças, como atualização de livros, revistas, jornais e sites. As opiniões sobre a nova ortografia despertam dúvidas, pois os países da comunidade lusófona possuem uma cultura própria. Vários os fatores que contribuem para a busca dessa unificação, uma delas é o uso de duas ortografias, que se torna prejudicial à unidade intercontinental da língua. Palavras-chave: acordo ortográfico; comunidade lusófona; discurso governamental; unificação.

  7. Leveling the Playing Field: Giving Girls An Equal Chance for Basic Education--Three Countries' Efforts. EDI Learning Resources Series.

    Science.gov (United States)

    Stromquist, Nelly; Murphy, Paud

    This booklet examines the efforts of Pakistan, Bangladesh and Malawi to increase the enrollment of girls in their schools. Each country has severe problems of access to education for girls; the gender gap in the gross enrollment rate at the primary school level is at least 10 percentage points in each country. What is noteworthy about these three…

  8. High-speed low-complexity video coding with EDiCTius: a DCT coding proposal for JPEG XS

    Science.gov (United States)

    Richter, Thomas; Fößel, Siegfried; Keinert, Joachim; Scherl, Christian

    2017-09-01

    In its 71th meeting, the JPEG committee issued a call for low complexity, high speed image coding, designed to address the needs of low-cost video-over-ip applications. As an answer to this call, Fraunhofer IIS and the Computing Center of the University of Stuttgart jointly developed an embedded DCT image codec requiring only minimal resources while maximizing throughput on FPGA and GPU implementations. Objective and subjective tests performed for the 73rd meeting confirmed its excellent performance and suitability for its purpose, and it was selected as one of the two key contributions for the development of a joined test model. In this paper, its authors describe the design principles of the codec, provide a high-level overview of the encoder and decoder chain and provide evaluation results on the test corpus selected by the JPEG committee.

  9. 5 anos de trabalho, 10 edições e mais de 100 trabalhos publicados: a identidade da revista Navus

    Directory of Open Access Journals (Sweden)

    Eduardo Gomes Carvalho

    2016-01-01

    Full Text Available Um dos principais veículos, se não o principal, para comunicação científica são os periódicos. Portanto, faz sentido estudar uma ou mais revistas científicas. Tais tipos de estudos não são raros na literatura, mesmo na brasileira, podendo citar como exemploMueller e Pecegueiro (2001. Esses estudos são importantes pois apresentam indicadores científicos de produção científica em uma determinada área. Assim, é objetivo do presente trabalho realizar uma análise bibliométrica da revista Navus buscando identificar características significativas da produção científica em gestão e tecnologia. A escolha do referido periódico se justifica primeiramente por publicar majoritariamente trabalhos nacionais, e em segundo por ser uma publicação jovem, trimestral e indexada em importantes bases. Serão apresentados os principais autores, os trabalhos mais relevantes do periódico e as palavras-chave mais utilizadas. Também serão apresentados caminhos para a melhoria da classificação do periódico no sistema Qualis de avaliação da Coordenação de Aperfeiçoamento de Pessoal de Nível superior. 

  10. RESENHA: BROADIE, A. Introduction to medieval logic. Segunda edição. Oxford: Clarendon Press, 2002.

    Directory of Open Access Journals (Sweden)

    Alexandre Cabeceiras

    2011-05-01

    Full Text Available Nessa obra, Broadie, após discutir qual seria a melhor ordem de exposição paraum texto sobre lógica medieval, decide tratar primeiro dos termos, depois dasproposições e, por fim, das inferências. Mas, não se restringindo ao que era uniforme oupredominante na Idade Média, explora disputas envolvendo lógicos ou filósofos daqueleperíodo. Delimitando seu objeto, estabelece que a obra lidará, hegemonicamente, commaterial produzido no período entre a segunda metade do século XIII e o final do séculoXV, por considerar essa a fase mais produtiva no que se refere à lógica medieval.

  11. Ecological DYnamics Simulation Model - Light (EDYS-L): User’s Guide Version 4.6.4

    Science.gov (United States)

    2011-08-01

    precipitation amount. Normal precipitation uses a value of 1.00. A wet cycle of a 25% increase would use a value of 1.25, while a drought 75% of normal would...tridentata Little bluestem Schizachyrium scoparium Mesquite Prosopis glandulosa Ponderosa pine Pinus ponderosa Ragweed Ambrosia artemisiifolia Russian

  12. Na sala de edição: “Mãe judia, 1964”, de Moacyr Scliar

    Directory of Open Access Journals (Sweden)

    Nicola Gavioli

    2014-01-01

    Full Text Available In contemporary Brazil, efforts continue to conceal liabilities of crimes committed during the years of dictatorship and to alter or weaken the testimony of victims who have spoken out against their perpetrators. This article explores how the short story “Jewish mother, 1964” by Moacyr Scliar, under the guise of a coming-of-age story and a monologue of a mentally ill patient, sheds light on violent practices that, without leaving visible marks on the body, have incurred serious and longstanding wounds within Brazilian society. Readers are made to see how persuasion, trivialization, and silencing are complicit in the “normalizing” of recent and traumatic histories. If made recognizable, this silencing practice could directly be challenged.

  13. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Joaquim Barradas de Carvalho

    1968-03-01

    Full Text Available IV - O Esmeraldo de Situ Orbis  O título da obra de Duarte Pacheco Pereira é composto pela palavra Esmeraldo e pela expressão De Situ Orbis. A compreensão da expressão De Situ Orbis não apresenta a mínima dificuldade. To-dos os autores que abordâram o assunto foram unânimes em consi-derar que se trata do título da obra de Pompônio Mela .

  14. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Joaquim Barradas de Carvalho

    1967-09-01

    Full Text Available Apesar da célebre "Carta" ter sido muitas vêzes editada (1, a verdade é que quase nada se sabe àcêrca do seu autor . Tendo em con-ta a documentação conhecida, surgem-nos até três, ou mesmo quatro, personagens com êste nome: existiu um Mestre João de Menelau, grego; existiu um Mestre João, alemão; existiu um Mestre João Fa-ras, espanhol, talvez aragonês, autor de uma tradução para espanhol do De Situ Orbis de Pompônio Mela (2, que bem poderá ser o Mestre João autor da célebre "Carta".

  15. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Joaquim Barradas de Carvalho

    1966-06-01

    Full Text Available É um fato incontestável que a História de Portugal, e até a História da Civilização Ibérica, avultam na História Universal mercê dos Descobrimentos Marítimos e da Expansão dos séculos XV e XVI. Só os Descobrimentos e a Expansão puderam ter dado origem a algo de inteiramente nôvo na História da Humanidade que tenha provindo de Portugal.

  16. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Joaquim Barradas de Carvalho

    1969-03-01

    Full Text Available Duarte Pacheco Pereira pertenceu a uma família cujas origens, segundo certos autores, seriam muito longínqüas . Os Pachecos descenderiam, com efeito, de um Lasius Suavius Paciecus que teria guerreado em Espanha (1 . Outros genealogistas, menos temerários, remontam a um D. Fernando Geremias, oriundo da Galiza, e rico-homem de Afonso VI de Leão.

  17. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Joaquim Barradas de Carvalho

    1969-06-01

    Full Text Available Em 14 de dezembro de 1508 (94 D. Manuel encarregou um chamado João Serrão de dar caça, com uma pequena frota, ao corsário francês Mondragon, que tinha atacado navios portuguêses pro-venientes da Ilidia . João Serrão não cumpriu a contento a sua mis-são e o rei substituiu-o por Duarte Pacheco Pereira .

  18. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Ana Maria de Almeida Camargo

    1966-12-01

    Full Text Available Muitas são as conjeturas em tôrno da figura de Pero Vaz de Caminha. Vários autores tentaram sua biografia, sem contudo, por falta de documentação esclarecedora, chegarem a resultados satisfatórios. O nosso caso não diferirá, infelizmente, em muito, do dos nossos antecessores.

  19. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Miyoko Makino

    1967-03-01

    A Relação do Pilôto Anônimo constitui, ao lado das Cartas de Pero Vaz de Caminha e do Mestre João, um importante documento sôbre o descobrimento do Brasil, pois seu autor participou da expedição de Pedro Álvares Cabral. Contêm os principais acontecimentos da viagem às índias, desde a partida da armada até o seu regresso a Portugal. Foi conhecida e divulgada na época, através de várias coleções de viagens.

  20. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Joaquim Barradas de Carvalho

    1968-12-01

    Full Text Available Não há nenhum documento referente à biografia de Duarte Pa-checo Pereira que nos possa ajudar a estabelecer a data, ou entre que datas, êle redigiu o seu Esmeraldo de situ orbis. Em conseqüên-cia, somos levados a considerar muito atentamente o texto da sua obra, o texto do Esmeraldo.

  1. The use of EDI to reduce the ammonia concentration in steam generators blowdown of PWR nuclear power plants

    International Nuclear Information System (INIS)

    Calay, J.C.; Goffin, C.

    2000-01-01

    To be recycled, PWR steam generator blowdown must be purified by mechanical filters, followed by ion exchangers (mixed bed preceded by a cationic ion exchange resin). The cationic ion exchange resin eliminates the conditioning agent ammonia in order to lengthen the cycles of the mixed bed. In the Doel nuclear power plant, Laborelec performed tests on a pilot plant for continuous electrodeionization that might replace the cation exchanger. The test campaign lasted six months. It is concluded that ammonia is removed well (1,000 μg/kg in the feed vs. 3 - 4 μg/kg in the product). The electrodeionization removes also other impurities; the conductivity of the treated water amounts to nearly 0.07 μs/cm

  2. Factors Associated with the Retinal Nerve Fiber Layer Loss after Acute Primary Angle Closure: A Prospective EDI-OCT Study.

    Directory of Open Access Journals (Sweden)

    Eun Ji Lee

    Full Text Available To determine the factors associated with retinal nerve fiber layer (RNFL loss in eyes with acute primary angle-closure (APAC, particularly focusing on the influence of the change in the anterior lamina cribrosa surface depth (LCD.After the initial presentation, 30 eyes with unilateral APAC were followed up at the following specific time points over a 12-month period: 1 week, 1~2 months, 2~3 months, 5~6 months, and 11~12 months. These follow-ups involved intraocular pressure measurements, enhanced depth-imaging spectral-domain optical coherence tomography (SD-OCT scanning of the optic disc, and measurements of the circumpapillary RNFL thickness. The prelaminar tissue thickness (PLT and LCD were determined in the SD-OCT images obtained at each follow-up visit.Repeated measures analysis of variance revealed a significant pattern of decrease in the global RNFL thickness, PLT, and LCD (all p<0.001. The global RNFL thickness decreased continuously throughout the follow-up period, while the PLT decreased until 5~6 months and did not change thereafter. The LCD reduced until 2~3 months and then also remained steady. Multivariable regression analysis revealed that symptoms with a longer duration before receiving laser peripheral iridotomy (LI (p = 0.049 and a larger LCD reduction (p = 0.034 were significant factors associated with the conversion to an abnormal RNFL thickness defined using OCT normative data.Early short-term decreases in the PLT and LCD and overall long-term decrease in the peripapillary RNFL were observed during a 12-month follow-up after an APAC episode. A longer duration of symptoms before receiving LI treatment and larger LCD reduction during follow-up were associated with the progressive RNFL loss. The LCD reduction may indicate a prior presence of significant pressure-induced stress that had been imposed on the optic nerve head at the time of APAC episode. Glaucomatous progression should be suspected in eyes showing LCD reduction after the APAC remission.

  3. An Indigenous Knowledges Perspective on Valid Meaning Making: A Commentary on Research with the EDI and Aboriginal Communities

    Science.gov (United States)

    Sam, Michele A.

    2011-01-01

    Offering an Indigenous perspective, this commentary discusses collaborative research, shared meaning making, and knowledge building specific to child development, and reflects on social, cultural, and historical aspects that influence these processes. Drawing upon experiences of developing a collaborative research approach with which to engage…

  4. Application of the EDYS Model to Evaluate Control Methods for Invasive Plants at Yakima Training Center, Washington

    National Research Council Canada - National Science Library

    Hunter, Rachael G; Mata-Gonzalez, Ricardo; McLendon, Terry

    2004-01-01

    .... Non-indigenous invasive plants can also reduce and destroy forage for livestock and wildlife, displace native plant species, increase fire frequency, reduce recreational opportunities, and can poison domestic animals...

  5. Nota editorial - Geonorte Edição 1 de 2017 v8 n°29

    OpenAIRE

    João Cândido André da Silva Neto

    2017-01-01

    Prezados leitores e autores, a Revista Geonorte está passando por uma reestruturação do conselho científico, corpo editorial e novo editor gerente, buscando assim, novos patamares para revista na perspectiva da divulgação do conhecimento científico produzido pela ciência geográfica e áreas afins. Informamos ainda que a Revista Geonorte a partir do ano de 2017 está com o DOI - Digital Object Identifier, um identificador único de metadados, além de estar compartilhada em diversas bases inde...

  6. Nota editorial - Geonorte Edição 1 de 2017 v8 n°29

    Directory of Open Access Journals (Sweden)

    João Cândido André da Silva Neto

    2017-08-01

    Full Text Available Prezados leitores e autores, a Revista Geonorte está passando por uma reestruturação do conselho científico, corpo editorial e novo editor gerente, buscando assim, novos patamares para revista na perspectiva da divulgação do conhecimento científico produzido pela ciência geográfica e áreas afins. Informamos ainda que a Revista Geonorte a partir do ano de 2017 está com o DOI - Digital Object Identifier, um identificador único de metadados, além de estar compartilhada em diversas bases indexadoras (18, permitindo ampla divulgação dos artigos publicados.

  7. Application of the EDYS Model to Evaluate Control Methods for Invasive Plants at Yakima Training Center, Washington

    Science.gov (United States)

    2004-12-01

    native plant species, increase fire frequency, reduce recreational opportunities, and can poison domestic animals. It is imperative to find economical ...A Multiscale Ecological Model for Allocation of Training Activities on US Army Installations. In: Jeffrey M. Klopatek and Robert H. Gardner (eds...Gigon, A. and I. H. Rorison. 1972. The response of some ecologically distinct plant species to nitrate and to ammonium nitrogen. Journal of Ecology

  8. Evaluation of estimated daily intake (EDI) of cadmium and lead for rice (Oryza sativa L.) in calcareous soils.

    Science.gov (United States)

    Chamannejadian, Ali; Sayyad, Gholamabbas; Moezzi, Abdolamir; Jahangiri, Alireza

    2013-04-08

    The excessive amounts of cadmium and lead in food chain can cause health problems for humans and ecosystem. Rice is an important food in human diet. Therefore this study was conducted in order to investigate cadmium and Lead concentrations in seed rice (Oryza saliva) of paddy fields in southwest of Iran. A total of 70 rice seed samples were collected from paddy fields in five regions of Khuzestan province, Southwest Iran, during harvesting time. In the samples cadmium and Lead concentrations were measured. To assess the daily intake of Cadmium and Lead by rice, daily consumption of rice was calculated. The results showed that average concentrations of Cadmium and Lead in rice seeds were 273.6 and 121.8 μg/kg, respectively. Less than 72% of rice seed samples had Cadmium concentrations above 200 μg/kg (i.e. Guide value for cadmium); and less than 3% had Lead concentrations above 150 μg/kg (i.e. Guide value for Lead). The estimated daily intakes of cadmium by the local population was calculated to 0.59 μg/day kg bw, which corresponds to 59% of the tolerable daily intakes (i.e. 1 μg/day kg bw). Eleven out of 70 samples (15.71%) exceed the tolerable daily intakes. The dietary intakes for Lead in the local population ranged from 0.22 to 0.47 μg/day kg bw. Tolerable daily intakes for Lead is 3.6 μg/day kg bw. As a whole, long term consumption of the local rice may bear high risk of heavy metal exposure to the consumer in the study region.

  9. Fluctuating seawater pH/pCO2 regimes are more energetically expensive than static pH/pCO2 levels in the mussel Mytilus edulis.

    Science.gov (United States)

    Mangan, Stephanie; Urbina, Mauricio A; Findlay, Helen S; Wilson, Rod W; Lewis, Ceri

    2017-10-25

    Ocean acidification (OA) studies typically use stable open-ocean pH or CO 2 values. However, species living within dynamic coastal environments can naturally experience wide fluctuations in abiotic factors, suggesting their responses to stable pH conditions may not be reflective of either present or near-future conditions. Here we investigate the physiological responses of the mussel Mytilus edulis to variable seawater pH conditions over short- (6 h) and medium-term (2 weeks) exposures under both current and near-future OA scenarios. Mussel haemolymph pH closely mirrored that of seawater pH over short-term changes of 1 pH unit with acidosis or recovery accordingly, highlighting a limited capacity for acid-base regulation. After 2 weeks, mussels under variable pH conditions had significantly higher metabolic rates, antioxidant enzyme activities and lipid peroxidation than those exposed to static pH under both current and near-future OA scenarios. Static near-future pH conditions induced significant acid-base disturbances and lipid peroxidation compared with the static present-day conditions but did not affect the metabolic rate. These results clearly demonstrate that living in naturally variable environments is energetically more expensive than living in static seawater conditions, which has consequences for how we extrapolate future OA responses in coastal species. © 2017 The Authors.

  10. CULTURA, LAZER E TURISMO A FESTA DO PINHÃO DE SÃO FRANCISCO DE PAULA/RS Edições 2009 e 2010

    Directory of Open Access Journals (Sweden)

    Airton da Silva Negrine

    2011-02-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} O artigo é produto de um trabalho acadêmico de investigação realizado por professores, alunos e ex-alunos do Mestrado de Turismo da Universidade de Caxias do Sul tendo como cenário de estudo a XIII e XIV Festa do Pinhão de São Francisco de Paula/RS, nos anos de 209 e 2010 respectivamente.O estudo das festas teve o propósito dar destaque a Araucária e seu fruto, a gastronomia e os valores culturais do pinhão como alimento de diferentes espécies que está em vias de extinção segundo fontes citadas no texto. Como a festa foco do estudo é uma festa temática, artigo o evento como cultura, lazer e turismo.

  11. Colaboração, edição, transparência: desafios e possibilidades de uma “wikificação” do jornalismo

    Directory of Open Access Journals (Sweden)

    Carlos d'Andréa

    2009-06-01

    Full Text Available A fragmentação dos relatos e a pluralidade de vozes são duas características marcantes da dinâmica de produção e publicação de informações, inclusive de caráter jornalístico, na atualidade. O modelo consolidado na era da comunicação de massa, baseado na restrição da produção e disseminação de notícias a poucos veículos e profissionais, responsáveis pela elaboração de produtos “acabados” (jornais, revistas etc., convive cada vez mais perto e é decisivamente influenciado por um fluxo disperso e ininterrupto de informações produzidas para, na e à  revelia das redações jornalísticas.

  12. The effect of childhood adversity on 4-year outcome in individuals at ultra high risk for psychosis in the Dutch Early Detection Intervention Evaluation (EDIE-NL) Trial

    NARCIS (Netherlands)

    Kraan, Tamar C.; Ising, Helga K.; Fokkema, Marjolein; Velthorst, Eva; van den Berg, David P. G.; Kerkhoven, Margot; Veling, Wim; Smit, Filip; Linszen, Don H.; Nieman, Dorien H.; Wunderink, Lex; Boonstra, Nynke; Klaassen, Rianne M. C.; Dragt, Sara; Rietdijk, Judith; de Haan, Lieuwe; van der Gaag, Mark

    2017-01-01

    Childhood adversity is associated with a range of mental disorders, functional impairment and higher health care costs in adulthood. In this study we evaluated if childhood adversity was predictive of adverse clinical and functional outcomes and health care costs in a sample of patients at

  13. Edição Temática “Cidades inteligentes: planejamento e gestão da sustentabilidade”

    Directory of Open Access Journals (Sweden)

    Cláudia Terezinha Kniess

    2016-09-01

    Ressalta-se que a revista GeSeC está inserida em bases indexadoras nacionais e internacionais, a saber:  Redalyc; Cengage Gale Learning; DOAJ; Proquest; Ebsco Host e Web of Science Core Collection.

  14. O estômago de um periódico: edição e circulação da Revista de Antropofagia

    OpenAIRE

    Queiroz, Helaine Nolasco

    2016-01-01

    A Revista de Antropofagia consiste em um periódico literário vanguardista que circula em São Paulo, entre maio de 1928 e agosto de 1929, reunindo dezenas de literatos e artistas sob a liderança do escritor Oswald de Andrade. A Antropofagia propõe a deglutição dos modelos importados, especialmente os europeus, no intuito de absorver o que eles têm de positivo, criando uma cultura brasileira mais forte, livre dos recalques a que se supõe estar submetida no período. Ela traça uma inversão da rel...

  15. DoD Electronic Data Interchange (EDI) Convention: ASC X12 Transaction Set 858 Freight Government Bill of Lading Shipment Information (Version 003010)

    Science.gov (United States)

    1993-02-01

    Segment: BX General Shipment Information Level: A Sequence: 30 Usage: M Max Use: 1 Loop: Purpose: To transmit identification numbers and other basic ...official code as- signed to a city or point (for ratemaking purposes) within a city. 930210 10.7.25 DEPARTM•B•T OF DOOM4N GOVERMET SILL OF LAD#M wDI...development group as the official code as- signed to a city or point (for ratemaking purposes) within a city. 930210 10.7.27 DEPARTMENT OF DG:dEI GOVWERJT

  16. 48 CFR 552.216-72 - Placement of Orders.

    Science.gov (United States)

    2010-10-01

    ...] (b) Orders may be placed through Electronic Data Interchange (EDI) or mailed in paper form. EDI... Data Interchange (EDI) format. (c) If the Contractor agrees, General Services Administration's Federal Acquisition Service (FAS) will place all orders by EDI using computer-to-computer EDI. If computer-to-computer...

  17. 75 FR 41093 - General Services Administration Acquisition Regulation; Rewrite of GSAR Part 516, Types of Contracts

    Science.gov (United States)

    2010-07-15

    ...) will place all orders by EDI using computer-to-computer EDI. If computer-to-computer EDI is not possible, FAS will use an alternative EDI method allowing the Contractor to receive orders by facsimile transmission. Subject to the Contractor's agreement, other agencies may place orders by EDI. * * * * * (g) The...

  18. 77 FR 57090 - Agency Information Collection Activities: Proposed Collection; Comment Request

    Science.gov (United States)

    2012-09-17

    ...: Medicare Electronic Data Interchange (EDI) Registration and Electronic Data Interchange (EDI) Enrollment... Electronic Data Interface (EDI) functions. The EDI Enrollment and the Medicare Registration Forms are... efficient uniform means by which Medicare captures information necessary to drive Medicare EDI security and...

  19. Cultural Narratives: Developing a Three-Dimensional Learning Community through Braided Understanding

    Science.gov (United States)

    Heck, Marsha L.

    2004-01-01

    Paula Underwood's "Learning Stories" braid together body, mind, and spirit to enable understanding that does not easily unravel. They tell of relationships among individual and community learning that parallel other ancient and contemporary ideas about learning in caring communities. Underwood's tradition considers learning sacred; everyone's…

  20. The Velvet Hammer

    Science.gov (United States)

    Henderson, Nancy

    2008-01-01

    This article features the life of Louise Underwood, an advocate for people with disabilities and their families. Underwood is known for her nickname "The Velvet Hammer" because of her relentless attitude when it comes to advocating for people with disabilities. Many times she has pulled strings to halt legislation that would have…

  1. 76 FR 40457 - Administrative Simplification: Adoption of Operating Rules for Eligibility for a Health Plan and...

    Science.gov (United States)

    2011-07-08

    ... information. Electronic Data interchange (EDI) enables providers and payers to process financial and... hardware and software to exchange EDI data. Each trading partner, including providers, separately provides...

  2. 75 FR 76426 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2010-12-08

    ... name, middle initial); unique identifiers including Electronic Data Interchange Person Identifier (EDI... (EDI PI), other unique identifier (not Social Security Number), Federal Agency Smart Credential Number...

  3. 78 FR 12322 - Agency Information Collection Activities: OMB Review; Comment Request

    Science.gov (United States)

    2013-02-22

    ... Interchange (EDI) Registration and Electronic Data Interchange (EDI) Enrollment Form; Use: The purpose of this... identification of Medicare providers/suppliers and authorization of requested Electronic Data Interface (EDI) functions. The EDI Enrollment and the Medicare Registration Forms are completed by Medicare providers...

  4. 75 FR 64737 - Automated Commercial Environment (ACE): Announcement of a National Customs Automation Program...

    Science.gov (United States)

    2010-10-20

    ... interchange (EDI) for submitting advance ocean and rail data and intends to amend the regulations as [email protected] . Please describe in the body of the e-mail any past EDI history with CBP. Written... (EDI). For ocean and rail carriers, the CBP-approved EDI is the Automated Manifest System (AMS). Ocean...

  5. Detecting Fraudulent Erasures at an Aggregate Level

    Science.gov (United States)

    Sinharay, Sandip

    2018-01-01

    Wollack, Cohen, and Eckerly suggested the "erasure detection index" (EDI) to detect fraudulent erasures for individual examinees. Wollack and Eckerly extended the EDI to detect fraudulent erasures at the group level. The EDI at the group level was found to be slightly conservative. This article suggests two modifications of the EDI for…

  6. 77 FR 70708 - VA Acquisition Regulation: Electronic Submission of Payment Requests

    Science.gov (United States)

    2012-11-27

    ... electronic data interchange (EDI) formats; or (3) another electronic form as prescribed by the contract....fsc.va.gov/einvoice.asp .); or, (b) A system that conforms to the X12 electronic data interchange (EDI... Institute (ANSI). The X12 EDI Web site ( http://www.x12.org ) includes additional information on EDI 810 and...

  7. 78 FR 29378 - Aquatic Nuisance Species Task Force; Public Teleconference/Webinar

    Science.gov (United States)

    2013-05-20

    ... Invasive Species Awareness Week, Michigan and Mississippi ANS Management Plans, and Asian Carp Surveillance....gov . Dated: May 14, 2013. Jeffrey Underwood, Acting Co-Chair, Aquatic Nuisance Species Task Force...

  8. 77 FR 16256 - Aquatic Nuisance Species Task Force Meeting

    Science.gov (United States)

    2012-03-20

    ... wheelchair users. If you require additional accommodations, please notify us at least 1 week in advance of... Act (5 U.S.C. App.) Dated: March 6, 2012. Jeffrey Underwood, Acting Co-Chair, Aquatic Nuisance Species...

  9. 76 FR 15334 - Aquatic Nuisance Species Task Force Meeting

    Science.gov (United States)

    2011-03-21

    ... Task Force Web site at: http://anstaskforce.gov/meetings.php . FOR FURTHER INFORMATION CONTACT: Susan...: http://anstaskforce.gov/meetings.php . Dated: March 14, 2011. Jeffrey Underwood, Acting Assistant...

  10. Department of Surgery, University of the Witwatersrand – a brief history

    African Journals Online (AJOL)

    result the departure of professors of anatomy and physiol- ogy was not permitted. .... details of the dog on which this surgery had been performed) and Underwood ... (Sholem Kay), breast cancer surgery (Myron Lange), thyroid diseases (Theo ...

  11. Poznámky k edičnímu zpracování rukopisných náčrtů v Kritické hybridní edici

    Czech Academy of Sciences Publication Activity Database

    Kosák, Michal; Flaišman, Jiří

    2017-01-01

    Roč. 2, č. 1 (2017), s. 38-43 ISSN 2453-8507 R&D Projects: GA MK(CZ) DG16P02H033 Keywords : Kritická hybridní edice (Critical Hybrid Editions) * editing * digital editions Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  12. Behaviour at high pressure of Rb7NaGa8Si12O40·3H2O (a zeolite with EDI topology): a combined experimental-computational study

    Science.gov (United States)

    Gatta, G. D.; Tabacchi, G.; Fois, E.; Lee, Y.

    2016-03-01

    The high-pressure behaviour and the P-induced structural evolution of a synthetic zeolite Rb7NaGa8Si12O40·3H2O (with edingtonite-type structure) were investigated both by in situ synchrotron powder diffraction (with a diamond anvil cell and the methanol:ethanol:water = 16:3:1 mixture as pressure-transmitting fluid) up to 3.27 GPa and by ab initio first-principles computational modelling. No evidence of phase transition or penetration of P-fluid molecules was observed within the P-range investigated. The isothermal equation of state was determined; V 0 and K T0 refined with a second-order Birch-Murnaghan equation of state are V 0 = 1311.3(2) Å3 and K T0 = 29.8(7) GPa. The main deformation mechanism (at the atomic scale) in response to the applied pressure is represented by the cooperative rotation of the secondary building units (SBU) about their chain axis (i.e. [001]). The direct consequence of SBU anti-rotation on the zeolitic channels parallel to [001] is the increase in pore ellipticity with pressure, in response to the extension of the major axis and to the contraction of the minor axis of the elliptical channel parallel to [001]. The effect of the applied pressure on the bonding configuration of the extra-framework content is only secondary. A comparison between the P-induced main deformation mechanisms observed in Rb7NaGa8Si12O40·3H2O and those previously found in natural fibrous zeolites is made.

  13. Análise do conteúdo das provas da área de Ciências Contábeis: edições do Provão 2002/2003 e do ENADE de 2006

    Directory of Open Access Journals (Sweden)

    Nálbia de Araújo Santos

    Full Text Available Resumo: Este estudo tem dois objetivos. O primeiro é verificar se as provas da área de Ciências Contábeis do Provão de 2002/2003 e do ENADE/2006 incluíram os itens que representem adequadamente o domínio de conteúdo da área. O segundo objetivo é desenvolver uma análise crítica acerca destes testes de desempenho. Para tanto, empregou-se a técnica do grupo focal. Foram realizadas duas sessões de entrevistas junto a um grupo de especialistas da área, composto por docentes, estudantes de mestrado e doutorado. Os resultados evidenciam que na percepção dos participantes do grupo focal os exames podem ser considerados uma aproximação adequada do nível de conhecimento cognitivo da área, dado que os principais conteúdos foram avaliados pelos testes. Entretanto, na percepção dos participantes as questões dos testes não mensuraram adequadamente as habilidades, atitudes e comportamentos predeterminados pelas comissões de especialistas da área, nomeadas pelo Instituto Nacional de Estudos e Pesquisas Educacionais Anísio Teixeira (INEP. Os participantes apontaram que o baixo desempenho dos estudantes possa estar relacionado à reduzida motivação para resolver a prova.

  14. A single blind randomized controlled trial of cognitive behavioural therapy in a help-seeking population with an At Risk Mental State for psychosis: the Dutch Early Detection and Intervention Evaluation (EDIE-NL) trial

    NARCIS (Netherlands)

    Rietdijk, J.; Dragt, S.; Klaassen, R.; Ising, H; Nieman, D.; Wunderink, L.; Delespaul, P.; Cuijpers, P.; Linszen, D.; van der Gaag, M.

    2010-01-01

    Background: Psychotic disorders are a serious mental health problem. Intervention before the onset of psychosis might result in delaying the onset, reducing the impact or even preventing the first episode of psychosis. This study explores the effectiveness of cognitive behavioural therapy (CBT) in

  15. Tenkostěnný sendvičový systém z vysokohodnotného betonu vyztuženého čedičovými vlákny

    DEFF Research Database (Denmark)

    Hodicky, Kamil; Hulin, Thomas

    2013-01-01

    The paper presents a new thin-walled high performance concrete (HPC) sandwich panel system reinforced with basalt fiber-reinforced plastic (BFRP). System is characteristic with a high structural resistance, thermal resistance and environmental friendliness. The newly developed shear connecting...

  16. 75 FR 7520 - Certain Refrigerators and Components Thereof; Notice of the Commission's Final Determination of...

    Science.gov (United States)

    2010-02-19

    ... for this investigation may be viewed on the Commission's electronic docket (EDIS) at http://edis.usitc... infringe claim 8 of the `130 patent. The Commission also affirms the ALJ's finding that the accused French...

  17. 77 FR 48007 - Administrative Simplification: Adoption of Operating Rules for Health Care Electronic Funds...

    Science.gov (United States)

    2012-08-10

    ... electronic data interchange (EDI). Through the use of electronic funds transfers (EFT) for health care claim... care transactions results in higher use of EDI by health care providers.\\8\\ We expect usage of EFT and...

  18. 75 FR 60782 - Notice of Regulatory Waiver Requests Granted for the Second Quarter of Calendar Year 2010

    Science.gov (United States)

    2010-10-01

    ... Town of Jean Lafitte, LA received an Economic Development Initiative Special Purpose (EDI-SP) grant in... the December 8, 2004 appropriation for the EDI-SP grant, but prior to the completion of a Federal...

  19. 76 FR 37136 - Post-Summary Corrections to Entry Summaries Filed in ACE Pursuant to the ESAR IV Test

    Science.gov (United States)

    2011-06-24

    ... accelerated liquidation request indicator. C. Electronic Data Interface (EDI) Capability Trade participants.../ace_edi_messages/catair_main/abi_catair . Operational documentation addressing PSC may be found in the...

  20. 78 FR 23778 - Notice of Proposed Information Collection: Comment Request: Congressional Earmark Grants

    Science.gov (United States)

    2013-04-22

    ... categories: Economic Development Initiative--Special Project (EDI--SP) grantees and Neighborhood Initiative... generally fall into two categories: Economic Development Initiative--Special Project (EDI--SP) grantees and...

  1. 76 FR 23628 - Agency Information Collection Activities: Submission for the Office of Management and Budget (OMB...

    Science.gov (United States)

    2011-04-27

    ... Form 628, ``Financial EDI Authorization;'' NUREG/BR-0254, Payment Methods; and NRC Form 629... applicable: NRC Form 628, ``Financial EDI Authorization'' and NRC Form 629, ``Authorization for Payment by...

  2. 75 FR 37455 - Mortgage Insurance Termination; Application for Premium Refund or Distributive Share Payment

    Science.gov (United States)

    2010-06-29

    ... EDI and is used to directly pay eligible homeowners. This condition occurs when the form passes the... information is submitted via the Internet or EDI and is used to directly pay eligible homeowners. This...

  3. 75 FR 12777 - Notice of Regulatory Waiver Requests Granted for the Fourth Quarter of Calendar Year 2009

    Science.gov (United States)

    2010-03-17

    ... Development Initiative Special Project (EDI-SP) funds to implement the Pagedale Community Development... are currently vacant. Subsequent to the March 11, 2009 appropriation containing the EDI-SP, but prior...

  4. 77 FR 1555 - Administrative Simplification: Adoption of Standards for Health Care Electronic Funds Transfers...

    Science.gov (United States)

    2012-01-10

    ... interim final rule with comment period. For further information about electronic data interchange (EDI... the accounts payable/receivable system and electronic data interchange (EDI) systems, and the business...

  5. 77 FR 72788 - Reduction of Use of Social Security Numbers in the Department of Defense

    Science.gov (United States)

    2012-12-06

    ... recommended replacing the SSN with the DoD Electronic Data Interchange Personal Identifier (EDI- PI... Number, the common name for the EDI-PI, is identified by both policies as the primary alternative for the...

  6. 76 FR 72210 - Notice of Proposed Information Collection: Comment Request Congressional Earmark Grants

    Science.gov (United States)

    2011-11-22

    ...-Special Project (EDI-SP) and Neighborhood Initiative (NI) grants. DATES: Comments Due Date: January 23... generally fall into two categories: Economic Development Initiative-Special Project (EDI-SP) grantees and...

  7. 75 FR 80854 - Agency Information Collection Activities: Proposed Collection; Comment Request

    Science.gov (United States)

    2010-12-23

    ..., ``Financial EDI Authorization''; NUREG/BR-0254, Payment Methods; and NRC Form 629, ``Authorization for Payment... licensing fees, and inspection fees to the NRC. The NRC Form 628, ``Financial EDI Authorization,'' provides...

  8. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... succinogenes] ... Length = 120 ... Query: 6 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVD...LPGVQKEDI 65 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVDLPGVQK...EDI Sbjct: 1 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVDLPGVQKEDI 60 ...

  9. Electronic Data Interchange: from its Birth to its New Role in Logistics Information Systems

    OpenAIRE

    Janssens, Gerrit K.

    2011-01-01

    The introduction of internet applications in e-commerce made many adopters think that EDI would soon disappear. But the trend in logistics towards closer collaboration in supply chains made on the other hand the impact of EDI larger. A resultant of those forces will probably lead to a new type of EDI, which integrates with other technologies. Early studies on EDI were promoting its use because of savings in administrative work. But due to intra-corporation management model...

  10. Electronic data intercharge: from its birth to its new role in logistics information systems

    OpenAIRE

    JANSSENS, Gerrit

    2011-01-01

    The introduction of internet applications in e-commerce made many adopters think that EDI would soon disappear. But the trend in logistics towards closer collaboration in supply chains made on the other hand the impact of EDI larger. A resultant of those forces will probably lead to a new type of EDI, which integrates with other technologies. Early studies on EDI were promoting its use because of savings in administrative work. But due to intra-corporation management model changes, to...

  11. Electronic data interchange in the Canadian natural gas industry

    International Nuclear Information System (INIS)

    Sheinfield, J.

    1995-01-01

    The concept of electronic data interchange (EDI) in the gas industry was discussed. EDI as a champion of costumer service and as a powerful management tool was defined, and the process of electronic information transfer was explained. EDI was then placed in the context of the business process, and its benefits in providing efficient service and product improvement were enumerated. North American Gas EDI standards, and industry initiatives were explored in detail

  12. Improving the Procurement of Information Technology Commodities

    Science.gov (United States)

    1994-04-12

    and 0 the federal government. Apply Electronic Data Interchange (EDI) to order processing at AVC. Implementing EDI at AVC and throughout the Air Force...ordering process by approximately 2 weeks. 4. Centralize the Central Order Processing Offices. By consolidating AVC and SSCs order processing responsibilities...Im plem entation ..................................................................................... 21 5. ORDER PROCESSING WITH EDI

  13. 77 FR 10621 - Changes to the In-Bond Process

    Science.gov (United States)

    2012-02-22

    ... submit in-bond applications electronically using a CBP-approved electronic data interchange (EDI) system... electronically submit the in-bond application to CBP via a CBP-approved EDI system. \\6\\ Due to the unique... as the CBP-approved EDI system for submitting the in-bond application and other information that is...

  14. 48 CFR 552.232-25 - Prompt Payment.

    Science.gov (United States)

    2010-10-01

    ... electronic data interchange (EDI) purchase orders (transaction set 850). (ii) The Contractor must generate and submit to the Government valid EDI invoices (transaction set 810) or submit invoices through the... of the Contractor, EFT payments through the Automated Clearing House (ACH) system. (iv) The EDI...

  15. 76 FR 42721 - Automated Commercial Environment (ACE): Announcement of a New Start Date for the National Customs...

    Science.gov (United States)

    2011-07-19

    ... the e-mail any past electronic data interchange (EDI) history with CBP. Written comments concerning... be transmitted in advance of arrival through a CBP-approved electronic data interchange (EDI).The..., 2008).\\1\\ Currently, the Automated Commercial System (ACS) is the CBP-approved EDI through which this...

  16. Alberta Learning: Early Development Instrument Pilot Project Evaluation.

    Science.gov (United States)

    Meaney, Wanda; Harris-Lorenze, Elayne

    The Early Development Instrument (EDI) was designed by McMaster University to measure the outcomes of childrens early years as they influence their readiness to learn at school. The EDI was piloted in several Canadian cities in recent years through two national initiatives. Building on these initiatives, Alberta Learning piloted the EDI as a…

  17. 77 FR 20835 - National Customs Automation Program (NCAP) Test Concerning Automated Commercial Environment (ACE...

    Science.gov (United States)

    2012-04-06

    ... Interchange (EDI). This notice also describes test particulars including commencement date, eligibility... Electronic Data Interchange (EDI) as part of the Document Image System (DIS) test. DIS is currently a stand... with supporting information via EDI in an Extensible Markup Language (XML) format, in lieu of...

  18. 75 FR 40729 - Residues of Quaternary Ammonium Compounds, N-Alkyl (C12-14

    Science.gov (United States)

    2010-07-14

    ... the Daily Dietary Dose (DDD) and the Estimated Daily Intake (EDI) using modified Food and Drug... survey days. The Estimated Daily Intake (EDI) calculations presented in this assessment for treated... is 0.0103 lbs a.i per gallon of treatment solution. EDI values were calculated using an approach...

  19. Extradyadic Involvement, Narcissism, and Callousness in College Students

    Science.gov (United States)

    Crass, Suzanne L.; Terranova, Andrew M.

    2018-01-01

    The relationship between narcissism, callousness, and extradyadic involvement (EDI), has been understudied. It was anticipated that callousness and narcissism would be associated with increased likelihood of engaging in an EDI and less distress about having engaged in the EDI. Participants (268 college students; 75% female; mean age of 20 years…

  20. 77 FR 65006 - Air Cargo Advance Screening (ACAS) Pilot Program

    Science.gov (United States)

    2012-10-24

    ... electronic cargo information by way of a CBP-approved electronic data interchange (EDI) system before the... electronically receive certain information regarding that cargo through a CBP-approved EDI system no later than... the above information regarding that cargo through a CBP-approved EDI system no later than the time of...

  1. 78 FR 35115 - Listing of Color Additives Exempt From Certification; Mica-Based Pearlescent Pigments

    Science.gov (United States)

    2013-06-12

    ... (EDI) of the additive from all sources for both the mean and high- intake consumer to an acceptable daily intake (ADI) level established by toxicological data. The EDI is determined by projections based... the issuance of Sec. 73.350 we calculated a cumulative EDI (CEDI) for the use of mica-based...

  2. 78 FR 52958 - Announcement of Test Concerning Manifesting and Entry of Residue Found in Instruments of...

    Science.gov (United States)

    2013-08-27

    ... Commercial Environment (ACE) will be the only CBP-approved electronic data interchange (EDI) system for... submitted electronically via EDI process at the master or simple bill level. (2) Qualifiers for IIT with... Regular Bill should be submitted electronically via EDI process. (b) Qualifiers for IIT with Residue (TBD...

  3. 77 FR 50613 - Didecyl Dimethyl Ammonium Carbonate and Didecyl Dimethyl Ammonium Bicarbonate; Exemption From the...

    Science.gov (United States)

    2012-08-22

    ...) and the Estimated Daily Intake (EDI) using modified Food and Drug Administration (FDA) methodologies for utensils and the Indirect Dietary Residential Exposure Model (IDREAM) for countertops. The EDI... for DDACB for bottling/packing of food is 0.0033 lbs a.i. per gallon of treatment solution. EDI values...

  4. 76 FR 71389 - Agency Forms Submitted for OMB Review, Request for Comments

    Science.gov (United States)

    2011-11-17

    ... Interchange (EDI) version of the Form Letter ID-4K notice, or an Internet equivalent ID-4K, which is... electronically via EDI or ERS. Completion is voluntary. Once the RRB determines to pay a claim post-payment Form...-4E paper notice and the EDI and Internet equivalent versions are transmitted on a daily basis...

  5. 76 FR 51324 - Hazardous Materials: Incorporating Rail Special Permits Into the Hazardous Materials Regulations

    Science.gov (United States)

    2011-08-18

    ... through use of electronic data interchange (EDI). The IVOHMA states ``differences in hazard communication... and on the possible effects EDI may have on distributing hazardous materials shipping paper... consider the use of EDI in other modes of transport in a future rulemaking. Petition No. P-1567 PHMSA...

  6. 77 FR 19030 - Automated Commercial Environment Required for the Transmission of Advance Ocean and Rail Cargo...

    Science.gov (United States)

    2012-03-29

    ... electronic data interchange (EDI) system. CBP recently completed the testing of the Automated Commercial..., after a six month transition period, ACE will be the only CBP-approved EDI for submitting required...-approved EDI for transmitting to CBP required advance information for ocean and rail cargo. FOR FURTHER...

  7. 78 FR 49117 - Listing of Color Additives Exempt From Certification; Spirulina Extract

    Science.gov (United States)

    2013-08-13

    .... We compare an individual's estimated daily intake (EDI) of the additive from all food sources to an acceptable intake level established by toxicological data. The EDI is determined by projections based on the... from all food sources of the additive. We commonly use the EDI for the 90th percentile consumer of a...

  8. 77 FR 34846 - Inspection, Repair, and Maintenance; Driver-Vehicle Inspection Report for Intermodal Equipment

    Science.gov (United States)

    2012-06-12

    ... report EDI Electronic data interchange FHWA Federal Highway Administration FMCSRs Federal Motor Carrier...-copy paperwork to unassisted electronic data interchange (EDI) transmissions. IANA added that the... system, or EDI and transmittals of files in various formats. IANA noted that its program offers IEPs and...

  9. 77 FR 37961 - Hazardous Materials: Incorporating Rail Special Permits Into the Hazardous Materials Regulations

    Science.gov (United States)

    2012-06-25

    ...'' are added to Sec. 171.8. Requirements for electronic shipping papers, electronic data interchange (EDI... electronic shipping paper information transmitted by EDI for the development of shipping papers used to... shipping papers by carriers. Most of the commenters support amending the HMR to permit EDI transmission of...

  10. 76 FR 54470 - Proposed Data Collections Submitted for Public Comment and Recommendations

    Science.gov (United States)

    2011-09-01

    ..., patient name, patient ID number, and cost. Pharmacies utilize Electronic Data Interchange (EDI) processing at the point-of-sale to transmit claims to the World Trade Center Health Program (WTC-HP). The EDI... the point-of-sale. The EDI transmission occurs in real-time as the prescription transaction is made...

  11. 75 FR 37827 - Notice of Regulatory Waiver Requests Granted for the First Quarter of Calendar Year 2010

    Science.gov (United States)

    2010-06-30

    ... Development Initiative Special Purpose (EDI-SP) grant in the amount of $745,575 for the Poverty Point restoration project in Delhi, LA. The State of Louisiana will use the EDI-SP funds to build a new visitor... site. Subsequent to the January 23, 2004 appropriation for the EDI-SP grant, but prior to the...

  12. 48 CFR 552.216-73 - Ordering Information.

    Science.gov (United States)

    2010-10-01

    ... transmission or □ computer-to-computer Electronic Data Interchange (EDI). (b) An offeror electing to receive computer-to-computer EDI is requested to indicate below the name, address, and telephone number of the representative to be contacted regarding establishment of an EDI interface. (c) An offeror electing to receive...

  13. 76 FR 55719 - Proposed Collection; Comment Request

    Science.gov (United States)

    2011-09-08

    ...-4K paper notice, an Electronic Data Interchange (EDI) version of the Form Letter ID-4K notice, or an... completed ID-4K back to the RRB, or electronically via EDI or ERS. Completion is voluntary. No changes are...-4E paper notice and the EDI and Internet equivalent versions are transmitted on a daily basis...

  14. Design management of electronic data interchange systems

    NARCIS (Netherlands)

    Heck, van H.W.G.M.

    1993-01-01

    This study deals with the management of the design process of Electronic Data Interchange (EDI) systems. Its objectives are (1) to investigate the design process of EDI systems from a practical and theoretical perspective; (2) to develop a model to describe factors relevant to EDI

  15. Employee-Driven Innovation: A Brave New World in the Build Environment’s Project Organisations

    DEFF Research Database (Denmark)

    Sørensen, Henrik; Wandahl, Søren

    2013-01-01

    -driven innovation (EDI) could be such a methodology to implicate the spoken and tacit knowledge of the employees that would strengthen the innovative capabilities of the project organisations. To investigate the theoretical field around EDI a literature study was conducted. The overall objective was to develop...... a theoretical framework based on the field of EDI and related methodologies. This research resulted in two main findings. First; identification of the overall themes of the EDI field of research. Second; definition of an overall framework of methodologies to conduct EDI in project organisations. Furthermore...

  16. Demand and withdraw behaviors in couples with a history of infidelity.

    Science.gov (United States)

    Balderrama-Durbin, Christina M; Allen, Elizabeth S; Rhoades, Galena K

    2012-02-01

    Although relationship distress and dissolution are common consequences of sexual involvement outside a committed relationship, there is little empirical information regarding communication behaviors of couples who have experienced extradyadic involvement (EDI). This study examined male and female demand and withdraw behaviors in videotaped conflict discussions among 170 married or seriously dating couples categorized into 3 groups: those without a history of sexual EDI, those with a history of sexual EDI that was known to the other partner, and those with a history of "unknown" (undisclosed or undiscovered) sexual EDI. Both men and women in a relationship where there was at least one unknown EDI demonstrated the highest levels of demand behaviors. Furthermore, demand behaviors were higher for participating partners (those engaging in an outside sexual relationship) in relationships with an unknown EDI compared with participating partners in relationships with a known EDI. Conversely, demand behaviors were higher among nonparticipating partners in relationships with known EDI, compared to with nonparticipating partners in relationships with unknown EDI. Withdraw behaviors demonstrated a less pronounced and less consistent pattern of elevation by EDI group, and role within EDI, compared with demand behaviors. Clinical and relational implications for these findings are discussed.

  17. Daily Spiritual Experiences and Psychological Well-Being among US Adults

    Science.gov (United States)

    Ellison, Christopher G.; Fan, Daisy

    2008-01-01

    This study focuses on one of the most significant recent innovations in the conceptualization and measurement of religiousness and spirituality, the Daily Spiritual Experience scale (DSES; Underwood (2006) "Archive for the Psychology of Religion/Archiv fur Religion Psychologie," 28, 181-218). Using data from 1998 and 2004 NORC General…

  18. An Institutional Code of Ethics--A Response to Attitude of Israeli Teachers' Education College Students towards Academic Plagiarism

    Science.gov (United States)

    Reingold,, Roni; Baratz, Lea

    2011-01-01

    Academic plagiarism becomes very easy due to new opportunities provided by the Internet era (Scrinber, 2003; Underwood & Sazabo, 2003; Ross, 2005). We believe that academic dishonesty is a major issue, because it strikes at the heart of the academic and social values: honesty, trust and integrity. When dealing with education students, the…

  19. Meaningful Engagements: Feminist Historiography and the Digital Humanities

    Science.gov (United States)

    Enoch, Jessica; Bessette, Jean

    2013-01-01

    Recent surveys of feminist rhetorical historiography by Royster and Kirsch, Elizabeth Tasker and Frances B. Holt-Underwood, K. J. Rawson, Kathleen J. Ryan, and Jessica Enoch reveal that very few feminist historiographers have taken up digital methodologies or engaged digital humanist conversations. Thus while digital feminist scholars have…

  20. Prototyping and Characterization of an Adjustable Skew Angle Single Gimbal Control Moment Gyroscope

    Science.gov (United States)

    2015-03-01

    plates, two curved supports for the gimbal frame, and the box shaped mount base with the four roller rods basically carried through all further design... Underwood , “Experimental Testing of a CMG Cluster for Agile Microsatellites,” Journal-British Interplanetary Society, vol. 57, no. 9/10, pp. 318–324

  1. Customer Overview of Pulsed Laser Heating for Evaluation of Gun Bore Materials

    Science.gov (United States)

    2015-05-01

    properties of the gun bore materials. Ideally, well validated interior ballistics modeling has been carried out (typically with NOVA) to provide time...03002, February 2003. 5. J. Warrender, C. Mulligan, and J. Underwood , “Analysis of thermo-mechanical cracking in refractory coatings using variable pulse duration laser pulse heating,” Wear 263 1540 (2007).

  2. Traditional Beach Template vs Cross Shore Swash Zone (CSSZ) Placement Methods at Egmont Key, FL: High Silt Content Beneficial Use Placement

    Science.gov (United States)

    2015-10-15

    Relationships • Swash Zone samples carried 13.2% of the Discharge Slurry fines out of the beach template, thus leaving 5.2% on the beach. *Sampling methods...Tina Underwood , Ms. Erin Duffy USACE Jacksonville District – Mr. Bryan Merrill, Mr. Mike Hensch, Mr. Vic Wilhelm, Mr. Tom Spencer. USACE Engineer

  3. Levels of antinutritional factors in some wild edible fruits of Northern ...

    African Journals Online (AJOL)

    SERVER

    2007-08-20

    Aug 20, 2007 ... Samples were pound to powder using mortar and pestle then sieved with 1 mm size sieve. Analysis of samples. Total oxalate was determined according to Day and Underwood. (1986) procedure. To 1 g of the ground powder, 75 ml of 15 N. H2SO4 was added. The solution was carefully stirred intermittently.

  4. Epifaunal Community Development on Great Lakes Breakwaters: An Engineering with Nature Demonstration Project

    Science.gov (United States)

    2014-08-01

    Formliners, Inc . Pattern 1705, 305 Standard Spec Flute) and the dimpled surface used a custom built form liner using plywood and round headed carriage...J. Underwood. 2011. Evaluation of ecological engineering of “ armoured ” shorelines to improve their value as habitat. J. Exp. Marine Biol. Ecol. 400

  5. Employee-driven innovation in large project organisations

    DEFF Research Database (Denmark)

    Sørensen, Henrik; Wandahl, Søren; Christensen, Randi Muff

    2014-01-01

    (EDI). The case was a group of employees in a large governmental client organisation. The EDI framework was based on a theoretical approach to conduct EDI, derived from a previous literature study. The case study was conducted as an exploratory case study with outset in a gaming approach...... that challenged the participants with discussions on obstacles and solutions for EDI. The game approach was undertaken to facilitate discussions on specific EDI topics carefully selected to stimulate both group and plenum discussions. The themes of the theoretical framework were challenged through...... the participants’ discussions and perceptions of the applicability in the organisation. The findings were discussed in relation to the theoretical approach and findings from a comparable case study. It identified overall methods that had the higher robustness and applicability to incorporate in a practical EDI...

  6. Phases of Violent Extremism: Targeting the Evolution of Al-Shabaab

    Science.gov (United States)

    2015-12-01

    Edi Rama, prime minister of Albania suggests, “The threat from the radicalization of ideologies and particularly from violent jihadist extremism will...Killed Al-Shabab Leader,” BBC News Africa, Accessed October 10, 2015, http://www.bbc.com/news/world-africa-29034409. 219 Edi Rama, To Defeat Extremism...Balasubramaniyan. “Organizational and Structural Evolution- Lessons from Al-Qaeda.” Indian Defense Review, November 21, 2013. Rama, Edi . To Defeat

  7. Evidence for the electromagnetic decay instability driven by two plasmon decay

    International Nuclear Information System (INIS)

    Baker, K.L.; Afeyan, B.B.; Estabrook, K.G.; Drake, R.P.

    1997-01-01

    This paper examines the electromagnetic decay instability (EDI) and its role in laser-produced plasmas. The electromagnetic decay instability provides another channel through which parametric instabilities involving Langmuir waves can saturate. In the case where EDI is pumped by the Langmuir waves associated with two plasmon decay, EDI is shown to present an explanation for ω o /2 emission from laser-produced plasmas which is consistent with experimental observations

  8. Preparing organisations for employee-driven open innovation

    Directory of Open Access Journals (Sweden)

    Amundsen, O.

    2014-07-01

    Full Text Available The present study addresses the need to prepare organisations, small or large, for open innovation approaches, including the development of capacity to exploit the potential benefits of such principles through Employee-Driven Innovation (EDI. Based on interviews in 20 Norwegian enterprises, we propose that EDI is an under-explored opportunity in many organisations, and that the systematic introduction of EDI practices increases organisations' ability to exploit open innovation principles and favourably impacts the capacity for innovation. Specifically, EDI results in a more general interest in improvement among employees, increased engagement in innovation processes, and reduced opposition to change.

  9. Theatrum Neolatinum. Latinské divadlo v českých zemích. Nová ediční řada ve světle bádání o školském divadle raného novověku

    Czech Academy of Sciences Publication Activity Database

    Jacková, Magdaléna; Bočková, A.; Bobková, Kateřina

    -, č. 11 (2016), s. 119-144 ISSN 2453-7284 Institutional support: RVO:68378068 ; RVO:67985963 Keywords : school theatre * neo-latin drama * Jesuit school s * critical edition * St. John of Nepomuk Subject RIV: AJ - Letters, Mass-media, Audiovision; AB - History (HIU-Y)

  10. Himatanthus lancifolius (Müll. Arg. Woodson, Apocynaceae: estudo farmacobotânico de uma planta medicinal da Farmacopeia brasileira 1ª edição Himatanthus lancifolius (Müll. Arg. Woodson, Apocynaceae: morpho-anatomical study of a medicinal plant described in the Brazilian Pharmacopoeia 1st edition

    Directory of Open Access Journals (Sweden)

    Leopoldo C. Baratto

    2010-11-01

    Full Text Available Himatanthus lancifolius (Müll. Arg. Woodson é um arbusto nativo do Brasil, latescente, popularmente conhecido como agoniada e utilizado principalmente para distúrbios menstruais. O presente trabalho teve como objetivo caracterizar morfoanatomicamente a folha, o caule e a casca caulinar dessa planta medicinal, a fim de contribuir para o controle de qualidade e a autenticidade dessa espécie. O material vegetal foi fixado e submetido às microtécnicas usuais. A folha é simples, glabra e obovado-lanceolada. A epiderme é uniestratificada, revestida por cutícula estriada e possui estômatos anisocíticos na face abaxial. O mesofilo é dorsiventral. A nervura central é biconvexa e o pecíolo é circular, ambos apresentando feixes vasculares bicolaterais. Laticíferos, amiloplastos e idioblastos fenólicos estão presentes no parênquima fundamental da nervura central e do pecíolo. O sistema vascular do caule é tipicamente bicolateral. Laticíferos e idioblastos fenólicos ocorrem no córtex, no floema e na medula. Esses caracteres morfoanatômicos, em conjunto, podem ser utilizados como parâmetros para o controle de qualidade dessa espécie.Himatanthus lancifolius (Müll. Arg. Woodson is a Brazilian native shrub, laticiferous, popularly known as "agoniada" and it is mainly used for uterine disorders. The present work aimed to study the leaf, stem and stem bark morpho-anatomy of this medicinal plant, in order to contribute to its quality control and identification. The plant material was fixed and submitted to standard microtechniques. The leaf is simple, glabrous and obovate-lanceolate. The epidermis is uniseriate, coated with striated cuticle and it has anysocitic stomata on the abaxial surface. The mesophyll is dorsiventral. The midrib is biconvex and the petiole is circular, both presenting bicollateral vascular bundles. Laticiferous ducts, amyloplasts and phenolic idioblasts are found in ground parenchyma of the midrib and petiole. The vascular system of the stem is tipically bicollateral. Laticiferous ducts and phenolic idioblasts are present in the cortex, phloem and pith. These morpho-anatomical characters, all together, can be used as quality control parameters of this species.

  11. Druhé vydání náměšťské mluvnice (1543) znovu nalezeno: podnět k úvahám o hláskosloví, typografii a ediční technice

    Czech Academy of Sciences Publication Activity Database

    Koupil, Ondřej

    2016-01-01

    Roč. 64, č. 2 (2016), s. 243-266 ISSN 0009-0468 R&D Projects: GA MK(CZ) DF12P01OVV028 Keywords : Czech grammar * 16th century * Beneš Optát * Petr Gzell * Václav Philomathes * Jan Blahoslav Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  12. Avaliação de progresso do Programa Nacional de Cooperação Acadêmica - Novas Fronteiras - edição 2007 e oportunidades de formação de redes cooperativas nas áreas estratégicas e tecnologias portadoras de futuro

    Directory of Open Access Journals (Sweden)

    DAYSE BENIGNA BERNARDO ARAUJO GOMES

    2011-01-01

    Full Text Available Los resultados de la estadística descriptiva de una consulta a coordinadores de proyectos son presentados para evaluación de progreso of Programa Nacional de Cooperacion Académica - Nuevas Fronteras (2007. La metodología cualitativa consideró la comparación con los pareceres de los consultores especialistas que aprobaran la continuidad de los proyectos. Instituciones fueran mapeadas con potencial à la formación de redes de cooperación en las áreas estratégicas e tecnologías avanzadas indicadas en lo Libro Azul de la Cuarta Conferencia de Ciencia Tecnología y Innovación para lo Desarrollo Sustentable por medio de busca de ocurrencias no Directorio de Investigación del Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq para comparación con los programas de posgrado aprobados pela Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES con grados mejores o iguales a cinco.

  13. Korespondence Jakuba Demla na pomezí dokumentu a básnického textu: Poznámky a dilemata z průběžné ediční přípravy

    Czech Academy of Sciences Publication Activity Database

    Iwashita, Daniela

    2014-01-01

    Roč. 62, č. 4 (2014), s. 619-637 ISSN 0009-0468 R&D Projects: GA ČR(CZ) GA14-32413S Institutional support: RVO:68378068 Keywords : Deml, Jakub * correspondence * editions Subject RIV: AJ - Letters, Mass-media, Audiovision

  14. FOUCAULT, Michel. A ordem do discurso: aula inaugural no Collège de France, pronunciada em 2 de dezembro de 1970. Tradução de Laura Fraga de Almeida Sampaio. São Paulo: Edições Loyola, 2012.

    Directory of Open Access Journals (Sweden)

    Ramon Taniguchi Piretti Brandão

    2016-03-01

    Full Text Available O presente livro é um fascículo onde Foucault adota um tom de conferência, relatando suas reflexões e pesquisas acerca das diversas abordagens possíveis do discurso e de como ele se dissemina em diferentes sociedades. O autor demonstra, dentre outras coisas, como o discurso exerce uma função de controle, de limitação e validação das regras de poder em diferentes períodos históricos e grupos sociais.

  15. Mikrostruktura a mechanické vlastnosti tepelně odolných a chemicky stálých kompozitů vyztužených čedičovými vlákny

    Czech Academy of Sciences Publication Activity Database

    Glogar, Petr; Černý, Martin; Sucharda, Zbyněk; Balík, Karel

    2006-01-01

    Roč. 13, č. 1 (2006), s. 4-6 ISSN 1210-4612 R&D Projects: GA MŠk(CZ) ME 712 Institutional research plan: CEZ:AV0Z30460519 Keywords : basalt fibre * polysiloxane resin * composite Subject RIV: JI - Composite Materials

  16. 32 CFR Appendix C to Part 57 - Procedures for the Provision of Related Services by the Military Medical Departments to DoDDS...

    Science.gov (United States)

    2010-07-01

    ... EDIS shall ensure that a qualified medical authority conducts or verifies a medical evaluation for use... to the questions posed in the original referral. The written report shall include: (i) Demographic... initial parental permission, EDIS must: (i) Obtain parental permission for the additional activities. (ii...

  17. 78 FR 16707 - Certain Electronic Devices Having Placeshifting or Display Replication Functionality and Products...

    Science.gov (United States)

    2013-03-18

    ... INTERNATIONAL TRADE COMMISSION [Docket No. 2943] Certain Electronic Devices Having Placeshifting... International Trade Commission (USITC): http://edis.usitc.gov . \\3\\ Electronic Document Information System (EDIS...; Solicitation of Comments Relating to the Public Interest AGENCY: U.S. International Trade Commission. ACTION...

  18. 77 FR 58101 - Proposed Collection; Comment Request

    Science.gov (United States)

    2012-09-19

    ... from members of the public is to make these submissions available for public viewing on the Internet at... Educational and Developmental Intervention Services (EDIS) clinics. The system's remote function allows EDIS... clearance, which allows them access to basic functions of SNPMIS (i.e., data querying, viewing, and printing...

  19. An Empirical Study of Logistics Organization, Electronic Linkage, and Performance

    Science.gov (United States)

    1993-01-01

    Anvari, M., "Electronic Data Interchange and Inventories," International Journal of Production Economics , 26, 1-3 (1992), 135-143. Baker, R. H., EDI: What...Electronic Data Interchange -- A Study of Norwegian Freight Forwarders Using EDI," International Journal of Production Economics , 24 (1991), 91-101. Henry, G

  20. Comparison of peripapillary choroidal thickness measurements via spectral domain optical coherence tomography with and without enhanced depth imaging.

    Science.gov (United States)

    Ayyildiz, Onder; Kucukevcilioglu, Murat; Ozge, Gokhan; Koylu, Mehmet Talay; Ozgonul, Cem; Gokce, Gokcen; Mumcuoglu, Tarkan; Durukan, Ali Hakan; Mutlu, Fatih Mehmet

    2016-05-01

    To compare peripapillary choroidal thickness (PP-CT) measurements using a spectral domain optical coherence tomography (SD-OCT) device with and without enhanced depth imaging (EDI). Sixty healthy subjects aged from 18 to 40 years were included in this study. PP-CTs were measured in the right eyes by manual segmentation via SD-OCT both with and without EDI. The intraclass correlation coefficient (ICC) for each technique and comparison of PP-CT measurements between two techniques were evaluated. The correlation between retinal nerve fiber layer (RNFL) thickness and PP-CT was also explored on images of SD-OCT without EDI. The PP-CT measurements of 55 subjects were evaluated. The ICC was 0.999 (95% CI: 0.998-1.0, p  0.05). Additionally, there was no correlation between RNFL thickness and PP-CT (r = -0.109; p = 0.335). The PP-CT measurements via SD-OCT without EDI were consistent with the measurements via SD-OCT with EDI. Ophthalmologists who do not have access to EDI technology can use images of SD-OCT without EDI to measure the peripapillary choroid for research purposes. However, thicker peripapillary choroids cannot be measured using this technique and require further modifications or newer technologies, such as SD-OCT with EDI.

  1. Neighborhood Poverty Impacts Children's Physical Health and Well-Being over Time: Evidence from the Early Development Instrument

    Science.gov (United States)

    Cushon, Jennifer A.; Vu, Lan T. H.; Janzen, Bonnie L.; Muhajarine, Nazeem

    2011-01-01

    Research Findings: The purpose of this study was to investigate how neighborhoods and neighborhood socioeconomic disadvantage impact school readiness over time. School readiness was measured using the Early Development Instrument (EDI) for 3 populations of kindergartners in 2001, 2003, and 2005 in Saskatoon, Saskatchewan, Canada. EDI results…

  2. Multi-zone modelling of PCCI combustion

    NARCIS (Netherlands)

    Egüz, U.; Somers, L.M.T.; Leermakers, C.A.J.; Goey, de L.P.H.

    2011-01-01

    Early Direct Injection Premixed Charge Compression Ignition (EDI PCCI) combustion is a promising concept for the diesel combustion. Although EDI PCCI assures very low soot and NO xemission levels, the injection is uncoupled from combustion, which narrows down the operating conditions. The main

  3. 78 FR 76655 - Notice of Receipt of Complaint; Solicitation of Comments Relating to the Public Interest

    Science.gov (United States)

    2013-12-18

    ... Trade Commission (USITC): http://edis.usitc.gov . \\3\\ Electronic Document Information System (EDIS... INTERNATIONAL TRADE COMMISSION Notice of Receipt of Complaint; Solicitation of Comments Relating to the Public Interest AGENCY: U.S. International Trade Commission. ACTION: Notice. SUMMARY: Notice...

  4. 76 FR 31632 - Notice of Receipt of Complaint; Solicitation of Comments Relating to the Public Interest

    Science.gov (United States)

    2011-06-01

    ... docket (EDIS) at http://edis.usitc.gov , and will be available for inspection during official business... Co. Ltd. of Shenzhen, China; Cellairis Franchise, Inc. of Alpharetta, GA; Cellet Products of Santa Fe... be filed no later than by close of business, five business days after the date of publication of this...

  5. Process mining for electronic data interchange

    NARCIS (Netherlands)

    Engel, R.; Krathu, W.; Zapletal, M.; Pichler, C.; Aalst, van der W.M.P.; Werthner, H.; Huemer, C.; Setzer, T.

    2011-01-01

    Choreography modeling and service integration received a lot of attention in the last decade. However, most real-world implementations of inter-organizational systems are still realized by traditional Electronic Data Interchange (EDI) standards. In traditional EDI standards, the notion of process or

  6. 78 FR 56737 - Certain Portable Electronic Communications Devices, Including Mobile Phones and Components...

    Science.gov (United States)

    2013-09-13

    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-885] Certain Portable Electronic Communications Devices, Including Mobile Phones and Components Thereof; Commission Determination Not To Review an... on the Commission's electronic docket (EDIS) at http://edis.usitc.gov . Hearing-impaired persons are...

  7. 78 FR 49764 - Certain Portable Electronic Communications Devices, Including Mobile Phones and Components...

    Science.gov (United States)

    2013-08-15

    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-885] Certain Portable Electronic Communications Devices, Including Mobile Phones and Components Thereof; Commission Determination Not To Review n... for this investigation may be viewed on the Commission's electronic docket (EDIS) at http://edis.usitc...

  8. 78 FR 72712 - Certain Portable Electronic Communications Devices, Including Mobile Phones and Components...

    Science.gov (United States)

    2013-12-03

    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-885] Certain Portable Electronic Communications Devices, Including Mobile Phones and Components Thereof; Commission Determination Not To Review an... this investigation may be viewed on the Commission's electronic docket (EDIS) at http://edis.usitc.gov...

  9. Multi-Sensor Image Fusion for Target Recognition in the Environment of Network Decision Support Systems

    Science.gov (United States)

    2015-12-01

    Classification Problem Adapted from E. Alpaydin, “Introduction to Machine Learning,” Thrird Edi . MIT Press, 2014. Table 7. Performance Measures for...Binary Classification Problem Adapted from E. Alpaydin, “Introduction to Machine Learning,” Thrird Edi . MIT Press, 2014. ROC curves give us a

  10. Are You Experienced The Case for Acquisition Professional Qualification Standards

    Science.gov (United States)

    2015-10-01

    1, DAU 236), featuring a cover story on micro machines used in defense systems. The winners for Defense AT&L were managing edi - tor/senior editor of...Gonzalez, copy edi - tor and circulation manager; and Noelia Gamboa, editorial support. Defense AT&L’s sister DAU publication, the Defense Acquisition

  11. 75 FR 62522 - Combined Notice of Filings No. 3

    Science.gov (United States)

    2010-10-12

    ... filing per 154.203: NAESB EDI Form Filing to be effective 11/1/ 2010. Filed Date: 09/30/2010. Accession....9 EDI Form to be effective 11/1/2010. Filed Date: 09/30/2010. Accession Number: 20100930-5348...

  12. Assessment of Korean consumer exposure to sodium saccharin, aspartame and stevioside.

    Science.gov (United States)

    Ha, Mi-Sun; Ha, Sang-Do; Choi, Sung-Hee; Bae, Dong-Ho

    2013-01-01

    The dietary intakes of sodium saccharin, aspartame and stevioside were estimated on the basis of food consumption data of the Korean consumer and the concentration of sweeteners in processed foods. Results were compared with the acceptable daily intake (ADI) of sweeteners. Among the 28 food categories for which the application of sodium saccharin, aspartame and stevioside is permitted in Korea, they were detected in 5, 12 and 13 categories, respectively. The estimated daily intake (EDI) of sodium saccharin and aspartame were high in infants and children, whereas the EDI of stevioside was high in adolescents and adults. The most highly consumed sweetener was aspartame, and the highest EDI/ADI ratio was found for sodium saccharin. The main food categories contributing to sweetener consumption were beverages, including alcoholic beverages. For most Korean consumers, the EDIs were no greater than 20% of their corresponding ADI; however, the EDI of sodium saccharin for conservative consumers aged 1-2 years reached 60% of their ADI.

  13. Enhanced-Depth Imaging Optical Coherence Tomography of the Human Choroid In Vivo Compared With Histology After Enucleation

    DEFF Research Database (Denmark)

    Li, Xiao Qiang; Heegaard, Steffen; Kiilgaard, Jens Folke

    2016-01-01

    PURPOSE: This study compared in vivo enhanced-depth imaging optical coherence tomography (EDI-OCT) with ex vivo histology of the choroid in human eyes. METHODS: Three eyes in three patients with advanced iris melanoma without posterior segment involvement underwent EDI-OCT less than 24 hours prior...... to enucleation and, in one eye, immediately after enucleation. Following fixation in 4% buffered formaldehyde and paraffin embedding, serial sections of the whole eye were cut horizontally, mounted, stained with hematoxylin-eosin and digitized. Alignment between histology and EDI-OCT was made on landmarks...... and subfoveal choroid thickness reduced to 56%, 45%, and 56%, respectively, of its in vivo thickness on EDI-OCT. CONCLUSIONS: There were no identifiable discrepancies in choroidal structural patterns between clinical EDI-OCT and histologic sections except that after enucleation and histologic fixation choroidal...

  14. Shallow surface etching of organic and inorganic compounds by electrospray droplet impact

    International Nuclear Information System (INIS)

    Hiraoka, Kenzo; Sakai, Yuji; Iijima, Yoshitoki; Asakawa, Daiki; Mori, Kunihiko

    2009-01-01

    The electrospray droplet impact (EDI) was applied to bradykinin, polyethylene terephthalate (PET), SiO 2 /Si, and indium phosphide (InP). It was found that bradykinin deposited on the stainless steel substrate was ionized/desorbed without the accumulation of radiation products. The film thickness desorbed by a single collisional event was found to be less than 10 monolayers. In the EDI mass spectra for PET, several fragment ions were observed but the XPS spectra did not change with prolonged cluster irradiation. The etching rate for SiO 2 by EDI was measured to be ∼0.2 nm/min. The surface roughness of InP etched by EDI was found to be one order of magnitude smaller than that etched by 3 keV Ar + for about the same etching depths. EDI is capable of shallow surface etching with little damage left on the etched surface.

  15. Validation of the Danish PAROLE lexicon (upubliceret)

    DEFF Research Database (Denmark)

    Møller, Margrethe; Christoffersen, Ellen

    2000-01-01

    This validation is based on the Danish PAROLE lexicon dated June 20, 1998, downloaded on March 16, 1999. Subsequently, the developers of the lexicon have informed us that they have been revising the lexicon, in particular the morphological level. Morphological entries were originally generated...... automatically from a machine-readable version of the Official Danish Spelling Dictionary (Retskrivningsordbogen 1986, in the following RO86), and this resulted in some overgeneration, which the developers started eliminating after submitting the Danish PAROLE lexicon for validation. The present validation is......, however, based on the January 1997 version of the lexicon. The validation as such complies with the specifications described in ELRA validation manuals for lexical data, i.e. Underwood and Navaretta: "A Draft Manual for the Validation of Lexica, Final Report" [Underwood & Navaretta1997] and Braasch: "A...

  16. Psychopathological Processes Involved in Social Comparison, Depression, and Envy on Facebook

    OpenAIRE

    Aurel Pera

    2018-01-01

    Is Facebook utilization beneficial or detrimental for psychological well-being? I draw on outstanding research (e.g., Chou and Edge, 2012; Lin and Utz, 2015; Appel et al., 2016; Ehrenreich and Underwood, 2016; Vogel and Rose, 2016; Hu et al., 2017) to substantiate that examining other individuals’ positively presented material on Facebook may have detrimental consequences. Increasing comparisons on Facebook may generate feelings of envy, the latter being a significant process determining the ...

  17. Use of real-time monitoring to predict concentrations of select constituents in the Menomonee River drainage basin, Southeast Wisconsin, 2008-9

    Science.gov (United States)

    Baldwin, Austin K.; Graczyk, David J.; Robertson, Dale M.; Saad, David A.; Magruder, Christopher

    2012-01-01

    The Menomonee River drainage basin in southeast Wisconsin is undergoing changes that may affect water quality. Several rehabilitation and flood-management projects are underway, including removal of concrete channels and the construction of floodwater retention basins. The city of Waukesha may begin discharging treated wastewater into Underwood Creek, thus approximately doubling the current base-flow discharge. In addition, the headwater basins, historically dominated by agriculture and natural areas, are becoming increasingly urbanized.

  18. Energy Optimization Assessment at U.S. Army Installations: Fort Bliss, TX

    Science.gov (United States)

    2008-09-01

    Log dampers, temperatures, actuator signals, and other parameters to identify problems. Adjust chiller and boiler setpoints and control curves...installation. The lowest setpoints were found in the Centennial Club, with 52 °F during unoccupied hours (morn- ing). The chillers ran pretty much fully loaded...ER D C/ CE R L TR -0 8 -1 5 Energy Optimization Assessment at U.S. Army Installations Fort Bliss, TX David M. Underwood, Alexander M

  19. Journal of Mormon History Vol. 15, 1989

    OpenAIRE

    1989-01-01

    --Irreconcilable Differences: David H. Smith's Relationship with the Muse of Mormon History Valeen Tippetts Avery, 3 --The New England Origins of Mormonism Revisited Grant Underwood, 15 --Anti-Mormonism in Illinois: Thomas C. Sharp's Unfinished History of the Mormon War, 1845 Roger D. Launius, 27 Houses with Two Fronts: The Evolution of Domestic Architectural Design in a Mormon Community Keith Bennett and Thomas Carter, 47 --The Mormon Reformation of 1856-1857: The...

  20. Development of a Mass Casualty Triage Performance Assessment Tool

    Science.gov (United States)

    2015-02-01

    CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT 18. NUMBER OF PAGES 19a. NAME OF RESPONSIBLE PERSON Cindy Underwood a. REPORT Unlimited b. ABSTRACT...describing the victim’s physical state; a list of tasks that must be carried out in order to treat the victim and correctly determine the victim’s triage...have nonmedical personnel practice proper techniques for transporting patients, including the loading, carrying , and unloading of litters

  1. Changes in the occurrance of hard substratum fauna: A case study from Mumbai harbour, India

    Digital Repository Service at National Institute of Oceanography (India)

    Gaonkar, C.A.; Sawant, S.S.; Anil, A.C.; Venkat, K.; Harkantra, S.N.

    , John Wiley and Sons, New York, Toronto) 1971. pp. 372. SAWANT et al.: CHANGE IN THE OCCURRENCE OF HARD SUBSTRATUM 83 3 McGuinness K A & Underwood A J, Habitat structure and the nature of communities on intertidal boulders, J. Exp. Mar. Biol... seaweed community composition and seaweed temperature patterns at a geographical scale, Botanica Marina, 33 (1990) 447-457. 6 Denny M, Dairiki J & Distefano S, Biological consequences of topography on wave-swept rocky shores: I. Enhancement...

  2. Clinical Investigation Progran, Fiscal Year 1980.

    Science.gov (United States)

    1980-10-01

    effect relationship between gastro - esophageal reflux and pulmonary disability. 44 PROGRESS: Until the project is approved by Health Services Command, we...semiconductor, gastro - esophageal probe presently available. This device is to be modified so as to incorporate both a Dent sleeve system in the center section...Ellen f. Pinholt, MC Esophageal reflux MAJ Anna K. Chacko, IC •MAJ George H. Underwood, MC Accumulative 1,’EDCASE IEst Accumulative PFeriodic Reevaluate

  3. Energy upcycle in anaerobic treatment: Ammonium, methane, and carbon dioxide reformation through a hybrid electrodeionization–solid oxide fuel cell system

    International Nuclear Information System (INIS)

    Xu, Linji; Dong, Feifei; Zhuang, Huichuan; He, Wei; Ni, Meng; Feng, Shien-Ping; Lee, Po-Heng

    2017-01-01

    Highlights: • EDI-SOFC integrated with AD is introduced for energy extraction from C and N pollutants. • NH_4"+ dissociation to NH_3 and H_2 in EDI avoids C deposition in SOFC. • EDI exhibits nutrient and heavy metal recovery. • SOFCs display its adaptability with NH_3, H_2, and biogas. • Energy balance ratio boosts from 1.11 to 1.75 by EDI-SOFC in a HK landfill plant. - Abstract: To create possibilities for a more sustainable wastewater management, a novel system consisting of electrodeionization (EDI) and solid oxide fuel cells (SOFCs) is proposed in this study. This system is integrated with anaerobic digestion/landfills to capture energy from carbonaceous and nitrogenous pollutants. Both EDI and SOFCs showed good performances. EDI removed 95% and 76% ammonium-nitrogen (NH_4"+-N) from diluted (0.025 M) to concentrated (0.5 M) synthetic ammonium wastewaters, respectively, accompanied by hydrogen production. SOFCs converted the recovered fuels, biogas mixtures of methane and carbon dioxide, to electricity. Under the optimal conditions of EDI (3.0 V applied voltage and 7.5 mm internal electrode distance (IED), and SOFCs (750 °C operating temperature), the system achieved 60% higher net energy output as compared to conventional systems. The estimated energy benefit of this proposed system showed that the net energy balance ratio is enhanced from 1.11 (existing system) to 1.75 (this study) for a local Hong Kong active landfill facility with 10.0 g L"−"1 chemical oxygen demand (COD) and 0.21 M NH_4"+-N. Additionally, an average of 80% inorganic ions (heavy metals and nutrient elements) can be removed from the raw landfill leachate by EDI cell. The results are successful demonstrations of the upgrades of anaerobic processes for energy extraction from wastewater streams.

  4. Mapping key antecedents of employee-driven innovations

    DEFF Research Database (Denmark)

    Smith, Pernille; Ulhøi, John Parm; Kesting, Peter

    2012-01-01

    Research on employee-driven innovation (EDI) is still in its infancy, and as yet there is no independent body of literature on the topic. The aim of this paper is to review existing insights into the key antecedents of EDI in other research contexts. In particular, we focus on: leader support......, autonomy, collaboration, and organisational norms of exploration. The main contribution of this paper is to discuss how these key antecedents apply to the specific case of EDI and to identify an agenda for new research....

  5. The role of employee participation in generating and commercializing innovations in China

    DEFF Research Database (Denmark)

    Kesting, Peter; Qin, Zhihua; Song, Jiwen Lynda

    2013-01-01

    In this paper we are investigating the effect of different forms of employee participation on innovation generation and commercialization in China. To date, the concept of employee-driven innovation (EDI) finds very little recognition in China, in research as well as in management practice....... It seems to fundamentally contradict traditional values in Chinese culture. On the other hand, work realities change rapidly in China. Research suggests that EDI might be particularly relevant for innovations in skilled labour contexts. Based on a survey of 620 medium-sized and large companies in China we...... underpin that EDI is also relevant for China....

  6. Self Assembly and Pyroelectric Poling for Organics

    Science.gov (United States)

    2015-07-06

    These “static” charges are the origin of electric field ( Edi ) creation inside the dielectric medium. If the loss of pyroelectric charges is...negligibly small, it would yield Edi = γΔT/[ε0(εdi + εcrLdi/Lcr)] (1) where ε0, εcr, and εdi are the dielectric permittivities of free space, the pyroelectric...field ( Edi ) in the dielectric thin film, and the small open arrows at the thin layer of dielectrics represent the direction of electric fields. The

  7. Grabbing the Air Force by the Tail: Applying Strategic Cost Analytics to Understand and Manage Indirect Cost Behavior

    Science.gov (United States)

    2015-09-17

    sector   age Technology Impact  that  significant  technology  adoption  (RFID,  ERP,   EDI ,  etc)  has  on  supply  chain... EDI  capabilities   Complexity Impact  of  a  wide  product/service  line  on  the  supply  chain,  cost  of  serving...can incorporate measurements of the number of EDI transactions in the purchasing function, the age of the technology in the production process, the

  8. THE NORMALIZATION OF FINANCIAL DATA EXCHANGE OVER THE INTERNET: ADOPTING INTERNATIONAL STANDARD XBRL

    Directory of Open Access Journals (Sweden)

    Catalin Georgel Tudor

    2009-05-01

    Full Text Available The development of a common syntax for EDI (Electronic Data Interchange, XML (eXtensible Markup Language, opened new formalization perspectives for interorganizational data exchanges over the Internet. Many of the organizations involved in the normaliza

  9. Why are some independent inventors 'heroes' and others 'hobbyists'? The moderating role of technological diversity and specialization

    DEFF Research Database (Denmark)

    Lettl, Christopher; Rost, Katja; von Wartburg, Iwan

    2009-01-01

    Despite a substantial body of research investigating the market significance of inventions by independent inventors, relatively little attention has been devoted to understanding their technological significance. A recent study conducted by [Dahlin, K., Taylor, M., Fichman, M., 2004. Today's Edis...

  10. Psychometric properties of the Dutch version of the Eating Disorder Inventory-3

    NARCIS (Netherlands)

    Lehmann, V.; Ouwens, M.A.; Braeken, J.; Danner, U.N.; van Elburg, A.A.; Bekker, M.H.J.; Breurkens, A.; van Strien, T.

    2013-01-01

    The psychometric properties of the Dutch version of the Eating Disorder Inventory–3 (EDI-3) were tested in eating disordered patients (N = 514) using confirmatory factor analyses, variance decomposition, reliabilities, and receiver operating characteristic (ROC) curve analyses. Factorial validity

  11. Intervention Framework to Support Employee-Driven Innovation Between R&D and Manufacturing Department

    DEFF Research Database (Denmark)

    Jensen, Christian Schou; Jensen, Anna Rose Vagn; Broberg, Ole

    2016-01-01

    This paper is exploring the area of employee-driven innovation (EDI) and describes how we in ourresearch project have developed and tested a framework for initiating employee participation between R&D and manufacturing department. EDI refers to the generation and implementation of significant new...... [Kesting andUlhøi 2010]. It is argued that companies should not restrict themselves to relying exclusively on R&D employees, but also recognize that manufacturing employees possess abilities for innovation [Høyrup2010]. Several other theories, such as high-involvement innovation share the conviction...... et al. 2013]. • It can generate a flow of additional information and tacit knowledge from employees to point out opportunities that management cannot [Kesting and Ulhøi 2010].With a long list of known benefits from EDI, one might wonder why it is not implemented everywhere? The list of EDI obstacles...

  12. Monitoring of essential and toxic metals in imported herbal teas ...

    African Journals Online (AJOL)

    Journal of Applied Sciences and Environmental Management ... Teas are the most consumed beverage worldwide after water, and its consumption ... Key words: Herbal teas, food safety, health risk assessment, THQ, EDI, HI, toxic metals ...

  13. Virtual Supply Chain Re-Intermediation Through Multi-Agent Systems

    National Research Council Canada - National Science Library

    Nissen, Mark

    2002-01-01

    ... inflexibility associated with EDI applications. Viewing respective procurement and order fulfillment processes of buyer and seller as an integrated whole along the supply chain, we identify opportunities for virtual supply chain re-intermediation...

  14. The Role of IT Solutions in Reverse Logistics Management Support

    African Journals Online (AJOL)

    pc

    2018-03-05

    Mar 5, 2018 ... Keywords-reverse logistics, return flow, IT solutions, EDI, Barcodes, ... and controlling the efficiency, performance, cost flow of raw materials ..... questions, for the further analysis only these were chosen that are strongly ...

  15. Logistikas on andmevahetus ülitähtis / Erik Sakkov

    Index Scriptorium Estoniae

    Sakkov, Erik, 1967-

    2004-01-01

    Tallinna Sadama turundusdirektor selgitab, miks Tallinna sadam on huvitatud elektroonilise infovahetussüsteemi EDI väljatöötamisest ja mis takistab sadama kommuuni ettevõtete vahel edastatava kaubaga seotud info elektroonilise edastamise arengut

  16. Embodied Design Ideation

    DEFF Research Database (Denmark)

    Wilde, Danielle; Vallgårda, Anna; Tomico, Oscar

    Embodied design ideation (EDI) practices work with relationships between body, material and context to enliven design and research potential. Methods are often idiosyncratic and – due to their physical nature – not easily transferred. As independent researchers, and as collaborators, we have been...... engaging with this problematic for some time. At CHI2017 we will present a framework that enables designers to understand, describe and contextualise EDI practices in ways that can be understood by peers, as well as those new to embodied ideation. Our framework affords discussion of embodied design actions...... individual approaches to EDI, developed over many years of research practice and (3) an inspirational catalogue demonstrating the diversity of ideas that EDI methods can foster....

  17. U.S. Environmental Protection Agency's Enterprise Data Inventory

    Data.gov (United States)

    U.S. Environmental Protection Agency — Complete Enterprise Dataset Inventory (EDI) listing all agency data assets for compliance with federal Project Open Data mandate (https://project-open-data.cio.gov/).

  18. HHS Enterprise Data Inventory

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Enterprise Data Inventory (EDI) is the comprehensive inventory listing of agency data resources including public, restricted public, and non-public datasets.

  19. Paying Personal Property Transportation Contracts at the Defense Finance and Accounting Service-Indianapolis Center

    National Research Council Canada - National Science Library

    Bridges, W

    1997-01-01

    ...-IN). This report identifies the issues that DFAS-IN needs to resolve before it can pay transportation FAR contracts and presents an operating concept for paying those bills using electronic data interchange (EDI...

  20. E-tarneahelas viib koostöö kasumini / Hele Hammer

    Index Scriptorium Estoniae

    Hammer, Hele, 1974-

    2011-01-01

    E-tarneahel võimaldab väiksemat laovaru ja õigeaegseid tarneid. Pideva asenduse strateegia (VMI, CRP). Skeem: Info ja kauba liikumine e-tarneahelas. Struktureeritud e-andmevahetus organisatsioonide vahel EDI, mille suurim operaator Baltikumis on Telema

  1. 全膜分离技术及其在电厂化学水处理中的应用%Whole Membrane Separation Technology and Its Application in Chemical Water Treatment of Power Plant

    Institute of Scientific and Technical Information of China (English)

    马福刚

    2011-01-01

    This paper introduces the definition, types and characteristics of membrane separation technology, and application instance of whole membrane separation treatment process (UF-RO-EDI) in power plant boiler feed water treatment.%介绍了膜分离技术的定义、种类、特点以及全膜分离处理工艺(UF-RO-EDI)在电厂锅炉补给水处理中的应用实例.

  2. Editorial

    Directory of Open Access Journals (Sweden)

    José Aparecido

    2011-05-01

    Full Text Available A presente edição da Revista Tecer traz para a comunidade acadêmica os resultados da terceira edição do Congresso Internacional de Dislexia (CID, que reúne bianualmente profissionais das áreas da Psicologia, Fonoaudiologia, Psicopedagogia, Pedagogia e Neurociências para discutir pesquisas realizadas no contexto nacional e internacional em torno da temática dislexia.

  3. Validating Advanced Supply-Chain Technology (VAST)

    Science.gov (United States)

    2004-06-01

    Use philosophy that is so important in today’s procurement environment. Electronic Data Interchange (EDI) and eCommerce is proving to be a major...the STEPwise methodology are particularly encouraging. These new EDI and eCommerce technologies are becoming more important with the customers who...critical assumption is based upon the 55 fact that eCommerce is growing throughout the commercial and military sector and those who are not

  4. Psycholinguistic factors in testing children’s theory of mind: false belief in their own words

    DEFF Research Database (Denmark)

    Hansen, Mikkel

    Symposium presented by Nathalie Nader-Grosbois, Valerie Plumet, Edy Veneziano, Koviljka Barisnikov, discussant: Koviljka Barisnikov. How does Theory of mind explain social skills? What is the impact of communicative and linguistic factors on Theory of mind?......Symposium presented by Nathalie Nader-Grosbois, Valerie Plumet, Edy Veneziano, Koviljka Barisnikov, discussant: Koviljka Barisnikov. How does Theory of mind explain social skills? What is the impact of communicative and linguistic factors on Theory of mind?...

  5. The occurrence, exposure and risk assessment of perfluoroalkyl acids in food from mainland, China.

    Science.gov (United States)

    Wang, Xinxuan; Zhang, Ruobing; Zhang, Hong; Wang, Yanping

    2017-11-01

    To study the contamination of perfluoroalkyl acids (PFAAs) in Chinese food and the risk of dietary exposure for the Chinese population, the data of 17 PFAAs covering 38 cities throughout China in 15 groups of foods were collected for meta-analysis from published and available research literature. Using food consumption and body weight parameters, estimated dietary intakes (EDIs) were calculated for evaluation using the Scenario-Based Risk Assessment (SceBRA) modelling. Among food groups, the highest ΣPFAAs concentrations and EDI contributions were both found in poultry (363 ng/g), fish and shrimp (313 ng/g), dark vegetables (309 ng/g), fruits (116 ng/g) and pork (25 ng/g). The EDI of adults in the high-exposure scenario was about twice that of the intermediate-exposure scenario, while the EDI of children was about twice that of adults' EDI in the intermediate-exposure scenario. In addition, the PFOS EDI for children under high exposure approached its tolerable daily intake (TDI). Therefore high dietary exposure to PFAAs is giving rise to an increased health risk, especially for children.

  6. Evaluation of Potential Biological Threats in Ukraine

    International Nuclear Information System (INIS)

    Pozdnyakova, L.; Slavina, N.; Pozdnyakov, S.

    2007-01-01

    Dilating of biological threats spectrum, EDI diffusion opportunities and routes, unpredictability of outbreaks connected with connatural, technogenic, terrorist factors determines constant monitoring and readiness for operative BPA indication and identification. Scientific analytical approach of existing and probable regional bio-threats evaluation is necessary for adequate readiness system creation and maintenance of medical counteraction tactics to probable biological threats. Basing on the international experience, we carry out analysis of a situation present in Ukraine and routes for the decisions. The basic directions are: - Evaluation of a reality for EDI penetration from abroad and presence of conditions for their further diffusion inside the country. - Revealing of presence and definition of connatural EDI foci biocenoses features and BPAs. - Appropriate level of biological safety and physical protection of bio-laboratories and pathogens collections maintenance. - Gene/molecular and phenotypical definition of EDI circulating strains. - Creation of the circulating EDI gene/ phenotypic characteristics regional data bank. - Ranging of EDI actual for area. - Introduction of GPT, mathematical modeling and forecasting for tactics development in case of technogenic accidents and connatural outbreaks. - Methodical basis and equipment improvement for BPA system indication for well-timed identification of natural, or modified agent. - Education and training The international cooperation in maintenance of biosafety and bioprotection within the framework of scientific programs, grants, exchange of experience, introduction of international standards and rules are among basic factors in the decision for creating system national biosafety for countries not included in EU and the NATO. (author)

  7. In vitro digestion and DGT techniques for estimating cadmium and lead bioavailability in contaminated soils: Influence of gastric juice pH

    International Nuclear Information System (INIS)

    Pelfrene, Aurelie; Waterlot, Christophe; Douay, Francis

    2011-01-01

    A sensitivity analysis was conducted on an in vitro gastrointestinal digestion test (i) to investigate the influence of a low variation of gastric juice pH on the bioaccessibility of Cd and Pb in smelter-contaminated soils (F B , using the unified bioaccessibility method UBM) and fractions of metals that may be transported across the intestinal epithelium (F A , using the diffusive gradient in thin film technique), and (ii) to provide a better understanding of the significance of pH in health risk assessment through ingestion of soil by children. The risk of metal exposure to children (hazard quotient, HQ) was determined for conditions that represent a worst-case scenario (i.e., ingestion rate of 200 mg day -1 ) using three separate calculations of metal daily intake: estimated daily intake (EDI), bioaccessible EDI (EDI-F B ), and oral bioavailable EDI (EDI-F A ). The increasing pH from 1.2 to 1.7 resulted in: (i) no significant variation in Cd-F B in the gastric phase but a decrease in the gastrointestinal phase; (ii) a decrease in soluble Pb in the gastric phase and a significant variation in Pb-F B in the gastrointestinal phase; (iii) a significant decrease in Cd-F A and no variation in Pb-F A ; (iv) no change in EDI-F B and EDI-F A HQs for Cd; (v) a significant decrease in EDI-F B HQs and no significant variation in EDI-F A HQ for Pb. In the analytical conditions, these results show that risk to children decreases when the bioavailability of Pb in soils is taken into account and that the studied pH values do not affect the EDI-F A HQs. The present results provide evidence that the inclusion of bioavailability analysis during health risk assessment could provide a more realistic estimate of Cd and Pb exposure, and opens a wide field of practical research on this topic (e.g., in contaminated site management). - Highlights: → Sensitivity analysis on an in vitro gastrointestinal digestion test. → Influence of gastric juice pH on metal bioaccessibility

  8. In vitro digestion and DGT techniques for estimating cadmium and lead bioavailability in contaminated soils: Influence of gastric juice pH

    Energy Technology Data Exchange (ETDEWEB)

    Pelfrene, Aurelie, E-mail: aurelie.pelfrene@isa-lille.fr [Universite Lille Nord de France, Lille (France); Groupe ISA, Equipe Sols et Environnement, Laboratoire Genie Civil et geo-Environnement (LGCgE) Lille Nord de France (EA 4515), 48 boulevard Vauban, 59046 Lille cedex (France); Waterlot, Christophe; Douay, Francis [Universite Lille Nord de France, Lille (France); Groupe ISA, Equipe Sols et Environnement, Laboratoire Genie Civil et geo-Environnement (LGCgE) Lille Nord de France (EA 4515), 48 boulevard Vauban, 59046 Lille cedex (France)

    2011-11-01

    A sensitivity analysis was conducted on an in vitro gastrointestinal digestion test (i) to investigate the influence of a low variation of gastric juice pH on the bioaccessibility of Cd and Pb in smelter-contaminated soils (F{sub B}, using the unified bioaccessibility method UBM) and fractions of metals that may be transported across the intestinal epithelium (F{sub A}, using the diffusive gradient in thin film technique), and (ii) to provide a better understanding of the significance of pH in health risk assessment through ingestion of soil by children. The risk of metal exposure to children (hazard quotient, HQ) was determined for conditions that represent a worst-case scenario (i.e., ingestion rate of 200 mg day{sup -1}) using three separate calculations of metal daily intake: estimated daily intake (EDI), bioaccessible EDI (EDI-F{sub B}), and oral bioavailable EDI (EDI-F{sub A}). The increasing pH from 1.2 to 1.7 resulted in: (i) no significant variation in Cd-F{sub B} in the gastric phase but a decrease in the gastrointestinal phase; (ii) a decrease in soluble Pb in the gastric phase and a significant variation in Pb-F{sub B} in the gastrointestinal phase; (iii) a significant decrease in Cd-F{sub A} and no variation in Pb-F{sub A}; (iv) no change in EDI-F{sub B} and EDI-F{sub A} HQs for Cd; (v) a significant decrease in EDI-F{sub B} HQs and no significant variation in EDI-F{sub A} HQ for Pb. In the analytical conditions, these results show that risk to children decreases when the bioavailability of Pb in soils is taken into account and that the studied pH values do not affect the EDI-F{sub A} HQs. The present results provide evidence that the inclusion of bioavailability analysis during health risk assessment could provide a more realistic estimate of Cd and Pb exposure, and opens a wide field of practical research on this topic (e.g., in contaminated site management). - Highlights: {yields} Sensitivity analysis on an in vitro gastrointestinal digestion test

  9. Solar Flare Studies

    Science.gov (United States)

    1982-03-20

    Feldman, U., and Dere, K. P.:ý 1978, Astophys. /. 224, 1017. Underwood, J. H., Milligan, !. C., dc Loach , A. C. and Hoover, R. B.:, 1977, Applied... Loach , A. C., Hoose~r, R. B., and MlcGuire, J. P.: 19 75,Solar Phys. 45, 377. N , Sheridan, K. V.. Jackson, B. V., hict-can, EX. I , and Sulk, G. A...Sacramento Peak Observatory, Ken Nicolas at NRL and Dean Jacobs at UCSD. This research was sponsored by the Air Force Office of Scientific Research, Air Force

  10. Simple multicomponent batch distillation procedure with a variable reflux policy

    Directory of Open Access Journals (Sweden)

    A. N. García

    2014-06-01

    Full Text Available This paper describes a shortcut procedure for batch distillation simulation with a variable reflux policy. The procedure starts from a shortcut method developed by Sundaram and Evans in 1993 and uses an iterative cycle to calculate the reflux ratio at each moment. The functional relationship between the concentrations at the bottom and the dome is evaluated using the Fenske equation and is complemented with the equations proposed by Underwood and Gilliland. The results of this procedure are consistent with those obtained using a fast method widely validated in the relevant literature.

  11. Wind River Watershed Restoration Project, Segment II, 2000-2002 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Bair, Brian; Olegario, Anthony; Powers, Paul

    2002-06-01

    This document represents work conducted as part of the Wind River Watershed Restoration Project during its second year of funding through the Bonneville Power Administration (BPA). The project is a comprehensive effort involving public and private entities seeking to restore water quality and fishery resources in the basin through cooperative actions. Project elements include coordination, watershed assessment, restoration, monitoring, and education. Entities involved with implementing project components are the Underwood Conservation District (UCD), USDA Forest Service (USFS), U.S. Geological Survey - Columbia River Research Lab (USGS-CRRL), and WA Department of Fish & Wildlife (WDFW).

  12. An(1) Toda solitons and the dressing symmetry

    International Nuclear Information System (INIS)

    Belich, H.; Paunov, R.

    1996-12-01

    We present an elementary derivation of the soliton-like solutions in the A n (1) Toda models which is alternative to the previously used Hirota method. The solutions of the underlying linear problem corresponding to the N-solitons are calculated. This enables us to obtain explicit expression for the element which by dressing group action, produces a generic soliton solution. In the particular example of mono solitons we suggest a relation to vertex operator formalism, previously used by olive, Turok and Underwood. Our results can also be considered as generalization of the approach to the sine-Gordon solitons, proposed by Babelon and Bernard. (author)

  13. Water-quality characteristics in runoff for three discovery farms in North Dakota, 2008-12

    Science.gov (United States)

    Nustad, Rochelle A.; Rowland, Kathleen M.; Wiederholt, Ronald

    2015-01-01

    The U.S. Geological Survey, in cooperation with North Dakota State University Agriculture Research Extension and in collaboration with North Dakota State Department of Health, North Dakota State Water Commission, U.S. Environmental Protection Agency, and several agricultural producers, helped organize a Discovery Farms program in North Dakota in 2007. Discharge measurements and water-quality samples collected at the three Farms (Underwood, Dazey, and Embden) were used to describe water-quality characteristics in runoff, and compute estimates of annual loads and yields for selected constituents from spring 2008 through fall 2012.

  14. Elementary number theory

    CERN Document Server

    Dudley, Underwood

    2008-01-01

    Ideal for a first course in number theory, this lively, engaging text requires only a familiarity with elementary algebra and the properties of real numbers. Author Underwood Dudley, who has written a series of popular mathematics books, maintains that the best way to learn mathematics is by solving problems. In keeping with this philosophy, the text includes nearly 1,000 exercises and problems-some computational and some classical, many original, and some with complete solutions. The opening chapters offer sound explanations of the basics of elementary number theory and develop the fundamenta

  15. Cost-effectiveness of using small vertebrates as indicators of disturbance.

    Science.gov (United States)

    Peck, Mika Robert; Maddock, Simon T; Morales, Jorge Noe; Oñate, Hugolino; Mafla-Endara, Paola; Peñafiel, Vanessa Aguirre; Torres-Carvajal, Omar; Pozo-Rivera, Wilmer E; Cueva-Arroyo, Xavier A; Tolhurst, Bryony A

    2014-10-01

    In species-rich tropical forests, effective biodiversity management demands measures of progress, yet budgetary limitations typically constrain capacity of decision makers to assess response of biological communities to habitat change. One approach is to identify ecological-disturbance indicator species (EDIS) whose monitoring is also monetarily cost-effective. These species can be identified by determining individual species' responses to disturbance across a gradient; however, such responses may be confounded by factors other than disturbance. For example, in mountain environments the effects of anthropogenic habitat alteration are commonly confounded by elevation. EDIS have been identified with the indicator value (IndVal) metric, but there are weaknesses in the application of this approach in complex montane systems. We surveyed birds, small mammals, bats, and leaf-litter lizards in differentially disturbed cloud forest of the Ecuadorian Andes. We then incorporated elevation in generalized linear (mixed) models (GL(M)M) to screen for EDIS in the data set. Finally, we used rarefaction of species accumulation data to compare relative monetary costs of identifying and monitoring EDIS at equal sampling effort, based on species richness. Our GL(M)M generated greater numbers of EDIS but fewer characteristic species relative to IndVal. In absolute terms birds were the most cost-effective of the 4 taxa surveyed. We found one low-cost bird EDIS. In terms of the number of indicators generated as a proportion of species richness, EDIS of small mammals were the most cost-effective. Our approach has the potential to be a useful tool for facilitating more sustainable management of Andean forest systems. © 2014 Society for Conservation Biology.

  16. Highly-sensitive aptasensor based on fluorescence resonance energy transfer between l-cysteine capped ZnS quantum dots and graphene oxide sheets for the determination of edifenphos fungicide.

    Science.gov (United States)

    Arvand, Majid; Mirroshandel, Aazam A

    2017-10-15

    With the advantages of excellent optical properties and biocompatibility, single-strand DNA-functionalized quantum dots have been widely applied in biosensing and bioimaging. A new aptasensor with easy operation, high sensitivity, and high selectivity was developed by immobilizing the aptamer on water soluble l-cysteine capped ZnS quantum dots (QDs). Graphene oxide (GO) sheets are mixed with the aptamer-QDs. Consequently, the aptamer-conjugated QDs bind to the GO sheets to form a GO/aptamer-QDs ensemble. This aptasensor enables the energy transfer based on a fluorescence resonance energy transfer (FRET) from the QDs to the GO sheets, quenching the fluorescence of QDs. The GO/aptamer-QDs ensemble assay acts as a "turn-on'' fluorescent sensor for edifenphos (EDI) detection. When GO was replaced by EDI, the fluorescence of QDs was restored and its intensity was proportional to the EDI concentration. This GO-based aptasensor under the optimum conditions exhibited excellent analytical performance for EDI determination, ranging from 5×10 -4 to 6×10 -3 mg L -1 with the detection limit of 1.3×10 -4 mgL -1 . Furthermore, the designed aptasensor exhibited excellent selectivity toward EDI compared to other pesticides and herbicides with similar structures such as diazinon, heptachlor, endrin, dieldrin, butachlor and chlordane. Good reproducibility and precision (RSD =3.9%, n =10) of the assay indicates the high potential of the aptasensor for quantitative trace analysis of EDI. Moreover, the results demonstrate the applicability of the aptasensor for monitoring EDI fungicide in spiked real samples. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Quality and safety implications of emergency department information systems.

    Science.gov (United States)

    Farley, Heather L; Baumlin, Kevin M; Hamedani, Azita G; Cheung, Dickson S; Edwards, Michael R; Fuller, Drew C; Genes, Nicholas; Griffey, Richard T; Kelly, John J; McClay, James C; Nielson, Jeff; Phelan, Michael P; Shapiro, Jason S; Stone-Griffith, Suzanne; Pines, Jesse M

    2013-10-01

    The Health Information Technology for Economic and Clinical Health Act of 2009 and the Centers for Medicare & Medicaid Services "meaningful use" incentive programs, in tandem with the boundless additional requirements for detailed reporting of quality metrics, have galvanized hospital efforts to implement hospital-based electronic health records. As such, emergency department information systems (EDISs) are an important and unique component of most hospitals' electronic health records. System functionality varies greatly and affects physician decisionmaking, clinician workflow, communication, and, ultimately, the overall quality of care and patient safety. This article is a joint effort by members of the Quality Improvement and Patient Safety Section and the Informatics Section of the American College of Emergency Physicians. The aim of this effort is to examine the benefits and potential threats to quality and patient safety that could result from the choice of a particular EDIS, its implementation and optimization, and the hospital's or physician group's approach to continuous improvement of the EDIS. Specifically, we explored the following areas of potential EDIS safety concerns: communication failure, wrong order-wrong patient errors, poor data display, and alert fatigue. Case studies are presented that illustrate the potential harm that could befall patients from an inferior EDIS product or suboptimal execution of such a product in the clinical environment. The authors have developed 7 recommendations to improve patient safety with respect to the deployment of EDISs. These include ensuring that emergency providers actively participate in selection of the EDIS product, in the design of processes related to EDIS implementation and optimization, and in the monitoring of the system's ongoing success or failure. Our recommendations apply to emergency departments using any type of EDIS: custom-developed systems, best-of-breed vendor systems, or enterprise systems

  18. Technical feasibility of the electrode ionization process for the makeup water treatment system of the thermal cycle of the CAREM-25 nuclear power plant

    International Nuclear Information System (INIS)

    Ramilo, Lucia B.; Chocron, Mauricio

    2003-01-01

    In thermal cycles of PWRs nuclear power plants with once-through steam generators as the CAREM-25, makeup water of very high purity is required to minimizing the induction of corrosion phenomena, fundamentally in the steam generators and other thermal cycle components. The makeup water treatment systems include several stages, of which the demineralization is the purification stage. The required makeup water purity is obtained in this stage. Historically, ultrapure water systems were based completely on ion exchange technology. Now, the electrode ionization process (EDI) has replaced the ion exchange technology used traditionally in the demineralization stage. Continuous demineralization in an EDI stack consists of three coupled processes: ion exchange, continuous ion removal by transport through the ion exchange resin and membranes into the concentrate stream, continuous regeneration by hydrogen and hydroxyl ions derived from the water splitting reaction and driven by the applied direct current. EDI process allows to obtain ultrapure water, with practically no use of chemical reagents and with technologies of continuous process. The objective of this work is the analysis of the electrode ionization process (EDI) for its implementation in the makeup water treatment system of the thermal cycle of the CAREM-25 nuclear power plant. The obtained results allow to assure the technical feasibility of implementation of the electrode ionization process, EDI, in the makeup water treatment system of the thermal cycle of this Argentinean nuclear power plant. (author)

  19. Exposure assessment of synthetic colours approved in Korea.

    Science.gov (United States)

    Ha, M-S; Ha, S-D; Choi, S-H; Bae, D-H

    2013-01-01

    The dietary intakes of nine synthetic food colours--amaranth, erythrosine, Allura Red, Ponceau 4R, tartrazine, Sunset Yellow FCF, Fast Green FCF, Brilliant Blue FCF and indigo carmine--permitted in Korea were estimated based on food consumption data for consumers and their concentrations in processed foods. The estimated daily intakes (EDIs) by Korean consumers were compared with the acceptable daily intakes (ADIs) of the colours. Among 704 foods sampled, 471 contained synthetic colours. The most highly consumed synthetic colours were Allura Red and tartrazine; the highest EDI/ADI ratios were found for amaranth, erythrosine and Allura Red. The EDIs of infants and children were higher than those of adults. The main food categories containing colours were beverages and liquor for adults, and beverages, chocolate and ice cream for infants and children. For average Korean consumers, the EDIs were not greater than 2.5% of their corresponding ADIs, although the EDI of a conservative consumer in the upper 95th percentile reached 37% of the ADI.

  20. Comparison Study of Water Demineralization System for the OPR 1000 and AP 1000 Nuclear Power Plant

    International Nuclear Information System (INIS)

    Dedy Priambodo; Siti Alimah; Erlan Dewita

    2009-01-01

    OPR 1000 adopts demineralization method based on ion exchanger resin and AP 1000 adopt the method that based on Reverse Osmosis (RO)-Electrodeionization (EDI). The Ion exchange process is a reversible chemical reaction of a solution and an insoluble solid. Ion exchanger use resin as polluter ions capture and will be regenerated after its saturated. RO is method using pressure to force a solution through a membrane, retaining the solute on one side and allowing the pure solvent to pass to the other side. Whereas, EDI is a combination of ion exchange and electrodialysis. The ions is taken by ion exchange resin, and then it is discharged utilizing electric potential difference. Due to water splitting phenomena in EDI, make resin will never be saturated, so the RO-EDI process is water demineralization system that use little chemical, more simple installation, capable to maintain demineralization water product quality and environmental friendly. Thereby, The RO-EDI water demineralization system is more advance then ion exchange technology. (author)

  1. 'I can't accept that feeling': Relationships between interoceptive awareness, mindfulness and eating disorder symptoms in females with, and at-risk of an eating disorder.

    Science.gov (United States)

    Lattimore, Paul; Mead, Bethan R; Irwin, Leanne; Grice, Lorna; Carson, Ruth; Malinowski, Peter

    2017-01-01

    Mindfulness based therapies (MBTs) for eating disorders show potential benefit for outcomes yet evidence is scarce regarding the mechanisms by which they influence remission from symptoms. One way that mindfulness approaches create positive outcomes is through enhancement of emotion regulation skills. Maladaptive emotion regulation is a key psychological feature of all eating disorders. The aim of the current study was to identify facets of emotion regulation involved in the relationship between mindfulness and maladaptive eating behaviours. In three cross-sectional studies, clinical (n=39) and non-clinical (n=137 and 119) female participants completed: 1) the Eating Disorder Inventory (EDI) eating specific scales (drive-for-thinness and bulimia) and the EDI psychological symptom scales (emotion dysregulation and interoceptive deficits); and 2) mindfulness, impulsivity, and emotion regulation questionnaires. In all samples mindfulness was significantly and inversely associated with EDI eating and psychological symptom scales, and impulsivity. In non-clinical samples interoceptive deficits mediated the relationship between mindfulness and EDI eating specific scales. Non-acceptance of emotional experience, a facet of interoceptive awareness, mediated the relationship between mindfulness and eating specific EDI scores. Further investigations could verify relationships identified so that mindfulness based approaches can be optimised to enhance emotion regulation skills in sufferers, and those at-risk, of eating disorders. Crown Copyright © 2016. Published by Elsevier Ireland Ltd. All rights reserved.

  2. The Impact of Impulsivity on Weight Loss Four Years after Bariatric Surgery

    Directory of Open Access Journals (Sweden)

    Kathrin Schag

    2016-11-01

    Full Text Available Bariatric surgery has serious implications on metabolic health. The reasons for a failure of bariatric surgery, i.e., limited weight loss, are multifactorial and include psychological factors. We established a theoretical model of how impulsivity is related to weight loss outcome. We propose that depressive symptoms act as a mediator between impulsivity and pathological eating behavior, and that pathological eating behavior has a direct impact on weight loss outcome. We calculated excessive weight loss (%EWL and assessed self-reported impulsivity (using the Baratt Impulsiveness Scale (BIS-15 total score, depressive symptoms (the Patient Health Questionnaire (PHQ-9 score, and pathological eating behavior (the Eating Disorder Inventory 2 (EDI-2 total score in 65 patients four years after laparoscopic sleeve gastrectomy. Regression and mediation analyses were computed to validate the theoretical model. The BIS-15, PHQ-9, and EDI-2 have medium to high correlations between each other, and EDI-2 correlated with %EWL. The mediation analysis yielded that the PHQ-9 represents a significant mediator between BIS-15 and EDI-2. The regression model between EDI-2 and %EWL was also significant. These results support our theoretical model, i.e., suggest that impulsivity has an indirect impact on weight loss outcome after bariatric surgery, mediated by depression and transferred through pathological eating behavior. Thus, the underlying psychological factors should be addressed in post-operative care to optimize weight loss outcome.

  3. Jeg Er blevet FRANKofil

    DEFF Research Database (Denmark)

    Andersson, Lasse

    2014-01-01

    afhængig af Frank Underwood fra serien House of Cards på den fremadstormende TV-streamingstjenesten Netflix. Jeg har opdaget et nyt internetbaseret datingforhold. Et surrealt, fedt miks af det kyniske og joviale personificeret i karakteren Frank Underwood, som er helt igennem ubehagelig, men fantastisk...... spillet af Kevin Spacey. Og tak til Spacey der for en tid har forladt teateret ’The Old Vic’ i London for at begejstre mig. Der er generelt to årsager til mine FRANKofile tilbøjeligheder. For det første er Netflix’s remake af den tyve år gamle BBC serie House of Cards efter min menig et stykke tv...... anden grund, til at jeg er blevet Frankofil, er, at jeg ikke skal sidde og vente på næste søndag efter søndag efter søndag for at få lov at se næste afsnit. Netflix lagde alle tretten timer af sæson 2 ud på nettet. Jeg afgør selv, hvornår jeg skal have mere Frank! Men på trods af mit narkomanlignende...

  4. Environmental aspects of Kaiser S2 harvester utilization in mountain terrains

    Directory of Open Access Journals (Sweden)

    Jozef Slugeň

    2012-01-01

    Full Text Available This paper deals with evaluating the ecological impacts of Kaiser S2 harvester utilization in mountain terrains. The harvester was used in bark beetle calamity and secondary felling in mixed forest (spruce, fir, beech stand with average incline of 70%. Assisting its movement in these extreme conditions were two supporting bases, which were used to stabilize it in the stand. Our aim was to determine the damage to the trees, underwood and stand soil. The resulting damage of remaining stand was 6.19%, which is, considering the demanding terrain conditions and in comparison with the outcomes of other research, a relatively acceptable value. Damage to the underwood was not found, due to its insufficient height and low representation. Measurements of damage to the soil by its compression indicated that the heaviest damage was under the supporting bases, where a heavy surface damage was found by creation of holes up to 15 cm deep. This type of damage is not dangerous, because it does not create a continuous track dangerous in storm rainfall and subsequent soil erosion. Soil compression in the track and on unimpaired soil reached lower levels. All of the measurements of compression by static penetration were carried out only to the depth of 15 cm due to high soil skeleton. This also negatively affected the measurements, which had to be repeated in many cases.

  5. Carta Editorial

    Directory of Open Access Journals (Sweden)

    Pedro Vitor Lemos Cravo

    2016-06-01

    Full Text Available A primeira edição de 2016 da revista Fronteiras: Journal of Social, Technological and Environmental Science, está no ar com a notícia que a partir desse volume todos os artigos contarão com os registros no DOI (Digital Object Identifier. O Doi é uma ferramenta que associa os artigos existentes nas plataformas digitais a um endereço eletrônico. As edições de 2105 já foram incluídas e até o final deste mês as demais edições receberão o registro DOI.

  6. Drivers and obstacles for employee-driven innovation in large client project organisations

    DEFF Research Database (Denmark)

    Sørensen, Henrik; Wandahl, Søren

    2012-01-01

    of employees’ spoken and tacit knowledge in development of new tools and structures to optimise the construction project management processes is a relatively new approach to engage innovation. In this broad perspective the aim is to map the boundary conditions for an EDI approach in a client project......, and in sequence increased revenue, this study suggests that the key source for innovation is the employees. Employee-driven innovation (EDI) is often seen in a greater innovation context, in which it is often de-emphasised contrary to product and process innovation. Hence a methodology to take advantage...... a literature review to clarify the most potential methodologies and tools. Based on this review a framework of tools and methods is derived from related development theories to engage EDI in client project organisa-tions, where product and process knowledge often are closely related to, and irregular driven by...

  7. Methane production using resin-wafer electrodeionization

    Science.gov (United States)

    Snyder, Seth W; Lin, YuPo; Urgun-Demirtas, Meltem

    2014-03-25

    The present invention provides an efficient method for creating natural gas including the anaerobic digestion of biomass to form biogas, and the electrodeionization of biogas to form natural gas and carbon dioxide using a resin-wafer deionization (RW-EDI) system. The method may be further modified to include a wastewater treatment system and can include a chemical conditioning/dewatering system after the anaerobic digestion system. The RW-EDI system, which includes a cathode and an anode, can either comprise at least one pair of wafers, each a basic and acidic wafer, or at least one wafer comprising of a basic portion and an acidic portion. A final embodiment of the RW-EDI system can include only one basic wafer for creating natural gas.

  8. Editorial

    OpenAIRE

    André Luis Calado Araújo

    2007-01-01

    O CEFET-RN apresenta a segunda edição da Holos de 2008. A revista se consolida com multidisciplinar com 8 artigos. Com esta edição completamos cinco anos no formato online e a décima quarta edição, mostrando que o periódico se consolida como alternativa à publicação de trabalhos científicos. O primeiro artigo intitulado “O façonismo no espaço urbano de Americana-SP”, discute o espaço urbano, a diversidade cultural e sua dinamicidade. O objetivo deste trabalho foi fazer uma análise da ativ...

  9. Real-time in vivo micromorphology and histopathology of choroidal osteoma using enhanced depth imaging

    Directory of Open Access Journals (Sweden)

    Rameez Hussain

    2015-01-01

    Full Text Available Choroidal osteoma is a usually unilateral benign tumor of the choroid composed of mature bone. Optical coherence tomography (OCT has been used to image osteoma for several years. With the advent of enhanced depth imaging (EDI feature of spectral-domain OCT (SD-OCT, better visualization of the morphology of choroidal lesions has been possible. Herein we present a case of choroidal osteoma in a 45-year-old woman, wherein in vivo morphology of the choroidal osteoma had been visualized using EDI technique of SD-OCT before and after performing photodynamic therapy. EDI OCT has proven to be a valuable noninvasive imaging modality, almost comparable to histopathological examination, for diagnosing choroidal osteomas and for providing an insight into the in vivo micromorphological changes occurring during the course of the disease.

  10. Outer Retinal and Choroidal Evaluation in Multiple Evanescent White Dot Syndrome (MEWDS): An Enhanced Depth Imaging Optical Coherence Tomography Study.

    Science.gov (United States)

    Fiore, Tito; Iaccheri, Barbara; Cerquaglia, Alessio; Lupidi, Marco; Torroni, Giovanni; Fruttini, Daniela; Cagini, Carlo

    2018-01-01

    To perform an analysis of optical coherence tomography (OCT) abnormalities in patients with MEWDS, during the acute and recovery stages, using enhanced depth imaging-OCT (EDI-OCT). A retrospective case series of five patients with MEWDS was included. EDI-OCT imaging was evaluated to detect retinal and choroidal features. In the acute phase, focal impairment of the ellipsoid zone and external limiting membrane, hyperreflective dots in the inner choroid, and full-thickness increase of the choroidal profile were observed in the affected eye; disappearance of these findings and restoration of the choroidal thickness (p = 0.046) was appreciated in the recovery phase. No OCT abnormalities were assessed in the unaffected eye. EDI-OCT revealed transient outer retinal layer changes and inner choroidal hyperreflective dots. A transient increased thickness of the whole choroid was also identified. This might confirm a short-lasting inflammatory involvement of the whole choroidal tissue in the active phase of MEWDS.

  11. The Long Term Effects of Electronic Commerce and Data Interchange on Firms

    Directory of Open Access Journals (Sweden)

    François Bergeron

    1998-11-01

    Full Text Available This research aims to identify the determinants of electronic commerce effectiveness, as well as the variation over time of their effect. A two-phased study was undertaken for this purpose, using EDI as a specific form of electronic commerce. Sixty-five organisations were surveyed twice over a three-year period. In Phase 1, determining factors were found to be the level of organisational support, the rigour of the implementation process, the presence of control procedures, and the level of internal integration, external integration and imposition of EDI. Imposition also has a negative effect on the organisational context of EDI. In Phase 2, the implementation process, internal integration and imposition lost their importance, whereas the effect of imposition on the organisational context became positive. In the future, we expect the security and external integration to be the most important success factors of electronic commerce.

  12. Population-level associations between preschool vulnerability and grade-four basic skills.

    Directory of Open Access Journals (Sweden)

    Amedeo D'Angiulli

    2009-11-01

    Full Text Available This is a predictive validity study examining the extent to which developmental vulnerability at kindergarten entry (as measured by the Early Development Instrument, EDI is associated with children's basic skills in 4th grade (as measured by the Foundation Skills Assessment, FSA.Relative risk analysis was performed on a large database linking individual-level EDI ratings to the scores the same children obtained on a provincial assessment of academic skills (FSA--Foundation Skills Assessment four years later. We found that early vulnerability in kindergarten is associated with the basic skills that underlie populations of children's academic achievement in reading, writing and math, indicating that the Early Development Instrument permits to predict achievement-related skills four years in advance.The EDI can be used to predict children's educational trends at the population level and can help select early prevention and intervention programs targeting pre-school populations at minimum cost.

  13. WEB Services Networks and Technological Hybrids — The Integration Challenges of WAN Distributed Computing for ASP Providers

    Science.gov (United States)

    Mroczkiewicz, Pawel

    A necessity of integration of both information systems and office software existing in organizations has had a long history. The beginning of this kind of solutions reaches back to the old generation of network protocols called EDI (Electronic Data Interchange) and EDIFACT standard, which was initiated in 1988 and has dynamically evolved ever since (S. Michalski, M. Suskiewicz, 1995). The mentioned protocol was usually used for converting documents into natural formats processed by applications. It caused problems with binary files and, furthermore, the communication mechanisms had to be modified each time new documents or applications were added. When we compare EDI with the previously used communication mechanisms, EDI was a great step forward as it was the first, big scale attempt to define standards of data interchange between the applications in business transactions (V. Leyland, 1995, p. 47).

  14. Surface characterization of polymethylmetacrylate bombarded by charged water droplets

    International Nuclear Information System (INIS)

    Hiraoka, Kenzo; Takaishi, Riou; Asakawa, Daiki; Sakai, Yuji; Iijima, Yoshitoki

    2009-01-01

    The electrospray droplet impact (EDI), in which the charged electrospray water droplets are introduced in vacuum, accelerated, and allowed to impact the sample, is applied to polymethylmetacrylate (PMMA). The secondary ions generated were measured by an orthogonal time-of-flight mass spectrometer. In EDI mass spectra for PMMA, fragment ions originating from PMMA could not be detected. This is due to the fact that the proton affinities of fragments formed from PMMA are smaller than those from acetic acid contained in the charged droplet. The x-ray photoelectron spectroscopy spectra of PMMA irradiated by water droplets did not change with prolonged cluster irradiation, i.e., EDI is capable of shallow surface etching for PMMA with a little damage of the sample underneath the surface.

  15. The Influence of Volume and Anatomic Location of Optic Disc Drusen on the Sensitivity of Autofluorescence

    DEFF Research Database (Denmark)

    Loft, Frederik Cornelius; Malmqvist, Lasse; Lindberg, Anne-Sofie Wessel

    2018-01-01

    Optic disc drusen (ODD) are acellular deposits in the optic nerve head. ODD can be diagnosed using different imaging modalities, including enhanced depth imaging optical coherence tomography (EDI-OCT) and autofluorescence (AF). It is unknown which factors determine the sensitivity of AF. The aim...... of this study was to investigate the effect of volume and anatomic location of ODD on the sensitivity of AF. Cross-sectional study. A total of 38 patients (75 eyes) with ODD were included. In 12 of 75 eyes (16%) and in 11 of 38 patients (29%), EDI-OCT detected ODD that were not detected by AF. In 24 distinctly...... solitary ODD, both increase in ODD volume (P = 0.0388) and a more superficial ODD location (P EDI-OCT is superior to AF in the diagnosis of ODD. Volume and anatomic location of ODD have a significant impact...

  16. Electronic commerce can cut purchasing costs

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, T.

    1995-06-01

    Electronic commerce could be the most important strategy exercised by utilities involved in transmission and distribution in the next five to ten years. One key element of electronic commerce is electronic data interchange (EDI). EDI is the direct, standardized computer-to-computer exchange of business documents, such as purchase orders, invoices, payments and inventory analysis between trading partners. EDI enables business documents delivery in seconds instead of days. Inventory has been a big expense for utilities, especially in the transmission and distribution area. In order to provide and restore electrical service to customers, utilities have been required to stock high levels of many different items. At times, warehouse personnel have had difficulty determining the minimum quantity needed for a particular part so items are stocked just-in-case.Electronic commerce will allow utilities to more accurately determine minimum stocking requirements and reduce inventory without sacrificing customer service.

  17. Validation of the Korean version of the Eating Disorder Inventory-2: psychometric properties and cross-cultural comparison.

    Science.gov (United States)

    Lee, Jung-Hyun; Shin, Mi-Yeon; Jo, Hye-Hyeon; Jung, Young-Chul; Kim, Joon-Ki; Kim, Kyung Ran

    2012-11-01

    The purpose of the present study was to examine the validity and reliability of the Korean version of the Eating Disorder Inventory-2 (EDI-2) in Korean patients with eating disorders and healthy controls, and to investigate cultural differences of EDI-2 between a Korean group and a North American standardization sample. The Korean version of the EDI-2 was prepared after comprehensive clinical assessment of Korean patients with eating disorders (n=327) as well as female undergraduates (n=176). Results were compared between eating disorder subgroups (anorexia nervosa, bulimia nervosa and eating disorders not otherwise specified) and those of a North American standardization sample and healthy controls. The results showed that the Korean EDI-2 had adequate internal consistency (0.77-0.93) and discriminated well between patients with eating disorders and healthy controls on all subscales. Significant differences in EDI-2 subscale scores between the eating disorder groups and the healthy control group were observed; however, there was no discernible difference among the eating disorder subgroups. When compared with a North American standardization sample, the Korean control group showed significantly higher scores for drive for thinness and asceticism. When patient groups were compared, the Korean group showed significantly lower scores for perfectionism. As expected, the results accurately reflected psychometric properties of the Korean version of EDI-2 for eating disorder patients in Korea. These findings also suggest that common characteristics for the eating disorder exist as a whole rather than with significant difference between each subgroup. In addition, significant differences between the Korean and the North American groups for both patients and controls also demonstrated specific cultural differences.

  18. Validation of the Korean Version of the Eating Disorder Inventory-2: Psychometric Properties and Cross-Cultural Comparison

    Science.gov (United States)

    Lee, Jung-Hyun; Shin, Mi-Yeon; Jo, Hye-Hyeon; Jung, Young-Chul; Kim, Joon-Ki

    2012-01-01

    Purpose The purpose of the present study was to examine the validity and reliability of the Korean version of the Eating Disorder Inventory-2 (EDI-2) in Korean patients with eating disorders and healthy controls, and to investigate cultural differences of EDI-2 between a Korean group and a North American standardization sample. Materials and Methods The Korean version of the EDI-2 was prepared after comprehensive clinical assessment of Korean patients with eating disorders (n=327) as well as female undergraduates (n=176). Results were compared between eating disorder subgroups (anorexia nervosa, bulimia nervosa and eating disorders not otherwise specified) and those of a North American standardization sample and healthy controls. Results The results showed that the Korean EDI-2 had adequate internal consistency (0.77-0.93) and discriminated well between patients with eating disorders and healthy controls on all subscales. Significant differences in EDI-2 subscale scores between the eating disorder groups and the healthy control group were observed; however, there was no discernible difference among the eating disorder subgroups. When compared with a North American standardization sample, the Korean control group showed significantly higher scores for drive for thinness and asceticism. When patient groups were compared, the Korean group showed significantly lower scores for perfectionism. Conclusion As expected, the results accurately reflected psychometric properties of the Korean version of EDI-2 for eating disorder patients in Korea. These findings also suggest that common characteristics for the eating disorder exist as a whole rather than with significant difference between each subgroup. In addition, significant differences between the Korean and the North American groups for both patients and controls also demonstrated specific cultural differences. PMID:23074108

  19. 'Bad boys'' Bodies

    DEFF Research Database (Denmark)

    Skårderud, Finn; Nygren, Pär; Edlund, Birgitta

    2005-01-01

    (n= 196) completed the Eating Disorders Inventory ? Child version (EDI-C). The childcare residents also completed an extended questionnaire, including questions regarding the use of anabolic?andro-genic steroids. Our main ?ndings were high scores on EDI-C symptom scales for boys in the childcare...... resident group; few differences between girls in the two samples; and a high frequency of having used anabolic?androgenic steroids among boys in care. Body-image problems among boys have hitherto been given little attention. The results call for increased efforts in describing and detecting patho...

  20. Confiabilidad de la detección de problemas de desarrollo mediante el semáforo de la prueba de Evaluación del Desarrollo Infantil: ¿es diferente un resultado amarillo de uno rojo?

    OpenAIRE

    Rizzoli-Córdoba, Antonio; Ortega-Ríosvelasco, Fernando; Villasís-Keever, Miguel Ángel; Pizarro-Castellanos, Mariel; Buenrostro-Márquez, Guillermo; Aceves-Villagrán, Daniel; O'Shea-Cuevas, Gabriel; Muñoz-Hernández, Onofre

    2014-01-01

    Introducción: La prueba Evaluación del Desarrollo Infantil (EDI) es un instrumento de tamizaje de problemas en el desarrollo diseñado y validado en México. La calificación obtenida se expresa como semáforo. Se consideran positivos tanto el resultado amarillo como el rojo, aunque se plantea una intervención diferente para cada uno. El objetivo de este trabajo fue evaluar la capacidad de la prueba EDI para discriminar entre los niños identificados con semáforo amarillo y los identificados con r...

  1. Dos novelas colombianas olvidadas

    Directory of Open Access Journals (Sweden)

    Eduardo García Piedrahita

    1980-06-01

    Full Text Available Estas dos novelas olvidadas llevan por títulos Pax de don Lorenzo Marroquín (pr. edi. 1907, y Diana Cazadora de don Clímaco Soto Borda(pr. edi. 1917, ambos bogotanos aunque de disímiles estirpes literarias; y como tales en sus obras fluyen física y verbalmente, el ambiente de su ciudad natal; espíritu hecho de zumbona crítica, individualismo cáustico y solapada parodia de usos y costumbres. Y sobre tales bases sentimentales y estilísticas debe considerárselas.

  2. Singularidades en ecuaciones diferenciales implícitas: aplicaciones a circuitos eléctricos

    OpenAIRE

    Kleiman, Diana

    2015-01-01

    El objetivo principal de esta tesis es aplicar resultados de la teoría de EDIs al análisis de distintos modelos de circuitos eléctricos. Dentro de estos modelos existen redes eléctricas lineales y no lineales. Para el caso de los circuitos lineales, se ha desarrollado una amplia teoría vinculada a las EDIs lineales que puede utilizarse para su estudio. En cambio, cuando se trabaja con circuitos no lineales, particularmente, en el estudio de cierto tipo de singularidades que aparecen en ellos,...

  3. NAVA: Nuevo modo de Ventilación

    OpenAIRE

    Martín Lorenzo, María del Carmen; Montón Giménez, Nuria; Paz Martín, Daniel

    2013-01-01

    La Ventilación Asistida Ajustada Neuronalmente (NAVA) es un nuevo modo de Ventilación Mecánica Asistida que utiliza la actividad eléctrica diafragmática (Edi) para el control del respirador. La Edi es registrada a través de un catéter esofágico, y representa directamente el impulso respiratorio central y, por lo tanto, la duración y la intensidad con que el paciente desea ventilar. La asistencia inspiratoria mecánica se inicia en el momento en que el centro respiratorio lo demanda, y el di...

  4. Guia de receitas brasileiras: uma saborosa viagem pela literatura

    OpenAIRE

    Santos, Denísia Moraes dos

    2011-01-01

    Esta dissertação tem por objetivo compreender, sob o ponto de vista da Análise Dialógica do Discurso, o processo de construção dos sentidos em Guia de receitas brasileiras ─ texto premiado na primeira edição do Concurso Cultural Viagem Nestlé pela Literatura (1999). Com o tema A literatura e a vida nos 500 anos de Brasil , essa edição desafiou alunos e professores a produzir um intertexto literário-cultural, utilizando cinco obras da literatura brasileira ─ Cronistas do Descobrim...

  5. The Environmental Data Initiative: A broad-use data repository for environmental and ecological data that strives to balance data quality and ease of submission

    Science.gov (United States)

    Servilla, M. S.; Brunt, J.; Costa, D.; Gries, C.; Grossman-Clarke, S.; Hanson, P. C.; O'Brien, M.; Smith, C.; Vanderbilt, K.; Waide, R.

    2017-12-01

    In the world of data repositories, there seems to be a never ending struggle between the generation of high-quality data documentation and the ease of archiving a data product in a repository - the higher the documentation standards, the greater effort required by the scientist, and the less likely the data will be archived. The Environmental Data Initiative (EDI) attempts to balance the rigor of data documentation to the amount of effort required by a scientist to upload and archive data. As an outgrowth of the LTER Network Information System, the EDI is funded by the US NSF Division of Environmental Biology, to support the LTER, LTREB, OBFS, and MSB programs, in addition to providing an open data archive for environmental scientists without a viable archive. EDI uses the PASTA repository software, developed originally by the LTER. PASTA is metadata driven and documents data with the Ecological Metadata Language (EML), a high-fidelity standard that can describe all types of data in great detail. PASTA incorporates a series of data quality tests to ensure that data are correctly documented with EML in a process that is termed "metadata and data congruence", and incongruent data packages are forbidden in the repository. EDI reduces the burden of data documentation on scientists in two ways: first, EDI provides hands-on assistance in data documentation best practices using R and being developed in Python, for generating EML. These tools obscure the details of EML generation and syntax by providing a more natural and contextual setting for describing data. Second, EDI works closely with community information managers in defining rules used in PASTA quality tests. Rules deemed too strict can be turned off completely or just issue a warning, while the community learns to best handle the situation and improve their documentation practices. Rules can also be added or refined over time to improve overall quality of archived data. The outcome of quality tests are stored as

  6. Where and Why Users Check In

    Science.gov (United States)

    2014-07-28

    a practical information-theoretic approach. Springer, 2 edi- tion. [Cho et al. 2013] Cho, Y. S.; Galstyan, A.; Brantingham, J.; and Tita , G. 2013...and Tita , G. E. 2011. Self- Exciting Point Process Modeling of Crime. Journal of the American Statistical Association 106(493):100–108. [Perry and

  7. Psychometric Properties of the Dutch Version of the Eating Disorder Inventory–3

    Directory of Open Access Journals (Sweden)

    Vicky Lehmann

    2013-10-01

    Full Text Available The psychometric properties of the Dutch version of the Eating Disorder Inventory–3 (EDI-3 were tested in eating disordered patients (N = 514 using confirmatory factor analyses, variance decomposition, reliabilities, and receiver operating characteristic (ROC curve analyses. Factorial validity results supported the 12 subscales, but model fit was impaired by correlated item errors, misallocated items, and redundant subscales. At the composite level, the Bulimia subscale was identified as a largely specific source of information that did not contribute much to its overarching composite. Reliabilities for subscales and composites ranged from .6 to .9. ROC curve analysis indicated good to excellent discriminative ability of the EDI-3 identifying clinical subjects against a reference group. In conclusion, further revisions of the EDI-3 might target the item allocation and (over-differentiation of subscales and composites to further clarify its structure. For the clinical practice, we advise the careful use of the EDI-3, although it might serve as a good screening tool.

  8. Online Scheduling in Distributed Message Converter Systems

    NARCIS (Netherlands)

    Risse, Thomas; Wombacher, Andreas; Surridge, Mike; Taylor, Steve; Aberer, Karl

    The optimal distribution of jobs among hosts in distributed environments is an important factor to achieve high performance. The optimal strategy depends on the application. In this paper we present a new online scheduling strategy for distributed EDI converter system. The strategy is based on the

  9. Assessment of chromium, nickel, cobalt and zinc in edible flesh of ...

    African Journals Online (AJOL)

    ADOWIE PERE

    melanotheron) are two of the highly consumed fish species in Bodo River. .... American diet as 60-90µg per day (i.e. estimated daily intake). ... estimated daily intake (EDI) for chromium in a North .... Trace Element Concentrations in Freshwater.

  10. Validity and Psychometric Properties of the Early Development Instrument in Canada, Australia, United States, and Jamaica

    Science.gov (United States)

    Janus, Magdalena; Brinkman, Sally A.; Duku, Eric K.

    2011-01-01

    There is an increasing support from international organizations and the research community for stepping beyond infant or child mortality as the most common child level social indicator and progressing towards an international measure of child development. The Early Development Instrument (EDI) is a teacher-completed measure of children's…

  11. EFFECT OF GREEN BUSINESS PRACTICES ON ...

    African Journals Online (AJOL)

    DGS-FUTO

    2018-06-01

    Jun 1, 2018 ... Probability level of significance was given at 5%. Data were presented using ..... Global warming impacts ecosystem through rising sea levels, warming of the ocean ..... of Florida, PEOD-5 http:/edis.ifass.ufi. edu. (18 January ...

  12. Determination and risk assessment of naturally occurring genotoxic and carcinogenic alkenylbenzenes in basil-containing sauce of pesto

    NARCIS (Netherlands)

    Al-Malahmeh, Amer J.; Al-Ajlouni, Abdalmajeed M.; Wesseling, Sebas; Vervoort, Jacques; Rietjens, Ivonne M.C.M.

    2017-01-01

    A risk assessment of basil-based pesto sauces containing methyleugenol and related alkenylbenzenes was performed based on their levels detected in a series of pesto sauces available on the Dutch market. The estimated daily intake (EDI) values of alkenylbenzenes as a result of consumption of the

  13. ASSIS, Machado de. Casa Velha / The Old House. Trad. de Mark Carlyon. Rio de Janeiro: Cidade Viva, 2010. 236 p.

    Directory of Open Access Journals (Sweden)

    Cynthia Beatrice Costa

    2014-12-01

    Full Text Available Por meio do exame desta edição bilíngue da novela machadiana, pretende-se analisar como o ato tradutório e as informações extratextuais foram valorizados pelos editores, ensaístas e pelo próprio tradutor.

  14. Health care and privacy law in electronic commerce.

    Science.gov (United States)

    Wright, B

    1994-01-01

    As electronic data interchange (EDI) continues to gain acceptance and use, questions regarding protection of the confidentiality of private healthcare information have arisen. This article explains how a computer-based information system equipped with appropriate safeguards can be far better at ensuring privacy than a paper-based system.

  15. 32 CFR 22.810 - Payments.

    Science.gov (United States)

    2010-07-01

    ..., whenever electronic commerce is used (i.e., EDI to request and authorize payments and electronic funds...) Expanding on these Governmentwide policies, DoD policy is for DoD Components to use electronic commerce, to... request by the administrative grants officer, when it is not possible to use electronic commerce and paper...

  16. Conversion into numerical form of radiographic images

    International Nuclear Information System (INIS)

    Cappabianca, C.; Della Rocca, A.B.; Ferriani, S.

    1986-01-01

    Radiographic means are widely used for non destructive testing. However, human and technological factors strongly influence reliability of the results and further use of these technique. Image Processing can help to overtake those difficulties if radiographic films are previously digitized. This paper shows methods and equipments used in this field. The system EDI (Enea Digital. Imagery) operating in Casaccia Energy Research Centre is described

  17. 78 FR 19526 - Light-Walled Rectangular Pipe and Tube From China, Korea, Mexico, and Turkey; Institution of Five...

    Science.gov (United States)

    2013-04-01

    ... for information is required if a currently valid Office of Management and Budget (OMB) number is not... of the Domestic Like Product constitutes a major proportion of the total domestic production of the... Commission's Handbook on E-Filing, available on the Commission's Web site at http://edis.usitc.gov . Also, in...

  18. 78 FR 46604 - Raw Flexible Magnets From China and Taiwan; Institution of Five-Year Reviews

    Science.gov (United States)

    2013-08-01

    ... of Management and Budget (OMB) number is not displayed; the OMB number is 3117-0016/USITC No. 13-5... Product constitutes a major proportion of the total domestic production of the product. In its original... Handbook on E-Filing, available on the Commission's Web site at http://edis.usitc.gov . Also, in accordance...

  19. 77 FR 301 - Corrosion-Resistant Carbon Steel Flat Products From Germany and Korea: Institution of Five-Year...

    Science.gov (United States)

    2012-01-04

    ... information is required if a currently valid Office of Management and Budget (OMB) number is not displayed... production of the product. In its original investigations and its full first and second five-year review... revised Commission's Handbook on E-Filing, available on the Commission's Web site at http://edis.usitc.gov...

  20. 77 FR 19714 - Folding Gift Boxes From China; Institution of a Five-Year Review of the Antidumping Duty Order

    Science.gov (United States)

    2012-04-02

    ...\\ No response to this request for information is required if a currently valid Office of Management and... proportion of the total domestic production of the product. In its original determination and its expedited... Handbook on E-Filing, available on the Commission's Web site at http://edis.usitc.gov . Also, in accordance...

  1. 77 FR 39257 - Honey From Argentina and China Institution of Five-Year Reviews Concerning the Countervailing...

    Science.gov (United States)

    2012-07-02

    ... this request for information is required if a currently valid Office of Management and Budget (OMB... output of the Domestic Like Product constitutes a major proportion of the total domestic production of... revised Commission's Handbook on E-Filing, available on the Commission's Web site at http://edis.usitc.gov...

  2. C2 Product-Centric Approach to Transforming Current C4ISR Information Architectures

    Science.gov (United States)

    2004-06-01

    SAML) Privacy (P3P) Digital Rights Management (XrML) Content Mngmnt (DASL) (WebDAV) Content Syndicat’n (ICE) (RSS) Ontology (OML) (OWL) Resource...RNIF Registry/ Repository BPSS eCommerce XML/EDI Universal Business Language (UBL) Internet & Computing Human Resources (HR-XML) Semantic C2RM

  3. Using a Combination of UML, C2RM, XML, and Metadata Registries to Support Long-Term Development/Engineering

    Science.gov (United States)

    2003-01-01

    Authenticat’n (XCBF) Authorizat’n (XACML) (SAML) Privacy (P3P) Digital Rights Management (XrML) Content Mngmnt (DASL) (WebDAV) Content Syndicat’n...Registry/ Repository BPSS eCommerce XML/EDI Universal Business Language (UBL) Internet & Computing Human Resources (HR-XML) Semantic KEY XML SPECIFICATIONS

  4. Measuring eating concerns in Black and White adolescent girls

    NARCIS (Netherlands)

    Franko, DL; Striegel-Moore, RH; Barton, BA; Schumann, BC; Garner, DM; Daniels, [No Value; Schreiber, GB; Crawford, PB

    Objective: Few instruments exist to measure eating concerns in adolescent girls from diverse ethnic backgrounds. Methods: A Children's version of the Eating Disorder Inventory (EDI-C) has been under development for several years and was designed to be more appropriate for younger children with lower

  5. Literatura e Autoritarismo - A conservação da violência

    OpenAIRE

    Ourique, João Luis Pereira; Universidade Federal de Pelotas - UFPel; Umbach, Rosani Ketzer; universidade Federal de Santa Maria - UFSM

    2015-01-01

    O título da publicação procura destacar o propósito dos textos que convergem a esta edição e deixar latente os mecanismos que operam para que um estado de violência esteja sempre presente e atuante nas nossas práticas sociais.

  6. Readiness to Recover in Adolescent Anorexia Nervosa: Prediction of Hospital Admission

    Science.gov (United States)

    Ametller, L.; Castro, J.; Serrano, E.; Martinez, E.; Toro, J.

    2005-01-01

    Objectives: To determine if motivation to change in anorexia nervosa during treatment is a predictor of hospitalisation in adolescent patients. Method: The Anorexia Nervosa Stages of Change Questionnaire (ANSOCQ), the Eating Disorders Inventory-2 (EDI-2) and the Beck Depression Inventory (BDI) were administered to a group of 70 anorexia nervosa…

  7. Intensive inpatient treatment for bulimia nervosa: Statistical and clinical significance of symptom changes.

    Science.gov (United States)

    Diedrich, Alice; Schlegl, Sandra; Greetfeld, Martin; Fumi, Markus; Voderholzer, Ulrich

    2018-03-01

    This study examines the statistical and clinical significance of symptom changes during an intensive inpatient treatment program with a strong psychotherapeutic focus for individuals with severe bulimia nervosa. 295 consecutively admitted bulimic patients were administered the Structured Interview for Anorexic and Bulimic Syndromes-Self-Rating (SIAB-S), the Eating Disorder Inventory-2 (EDI-2), the Brief Symptom Inventory (BSI), and the Beck Depression Inventory-II (BDI-II) at treatment intake and discharge. Results indicated statistically significant symptom reductions with large effect sizes regarding severity of binge eating and compensatory behavior (SIAB-S), overall eating disorder symptom severity (EDI-2), overall psychopathology (BSI), and depressive symptom severity (BDI-II) even when controlling for antidepressant medication. The majority of patients showed either reliable (EDI-2: 33.7%, BSI: 34.8%, BDI-II: 18.1%) or even clinically significant symptom changes (EDI-2: 43.2%, BSI: 33.9%, BDI-II: 56.9%). Patients with clinically significant improvement were less distressed at intake and less likely to suffer from a comorbid borderline personality disorder when compared with those who did not improve to a clinically significant extent. Findings indicate that intensive psychotherapeutic inpatient treatment may be effective in about 75% of severely affected bulimic patients. For the remaining non-responding patients, inpatient treatment might be improved through an even stronger focus on the reduction of comorbid borderline personality traits.

  8. 76 FR 66004 - Preliminary Plan for Retrospective Analysis of Existing Rules

    Science.gov (United States)

    2011-10-25

    ... Handbook for Electronic Filing Procedures (see http://www.usitc.gov/secretary/edis.htm ). For those... facilitate the development of sound and informed U.S. trade policy. The Commission makes most of its... Duty Handbook,'' ``An Introduction to Administrative Protective Order Practice in Import Injury...

  9. African Journal on Conflict Resolution - Vol 4, No 1 (2004)

    African Journals Online (AJOL)

    The print media and conflict resolution in Northern Uganda · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT ... Book Review: Second Track / Citizens' Diplomacy : Concepts and Techniques for Conflict Transformation, John Davies and Edward (Edy) Kaufman (eds.) EMAIL FREE FULL TEXT ...

  10. Architecture for Cross-Organizational Business Processes

    NARCIS (Netherlands)

    Hoffner, Yigal; Ludwig, Heiko; Gülcü, Ceki; Grefen, P.W.P.J.

    Efficient means of electronic interaction are an essential requirement for the integration of different companies' business processes along the value chain. Until recently, this interaction relied on expensive, complex and inflexible solutions, mostly based on EDI or some proprietary means. The high

  11. Choice, interpretation and implementation of IT systems

    DEFF Research Database (Denmark)

    Madsen, Charlotte Øland

    The topic of the research project is to investigate how new Internet-related information technologies such as EDI/SAP/CRM are implemented in Danish food processing companies. A recently published report on "IT in praxis 2001" by PLS RAMBØLL Management A/S contains a survey of the Danish private...

  12. Uncooled EGR as a means of limiting wall-wetting under early direct injection conditions

    NARCIS (Netherlands)

    Boot, M.D.; Luijten, C.C.M.; Somers, L.M.T.; Eguz, U.; Erp, D.D.T.M. van; Albrecht, A.; Baert, R.S.G.

    2009-01-01

    Collision of injected fuel spray against the cylinder liner (wall-wetting) is one of the main hurdles that must be overcome in order for early direct injection Premixed Charge Compression Ignition (EDI PCCI) combustion to become a viable alternative for conventional DI diesel combustion. Preferably,

  13. Linked data for transaction based enterprise interoperability

    NARCIS (Netherlands)

    Folmer, E.J.A.; Krukkert, D.

    2015-01-01

    Interoperability is of major importance in B2B environments. Starting with EDI in the ‘80s, currently interoperability relies heavily on XMLbased standards. Although having great impact, still issues remain to be solved for improving B2B interoperability. These issues include lack of dynamics, cost

  14. Zhuyi Quexian Duodong Zhang'ai Ertong de Shijian Zhijue Tezheng

    DEFF Research Database (Denmark)

    Yin, Huazhan; Sun, Zudi; Li, Dan

    2015-01-01

    To explore the characteristics of time perception of children with attention-deficit /hyperactivity disorder ( ADHD) and its relevant reasons by using a duration discrimination task. Methods: Totally 55 children with ADHD who met the Diagnostic and Statistical Manual of Mental Disorder,Fourth Edi...

  15. NCBI nr-aa BLAST: CBRC-TTRU-01-0142 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0142 ref|ZP_05065637.1| binding-protein-dependent transport systems in...ner membrane component [Octadecabacter antarcticus 238] gb|EDY90876.1| binding-protein-dependent transport systems

  16. Landau

    Directory of Open Access Journals (Sweden)

    José Abdalla Helayël-Neto

    2013-10-01

    Full Text Available https://dx.doi.org/2175-7941.2013v30n3p656 Resenha do livro “Landau”, da autoria de José Maria Filardo Bassalo e Francisco Caruso Editora Livraria da Física, São Paulo, 2013, 1a edição ISBN: 9788578612009

  17. De Paris a Buenos Aires: imprensa, ideias e intelectuais no Le Monde Diplomatique

    Directory of Open Access Journals (Sweden)

    Juliana Sayuri Ogassawara

    2016-03-01

    Full Text Available Este artigo pretende expor as relações entre os intelectuais e jornalistas imbricados nas edições latino-americanas e a edição francesa do periódico Le Monde Diplomatique. Fundado em maio de 1954, em Paris, por Hubert Beuve-Méry, Le Monde Diplomatique viu suas páginas e suas ideias se alastrarem mundo afora – em 2013, o magazine tinha 47 edições internacionais, considerado um fenômeno único na imprensa mundial. Ao longo de sua trajetória, Le Monde Diplomatique teve sua linha editorial marcada por diretrizes politizadas, declaradamente antiimperialistas e antineoliberais. A tese desenvolvida focou a versão publicada em Buenos Aires, considerada a principal edição latino-americana, fundada por iniciativa do argentino Carlos Gabetta, diretor de Le Monde Diplomatique Edición Cono Sur entre 1999 e 2011. Ancorado na história dos intelectuais e na história do tempo presente, este artigo aborda as relações entre intelectuais franceses e argentinos na consolidação de uma experiência singular da imprensa.

  18. The Effects of Peer Influence on Disordered Eating Behavior

    Science.gov (United States)

    Meyer, Tiffany A.; Gast, Julie

    2008-01-01

    Peer influence has been found to be correlated with a host of harmful health behaviors. However, little research has been conducted investigating the relationship between peer influence and disordered eating. The present study surveyed 6th-, 7th-, and 8th-grade girls and boys using the Eating Disorder Inventory (EDI) and Inventory of Peer…

  19. O aniversário do Pasquim: 22 anos em 5

    Directory of Open Access Journals (Sweden)

    Márcia Neme Buzalaf

    2009-04-01

    Full Text Available Resenha: Pasquim 40 anos: Edição Comemorativa. Rio de Janeiro: Desiderata, 2009, 40 p. e Antologia do Pasquim - volume III:1973-1974, de Jaguar e Sérgio Augusto (Org.. Rio de Janeiro: Desiderata, 2009, 376 p.

  20. Internet Commerce Managing Financial on the Internet

    Directory of Open Access Journals (Sweden)

    Chandra Wibowo Widhianto

    2001-03-01

    Full Text Available Article explain how to business through internet which are web business clarification, strategy effect, how to make profit, and business electronic changes consist of criptografy, EDI, signature, digital notarisation, file, payment, and how to get succes in internet business.

  1. Soybean (Glycine max) as a versatile biocatalyst for organic synthesis

    African Journals Online (AJOL)

    Luciana

    2012-04-12

    Apr 12, 2012 ... Cetonas Aromáticas Utilizando a Casca da Passiflora como. Biocatalisador. MS Thesis, Edições UFC, Fortaleza, Brazil, 2003. Machado LL, Monte FJQ, de Oliveira MCF, de Mattos MC, Lemos TLG,. Gotor-Fernández V, Gonzalo G, Gotor V (2008). Bioreduction of aromatic aldehydes and ketones by fruits' ...

  2. “En-Face” Spectral-Domain Optical Coherence Tomography Findings in Multiple Evanescent White Dot Syndrome

    Directory of Open Access Journals (Sweden)

    Flore De bats

    2014-01-01

    Full Text Available Purpose. The recent use of “en-face” enhanced-depth imaging spectral-domain optical coherence tomography (EDI SD-OCT helps distinguish the retinal layers involved in the physiopathology of multiple evanescent white dot syndrome (MEWDS. Methods. Four patients presenting with MEWDS underwent a comprehensive ocular examination including C-scan (“en-face” EDI SD-OCT at the initial visit and during follow-up. Results. C-scans combined with the other multimodal imaging enabled the visualization of retinal damage. Acute lesions appeared as diffuse and focal disruptions occurring in the ellipsoid and interdigitation zones. The match between autofluorescence imaging, indocyanine green angiography, and “en-face” OCT helped identify the acute microstructural damages in the outer retina further than the choroid. Follow-up using “en-face” EDI-OCT revealed progressive and complete recovery of the central outer retinal layers. Conclusion. “En-face” EDI SD-OCT identified the site of initial damage in MEWDS as the photoreceptors and the interdigitation layers rather than the choroid. Moreover, “en-face” OCT is helpful in the follow-up of these lesions by being able to show the recovery of the outer retinal layers.

  3. 32 CFR Appendix D to Part 57 - The DoD-AP

    Science.gov (United States)

    2010-07-01

    ... children, ages 3 through 21 years, inclusive, who are receiving special education from the DoD school... from EDIS and children, ages 3 through 21 years, inclusive who are receiving special education from the... PROVISION OF EARLY INTERVENTION AND SPECIAL EDUCATION SERVICES TO ELIGIBLE DOD DEPENDENTS Pt. 57, App. D...

  4. Nové technologie v obchodním podnikání

    OpenAIRE

    PENIAŠTEKOVÁ, Gabriela

    2010-01-01

    Subject of this bachelor work is the "New Technologies in Trade". Selected hypotheses are focused on technologies used in retail and wholesale and on comparison of these technologies in the Czech Republic and economically advanced European countries. Three of these technologies were chosen and studied in detail. It is electronic bussines (E-Business), EDI (Electronic Data Interchange) and RFID (Radio Frequency Identification).

  5. Level of Alkenylbenzenes in Parsley and Dill Based Teas and Associated Risk Assessment Using the Margin of Exposure Approach

    NARCIS (Netherlands)

    Alajlouni, Abdul; Al-Malahmeh, Amer J.; Isnaeni, Farida Nur; Wesseling, Sebas; Vervoort, Jacques; Rietjens, Ivonne M.C.M.

    2016-01-01

    Risk assessment of parsley and dill based teas that contain alkenylbenzenes was performed. To this end the estimated daily intake (EDI) of alkenylbenzenes resulting from use of the teas was quantified. Since most teas appeared to contain more than one alkenylbenzene, a combined risk assessment

  6. Risk assessment of combined exposure to alkenylbenzenes through consumption of plant food supplements containing parsley and dill

    NARCIS (Netherlands)

    Alajlouni, Abdalmajeed M.; Al-Malahmeh, Amer J.; Wesseling, Sebastiaan; Kalli, Marina; Vervoort, Jacques; Rietjens, Ivonne M.C.M.

    2017-01-01

    A risk assessment was performed of parsley- and dill-based plant food supplements (PFS) containing apiol and related alkenylbenzenes. First, the levels of the alkenylbenzenes in the PFS and the resulting estimated daily intake (EDI) resulting from use of the PFS were quantified. Since most PFS

  7. Uma jornada histórica de Umberto Eco em busca da beleza

    Directory of Open Access Journals (Sweden)

    Elaine Cristina Senko

    2015-09-01

    Full Text Available Esta é uma resenha da importante obra de Umberto Eco "História da Beleza". ECO, Umberto. História da Beleza. Tradução de Eliana Aguiar. 3ª edição. Rio de Janeiro: Record, 2013, 438 p.

  8. NCBI nr-aa BLAST: CBRC-TTRU-01-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0045 ref|ZP_04874428.1| Cobalt transport protein [Aciduliprofundum boo...nei T469] gb|EDY35950.1| Cobalt transport protein [Aciduliprofundum boonei T469] ZP_04874428.1 0.084 27% ...

  9. agradecimento aos consultores ad hoc

    Directory of Open Access Journals (Sweden)

    REA Editor

    2012-02-01

    Full Text Available Agradecemos aos professores Nildo Viana (UFG e Flavio Sofiati (UFG, organizadores do DOSSIÊ JUVENTUDE & SOCIEDADE, e aos Consultores Ad hoc pela leitura e apreciação crítica dos artigos submetidos e publicados nesta edição.

  10. evaluation of growth of young coconut and nut yield of old coconut

    African Journals Online (AJOL)

    User

    nutrient status under coconut-cassava intercropping systems. Experiment I was ... farmer's income/ food security base and helps in weed control ... GenStat Discovery Edi- tion 3 statistical ..... nut, it did not impact on nut yield since it was not a limiting ... Evaluation of crop management options ... (1996). Manual on standard-.

  11. Determination and risk assessment of naturally occurring genotoxic and carcinogenic alkenylbenzenes in nutmeg-based plant food supplements

    NARCIS (Netherlands)

    Al-Malahmeh, Amer J.; Alajlouni, Abdul; Ning, Jia; Wesseling, Sebas; Vervoort, Jacques; Rietjens, Ivonne M.C.M.

    2017-01-01

    A risk assessment of nutmeg-based plant food supplements (PFS) containing different alkenylbenzenes was performed based on the alkenylbenzene levels quantified in a series of PFS collected via the online market. The estimated daily intake (EDI) of the alkenylbenzenes amounted to 0.3 to 312μg kg-1

  12. Identifying Effectiveness Criteria for Internet Payment Systems.

    Science.gov (United States)

    Shon, Tae-Hwan; Swatman, Paula M. C.

    1998-01-01

    Examines Internet payment systems (IPS): third-party, card, secure Web server, electronic token, financial electronic data interchange (EDI), and micropayment based. Reports the results of a Delphi survey of experts identifying and classifying IPS effectiveness criteria and classifying types of IPS providers. Includes the survey invitation letter…

  13. Ice-cream consumption, tendency toward overeating, and personality

    NARCIS (Netherlands)

    van Strien, T

    2000-01-01

    OBJECTIVE: The exploration of the mechanisms underlying the tendency toward overeating by investigating the Dutch Eating Behavior Questionnaire (DEBQ)/Revised Eating Disorders Inventory (EDI-R) disinhibition, in sequence to the milkshake-ice cream study (van Strien, Cleven, and Schippers, in press).

  14. Linkage of a Physically Based Distributed Watershed Model and a Dynamic Plant Growth Model

    Science.gov (United States)

    2006-12-01

    i.e., Universal Soil Loss Equation ( USLE ) factors, K, C, and P). The K, C, and P factors are empiri- cal coefficients with the same conceptual...with general ecosystem models designed to make long-term projections of ecosystem dynamics. This development effort investigated the linkage of soil ...20 EDYS soil module

  15. 76 FR 58040 - Certain Coaxial Cable Connectors and Components Thereof and Products Containing Same; Notice of...

    Science.gov (United States)

    2011-09-19

    ...://edis.usitc.gov . Hearing-impaired persons are advised that information on this matter can be obtained... Industry, Co., Ltd. and Gem Electronics, Inc. (``the active respondents''), remained active. On October 13... found infringement of the `257 patent by the defaulting respondents and no infringement by the active...

  16. Revolution through electronic purchasing

    NARCIS (Netherlands)

    Telgen, Jan; Lamming, R.C.; Grickus, I.

    1998-01-01

    Automation is finding its way in the world of purchasing. This development could evoke dramatic effects in the long term, not only on purchasing but even on the market place itself. Nowadays, EDI and CD-ROM are examples of automation applications that purchasing departments use frequently. Internet

  17. Optimization of operating conditions in the early direct injection premixed charge compression ignition regime

    NARCIS (Netherlands)

    Boot, M.D.; Luijten, C.C.M.; Rijk, E.P.; Albrecht, B.A.; Baert, R.S.G.

    2009-01-01

    Early Direct Injection Premixed Charge Compression Ignition (EDI PCCI) is a widely researched combustion concept, which promises soot and CO2 emission levels of a spark-ignition (SI) and compression-ignition (CI) engine, respectively. Application of this concept to a conventional CI engine using a

  18. Flux-gate magnetometer spin axis offset calibration using the electron drift instrument

    International Nuclear Information System (INIS)

    Plaschke, Ferdinand; Nakamura, Rumi; Baumjohann, Wolfgang; Steller, Manfred; Magnes, Werner; Leinweber, Hannes K; Chutter, Mark; Vaith, Hans

    2014-01-01

    Spin-stabilization of spacecraft immensely supports the in-flight calibration of on-board flux-gate magnetometers (FGMs). From 12 calibration parameters in total, 8 can be easily obtained by spectral analysis. From the remaining 4, the spin axis offset is known to be particularly variable. It is usually determined by analysis of Alfvénic fluctuations that are embedded in the solar wind. In the absence of solar wind observations, the spin axis offset may be obtained by comparison of FGM and electron drift instrument (EDI) measurements. The aim of our study is to develop methods that are readily usable for routine FGM spin axis offset calibration with EDI. This paper represents a major step forward in this direction. We improve an existing method to determine FGM spin axis offsets from EDI time-of-flight measurements by providing it with a comprehensive error analysis. In addition, we introduce a new, complementary method that uses EDI beam direction data instead of time-of-flight data. Using Cluster data, we show that both methods yield similarly accurate results, which are comparable yet more stable than those from a commonly used solar wind-based method. (paper)

  19. Formation of HgSe thin films using electrochemical atomic Layer epitaxy

    CSIR Research Space (South Africa)

    Mathe, MK

    2005-09-01

    Full Text Available . Bard and I. Rubenstein, Edi- tors, Vol. 21, p. 75, Marcel Dekker, New York �1999�. 38. J. L. Stickney, in Advances in Electrochemical Science and Engineering, D. M. Kolb and R. Alkire, Editors, Vol. 7, p. 1, Wiley-VCH, Weinheim �2002�. 39. S. Bedair...

  20. Psychological characteristics and associations with weight outcomes two years after gastric bypass surgery

    DEFF Research Database (Denmark)

    Beck, Nina N; Mehlsen, Mimi; Støving, René Klinkby

    2012-01-01

    (EDI-2), Harvard Anxiety and Depression Scale (HADS), and questions related specifically to binge eating. Forty-five patients (8 men, 37 women) out of 65 (67%) responded. Scores were significant higher on impulse regulation, interoceptive awareness, ineffectiveness, maturity fears and interpersonal...

  1. EDIÇÃO ESPECIAL: 10 ANOS DO PROGRAMA DE PÓS-GRADUAÇÃO EM GEOGRAFIA DA UNIVERSIDADE FEDERAL DO AMAZONAS.

    Directory of Open Access Journals (Sweden)

    João Cândido André da Silva Neto

    2018-04-01

    Full Text Available Prezados leitores e autores, a Revista Geonorte, do Departamento de Geografia e do Programa de Pós-Graduação em Geografia da Universidade Federal do Amazonas – UFAM, apresenta sua nova edição, de 10 ANOS DO PROGRAMA DE PÓS-GRADUAÇÃO EM GEOGRAFIA DA UNIVERSIDADE FEDERAL DO AMAZONAS.

  2. NOTA EDITORIAL: REVISTA GEONORTE VOLUME 8, NÚMERO.30, JUL. DEZ. 2017

    Directory of Open Access Journals (Sweden)

    João Cândido André da Silva Neto

    2017-12-01

    Full Text Available Prezados leitores e autores, a Revista Geonorte, do Departamento de Geografia e do Programa de Pós-Graduação em Geografia da Universidade Federal do Amazonas – UFAM, apresenta sua nova edição, Volume 8 Número 30, do 2° semestre de 2017.

  3. NOTA EDITORIAL: REVISTA GEONORTE VOLUME 8, NÚMERO.30, JUL. DEZ. 2017

    OpenAIRE

    João Cândido André da Silva Neto

    2017-01-01

    Prezados leitores e autores, a Revista Geonorte, do Departamento de Geografia e do Programa de Pós-Graduação em Geografia da Universidade Federal do Amazonas – UFAM, apresenta sua nova edição, Volume 8 Número 30, do 2° semestre de 2017.

  4. EDIÇÃO ESPECIAL: 10 ANOS DO PROGRAMA DE PÓS-GRADUAÇÃO EM GEOGRAFIA DA UNIVERSIDADE FEDERAL DO AMAZONAS.

    OpenAIRE

    João Cândido André da Silva Neto

    2018-01-01

    Prezados leitores e autores, a Revista Geonorte, do Departamento de Geografia e do Programa de Pós-Graduação em Geografia da Universidade Federal do Amazonas – UFAM, apresenta sua nova edição, de 10 ANOS DO PROGRAMA DE PÓS-GRADUAÇÃO EM GEOGRAFIA DA UNIVERSIDADE FEDERAL DO AMAZONAS.

  5. Catastrophe, Gender and Urban Experience, 1648–1920

    DEFF Research Database (Denmark)

    Employing a broad definition of catastrophe, this book examines how urban communities conceived, adapted to and were transformed by catastrophes. Competing views of gender figure in the telling and retelling of these trag- edies, which are mediated by myth and memory. This is a nuanced account...

  6. Elementos doi: 10.5007/1807-9288.2011v7n1p167

    Directory of Open Access Journals (Sweden)

    Francisco Carlos de Carvalho Marinho

    2011-01-01

    Full Text Available Encerrando a presente edição da revista Texto Digital, apresentamos a belíssima criação "Elementos" do prof. Dr. Chico Marinho, da Universidade Federal de Minas Gerais (UFMG. Para ter acesso ao arquivo, clique aqui.

  7. Sociocultural Attitudes and Symptoms of Bulimia: Evaluating the SATAQ with Diverse College Groups

    Science.gov (United States)

    Cashel, Mary Louise; Cunningham, Dana; Landeros, Clarinda; Cokley, Kevin O.; Muhammad, Grace

    2003-01-01

    This study evaluated the utility of the Sociocultural Attitudes Towards Appearance Questionnaire (SATAQ; L. J. Heinberg, J. K. Thompson, & S. Stormer, 1995) for the assessment of diverse college groups, including men, women, minorities, and sorority members. Scores from the SATAQ were compared with the Eating Disorder Inventory-2 (EDI-2; D. M.…

  8. 15 CFR 950.8 - Satellite Data Services Division (SDSD).

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Satellite Data Services Division (SDSD... THE ENVIRONMENTAL DATA SERVICE ENVIRONMENTAL DATA AND INFORMATION § 950.8 Satellite Data Services Division (SDSD). The Satellite Data Services Division of the EDIS National Climatic Center provides...

  9. 76 FR 76733 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2011-12-08

    ... point-of-sale. The EDI transmission occurs in real-time as the prescription transaction is made. The... appeal the decision. Once someone is enrolled, he or she may request approval for reimbursement of travel if the individual must travel more than 250 miles to receive healthcare services. Healthcare...

  10. A change of course: The importance to DoD of international standards for electronic commerce

    Science.gov (United States)

    Payne, Judith E.

    1991-12-01

    The U.S. Department of Defense (DoD) is committed to using electronic commerce in the future with the over 300,000 vendors interested in doing business with DoD. Electronic commerce will move DoD from a paper-based world to one based on electronic transactions enabled by the exchange of formatted, electronic messages referred to as electronic data interchange (EDI). With electronic commerce, DoD plans to reduce costs, increase effectiveness, and make it easier for vendors to deal with DoD. Benefits from electronic commerce are enhanced when many businesses use the same standards for EDI messages themselves and their transmission. The fewer standards used, the less time and resources must be spent translating messages and agreeing on how to use different standards. To enhance benefits and smooth the transition to electronic commerce for itself and its vendors, DoD has chosen to use the widely accepted American National Standards Institute (ANSI) X12 standards for EDI messages, coupled with international standards for delivering messages and organizing addresses. In the past 18 months, EDI standards sponsored by a United Nations body and serving the same purpose as ANSI X12 message standards have begun to gain wider acceptance internationally.

  11. Prospective pilot study of a tablet computer in an Emergency Department.

    Science.gov (United States)

    Horng, Steven; Goss, Foster R; Chen, Richard S; Nathanson, Larry A

    2012-05-01

    The recent availability of low-cost tablet computers can facilitate bedside information retrieval by clinicians. To evaluate the effect of physician tablet use in the Emergency Department. Prospective cohort study comparing physician workstation usage with and without a tablet. 55,000 visits/year Level 1 Emergency Department at a tertiary academic teaching hospital. 13 emergency physicians (7 Attendings, 4 EM3s, and 2 EM1s) worked a total of 168 scheduled shifts (130 without and 38 with tablets) during the study period. Physician use of a tablet computer while delivering direct patient care in the Emergency Department. The primary outcome measure was the time spent using the Emergency Department Information System (EDIS) at a computer workstation per shift. The secondary outcome measure was the number of EDIS logins at a computer workstation per shift. Clinician use of a tablet was associated with a 38min (17-59) decrease in time spent per shift using the EDIS at a computer workstation (pcomputer was associated with a reduction in the number of times physicians logged into a computer workstation and a reduction in the amount of time they spent there using the EDIS. The presumed benefit is that decreasing time at a computer workstation increases physician availability at the bedside. However, this association will require further investigation. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  12. Neighbourhood ethnic diversity buffers school readiness impact in ESL children.

    Science.gov (United States)

    Puchala, Chassidy; Vu, Lan T H; Muhajarine, Nazeem

    2010-01-01

    Contextual factors, as measured by neighbourhood characteristics, shape the experiences children have and affect their "school readiness", i.e., whether they are well or poorly prepared for the transition from home to kindergarten. This study assessed the independent effects of individual and neighbourhood factors on school readiness; specifically, it examined whether and to what degree neighbourhood factors modified children's language ability and thus their school readiness in a population of children in Saskatoon, Saskatchewan. The study included all children attending kindergarten in 2001, 2003 and 2005 in Saskatoon. School readiness and child characteristics were measured by the Early Development Instrument (EDI). The EDI measures child development at school commencement in five domains: physical health and well-being, social competence, emotional maturity, cognitive and language development, and communication skills and general knowledge. Data from the 2001 Census were used to characterize Saskatoon's neighbourhoods. Multilevel modeling examined the independent and buffering or exacerbating effects of individual and neighbourhood factors on the relation between English as a Second Language (ESL) status in children and EDI domain scores. ESL children had significantly lower scores on all EDI domains compared with non-ESL children. Certain factors (e.g., younger age, male, Aboriginal status, having special needs) were significantly related to lower readiness in terms of the emotional maturity, and communication skills and general knowledge domains. Importantly, children who lived in neighbourhoods that were highly transient (with a higher proportion of residents who had moved in the previous year) had lower EDI scores on both domains, and those in neighbourhoods with lower rates of employment had lower EDI scores on communication skills and general knowledge. Neighbourhood ethnic diversity mitigated the negative impact of ESL status on school readiness for both

  13. The emotion dysregulation inventory: Psychometric properties and item response theory calibration in an autism spectrum disorder sample.

    Science.gov (United States)

    Mazefsky, Carla A; Yu, Lan; White, Susan W; Siegel, Matthew; Pilkonis, Paul A

    2018-04-06

    Individuals with autism spectrum disorder (ASD) often present with prominent emotion dysregulation that requires treatment but can be difficult to measure. The Emotion Dysregulation Inventory (EDI) was created using methods developed by the Patient-Reported Outcomes Measurement Information System (PROMIS ® ) to capture observable indicators of poor emotion regulation. Caregivers of 1,755 youth with ASD completed 66 candidate EDI items, and the final 30 items were selected based on classical test theory and item response theory (IRT) analyses. The analyses identified two factors: (a) Reactivity, characterized by intense, rapidly escalating, sustained, and poorly regulated negative emotional reactions, and (b) Dysphoria, characterized by anhedonia, sadness, and nervousness. The final items did not show differential item functioning (DIF) based on gender, age, intellectual ability, or verbal ability. Because the final items were calibrated using IRT, even a small number of items offers high precision, minimizing respondent burden. IRT co-calibration of the EDI with related measures demonstrated its superiority in assessing the severity of emotion dysregulation with as few as seven items. Validity of the EDI was supported by expert review, its association with related constructs (e.g., anxiety and depression symptoms, aggression), higher scores in psychiatric inpatients with ASD compared to a community ASD sample, and demonstration of test-retest stability and sensitivity to change. In sum, the EDI provides an efficient and sensitive method to measure emotion dysregulation for clinical assessment, monitoring, and research in youth with ASD of any level of cognitive or verbal ability. Autism Res 2018. © 2018 International Society for Autism Research, Wiley Periodicals, Inc. This paper describes a new measure of poor emotional control called the Emotion Dysregulation Inventory (EDI). Caregivers of 1,755 youth with ASD completed candidate items, and advanced statistical

  14. Optimizing visualization in enhanced depth imaging OCT in healthy subjects and patients with retinal pigment epithelial detachment

    Directory of Open Access Journals (Sweden)

    Kampik A

    2012-11-01

    Full Text Available Lukas Reznicek, Efstathios Vounotrypidis, Florian Seidensticker, Karsten Kortuem, Anselm Kampik, Aljoscha S Neubauer, Armin WolfDepartment of Ophthalmology, Ludwig Maximilians University Muenchen, Munich, GermanyBackground: This study’s objective was to optimize the visualization of three different spectral-domain optical coherence tomography (SD-OCT display modalities and evaluate enhanced depth imaging (EDI by comparing the maximum depth of assessment in conventional versus inverted cross-sectional OCT images in healthy subjects and in patients with retinal pigment epithelial detachment (PED.Methods: Cross-sectional SD-OCT conventional and inverted images were obtained with the HRA2 (Heidelberg Retina Angiograph II, Heidelberg Engineering, Heidelberg, Germany. Horizontal as well as vertical sections in three different display modes were blinded for evaluation by three independent, experienced graders for maximal imaging depth of the deep ocular fundus layers.Results: The mean imaging depth as measured from the inner segment/outer segment (IS/OS to the outer choroid of all 14 healthy subjects was 197 ± 44 µm vs 263 ± 56 µm for conventional vs EDI scans: in black/white mode, it was significantly lower (P < 0.001 than in white/black mode (249 ± 42 µm vs 337 ± 71 µm and color/heat mode (254 ± 48 µm vs 354 ± 73 µm. The mean imaging depth of all 14 study eyes with PED was 240 ± 78 µm vs 345 ± 100 µm for conventional vs EDI scans in black/white mode, and was significantly lower (P < 0.001 than in white/black mode (393 ± 104 µm vs 464 ± 126 µm and in color/heat mode (373 ± 106 µm vs 453 ± 114 µm. In each display modality of healthy subjects and of patients with PED, EDI scans showed a significantly higher imaging depth than the corresponding conventional scans.Conclusion: White/black and color/heat modes allow increased imaging depth, compared to black/white mode using both conventional or EDI OCT scans in healthy subjects or

  15. Supply Chain adoption in Small and Medium-Sized Enterprises (SMEs)

    DEFF Research Database (Denmark)

    Juhl, Mathias Thim; Bernon, Mike

    Purpose: The importance of having a competitive supply chain strategy is not to be underestimated (Underwood & Agg 2012; Aronow et al. 2014). Despite the importance of creating strong supply chain capabilities, small and medium-sized enterprises (SMEs) find it difficult to implement supply chain...... and customer needs. Research Approach: An exploratory case study of five small and medium sized manufacturing companies was undertaken using in-depth interviews and business reports. Combined with relevant literature, the case study interviews provide basis for a discussion on the current adoption of supply...... needs and a low interaction in the supply chain, to having an “outside-in” perspective (Day & Moorman 2013) and development of capabilities that support long-term competitive advantage. The case studies revealed two significant factors to support consistency between supply chain capabilities...

  16. DECIPHERING THE FINEST IMPRINT OF GLACIAL EROSION: OBJECTIVE ANALYSIS OF STRIAE PATTERNS ON BEDROCK

    Directory of Open Access Journals (Sweden)

    Piet Stroeven

    2011-05-01

    Full Text Available The aim of this study is to compare the efficiency of different mathematical and statistical geometrical methods applied to characterise the orientation distribution of striae on bedrock for deciphering the finest imprint of glacial erosion. The involved methods include automatic image analysis techniques of Fast Fourier Transform (FFT, and the experimental investigations by means of Saltikov's directed secants analysis (rose of intersection densities, applied to digital and analogue images of the striae pattern, respectively. In addition, the experimental data were compared with the modelling results made on the basis of Underwood's concept of linear systems in a plane. The experimental and modelling approaches in the framework of stereology yield consistent results. These results reveal that stereological methods allow a reliable and efficient delineation of different families of glacial striae from a complex record imprinted in bedrock.

  17. Design of an elliptically bent refocus mirror for the MERLIN beamline at the advanced light source

    International Nuclear Information System (INIS)

    Kelez, Nicholas; Chuang, Yi-De; Smith-Baumann, Alexis; Franck, Keith; Duarte, R.; Lanzara, A.; Hasan, M.Z.; Dessau, D.S.; Chiang, T.C.; Shen, Z.-X.; Hussain, Zahid

    2007-01-01

    There is an increasing demand for well-focused beam with high quality imaging of the full field to further explore the potential of novel instruments. For beamlines operating at focal point, mechanical benders have often been used to shape the refocusing mirror into an ideal elliptical cylinder. Unfortunately, the limited number of couplings for these mechanisms requires specific substrate side-shaping, often calculated using beam bending theory [J.H. Underwood, Space Sci. Instrum. 3 (1977) 259; M. Howells et al., Opt. Eng. 39 (2000) 2748; T. Warwick et al., Document available at OSTI website: http://www.osti.gov/energycitations/servlets/purl/842557-JYZCS3/native/], to meet demanding figure requirements. Here, we use finite element analysis (FEA) to validate the side-shaping algorithm and then couple the output with SHADOW to evaluate mirror performance when an ideal ellipse is not achieved

  18. Stennis observes Women's History Month

    Science.gov (United States)

    2010-01-01

    NASA John C. Stennis Space Center employees observed Women's History Month on March 17 with a panel discussion that featured accomplished women of the facility. The gathering featured (l to r): Pam Covington, manager of the NASA Office of External Affairs at Stennis; Mary Jones, assistant chief of staff with the Navy Meterology & Oceanography Command; and Lauren Underwood, senior research scientist with Science Systems and Applications, Inc. In addition to the panel discussion, the Stennis Diversity Council and Patriot Technologies also hosted a pair of 'lunch-and-learn' sessions focused on women's issues and history. The luncheons featured videos on Sally Hemings, the slave widely recognized as the mistress of President Thomas Jefferson; and several mothers of U.S. presidents.

  19. NATO Advanced Research Workshop on Incommensurate Crystals, Liquid Crystals, and Quasi-Crystals

    CERN Document Server

    Clark, N

    1988-01-01

    In this NATO-sponsored Advanced Research Workshop we succeeded in bringing together approximately forty scientists working in the three main areas of structurally incommensurate materials: incommensurate crystals (primarily ferroelectric insulators), incommensurate liquid crystals, and metallic quasi-crystals. Although these three classes of materials are quite distinct, the commonality of the physics of the origin and descrip­ tion of these incommensurate structures is striking and evident in these proceedings. A measure of the success of this conference was the degree to which interaction among the three subgroups occurred; this was facili­ tated by approximately equal amounts of theory and experiment in the papers presented. We thank the University of Colorado for providing pleasant housing and conference facilities at a modest cost, and we are especially grate­ ful to Ann Underwood, who retyped all the manuscripts into camera-ready form. J. F. Scott Boulder, Colorado N. A. Clark v CONTENTS PART I: INCO...

  20. PERFORMANCE INDICES TO DESIGN A MULTICOMPONENT BATCH DISTILLATION COLUMN USING A SHORTCUT METHOD

    Directory of Open Access Journals (Sweden)

    A. Narvaes-Garcia

    2015-06-01

    Full Text Available AbstractIn this paper, three quality or performance indices (Luyben's capacity factor, total annual costs, and annual profit were applied for the design of a batch distillation column working at variable reflux. This work used the Fenske-Underwood-Gilliland short-cut method to solve a problem of four components (benzene, toluene, ethyl-benzene, and ortho-xylene that needed to be separated and purified to a mole fraction of 0.97 or better. The performance of the system was evaluated using distillation columns with 10, 20, 30, 40 and 50 theoretical stages with a boil-up vapor flow set at 100 kmol/h. It was found that the annual profit was the best quality index, while the best case for variable reflux was the column with 50 stages. It was confirmed that the best case always required a reflux ratio close to the minimum.

  1. THE REST-FRAME OPTICAL LUMINOSITY FUNCTION OF CLUSTER GALAXIES AT z < 0.8 AND THE ASSEMBLY OF THE CLUSTER RED SEQUENCE

    International Nuclear Information System (INIS)

    Rudnick, Gregory; Von der Linden, Anja; De Lucia, Gabriella; White, Simon; Pello, Roser; Aragon-Salamanca, Alfonso; Marchesini, Danilo; Clowe, Douglas; Halliday, Claire; Jablonka, Pascale; Milvang-Jensen, Bo; Poggianti, Bianca; Saglia, Roberto; Simard, Luc; Zaritsky, Dennis

    2009-01-01

    We present the rest-frame optical luminosity function (LF) of red-sequence galaxies in 16 clusters at 0.4 < z < 0.8 drawn from the ESO Distant Cluster Survey (EDisCS). We compare our clusters to an analogous sample from the Sloan Digital Sky Survey (SDSS) and match the EDisCS clusters to their most likely descendants. We measure all LFs down to M ∼ M * + (2.5-3.5). At z < 0.8, the bright end of the LF is consistent with passive evolution but there is a significant buildup of the faint end of the red sequence toward lower redshift. There is a weak dependence of the LF on cluster velocity dispersion for EDisCS but no such dependence for the SDSS clusters. We find tentative evidence that red-sequence galaxies brighter than a threshold magnitude are already in place, and that this threshold evolves to fainter magnitudes toward lower redshifts. We compare the EDisCS LFs with the LF of coeval red-sequence galaxies in the field and find that the bright end of the LFs agree. However, relative to the number of bright red galaxies, the field has more faint red galaxies than clusters at 0.6 < z < 0.8 but fewer at 0.4 < z < 0.6, implying differential evolution. We compare the total light in the EDisCS cluster red sequences to the total red-sequence light in our SDSS cluster sample. Clusters at 0.4 < z < 0.8 must increase their luminosity on the red sequence (and therefore stellar mass in red galaxies) by a factor of 1-3 by z = 0. The necessary processes that add mass to the red sequence in clusters predict local clusters that are overluminous as compared to those observed in the SDSS. The predicted cluster luminosities can be reconciled with observed local cluster luminosities by combining multiple previously known effects.

  2. Choroidal vasculature characteristics based choroid segmentation for enhanced depth imaging optical coherence tomography images

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Qiang; Niu, Sijie [School of Computer Science and Engineering, Nanjing University of Science and Technology, Nanjing 210094 (China); Yuan, Songtao; Fan, Wen, E-mail: fanwen1029@163.com; Liu, Qinghuai [Department of Ophthalmology, The First Affiliated Hospital with Nanjing Medical University, Nanjing 210029 (China)

    2016-04-15

    Purpose: In clinical research, it is important to measure choroidal thickness when eyes are affected by various diseases. The main purpose is to automatically segment choroid for enhanced depth imaging optical coherence tomography (EDI-OCT) images with five B-scans averaging. Methods: The authors present an automated choroid segmentation method based on choroidal vasculature characteristics for EDI-OCT images with five B-scans averaging. By considering the large vascular of the Haller’s layer neighbor with the choroid-sclera junction (CSJ), the authors measured the intensity ascending distance and a maximum intensity image in the axial direction from a smoothed and normalized EDI-OCT image. Then, based on generated choroidal vessel image, the authors constructed the CSJ cost and constrain the CSJ search neighborhood. Finally, graph search with smooth constraints was utilized to obtain the CSJ boundary. Results: Experimental results with 49 images from 10 eyes in 8 normal persons and 270 images from 57 eyes in 44 patients with several stages of diabetic retinopathy and age-related macular degeneration demonstrate that the proposed method can accurately segment the choroid of EDI-OCT images with five B-scans averaging. The mean choroid thickness difference and overlap ratio between the authors’ proposed method and manual segmentation drawn by experts were −11.43 μm and 86.29%, respectively. Conclusions: Good performance was achieved for normal and pathologic eyes, which proves that the authors’ method is effective for the automated choroid segmentation of the EDI-OCT images with five B-scans averaging.

  3. Choroidal vasculature characteristics based choroid segmentation for enhanced depth imaging optical coherence tomography images

    International Nuclear Information System (INIS)

    Chen, Qiang; Niu, Sijie; Yuan, Songtao; Fan, Wen; Liu, Qinghuai

    2016-01-01

    Purpose: In clinical research, it is important to measure choroidal thickness when eyes are affected by various diseases. The main purpose is to automatically segment choroid for enhanced depth imaging optical coherence tomography (EDI-OCT) images with five B-scans averaging. Methods: The authors present an automated choroid segmentation method based on choroidal vasculature characteristics for EDI-OCT images with five B-scans averaging. By considering the large vascular of the Haller’s layer neighbor with the choroid-sclera junction (CSJ), the authors measured the intensity ascending distance and a maximum intensity image in the axial direction from a smoothed and normalized EDI-OCT image. Then, based on generated choroidal vessel image, the authors constructed the CSJ cost and constrain the CSJ search neighborhood. Finally, graph search with smooth constraints was utilized to obtain the CSJ boundary. Results: Experimental results with 49 images from 10 eyes in 8 normal persons and 270 images from 57 eyes in 44 patients with several stages of diabetic retinopathy and age-related macular degeneration demonstrate that the proposed method can accurately segment the choroid of EDI-OCT images with five B-scans averaging. The mean choroid thickness difference and overlap ratio between the authors’ proposed method and manual segmentation drawn by experts were −11.43 μm and 86.29%, respectively. Conclusions: Good performance was achieved for normal and pathologic eyes, which proves that the authors’ method is effective for the automated choroid segmentation of the EDI-OCT images with five B-scans averaging.

  4. Drought over Seoul and Its Association with Solar Cycles

    Directory of Open Access Journals (Sweden)

    Jong-Hyeok Park

    2013-12-01

    Full Text Available We have investigated drought periodicities occurred in Seoul to find out any indication of relationship between drought in Korea and solar activities. It is motivated, in view of solar-terrestrial connection, to search for an example of extreme weather condition controlled by solar activity. The periodicity of drought in Seoul has been re-examined using the wavelet transform technique as the consensus is not achieved yet. The reason we have chosen Seoul is because daily precipitation was recorded for longer than 200 years, which meets our requirement that analyses of drought frequency demand long-term historical data to ensure reliable estimates. We have examined three types of time series of the Effective Drought Index (EDI. We have directly analyzed EDI time series in the first place. And we have constructed and analyzed time series of histogram in which the number of days whose EDI is less than -1.5 for a given month of the year is given as a function of time, and one in which the number of occasions where EDI values of three consecutive days are all less than -1.5 is given as a function of time. All the time series data sets we analyzed are periodic. Apart from the annual cycle due to seasonal variations, periodicities shorter than the 11 year sunspot cycle, ~ 3, ~ 4, ~ 6 years, have been confirmed. Periodicities to which theses short periodicities (shorter than Hale period may be corresponding are not yet known. Longer periodicities possibly related to Gleissberg cycles, ~ 55, ~ 120 years, can be also seen. However, periodicity comparable to the 11 year solar cycle seems absent in both EDI and the constructed data sets.

  5. Pratiques, objets et finalités de collaboration en lien avec l’intégration des tablettes numériques dans une école secondaire | Practices, Objects and Collaboration Purposes Related to the Integration of Digital Tablets in a High School

    Directory of Open Access Journals (Sweden)

    Nadia Cody

    2016-08-01

    Full Text Available Bien que les technologies de l’information et de la communication (TIC occupent une place de plus en plus prépondérante, tant au sein de la société que de l’école (Anderson, 2010, on remarque que leur intégration en contexte scolaire représente encore un défi de taille (Underwood et Dillon, 2011. Selon certains auteurs (Portelance, 2011; Desgagné, 1997, la collaboration constituerait un vecteur pour transformer les pratiques éducatives. Comment la collaboration peut-elle contribuer à ce changement que représente l’intégration des TIC? Les résultats d’une recherche-action, menée depuis trois ans de concert avec une école secondaire ayant pour objectif d’intégrer la tablette numérique, permet de mettre en lumière des pratiques, des objets et des finalités de collaboration qui ont émergé entre les différents acteurs, favorisant ainsi l’implantation de cet outil technologique. Although Information and Communication Technologies (ICT play an increasingly predominant role (Anderson, 2010, their integration in school context is still a challenge (Underwood and Dillon, 2011. According to Portelance (2011 and Desgagné (1997, collaboration is one vector that can be used to transform educational practices. How can collaboration contribute to the ICT integration process into our schools? The results of an action research, conducted for three years along with a high school that aims to integrate digital tablet, allows to highlighting practices, objects and collaboration purposes that emerged between actors, therefore facilitating the implementation of this technological tool.

  6. Logo do cabeçalho da página SCIENTIFIC ELECTRONIC ARCHIVES OPEN JOURNAL SYSTEMS Ajuda do sistema USUÁRIO Login RAF Senha •••••• Lembrar usuário Acesso NOTIFICAÇÕES Visualizar Assinar IDIOMA Selecione o idiomaSubmeter CONTEÚDO DA REVISTA Pesquisa Escopo da Busca Pesquisar Procurar Por Edição Por Autor Por título TAMANHO DE FONTE Make font size smallerMake font size defaultMake font size larger INFORMAÇÕES Para leitores Para Autores Para Bibliotecários CAPA SOBRE ACESSO CADASTRO PESQUISA ATUAL ANTERIORES NOTÍCIAS Capa > v. 10, n. 5 (2017 >\tPaixão KORFBALL AT SCHOOL: A PROPOSAL FOR PEDAGOGICAL PRACTICES IN A GRADUATION COURSE OF PHYSICAL EDUCATION

    Directory of Open Access Journals (Sweden)

    J. A. Paixão

    2017-10-01

    Full Text Available This article aims to report a proposal of educational practices experienced by students of the graduation course of Physical Education, linked to the Programa Institucional de Bolsa de Iniciação à Docência of the Federal University of Viçosa, in a public school in Viçosa, MG. In addition to the joint theory and practice, the collective planning adopted by the working group, led numerous possibilities in the development of educational and pedagogical aspects of content korfball at school. Above all, it is an experience that provided an opportunity to expand the academic comprehensive outlook of the teaching activity through analysis, discussion, action and reflection grounded in the field of Didactic and Methodology of Teaching Physical Education

  7. Cabeçalho da página OPEN JOURNAL SYSTEMS Ajuda do sistema USUÁRIO Login Senha Lembrar usuário Acesso NOTIFICAÇÕES Visualizar Assinar / Cancelar assinatura de notificações IDIOMA CONTEÚDO DA REVISTA Pesquisa Pesquisar Procurar Por Edição Por Autor Por título Outras revistas TAMANHO DE FONTE Make font size smallerMake font size defaultMake font size larger INFORMAÇÕES Para leitores Para Autores Para Bibliotecários CAPA SOBRE ACESSO CADASTRO PESQUISA ATUAL ANTERIORES NOTÍCIAS Capa > v. 1, n. 1 (2015 >\tSantos Empreendimento de economia solidária: Uma análise da autogestão coletiva / Venture solidarity economy: An analysis of collective self-management

    Directory of Open Access Journals (Sweden)

    Luciane Cristina Ribeiro dos Santos

    2017-06-01

    Full Text Available Com o predomínio na sociedade de um modelo socioeconômico baseado no capitalismo neoliberal, novas experiências vêm se desenvolvendo no interior de algumas comunidades como alternativas a esse contexto. O Clube de Trocas da Amizade, concebido em 2003 pelo hoje denominado Centro Educacional Marista Curitiba, como parte da Rede Pinhão de Clubes de Troca, consiste em um empreendimento de Economia Solidária, que permite visualizar diferentes manifestações de uma proposta ainda incipiente. Este estudo busca analisar a partir das questões relacionadas à Ecossocioeconomia Urbana, Economia Solidária e às Políticas Públicas o papel do Clube de Trocas da Amizade enquanto proposta de organização social. A pesquisa apresentou caráter qualitativo-descritivo, baseado em método analítico-exploratório. Entre os resultados obtidos, verificou-se que soluções práticas, no caso do Clube de Trocas da Amizade, possibilitavam não só o provimento da subsistência de seus participantes, como também o incentivo à criatividade, à educação, ao convívio social, à valorização de tais pessoas e o aumento de sua autoestima. Acredita-se que a promoção desse tipo de iniciativa em nível comunitário tanto urbano quanto rural, considerando-se suas particularidades, poderia desenvolver atividades mais integradoras entre os seus moradores, das quais um maior número de cooperativas poderiam se beneficiar, conforme os princípios da Economia Solidária.

  8. Human exposure to per- and polyfluoroalkyl substances (PFASs) via house dust in Korea: Implication to exposure pathway.

    Science.gov (United States)

    Tian, Zhexi; Kim, Seung-Kyu; Shoeib, Mahiba; Oh, Jeong-Eun; Park, Jong-Eun

    2016-05-15

    A wide range of per- and polyfluoroalkyl substances (PFASs), including fluorotelomer alcohols (FTOHs), perfluorooctane sulfonamidoethanols (FOSEs), perfluoroalkyl carboxylic acids (PFCAs), and perfluoroalkane sulfonic acids (PFSAs), were measured in fifteen house dust and two nonresidential indoor dust of Korea. Total concentrations of PFASs in house dust ranged from 29.9 to 97.6 ng g(-1), with a dominance of perfluorooctane sulfonic acid (PFOS), followed by 8:2 FTOH, N-Ethyl perfluorooctane sulfonamidoethanol (EtFOSE), perfluoroctanoic acid (PFOA). In a typical exposure scenario, the estimated daily intakes (EDIs) of total PFASs via house dust ingestion were 2.83 ng d(-1) for toddlers and 1.13 ng d(-1) for adults, which were within the range of the mean EDIs reported from several countries. For PFOA and PFOS exposure via house dust ingestion, indirect exposure (via precursors) was a minor contributor, accounting for 5% and 12%, respectively. An aggregated exposure (hereafter, overall-EDIs) of PFOA and PFOS occurring via all pathways, estimated using data compiled from the literature, were 53.6 and 14.8 ng d(-1) for toddlers, and 20.5 and 40.6 ng d(-1) for adults, respectively, in a typical scenario. These overall-EDIs corresponded to 82% (PFOA) and 92% (PFOS) of a pharmacokinetic model-based EDIs estimated from adults' serum data. Direct dietary exposure was a major contributor (>89% of overall-EDI) to PFOS in both toddlers and adults, and PFOA in toddlers. As for PFOA exposure of adults, however direct exposure via tap water drinking (37%) and indirect exposure via inhalation (22%) were as important as direct dietary exposure (41%). House dust-ingested exposure (direct+indirect) was responsible for 5% (PFOS in toddlers) and house-dust ingestion was a minor contributor in this study, but should not be ignored for toddlers' PFOS exposure due to its significance in the worst-case scenario. Copyright © 2016 Elsevier B.V. All rights reserved.

  9. Analysis of Hydrogen/Air Turbulent Premixed Flames at Different Karlovitz Numbers Using Computational Singular Perturbation

    KAUST Repository

    Manias, Dimitrios; Tingas, Alexandros-Efstathios; Hernandez Perez, Francisco E.; Im, Hong G.; Galassi, Riccardo Malpica; Ciottoli, Pietro Paolo; Valorani, Mauro

    2018-01-01

    The dynamics and structure of two turbulent H2/air premixed flames, representative of the corrugated flamelet (Case 1) and thin reaction zone (Case 2) regimes, are analyzed and compared, using the computational singular perturbation (CSP) tools

  10. Foucault, Derrida e a História da Loucura: notas sobre uma polêmica

    OpenAIRE

    André de Faria Pereira Neto

    1998-01-01

    A publicação do livro Folie et Déraison. Histoire de la Folie à l'âge Classique (1961), de Michel Foucault, promoveu um debate entre o autor e o filósofo Jacques Derrida, durante os anos 60/70. Derrida criticou a proposta metodológica e a organização da História da Loucura, apresentadas por Foucault, no prefácio da primeira edição. Essa polêmica parece ter motivado o autor a retirar, da segunda edição, o prefácio que abria a primeira versão do livro. O objetivo deste artigo é analisar alguns ...

  11. Uma lição vinda da África do Sul: os cartéis da construção estão aumentando significativamente os custos de infraestrutura da copa do mundo FIFA 2014 no Brasil?

    Directory of Open Access Journals (Sweden)

    Eddie Cottle

    2013-11-01

    Full Text Available http://dx.doi.org/10.5007/2175-8042.2013v25n41p166 O artigo é o resultado da parceria acadêmica entre IELA / UFSC - Instituto de Estudos Latino-Americanos  e Edie Cottle, um pesquisador Sul-Africano, autor de artigos críticos sobre os impactos da Copa do Mundo da FIFA de 2010 na vida da população daquele país. A metodologia utilizada na pesquisa é a desenvolvida pelo pesquisador Edie Cottle e o estudo tem como objetivo revelar os verdadeiros custos e possíveis superfaturamentos na construção de arenas brasileiras que receberão os jogos da Copa do Mundo 2014.

  12. Multimodal Ultrawide-Field Imaging Features in Waardenburg Syndrome.

    Science.gov (United States)

    Choudhry, Netan; Rao, Rajesh C

    2015-06-01

    A 45-year-old woman was referred for bilateral irregular fundus pigmentation. Dilated fundus examination revealed irregular hypopigmentation posterior to the equator in both eyes, confirmed by fundus autofluorescence. A thickened choroid was seen on enhanced-depth imaging spectral-domain optical coherence tomography (EDI SD-OCT). Systemic evaluation revealed sensorineural deafness, telecanthus, and a white forelock. Further investigation revealed a first-degree relative with Waardenburg syndrome. Waardenburg syndrome is characterized by a group of features including telecanthus, a broad nasal root, synophrys of the eyebrows, piedbaldism, heterochromia irides, and deafness. Choroidal hypopigmentation is a unique feature that can be visualized with ultrawide-field fundus autofluorescence. The choroid may also be thickened and its thickness measured with EDI SD-OCT. Copyright 2015, SLACK Incorporated.

  13. The association between sports participation and athletic identity with eating pathology among college-aged males and females.

    Science.gov (United States)

    Fay, K; Economos, C; Lerner, R M; Becker, A E; Sacheck, J

    2011-06-01

    The current study examined associations among sports participation (SP), athletic identity (AI), weight status, and eating pathology, and whether these relations differed by gender. Data come from male and female first-year college students who participated in the Tufts Longitudinal Health Study (TLHS) between 1999-2007 (N=712). Relations among SP, AI, actual and perceived weight statuses, Eating Disorders Inventory (EDI) subscale scores, and indices of body shape concern and restrictive eating were examined with hierarchical ordinary least squares (OLS) regression. Associations between SP and eating pathology among females were moderated by perceived weight status. By contrast, relations between males' EDI subscales scores and SP were moderated by ethnicity, as well as by actual weight status. Our findings support that sports participation alone neither promotes nor protects against eating pathology among males and females.

  14. Internet-based data interchange with XML

    Science.gov (United States)

    Fuerst, Karl; Schmidt, Thomas

    2000-12-01

    In this paper, a complete concept for Internet Electronic Data Interchange (EDI) - a well-known buzzword in the area of logistics and supply chain management to enable the automation of the interactions between companies and their partners - using XML (eXtensible Markup Language) will be proposed. This approach is based on Internet and XML, because the implementation of traditional EDI (e.g. EDIFACT, ANSI X.12) is mostly too costly for small and medium sized enterprises, which want to integrate their suppliers and customers in a supply chain. The paper will also present the results of the implementation of a prototype for such a system, which has been developed for an industrial partner to improve the current situation of parts delivery. The main functions of this system are an early warning system to detect problems during the parts delivery process as early as possible, and a transport following system to pursue the transportation.

  15. E-Commerce in Ports

    Directory of Open Access Journals (Sweden)

    Elen Twrdy

    2002-01-01

    Full Text Available EDI (Electronic Data Interchange and electronic businessshould be looked upon as a natural evolution in the internationaltrade and transport cycle. One of the principal reasonsfor starting to use EDI are the heaps of documents written,shifted, handled, conected, transcribed and copied for normalbusiness and administrative transactions. EDJ and in generalelectronic business would have none of the disadvantages ofpaper documents and have already brought substantial benefitsand savings to companies that implement it.Most port community systems today still do not provide forelectronic transfer of funds or for electronic interchange of invoicesand other trade documents, for instance bills of lading.Such services are specific toe-business and they are the necessarytransport-related documents.

  16. Employee-driven innovation

    DEFF Research Database (Denmark)

    Kesting, Peter; Ulhøi, John Parm

    2015-01-01

    Purpose – The purpose of this paper is to outline the “grand structure” of the phenomenon in order to identify both the underlying processes and core drivers of employee-driven innovation (EDI). Design/methodology/approach – This is a conceptual paper. It particularly applies the insights...... of contemporary research on routine and organizational decision making to the specific case of EDI. Findings – The main result of the paper is that, from a theoretical point of view, it makes perfect sense to involve ordinary employees in innovation decisions. However, it is also outlined that naıve or ungoverned...... participation is counterproductive, and that it is quite difficult to realize the hidden potential in a supportive way. Research limitations/implications – The main implication is that basic mechanisms for employee participation also apply to innovation decisions, although often in a different way. However...

  17. Communication security in open health care networks.

    Science.gov (United States)

    Blobel, B; Pharow, P; Engel, K; Spiegel, V; Krohn, R

    1999-01-01

    Fulfilling the shared care paradigm, health care networks providing open systems' interoperability in health care are needed. Such communicating and co-operating health information systems, dealing with sensitive personal medical information across organisational, regional, national or even international boundaries, require appropriate security solutions. Based on the generic security model, within the European MEDSEC project an open approach for secure EDI like HL7, EDIFACT, XDT or XML has been developed. The consideration includes both securing the message in an unsecure network and the transport of the unprotected information via secure channels (SSL, TLS etc.). Regarding EDI, an open and widely usable security solution has been specified and practically implemented for the examples of secure mailing and secure file transfer (FTP) via wrapping the sensitive information expressed by the corresponding protocols. The results are currently prepared for standardisation.

  18. Effect of Reduced Meal Frequency during Ramadan Fasting on Retinal and Choroidal Thickness.

    Science.gov (United States)

    Ersan, Ismail; Tufan, Hasan Ali; Arikan, Sedat; Kara, Selcuk; Gencer, Baran; Hondur, Ahmet Murat

    2017-01-01

    To evaluate the effects of Ramadan fasting on central foveal thickness (CFT) and subfoveal choroidal thickness (SFCT) in healthy individuals using enhanced depth imaging optical coherence tomography (EDI-OCT). The EDI-OCT scans of 42 healthy individuals obtained after about 12 hours of fasting on at least the twenty-first consecutive day of fasting were compared to scans of the same patients taken one month after the last day they had fasted. CFT values were similar for both time periods (p > 0.05). The SFCT was significantly higher after consecutive fasting days towards the end of Ramadan, compared to the SFCT after one month of no fasting (one month after Ramadan ended) (p Ramadan fasting may lead to a significant increase in subfoveal choroidal thickness without affecting the central foveal thickness.

  19. «Recetario de cocina mexicana»: edición semidiplomática y modernizada de un manuscrito inédito del siglo XIX

    OpenAIRE

    Susana Echeverría Echeverría

    2010-01-01

    Resumo: Neste trabalho apresentam-se amostras de edição semidiplomática e modernizada do texto manuscrito inédito intitulado Recetario de cocina mexicana (Mss/23133/15), ca. 1850, que se guarda na Biblioteca Nacional de España, em Madri. Para terminar, acrescenta-se um comentário linguístico sobre alguns aspectos destacáveis do recetuário. Palavras-chave: Crítica textual; edição; manuscrito; cozinha mexicana; século XIX.  Resumen: En este trabajo se presentan muestras de edición semidiplomáti...

  20. The Exchange Data Communication System based on Centralized Database for the Meat Industry

    Science.gov (United States)

    Kobayashi, Yuichi; Taniguchi, Yoji; Terada, Shuji; Komoda, Norihisa

    We propose applying the EDI system that is based on centralized database and supports conversion of code data to the meat industry. This system makes it possible to share exchange data on beef between enterprises from producers to retailers by using Web EDI technology. In order to efficiently convert code direct conversion of a sender's code to a receiver's code using a code map is used. This system that mounted this function has been implemented in September 2004. Twelve enterprises including retailers, and processing traders, and wholesalers were using the system as of June 2005. In this system, the number of code maps relevant to the introductory cost of the code conversion function was lower than the theoretical value and were close to the case that a standard code is mediated.

  1. Diseño de un modelo de supervisión para la aplicación de la prueba de Evaluación del Desarrollo Infantil en las unidades de atención primaria en México

    OpenAIRE

    Villasís-Keever, Miguel Ángel; Rizzoli-Córdoba, Antonio; Delgado-Ginebra, Ismael; Mares-Serratos, Blanca Berenice; Martell-Valdez, Liliana; Sánchez-Velázquez, Olivia; Reyes-Morales, Hortensia; O'Shea-Cuevas, Gabriel; Aceves-Villagrán, Daniel; Carrasco-Mendoza, Joaquín; Antillón-Ocampo, Fátima Adriana; Villagrán-Muñoz, Víctor Manuel; Halley-Castillo, Elizabeth; Baqueiro-Hernández, César Iván; Pizarro-Castellanos, Mariel

    2015-01-01

    Introducción: La prueba Evaluación del Desarrollo Infantil (EDI), diseñada y validada en México, se ha aplicado en las unidades de atención primaria del país. Los resultados han sido heterogéneos entre los estados en que se aplicaron las pruebas, a pesar de haber utilizado un modelo de capacitación estandarizado con la misma metodología para la aplicación. El objetivo de este trabajo fue evaluar un modelo de supervisión que permita identificar la calidad de la aplicación de la prueba EDI a ni...

  2. Para uma (re)leitura das Anotações sobre as cores de Wittgenstein

    OpenAIRE

    Salles, João Carlos

    2017-01-01

    As Anotações sobre as cores não têm tido o destaque merecido, pois parecem um conjunto parcialmente amorfo e desconexo, com precária estrutura de conjunto. Isso se deve, em grande medida, ao estado da edição dos textos realizada por G. E. M. Anscombe, que despreza variantes, faz sugestões equivocadas para a datação dos manuscritos, suprime parágrafos (inclusive uma quarta parte), além de ter desfigurado a Parte II, ordenando equivocadamente esses parágrafos. Uma edição bem cuidadaé necessária...

  3. Effectiveness of individualized, integrative outpatient treatment for females with anorexia nervosa and bulimia nervosa.

    Science.gov (United States)

    Freudenberg, Cara; Jones, Rebecca A; Livingston, Genvieve; Goetsch, Virginia; Schaffner, Angela; Buchanan, Linda

    2016-01-01

    The effectiveness of an individualized outpatient program was investigated in the treatment of bulimia nervosa (BN) and anorexia nervosa (AN). Participants included 151 females who received outpatient eating disorder treatment in the partial hospitalization program, the intensive outpatient program, or a combination of the two programs. Outcome measures included the Eating Disorder Inventory (EDI-2), Beck Depression Inventory (BDI-II), frequency of binge eating and purging, and mean body weight. Findings included significant increases in weight for the AN group, reductions in binge eating frequency for the BN group, and reductions in EDI-2 and BDI-II scores and purging frequency for both groups. This study provides preliminary support for the efficacy of a multimodal program for the treatment of both anorexia nervosa and bulimia nervosa.

  4. Selecionar é preciso, avaliar é fundamental: acervos de literatura para jovens leitores = If selecting is necessary, assessment is essential: collections of literature for young readers

    Directory of Open Access Journals (Sweden)

    Paiva, Aparecida

    2012-01-01

    Full Text Available O trabalho analisa três edições do Programa Nacional Biblioteca da Escola (PNBE tomando como ponto de partida a avaliação pedagógica realizada pelo Centro de Alfabetização, Leitura e Escrita (CEALE da Faculdade de Educação da UFMG. O objetivo é refletir sobre a produção editorial destinada ao público juvenil, a partir dos acervos destinados aos jovens, tanto dos anos finais do Ensino Fundamental quanto os do Ensino Médio, nas edições do PNBE destinadas a esses segmentos, nos anos de 2006, 2009 e 2011. Neste texto, apresentamos ao debate nossa maior inquietação: a possível distância entre a composição dos acervos e a apropriação efetiva dos mesmos pelos jovens

  5. Inteligência Humana: Investigações e Aplicações

    OpenAIRE

    Candeias, Adelinda Maria; Almeida, Leandro Silva

    2007-01-01

    Este livro reúne contributos teóricos, empíricos e práticos em torno de uma das variáveis mais relevantes e mais polémicas no seio da psicologia – a Inteligência –, estando a sua edição na sequência da realização, na Universidade de Évora (6-8 de Outubro, 2005) do I Simpósio Internacional “Inteligência Humana: Investigação e Aplicações”. Nesta primeira edição, o Congresso reportou-se a autores de Portugal, Espanha e Brasil, devendo este espectro alargar-se nas suas futura...

  6. Heavy metal contamination in the muscle of Aegean chub (Squalius fellowesii) and potential risk assessment.

    Science.gov (United States)

    Şaşi, Hüseyin; Yozukmaz, Aykut; Yabanli, Murat

    2018-03-01

    Especially after the industrial revolution, the amount of contaminants released in aquatic ecosystems has considerably increased. For this reason, the necessity to carry on research on the existence of contaminants, specifically heavy metals, has emerged. In this study, heavy metal concentrations in muscle tissues of Aegean chub, which was an endemic species of south western part of Turkey, gathered from Tersakan River were examined. Heavy metal concentrations of the samples were analyzed with ICP-MS. Estimated daily intakes (EDI), target hazard quotient (THQ), and carcinogenic risk (CR) of elements were calculated. The heavy metals detected in muscle tissues were Zn > Cu > Cr > Mn > Pb > Cd, consecutively. According to the results of the applied health risk assessment (EDI, THQ and CR) for heavy metal exposure from fish consumption in children and adults, it was determined that there was no any significant threat to human health.

  7. Shaggy Photoreceptors with Subfoveal Fluid Associated with a Distant Choroidal Melanoma

    Directory of Open Access Journals (Sweden)

    Ann Q. Tran

    2015-01-01

    Full Text Available Purpose. To describe the enhanced depth imaging optical coherence tomography (EDI-OCT findings in a patient with an extra macula choroidal melanoma before and after treatment. Methods. Observational case report. Results. A 45 year-old Caucasian male patient was referred to retina clinic for management of choroidal melanoma. Examination revealed a nasal choroidal melanoma while EDI-OCT illustrated subfoveal fluid pocket with elongated shaggy photoreceptors distant and separate from the tumor. The patient was treated with plaque brachytherapy and intravitreal bevacizumab. One week after plaque removal, there was a dramatic reduction in the shaggy photoreceptors. Conclusion. Choroidal melanomas have effects that are not localized to the area of the tumor. This loculated pocket of subretinal fluid and coinciding changes to photoreceptor morphology may be related to global changes in choroidal function or release of tumor related cytokines.

  8. Breakdown assisted by a novel electron drift injection in the J-TEXT tokamak

    International Nuclear Information System (INIS)

    Wang, Nengchao; Jin, Hai; Zhuang, Ge; Ding, Yonghua; Pan, Yuan; Cen, Yishun; Chen, Zhipeng; Huang, Hai; Liu, Dequan; Rao, Bo; Zhang, Ming; Zou, Bichen

    2014-01-01

    A novel electron drift injection (EDI) system aiming to improve breakdown behavior has been designed and constructed on the Joint Texas EXperiment Tokamak Tokamak. Electrons emitted by the system undergo the E×B drift, ∇B drift and curvature drift in sequence in order to traverse the confining magnetic field. A local electrostatic well, generated by a concave-shaped plate biased more negative than the cathode, is introduced to interrupt the emitted electrons moving along the magnetic field line (in the parallel direction) in an attempt to bring an enhancement of the injection efficiency and depth. A series of experiments have demonstrated the feasibility of this method, and a penetration distance deeper than 9.5 cm is achieved. Notable breakdown improvements, including the reduction of breakdown delay and average loop voltage, are observed for discharges assisted by EDI. The lower limit of successfully ionized pressure is expanded

  9. Effect of Yoga in the Treatment of Eating Disorders: A Single-blinded Randomized Controlled Trial with 6-Months Follow-up.

    Science.gov (United States)

    Karlsen, Kari Ebbesen; Vrabel, Karianne; Bratland-Sanda, Solfrid; Ulleberg, Pål; Benum, Kirsten

    2018-01-01

    The aim of this study is to examine the effect of yoga treatment of eating disorders (EDs). Adult females meeting the Diagnostic and Statistical Manual-IV criteria for bulimia nervosa or ED not otherwise specified ( n = 30) were randomized to 11-week yoga intervention group (2 × 90 min/week) or a control group. Outcome measures, the Eating Disorder Examination (EDE)-Interview and Eating Disorders Inventory-2 (EDI-2) scores, were administered at baseline, posttest, and at 6-month follow-up. There was a dropout rate of 30% (posttest) and 37% (6-month follow-up). The intervention group showed reductions in EDE global score ( P control group. The differences between the groups increased at 6-month follow-up. There were no differences between the groups in the EDI-2 score. The results indicate that yoga could be effective in the treatment of ED.

  10. Shipping Information Pipeline

    DEFF Research Database (Denmark)

    Jensen, Thomas

    to creating a more efficient shipping industry, and a number of critical issues are identified. These include that shipments depend on shipping information, that shipments often are delayed due to issues with documentation, that EDI messages account for only a minor part of the needed information......This thesis applies theoretical perspectives from the Information Systems (IS) research field to propose how Information Technology (IT) can improve containerized shipping. This question is addressed by developing a set of design principles for an information infrastructure for sharing shipping...... information named the Shipping Information Pipeline (SIP). Review of the literature revealed that IS research prescribed a set of meta-design principles, including digitalization and digital collaboration by implementation of Inter-Organizational Systems based on Electronic Data Interchange (EDI) messages...

  11. Electronic commerce: wiring the coal industry for new data technology

    Energy Technology Data Exchange (ETDEWEB)

    Carter, R.A.

    1998-07-01

    Industry pundits predict that coal by wire may some day replace much of the industry`s long-distance shipping requirements and their attendant costs, but data by wire, also known as electronic commerce (EC) can today offer coal producers and customers the means to gather and send large volumes of data cheaply and quickly. EC`s major components - electronic data interchange (EDI), bar-coding, smart codes, radio frequency `D`, and the internet - can reduce costs in equipment-intensive industries such as mining. The US National Mining Association sponsored a forum to discuss these alternatives at its 1998 Electronic Commerce Summit held in Tuscon, Arizona, 18-20 May. A report is given of discussions at the forum and contacts are given for sources of EDI information.

  12. Runoff and water-quality characteristics of three Discovery Farms in North Dakota, 2008–16

    Science.gov (United States)

    Galloway, Joel M.; Nustad, Rochelle A.

    2017-12-21

    Agricultural producers in North Dakota are aware of concerns about degrading water quality, and many of the producers are interested in implementing conservation practices to reduce the export of nutrients from their farms. Producers often implement conservation practices without knowledge of the water quality of the runoff from their farm or if conservation practices they may implement have any effect on water quality. In response to this lack of information, the U.S. Geological Survey, in cooperation with North Dakota State University Extension Service and in coordination with an advisory group consisting of State agencies, agricultural producers, and commodity groups, implemented a monitoring study as part of a Discovery Farms program in North Dakota in 2007. Three data-collection sites were established at each of three farms near Underwood, Embden, and Dazey, North Dakota. The purpose of this report is to describe runoff and water-quality characteristics using data collected at the three Discovery Farms during 2008–16. Runoff and water-quality data were used to help describe the implications of agricultural conservation practices on runoff and water-quality patterns.Runoff characteristics of monitoring sites at the three farms were determined by measuring flow volume and precipitation. Runoff at the Underwood farm monitoring sites generally was controlled by precipitation in the area, antecedent soil moisture conditions, and, after 2012, possibly by the diversion ditch constructed by the producer. Most of the annual runoff was in March and April each year during spring snowmelt. Runoff characteristics at the Embden farm are complex because of the mix of surface runoff and flow through two separate drainage tile systems. Annual flow volumes for the drainage tiles sites (sites E2 and E3) were several orders of magnitude greater than measured at the surface water site E1. Site E1 generally only had runoff briefly in March and April during spring snowmelt and

  13. Validity and reliability of eating disorder assessments used with athletes: A review

    Directory of Open Access Journals (Sweden)

    Zachary Pope

    2015-09-01

    Conclusion: Only seven studies calculated validity coefficients within the study whereas 47 cited the validity coefficient. Twenty-six calculated a reliability coefficient whereas 47 cited the reliability of the ED measures. Four studies found validity evidence for the EAT, EDI, BULIT-R, QEDD, and EDE-Q in an athlete population. Few studies reviewed calculated validity and reliability coefficients of ED measures. Cross-validation of these measures in athlete populations is clearly needed.

  14. Bioequivalence of a fixed-dose repaglinide/metformin combination tablet and equivalent doses of repaglinide and metformin tablets
.

    Science.gov (United States)

    Cho, Hea-Young; Ngo, Lien; Kim, Sang-Ki; Choi, Yoonho; Lee, Yong-Bok

    2018-06-01

    This study was conducted to determine whether a fixed-dose combination (FDC) tablet of repaglinide/metformin (2/500 mg) is equivalent to coadministration of equivalent doses of individual (EDI) tablets of repaglinide (2 mg) and metformin (500 mg) in healthy Korean male subjects. This study was conducted as an open-label, randomized, single-dose, two-period, two-sequence crossover design in 50 healthy Korean male subjects who received an FDC tablet or EDI tablets. Plasma concentrations of repaglinide and metformin were determined for up to 24 hours using a validated UPLC-MS/MS method. Bioequivalence was assessed according to current guidelines issued by the U.S. Food and Drug Administration (FDA) and Korean legislation. Tolerability was also evaluated throughout the study via subject interview, vital signs, and blood sampling. Point estimates (90% CIs) for AUC0-t, AUC0-∞, and Cmax based on EDI tablets were 110.07 (102.25 - 118.49), 109.90 (101.70 - 118.39), and 112.60 (101.49 - 124.85), respectively, for repaglinide. They were 95.18 (89.62 - 101.05), 95.00 (89.74 - 100.65), and 98.44 (92.72 - 104.50), respectively, for metformin. These results satisfied the bioequivalence criteria of 80.00 - 125.00% proposed by the FDA and Korean legislation. Results of pharmacokinetic analysis suggested that repaglinide and metformin in FDC tablets were bioequivalent to EDI tablets of repaglinide (2 mg) and metformin (500 mg) in healthy Korean male subjects. Both formulations appeared to be well tolerated.
.

  15. Alcoholic hallucinosis: case report

    OpenAIRE

    Bárbara Werner Griciunas; Norton Yoshiaki Kitanishi; Patricia Motta Carvalho; Daniel Azevedo Cavalcante; Leonardo Mattiolli Marini

    2017-01-01

    Case report of patient who has been an alcoholic for 40 years and, after reducing alcohol intake, developed auditory and visual hallucinations, which caused behavior change. Neurological issues, electrolyte disturbances and other organ dysfunctions were excluded as cause of said change. After intake of haloperidol and risperidone, the patient had regression of symptoms and denied having presented hallucinatory symptoms. The Manual Diagnóstico e Estatístico de Transtornos Mentais – 5ª edição (...

  16. JClic y Edilim: programas de autor para el diseño de actividades educativas en soporte digital para Educación Infantil y Primaria

    Directory of Open Access Journals (Sweden)

    Raul Tarraga

    2012-12-01

    Full Text Available Este trabajo analiza las prestaciones de JClic y EdiLim, dos programas de autor para el diseño de actividades educativas para las etapas de educación infantil y primaria. Se revisan algunos de los tipos de actividades que pueden diseñarse con cada programa, y se ofrecen datos informativos sobre cómo descargar los programas ylocalizar repositorios de recursos y tutoriales de uso en Internet.

  17. ASSIS, Machado de. Casa Velha / The Old House. Trad. de Mark Carlyon. Rio de Janeiro: Cidade Viva, 2010. 236 p.

    Directory of Open Access Journals (Sweden)

    Cynthia Beatrice Costa

    2014-12-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2014v2n34p283 Por meio do exame desta edição bilíngue da novela machadiana, pretende-se analisar como o ato tradutório e as informações extratextuais foram valorizados pelos editores, ensaístas e pelo próprio tradutor.

  18. Labour flexibility and innovation, complementary or concurrent strategies? A review of the literature

    OpenAIRE

    De Spiegelaere, Stan; Van Gyes, Guy; Van Hootegem, Geert

    2014-01-01

    The European strategy for growth has a double aim: becoming an innovative union and enhancing labour flexibility. Yet, few addressed the question whether these two strategies are compatible or concurrent strategies. Through a review of the literature, we address this question by focusing on different types of labour flexibility (functional, contractual and financial), and two types of innovation outcomes: employee-driven innovation (EDI) and organizational innovativeness. Using insights from ...

  19. An incremental approach to a secure e-commerce environment

    OpenAIRE

    2014-01-01

    M.Sc. (Computer Science) The terms "Electronic Commerce" and "Internet Commerce" are often used interchangeably to mean similar processes. By definition, electronic commerce (e-commerce) means any exchange of information that occurs electronically. There are various types of electronic commerce transactions to name a few; electronic data interchange (EDI), fax, electronic funds transfer, interorganisational systems, technical data and document exchange, customer credit approval systems, in...

  20. Репрессии австрийских властей против москвофилов Буковины в годы Первой мировой войны

    Directory of Open Access Journals (Sweden)

    Виталий Гайсенюк

    2014-12-01

    Full Text Available The paper analyzes the repressive measures taken by Austro-Hungarian administra-tion against the russophile current in Bukovina during 1914-1918. The author points out that retaliations of authorities were directed not only against moscowphiles, but also af-fected the entire Ukrainian population of the province, fully cataloged as practically rus-sophile. According to the author, the years of the First World War represented a real trag-edy for the Ukrainians in Bukovina.

  1. [Binge eating disorder: Links with personality and emotionality].

    Science.gov (United States)

    Dorard, G; Khorramian-Pour, M

    2017-04-01

    Our two objectives were: (1) to investigate the relationship between binge eating disorder, dimensions of personality (according to the Big Five model of Costa and McCrae) and those of emotionality in the "tripartite" model of emotions of Watson and Clark; (2) to evaluate the correspondence between the Binge Eating Scale (BES) and the Eating Disorder Inventory (EDI-2) scores. Four self-administered questionnaires were completed on a shared doc website: the EDI-2, the BES, the BFI-Fr (Big Five Inventory-French version) and the EPN-31 (Positive and Negative Emotionality Scale). The analyses were conducted in a sample of 101 participants (36 men and 65 women), aged 20-59 years (mean age=35.28±9.76) from the general population. We found that 11% of the participants had moderate to severe binge eating disorder. Among them, nearly 4% were overweight and 4% were obese. The correlations analyses indicated that binge eating disorder was associated with two dimensions of personality, the neuroticism (P=0.001) and the consciousness (P=0.010), and with the emotions of joy (P=0.008), tenderness (P=0.036), fear (P=0.011), shame (Pbinge eating disorder get higher scores on EDI-2 subscales: search for thinness (P=0.001), bulimia (Pbinge eating disorder is associated with negative affectivity both as a personality dimension and as an emotional feeling. The patterns of associations, observed with the EDI scale, seem to confirm the good convergent validity of the Binge Eating Scale. Thus, like other eating disorders, emotional functioning should be a prime target for prevention and treatment. Copyright © 2016 L’Encéphale, Paris. Published by Elsevier Masson SAS. All rights reserved.

  2. Economic Effectiveness Evaluation In Projects Consisting In Automating Settlement Systems. The Example Of A Financial Centre Of An Internationa l Automotive Company

    OpenAIRE

    Miroslaw Dyczkowski

    2010-01-01

    Economic effectiveness has become a decisive factor in feasibility studies for IT projects due to deteriorating economic situation. This paper characterises such an assessment on the example of an automated settlement system for a supply chain. The described project was carried out by a financial centre – located in Poland – of an in ternational company operating in the automotive industry. It aimed at applying EDI technologies to automate logistics. The project...

  3. [Study on application of CPP-ACP on tooth mineralization during orthodontic treatment with fixed appliance].

    Science.gov (United States)

    He, Wen-dan; Liu, Ying-zhi; Xu, Yuan-yuan; Chen, Dong

    2010-04-01

    To determine the value of clinical application of CPP-ACP during orthodontic treatment with fixed appliance. Seventy-five subjects were divided randomly into three groups, the control group, experimental group A and experimental group B. The control group were emphasized on daily oral hygiene. Experimental group A used fluor protector every three months under the dentist's guidance. Experimental group B used Casein phosphopeptide amorphous calcium phosphate(CCP-ACP) once a day. After finishing the orthodontic treatment, photos were taken under the same condition ,then the degree of the enamel's demineralization was examined and the enamel decalcification index(EDI) was calculated. SPSS11.0 software package was used for statistical analysis. (1)The incidence of three groups' enamel decalcification declined in sequence as the control group(60%),experimental group A (36%), experimental group B (32%).(2)The incidence of the teeth's enamel calcification of three groups declined in sequence as the control group(14.7%),experimental group A (8.46%), experimental group B (7.72%), the difference between the control group and two experimental groups was significant, while no significant difference was found between the two experimental groups.(3(EDI of the control group was 0.155+/-0.023, EDI of the experimental group A was 0.082+/-0.009,while EDI of the experimental group B was 0.078+/-0.006. The difference between the control group and two experimental groups was statistically significant, while was not statistically significant between the two experimental groups. The application of fluor protector and CPP-ACP can improve the mineralization of the teeth during orthodontic treatment with fixed appliance. CPP-ACP is more convenient for the patients to use. Supported by Research Fund of Bureau of Science and Technology of Futian District Shenzhen City(Grant No.FTWS056).

  4. Area Handbook Series: Argentina: A Country Study

    Science.gov (United States)

    1985-08-01

    votes after a campaign that emphasized firm opposition to the military government and verbal attacks on the trade union leadership of the PJ...legal pro- cedures that were designed especially for these cases. The trials were open to the public, evidence would be taken verbal - ly instead of...1981,144-45. Terrera, Guillermo Alfredo. Geopolitica Argentina: Poblacion, fronteras, comunicaciones , antropologia. Buenos Aires: Edi- torial Plus

  5. Naval Logistics Integration Through Interoperable Supply Systems

    Science.gov (United States)

    2014-06-13

    owe special gratitude to the Marines of 3rd Supply Battalion for supporting me as the Supply Management Unit Officer-in-charge, Supply Company ...XML) that works in conjunction with EDI, DLMS transactions can be quickly converted via Business-to-Business ( B2B ) integration software into an...purchasing user’s guide release 11i. Oracle Corporation. ———. 2011. Oracle B2B datasheet. http://www.oracle.com/technetwork/ middleware/soasuite/ b2b

  6. A Study in Sea-Air Intermodal Port Selection: Strategic Decision Making for United States Southern Command

    Science.gov (United States)

    2011-06-01

    commerce ( B2B EC) and electronic data interchange (EDI) enabled by internet connectivity are leading the way in industry innovation. Business can profit...points. Companies like Bon-Ton Stores Inc. are rethinking their supply chains and are using intermodal for the first time ever. In this case, they...W. (1997). Strategic Decision Making: Multiobjective Decision Analysis with Spreadsheets. Belmont, CA: Wadsworth Publishing Company

  7. Spaceborne Ocean Intelligence Network: SOIN - Fiscal Year 10/11 Year-End Summary

    Science.gov (United States)

    2011-10-01

    however, a nontrivial challenge , that may well require a lot of time and effort for marginal gains. Furthermore, the growing collection of well...detection and identification. Although still in progress, the search for suitable textual measures has been greatly aided by the experience gained in...To research & d~ operational means to ll’ICIMor meSOS¢S(e coastal & oceanic froots and ed:ies with spaoebome SAR: • To provide MetOc Ha5fax wih the

  8. The Impact of Overeating on Mood Among Unrestrained College Females

    Science.gov (United States)

    2005-11-28

    term caloric restriction, although those participants scoring high on this scale may not be in a hypocaloric state (Gorman & Allison, 1995...nervosa (Garner et al., 1983). The subscales of the EDI include: Drive for Thinness (DT; excessive concern with dieting , preoccupation with weight...Wadden, T.A. (2001). Restrictive dieting versus “undieting”: Effects on eating regulation in obese clinic attenders. Addictive Behaviors, 26, 253-266

  9. A brief report on the 2nd PAGES Young Scientists Meeting in Goa, India

    Digital Repository Service at National Institute of Oceanography (India)

    Saraswat, R.; Jensen, B.

    ; System for Analysis, Research and Training; IGBP, Brazil Regional Office; National Oceanic and Atmosphere Administration, USA; National Institute of Ocean Technology, India; Indian National Centre for Ocean Information Services, India; Indian.... They fielded many questions from the audience, addressing various topics such as signing re- views vs. double-blind reviews and what edi- tors expect in a good review. It became clear during this session that many YSM partici- pants did not feel...

  10. Determination of total vanadium and vanadium(V) in groundwater from Mt. Etna and estimate of daily intake of vanadium(V) through drinking water.

    Science.gov (United States)

    Arena, Giovanni; Copat, Chiara; Dimartino, Angela; Grasso, Alfina; Fallico, Roberto; Sciacca, Salvatore; Fiore, Maria; Ferrante, Margherita

    2015-06-01

    Vanadium(V) can be found in natural waters in the form of V(IV) and V(V) species, which have different biological properties and toxicity. The purpose of this study was to determine the concentrations of total V and V(V) in groundwater from the area of Mt. Etna and to assess the estimated daily intake (EDI) of V(V) of adults and children through drinking water. Water was sampled monthly at 21 sites in 2011. Total vanadium was determined by inductively coupled plasma-mass spectrometry (ICP-MS) and speciation by ion chromatography-ICP-MS (IC-ICP-MS). The concentration of V(V) species ranged from 62.8 to 98.9% of total V, with significantly higher concentrations in samples from the S/SW slope of Mt. Etna. The annual mean concentrations of total V exceeded the Italian legal limit of 140 μg/L at four sites on the S/SW slope. In the absence of thresholds for V(V) intake, only the Environmental Protection Agency (EPA) has calculated a reference dose. Children's EDI of V(V) at the sites with the higher V concentrations exceeded EPA thresholds (9 μg/kg/day). In particular, we found in Camporotondo, Mascalucia, Ragalna and San Pietro Clarenza sites children's EDIs of 11, 9.3, 11 and 9.9, respectively. The EDI of V(V) was significantly higher than the literature range (0.09-0.34 μg/kg/day).

  11. [Runoff loss of soil mineral nitrogen and its relationship with grass coverage on Loess slope land].

    Science.gov (United States)

    Zhang, Yali; Li, Huai'en; Zhang, Xingchang; Xiao, Bo

    2006-12-01

    In a simulated rainfall experiment on Loess slope land, this paper determined the rainfall, surface runoff and the effective depth of interaction (EDI) between rainfall and soil mineral nitrogen, and studied the effects of grass coverage on the EDI and the runoff loss of soil mineral nitrogen. The results showed that with the increase of EDI, soil nitrogen in deeper layers could be released into surface runoff through dissolution and desorption. The higher the grass coverage, the deeper the EDI was. Grass coverage promoted the interaction between surface runoff and surface soil. On the slope land with 60%, 80% and 100% of grass coverage, the mean content of runoff mineral nitrogen increased by 34.52%, 32.67% and 6.00%, while surface runoff decreased by 4.72%, 9.84% and 12.89%, and eroded sediment decreased by 83.55%, 87.11% and 89.01%, respectively, compared with bare slope land. The total runoff loss of soil mineral nitrogen on the lands with 60%, 80%, and 100% of grass coverage was 95.73%, 109.04%, and 84.05% of that on bare land, respectively. Grass cover had dual effects on the surface runoff of soil mineral nitrogen. On one hand, it enhanced the influx of soil mineral nitrogen to surface runoff, and on the other hand, it markedly decreased the runoff, resulting in the decrease of soil mineral nitrogen loss through runoff and sediment. These two distinct factors codetermined the total runoff loss of soil mineral nitrogen.

  12. Bilateral vocal fold immobility: a 13 year review of etiologies, management and the utility of the empey index

    OpenAIRE

    Brake, Maria K.; Anderson, Jennifer

    2015-01-01

    Background Bilateral vocal fold immobility (BVFI) is a rare diagnosis causing dyspnea, dysphonia and dysphagia. Management depends on respiratory performance, airway patency, vocal ability, and quality-of-life priorities. The authors review the presentation, management and outcome in patients diagnosed with BVFI. The utility and efficacy of the Empey index (EI) and the Expiratory Disproportion Index (EDI) are evaluated as an objective monitoring tools for BVFI patients. Methods A 13-year retr...

  13. Polymorphism of the prolactin gene (PRL) and its relationship with ...

    African Journals Online (AJOL)

    enoh

    2012-04-10

    Apr 10, 2012 ... cattle. Edy Alfonso1, Reyna Rojas1, José G. Herrera1, María E. Ortega1, Clemente Lemus2*, César. Cortez1, Jaime Ruiz3, René Pinto4 and Heriberto Gómez4 ..... Ciencias Médicas y Nutrición Salvador Zubirán. México. Rev. Invest. Clín. 57(3): ISSN 0034-8376. Miller SA, Dykes DD, Poletsky HF (1988).

  14. Novel brominated flame retardants in food composites and human milk from the Chinese Total Diet Study in 2011: Concentrations and a dietary exposure assessment.

    Science.gov (United States)

    Shi, Zhixiong; Zhang, Lei; Li, Jingguang; Zhao, Yunfeng; Sun, Zhiwei; Zhou, Xianqing; Wu, Yongning

    2016-11-01

    On the basis of the fifth Chinese total diet study (TDS) performed in 2011, the dietary exposure of the Chinese population to novel brominated flame retardants (NBFRs) was assessed. Six NBFRs were determined in 80 composite samples from four animal origin food groups and 29 pooled human milk samples. Based on gas chromatography-negative chemical ionization mass spectrometry (GC-NCI/MS) analysis, the levels of the total NBFRs ranged from human milk samples. Decabromodiphenyl ethane (DBDPE), with mean levels of 9.03ng/g lw in food composites and 8.06ng/g lw in human milk, was the most abundant compound in the total NBFRs. No obvious spatial distribution patterns in China were observed in food samples or human milk. The average estimated daily intake (EDI) of total NBFRs via food consumption for a "standard Chinese man" was 4.77ng/kg bodyweight (bw)/day, with a range of 0.681 to 18.9ng/kgbw/day. Meat and meat products were the main dietary source of NBFRs, although levels of NBFRs in aquatic food were found to be the highest among the four food groups. The average EDI of total NBFRs for nursing infants was 38.4ng/kgbw/day, with a range of 17.4 to 113ng/kgbw/day, which was approximately eight-fold higher than the EDI for adults, suggesting the heavy body burden of NBFRs on nursing infants. The levels and EDI of DBDPE in the present study were similar to or higher than those of legacy BFRs (i.e., PBDEs and HBCD) in the TDS 2007, indicating that DBDPE, as a main alternative to PBDEs, might have become the primary BFR used in China. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Annual Systems Engineering Conference (11th) Held in San Diego, California on October 20-23, 2008. Volume 3

    Science.gov (United States)

    2008-10-23

    CapabilitiesOSGi All BPMN , BPEL, DEX, EDI Msgs Contained in W3C WSDL SOAP Msgs AAP Asset & Logistics Information AAP Commitments UDDI APIs UDDI...APIs OASIS WS-BPEL AAP Collaborative Net-Centric Model (OMG BPMN Business Process Modeling Notation) mapsTo mapsTo mapsTo AAP Business DEXs Messages...processes and activities defined which are then supported by the processes and activities in the BPMN model. Supply Chain Council – SCOR Supply Chain

  16. Personality and Eating Disorders: A Longitudinal Study on a Non-Clinical Sample of Adolescents

    OpenAIRE

    De Caro, Elide Francesca; Di Blas, Lisa

    2014-01-01

    The present longitudinal study is aimed at analyzing how adolescents change their dysfunctional attitudes towards their body and eating behaviors in relation to personality characteristics across a six-month time span. Via multiple regression analyses we investigated whether MMPI-A Obsessiveness, Low Self-Esteem, Depression, Family Problems and Concern for health are temporal antecedents of EDI-2 eating disorders, and vice versa. Our main findings revealed a bidirectio...

  17. Estudo do gênero conversação espontânea: uma análise da fala de Arc, o marciano invisível da Veja

    Directory of Open Access Journals (Sweden)

    Sueli Maria Coelho

    2005-03-01

    Full Text Available Este artigo se propõe a apresentar uma análise do gênero conversação espontânea, considerando-se as metafunções propostas por Thompson (1996. Tomou-se como objeto de análise um texto veiculado na revista Veja em sua edição de n. 1.813 intitulado Arc e o predidente em greve.

  18. Education in the Information Age, Conference Proceedings April 17-19, 1999,

    Science.gov (United States)

    1997-08-13

    more about being a beginner. Also, our culture is hard on beginners, claiming they’re wet behind the ears, new kids on the block, and rookies... telecommuting from anywhere to anywhere. Coupled with extensive desktop computing power, collaborative planning and telepresence will be the norm. This, EC/EDI...and by extension, worth paying more for? The truth is that technical performance is only one part of what’s needed to describe how we living

  19. História da terra e do homem no Planalto Central, de Paulo Bertran

    Directory of Open Access Journals (Sweden)

    Kelerson Semerene Costa

    2012-07-01

    Full Text Available História da terra e do homem no Planalto Central: eco-história do Distrito Federal, de Paulo Bertran. Brasília, Editora da Universidade de Brasília, 3a. edição, 2011. 615 p. Coleção UnB nos 50 anos de Brasília. R$ 65,00 Ilustrado, Índice remissivo, ISBN 978-85-230-1281-6

  20. Supply chain management ve společnosti L'oreal ČR

    OpenAIRE

    Šenkýřová, Kateřina

    2009-01-01

    The thesis Supply chain management in L'Oréal Czech republic describes and analyses the supply chain of the company. The objective is to define weaknesses of the chain and outline future projects. It analyses the utilization of logistic technologies such as EDI communication, VMI and ECR. In the practical part it focuses in forecasting process in the company. The work suggests new processes and defines parameters that should lead to better results when planning future sales.

  1. JPRS Report, Soviet Union: Political Affairs.

    Science.gov (United States)

    1989-06-08

    Central perhaps erroneous but honest actions, because this trag- Committee Plenum elected Givi Grigoryevich Gum - edy is extremely remote from moral...fifteen clients in the service sphere. regardless of his origin, be affirmed constitutional guar - antees to use his native tongue and culture, to... powder . situation. Only then did a specially formed committee, chaired by G. Yefremov, the chief of the oblast’s One summer day, which was not noted for

  2. Wykorzystanie elektronicznej wymiany danych w wybranych przedsiębiorstwach

    OpenAIRE

    Fajczak-Kowalska, Anita

    2012-01-01

    IT systems that use electronic data interchange standards significantly contribute to the development of companies. This is due to the possibility for increasing the efficiency of data processing, which in today's economic relations is the key to the smooth functioning of the market. The examples of companies that use EDI systems testify to the fact that the progressive computerization is a prerequisite for harmonious action, and more and more advanced solutions are highly convenient in terms...

  3. Influence of mathematical and physical background of drought indices on their complementarity and drought recognition ability

    Science.gov (United States)

    Frank, Anna; Armenski, Tanja; Gocic, Milan; Popov, Srdjan; Popovic, Ljiljana; Trajkovic, Slavisa

    2017-09-01

    The aim of this study is to test how effective and physically correct are the mathematical approaches of operational indices used by relevant National Agencies across the globe. To do so, the following indices were analysed Standardized Precipitation Index (SPI) -1, 3, 6, 12 and 24, Standardized Precipitation - Evapotranspiration Index (SPEI) - 1, 3, 6, 12 and 24, Effective Drought Index (EDI) and Index of Drying Efficiency of Air (IDEA). To make regions more comparable to each other and follow the spatial development of drought SPI index was advised by World Meteorological Organisation to be used widely by official meteorological services. The SPI and SPEI are used for Drought Early Warning in the USA, National Drought Mitigation Center and NASA, and in the EU by the European Drought Centre (EDC) and in the Balkan Region by National Meteorological Agencies. The EDI Index has wide application in Asia. In this paper four different issues were investigated: 1) how the mathematical method used in a drought indicator's computation influence drought indices' (DI) comparative analyses; 2) the sensitivity of the DIs on any change of the length of observational period; 3) similarities between the DIs time series; 4) and how accurate DIs are when compared to historical drought records. Results suggest that it is necessary to apply a few crucial changes in the Drought Monitoring and Early Warning Systems: 1) reconsider use of SPI and SPEI family indices as a measure of quality of other indices; and for Drought Early Recognition Programs 2) switch to DIs with a solid physical background, such as EDI; 3) Adopt solid physics for modelling drought processes and define the physical measure of drought, e.g. EDI and IDEA indices; 4) investigate further the IDEA index, which, supported by our study as well, is valuable for simulation of a drought process.

  4. Editorial

    Directory of Open Access Journals (Sweden)

    José Aparecido de Oliveira

    2011-10-01

    Full Text Available A segunda edição de 2011 da Revista Tecer, em seu enfoque multidisciplinar, abre espaço para os estudos e pesquisas do recente campo das Ciências da Comunicação. Como ciência nova, este campo de pesquisa tem possibilitado diferentes enfoques e contribuições para as Ciências Sociais

  5. Dark adaptation in relation to choroidal thickness in healthy young subjects

    DEFF Research Database (Denmark)

    Munch, Inger Christine; Altuntas, Cigdem; Li, Xiao Qiang

    2016-01-01

    a sensitivity of 5.0 × 10-3 cd/m2 (time to rod intercept) and the slope (rod adaptation rate). The choroid was imaged using enhanced-depth imaging spectral-domain optical coherence tomography (EDI-OCT). Results: The time to the rod intercept was 7.3 ± 0.94 (range 5.1 - 10.2) min. Choroidal thickness 2.5° above...

  6. Electric field measurements on Cluster: comparing the double-probe and electron drift techniques

    Directory of Open Access Journals (Sweden)

    A. I. Eriksson

    2006-03-01

    Full Text Available The four Cluster satellites each carry two instruments designed for measuring the electric field: a double-probe instrument (EFW and an electron drift instrument (EDI. We compare data from the two instruments in a representative sample of plasma regions. The complementary merits and weaknesses of the two techniques are illustrated. EDI operations are confined to regions of magnetic fields above 30 nT and where wave activity and keV electron fluxes are not too high, while EFW can provide data everywhere, and can go far higher in sampling frequency than EDI. On the other hand, the EDI technique is immune to variations in the low energy plasma, while EFW sometimes detects significant nongeophysical electric fields, particularly in regions with drifting plasma, with ion energy (in eV below the spacecraft potential (in volts. We show that the polar cap is a particularly intricate region for the double-probe technique, where large nongeophysical fields regularly contaminate EFW measurments of the DC electric field. We present a model explaining this in terms of enhanced cold plasma wake effects appearing when the ion flow energy is higher than the thermal energy but below the spacecraft potential multiplied by the ion charge. We suggest that these conditions, which are typical of the polar wind and occur sporadically in other regions containing a significant low energy ion population, cause a large cold plasma wake behind the spacecraft, resulting in spurious electric fields in EFW data. This interpretation is supported by an analysis of the direction of the spurious electric field, and by showing that use of active potential control alleviates the situation.

  7. Evaluation of Alternative Technologies to Supply Drinking Water to Marines in Forward Deployed Locations

    Science.gov (United States)

    2010-03-01

    Afghanistan.” 2009. http://www.coleparmer.com/techinfo/techinfo.asp?htmlfile= water - afghanistan.htm&ID=964. Christ- wasser . “RO, EDI and optional UF...Cover, Single-Author Thesis EVALUATION OF ALTERNATIVE TECHNOLOGIES TO SUPPLY DRINKING WATER TO MARINES IN FORWARD DEPLOYED...AFIT/GES/ENV/10-M02 EVALUATION OF ALTERNATIVE TECHNOLOGIES TO SUPPLY DRINKING WATER TO MARINES IN FORWARD DEPLOYED

  8. Suicide attempts and clinical severity of eating disorders : an exploratory study

    OpenAIRE

    Machado, Paulo P. P.; Gonçalves, Sónia; Machado, Bárbara César; Torres, António Roma; Brandão, Isabel

    2004-01-01

    The present study examines whether eating disorders patients with suicide attempts present differences in disordered eating and clinical traits compared to those without suicide attempts. Method: 144 patients with eating disorders (65 anorexia nervosa and 79 bulimia nervosa) completed the Eating Disorders Inventory (EDI; Garner, Omstead & Polivy, 1983), the Symptom Checklist - 90- Revised (SCL-90; Derrogatis, 1977), and a questionnaire to assess eating behaviors and attitudes, information reg...

  9. Employee-driven Innovation in Welfare Services

    Directory of Open Access Journals (Sweden)

    Thomas Wihlman

    2014-05-01

    Full Text Available There is a growing interest in both employee-driven innovation (EDI and innovation in welfare services, but a lack of empirical studies addressing innovation from the employee perspective. Accordingly, this study was designed to contribute with well-grounded empirical knowledge, aiming to explore the barriers to and opportunities for participation in innovation experienced by employees of the Swedish welfare services. In order to reach the aim, a qualitative thematic analysis of 27 semi-structured interviews with employees in four municipalities was performed. The study identified three main themes, with a great impact on the innovative performance of the studied organizations: support, including leadership and innovation processes; development, including creativity and learning; and organizational culture, which includes attitudes and communication, all essential ingredients in EDI. Experienced barriers for innovation were unclear or non-existing innovation processes with ambiguous goals, insufficient learning, and deficient organizational slack, thus creating a tension between day-to-day work and innovation and hindering reflection and exploration. Attitudes of colleagues and lack of communication were also barriers to implementing innovation, suggesting the need for better management support for a communicative and open culture. Opportunities were found, including commitment to innovation and willingness to try new ideas, but the employees must be given the mandate and sufficient time to develop the potential that emerges from continuous learning, time for reflection, and user dialogue. The conclusion was that incremental innovations existed, but the full potential of these did not benefit the entire organization due to inadequate communication and lack of innovation processes. The study improves our understanding of how employees regard their involvement in innovation. It also discusses how to make better use of employees’ resources in

  10. Environmental data exchanging – the need for management

    Directory of Open Access Journals (Sweden)

    Drago Vuk

    2000-01-01

    Full Text Available In this paper, the author analyses the beginning of the application of measures imposed by the Slovenian Law on the Environmental Protection and the Environmental Information System. On the basis of his knowledge of the actual state, he proposes a model by means of which it would be possible to systematically assure with EDI environmental balances and environmental accounting, thus providing the basis for the implementation of an applicable environmental information system.

  11. Determination of Arsenic Species in Ophiocordyceps sinensis from Major Habitats in China by HPLC-ICP-MS and the Edible Hazard Assessment.

    Science.gov (United States)

    Guo, Lian-Xian; Zhang, Gui-Wei; Wang, Jia-Ting; Zhong, Yue-Ping; Huang, Zhi-Gang

    2018-04-26

    This study sought to determine the concentration and distribution of arsenic (As) species in Ophiocordyceps sinensis ( O. sinensis ), and to assess its edible hazard for long term consumption. The total arsenic concentrations, measured through inductively coupled plasma mass spectrometry (ICP-MS), ranged from 4.00 mg/kg to 5.25 mg/kg. As determined by HPLC-ICP-MS, the most concerning arsenic species—AsB, MMA V , DMA V , As V , and As Ш —were either not detected (MMA V and DMA V ) or were detected as minor As species (AsB: 1.4⁻2.9%; As V : 1.3⁻3.2%, and As Ш : 4.1⁻6.0%). The major components were a cluster of unknown organic As (uAs) compounds with As Ш , which accounted for 91.7⁻94.0% of the As content. Based on the H₂O₂ test and the chromatography behavior, it can be inferred that, the uAs might not be toxic organic As. Estimated daily intake ( EDI) , hazard quotient ( HQ ), and cancer risk ( CR ) caused by the total As content; the sum of inorganic As (iAs) and uAs, namely i+uAs; and iAs exposure from long term O. sinensis consumption were calculated and evaluated through equations from the US Environmental Protection Agency and the uncertainties were analyzed by Monte-Carlo Simulation (MCS). EDI total As and EDI i+uAs are approximately ten times more than EDI iAs ; HQ total As and HQ i+u As > 1 while HQ i As 1 × 10 −4 while CR iAs iAs is very low.

  12. ADMINISTRATIVE COMPUTING SERVICES DURING THE END OF THE YEAR SHUTDOWN

    CERN Multimedia

    AS Division

    2002-01-01

    Please note that all the AIS services and databases (ADRESSAGE, AVCL, BAAN, BHT, CET, CFU, CTA, COURRIER, EDH, EDI, FOUNDATION, GESCLE, GESLOC, GRAYBOOK, HR, HRT, IMP/EXP, INVENTORY, LIMS, PIE, PPT, QUALIAC, REMEDY, SOS, WOS, etc) see also http://ais.cern.ch, will be unavailable: Friday 20.12.2002 12:00 to Monday 6.1.2003 08:00 AS Division

  13. Novos horizontes da Criminalística nacional

    OpenAIRE

    Ângela Tonietto; Bruno Telles; Charles Albert Andrade; Claudemir Rodrigues Dias Filho; Elvis Medeiros; Juliano de Andrade Gomes; Maria Paula Oliveira Valadares

    2014-01-01

    Convidamos à leitura desta terceira edição da Revista Brasileira de Criminalística que traz cinco artigos, versando sobre variadas áreas das Ciências Forenses. Também convidamos você pesquisador, perito, professor, para submeter seu trabalho e contribuir com mais uma peça na construção desse conhecimento. Saudações periciais e boa leitura.

  14. Business-to-business electronic commerce systems and services. Smart EC solution; Kigyoka nrenkei system solution system. Smart EC solution

    Energy Technology Data Exchange (ETDEWEB)

    Setoguchi, T.; Manchu, Y.; Katsumata, M. [Toshiba Corp., Tokyo (Japan)

    2000-04-01

    Toshiba provides a range of information technology (IT) solutions called SmartEC Solution, which includes business-to-business electronic commerce systems and services based on international standards and industrial know-how, especially our electronic data interchange (EDI) know-how as a manufacturer. These IT solutions are supplied as services covering strategy planning, system integration, and application service provider based on five types of business-to-business electronic commerce. (author)

  15. Sustainable Regulation of Information Sharing with Electronic Data Interchange by a Trust-Embedded Contract

    Directory of Open Access Journals (Sweden)

    Guanghua Han

    2017-06-01

    Full Text Available This paper studies the risks in demand information sharing applications by electronic soft-orders using electronic data interchange (EDI systems in e-commerce and aims to suggest a sustainable regulation mechanism with a trust-embedded contract. In a supply chain with one retailer and one supplier, the retailer solicits private forecasted demand and places soft-orders via EDI to the supplier. To ensure abundant supply, the retailer has an incentive to inflate her soft-orders, which potentially harms the credible information sharing and sustainability of business cooperation. Normally, the degree to which the supplier relies on the retailer’s order information is specified by trust, which is evaluated according to the retailer’s reputation and supplier’s intuition in this study. Based on standard game theory, we find that both the retailer’s order and the quantity of supplier prepared materials are independent of the retailer’s forecast. Therefore, EDI based information sharing in e-commerce without a regulation mechanism leads to inefficient demand information sharing. Since both the supplier and retailer are proved to faces huge of potential profit losses due to the failure of information sharing, the commerce by EDI based information sharing is full of risk and unsustainable. Therefore, a regulation mechanism that leaded by the retailer is proposed to establish ‘win-win’ sustainable cooperation. Numerical experiments highlight the value of trust, the impact of reputation and intuition in decisions, and the effectiveness of the regulation mechanism by a cost-sharing contract.

  16. Antibacterial evaluation of Anacardium occidentale (Linn ...

    African Journals Online (AJOL)

    aghomotsegin

    Química Nova. 30(2):374-381. Gonçalves GMS, Gobbo J (2012). Antimicrobial Effect of Anacardium. Occidentale Extract and Cosmetic Formulation Development. Braz. Arc. Biol. Technol. 55(6): 843-850. Matos FJA (1997). Introdução à fitoquímica experimental. UFC Edições. pp. 44-46. Melo AFM, Santos EJV, Souza LFC, ...

  17. Gas to Power in North America. Issues surrounding the use of natural gas in the next generation of North American power plants

    International Nuclear Information System (INIS)

    Thorn, T.

    2006-01-01

    In January 2006 a study was concluded on Gas to Power in North America. This study has been prepared for EDI and IGU and is part of the Gas to Power Project, which has been set up in view of the pivotal role power is likely to play in the development of new gas markets and the realization that it will take enormous efforts to achieve the projected growth. In this report the focus is on North America

  18. Variants of early-onset restrictive eating disturbances in middle childhood.

    Science.gov (United States)

    Kurz, Susanne; van Dyck, Zoé; Dremmel, Daniela; Munsch, Simone; Hilbert, Anja

    2016-01-01

    This study sought to determine the factor structure of the newly developed self-report screening questionnaire Eating Disturbances in Youth-Questionnaire (EDY-Q) as well as to report the distribution of variants of early-onset restrictive eating disturbances characteristic of avoidant/restrictive food intake disorder (ARFID) in a middle childhood population sample. Using the EDY-Q, a total of 1,444 children aged 8-13 years were screened in elementary schools in Switzerland via self-report. The factor analysis of the 12 items covering ARFID related symptoms was performed using a principal component analysis (PCA). The PCA showed a four factor solution, with clear allocation to the scales covering three variants of early-onset restrictive eating disturbances and weight problems. Inadequate overall food intake was reported by 19.3% of the children, a limited accepted amount of food by 26.1%, and food avoidance based on a specific underlying fear by 5.0%. The postulated factor structure of the EDY-Q was confirmed, further supporting the existence of distinct variants of early-onset restrictive eating disturbances. Avoidant/restrictive eating behavior seems to be a common experience in middle childhood, but results have to be confirmed using validated interviews. © 2015 Wiley Periodicals, Inc.

  19. Early-onset restrictive eating disturbances in primary school boys and girls.

    Science.gov (United States)

    Kurz, Susanne; van Dyck, Zoé; Dremmel, Daniela; Munsch, Simone; Hilbert, Anja

    2015-07-01

    This study sought to determine the distribution of early-onset restrictive eating disturbances characteristic of the new DSM-5 diagnosis, avoidant/restrictive food intake disorder (ARFID) in middle childhood, as well as to evaluate the screening instrument, Eating Disturbances in Youth-Questionnaire (EDY-Q). A total of 1,444 8- to 13-year-old children were screened in regular schools (3rd to 6th grade) in Switzerland using the self-report measure EDY-Q, consisting of 12 items based on the DSM-5 criteria for ARFID. 46 children (3.2%) reported features of ARFID in the self-rating. Group differences were found for body mass index, with underweight children reporting features of ARFID more often than normal and overweight children. The EDY-Q revealed good psychometric properties, including adequate discriminant and convergent validity. Early-onset restrictive eating disturbances are commonly reported in middle childhood. Because of possible negative short- and long-term impact, early detection is essential. Further studies with structured interviews and parent reports are needed to confirm this study's findings.

  20. Age at menarche and digit ratio (2D:4D): relationships with body dissatisfaction, drive for thinness, and bulimia symptoms in women.

    Science.gov (United States)

    Oinonen, Kirsten A; Bird, Jessica L

    2012-03-01

    This study examined the hypothesis that lower prenatal androgen exposure and earlier puberty are associated with more dysfunctional eating attitudes and behaviors. Relationships between both age at menarche (AAM) and 2D:4D (a marker of prenatal androgen exposure), and EDI-2-Body Dissatisfaction, EDI-2-Drive for Thinness, and EDI-2-Bulimia scores, were examined in women using correlations and regressions. Earlier menarche was associated with higher drive for thinness after controlling for BMI and negative affect, but only in women who were not exclusively heterosexual. Higher 2D:4D was associated with higher Bulimia and Body Dissatisfaction scores, but only in exclusively heterosexual women, and relationships disappeared when covariates were controlled. Later AAM and higher 2D:4D were unique predictors of higher Bulimia scores for exclusive heterosexuals when BMI was controlled. These findings suggest future research should examine sexual orientation as a mediator or moderator of prenatal and postnatal organizational hormonal effects on women's disordered eating attitudes and behaviors. Copyright © 2011 Elsevier Ltd. All rights reserved.

  1. de Secundaria

    Directory of Open Access Journals (Sweden)

    Manuel Herrero

    2005-01-01

    Full Text Available Los objetivos de este estudio transversal han sido determinar la frecuencia de las actitudes y conductas autoinformadas asociadas con los trastornos de la conducta alimentaria evaluadas mediante el Inventario de Trastornos de la Conducta Alimentaria (EDI-2, comprobar si existen diferencias en esas variables en función de las variables sociodemográficas tenidas en cuenta y, por último, estimar el porcentaje de población en situación de riesgo. Se aplicó el EDI-2 a una muestra aleatoria y representativa de estudiantes de Secundaria (n = 1190 en un diseño transversal. Las medias de las subescalas de Obsesión por la Delgadez, Bulimia e Insatisfacción Corporal se enmarcan dentro del rango de lo encontrado en la literatura. Al comparar las medias de las escalas y subescalas del EDI en función de las distintas variables demográficas tenidas en cuenta se obtienen diferencias significativas sobre todo en género. Se analizan distintos criterios para determinar el porcentaje de personas en situación de riesgo de presentar y/o desarrollar un trastorno de la conducta alimentaria y se ofrecen estos resultados en función de las distintas variables demográficas consideradas en este estudio.

  2. Technical feasibility of reuse of effluent generated from reverse osmosis system in a pharmaceutical plant

    Directory of Open Access Journals (Sweden)

    Bárbara de A. S. de Andrade

    2017-09-01

    Full Text Available Reuse reduces the consumption of freshwater supplies and the negative environmental impact caused by the discharge of industrial effluents. Some industries have already adopted this practice; however, no studies were found in the literature regarding this subject in the pharmaceutical industry. This work investigated the potential reuse of effluent (concentrate generated from the Reverse Osmosis/Electro-deionization System (RO/EDI that is used for the production of purified water in a Brazilian pharmaceutical plant. This industrial complex consumed about 200,000 m3 of water per year between 2012 and 2013 to produce one million of doses of vaccines, i.e., 2 L of water per dose of vaccine produced. During this period, the RO/EDI produced 27,000 m3 of purified water annually and generated 24,000 m3 of effluent (concentrate. This amount of effluent could be used to supply the production of industry steam (boilers and/or cold water (cooling towers that annually consumed an average of 12,000 m3 and 40,000 m3, respectively. The reuse of this effluent would result in a gross financial savings of 96,000 USD per year, excluding the costs of installation and control. From what has been researched in the literature, this work showed for the first time the possibility of reuse of effluent from RO/EDI System in the pharmaceutical industry.

  3. Embodiment Mediates the Relationship between Avoidant Attachment and Eating Disorder Psychopathology.

    Science.gov (United States)

    Monteleone, Alessio Maria; Castellini, Giovanni; Ricca, Valdo; Volpe, Umberto; De Riso, Francesco; Nigro, Massimiliano; Zamponi, Francesco; Mancini, Milena; Stanghellini, Giovanni; Monteleone, Palmiero; Treasure, Janet; Maj, Mario

    2017-11-01

    The overvaluation of body shape and weight of persons with eating disorders (EDs) is putatively explained by a disturbance in the way they experience their own body (embodiment). Moreover, attachment disorders seem to promote the use of body as source for self-definition. Therefore, we assessed the role of embodiment in the connection between attachment styles and ED psychopathology. One-hundred and thirteen ED patients and 117 healthy subjects completed the Identity and Eating Disorders (IDEA) Questionnaire, the Eating Disorder Inventory-2 (EDI-2) and the Experiences in Close Relationships Scale. Eating disorder patients displayed IDEA, EDI-2 and Experiences in Close Relationships scores significantly higher than controls. IDEA total and subtotal scores mediated entirely the influence of avoidant attachment on EDI-2 interoceptive awareness and impulsivity. These findings demonstrate a relationship between insecure attachment and disorders of identity and embodiment and point to embodiment as a possible mediator between avoidant attachment and specific ED psychopathological traits. Copyright © 2017 John Wiley & Sons, Ltd and Eating Disorders Association. Copyright © 2017 John Wiley & Sons, Ltd and Eating Disorders Association.

  4. Psychological predictors of outcome in vertical banded gastroplasty: a 6 months prospective pilot study.

    Science.gov (United States)

    Leombruni, Paolo; Pierò, Andrea; Dosio, Davide; Novelli, Alessia; Abbate-Daga, Giovanni; Morino, Mario; Toppino, Mauro; Fassino, Secondo

    2007-07-01

    At present, bariatric surgery is the most effective treatment for morbid obesity. Several factors appear to influence the patient's ability to adjust to the postoperative condition, but reliable predictors are lacking. The aim of this study was to assess whether psychological presurgical variables can predict outcome of vertical banded gastroplasty (VBG) in the short term. 38 severely obese patients (6 men and 32 women) underwent laparoscopic VBG. All were assessed prospectively at TO (before surgery) and at T6 (6 months after surgery) with a semi-structured interview and a battery of psychological tests: State Trait Anger Expression Inventory (STAXI), Eating Disorder Inventory (EDI-2), Symptom Checklist 90 (SCL-90), Beck Depression Inventory (BDI), Binge Eating Scale (BES), Body Shape Questionnaire (BSQ), and (only at TO) the Temperament and Character Inventory (TCI). The comparison between TO and T6 found a significant weight loss and an improvement in several dimensions of EDI-2, BDI, and BSQ, together with an increase in the frequency of vomiting. Self-directedness (TCI) and Body Dissatisfaction (EDI-2) appear to be predictors of short-term outcome regarding weight loss. Self-transcendence (TCI) is associated with emerging side-effects. Although larger and longer studies are necessary to confirm these data, Self directedness and Self trascendence emerge as predictors of 6 months clinical and psychological outcome of VBG.

  5. Inpatient Treatment for Adolescents with Anorexia Nervosa: Clinical Significance and Predictors of Treatment Outcome.

    Science.gov (United States)

    Schlegl, Sandra; Diedrich, Alice; Neumayr, Christina; Fumi, Markus; Naab, Silke; Voderholzer, Ulrich

    2016-05-01

    This study evaluated the clinical significance as well as predictors of outcome for adolescents with severe anorexia nervosa (AN) treated in an inpatient setting. Body mass index (BMI), eating disorder (ED) symptoms [Eating Disorder Inventory-2 (EDI-2)], general psychopathology and depression were assessed in 238 patients at admission and discharge. BMI increased from 14.8 + 1.2 to 17.3 + 1.4 kg/m(2). Almost a fourth (23.6%) of the patients showed reliable changes, and 44.7% showed clinically significant changes (EDI-2). BMI change did not significantly differ between those with reliable or clinically significant change or no reliable change in EDI-2. Length of stay, depression and body dissatisfaction were negative predictors of a clinically significant change. Inpatient treatment is effective in about two thirds of adolescents with AN and should be considered when outpatient treatment fails. About one third of patients showed significant weight gain, but did not improve regarding overall ED symptomatology. Future studies should focus on treatment strategies for non-responders. Copyright © 2015 John Wiley & Sons, Ltd and Eating Disorders Association.

  6. Management of Patients with Graves’ Disease and Orbital Involvement: Role of Spectral Domain Optical Coherence Tomography

    Directory of Open Access Journals (Sweden)

    Alice Bruscolini

    2018-01-01

    Full Text Available Purpose. To investigate the role of choroidal thickness evaluation with spectral domain optical coherence tomography (SDOCT and enhanced depth imaging (EDI technique in the management of patients with Graves’ disease and orbitopathy (GO. Methods. Thirty-six eyes of 18 patients with GO and 36 eyes of 18 age-matched control subjects were included in this retrospective observational study. All the subjects underwent a complete ophthalmological evaluation, including clinical activity score (CAS and exophthalmometry. The SDOCT images of the choroid were obtained by EDI modality. Results. Choroidal thickness was significantly increased in GO than in control eyes (p<0.01. A significant correlation was found between choroidal thickness and CAS, proptosis, and the duration of disease (p<0.05. Conclusion. This study shows that choroidal thickness, evaluated with EDI-OCT, is significantly increased in patients with GO and correlates with the activity of the disease, proptosis, and duration of the disease. The choroidal thickening may reflect the ocular hemodynamic changes, and enhanced depth imaging optical coherence tomography may be a useful tool for the evaluation of orbital congestion and management of patients with Graves’ disease and orbital involvement.

  7. Optical coherence tomography and fundus autofluorescence findings in presumed congenital simple retinal pigment epithelium hamartoma

    Directory of Open Access Journals (Sweden)

    Baskaran, Prabu

    2017-10-01

    Full Text Available Aim: Presumed congenital simple retinal pigment epithelium hamartoma is a rare benign lesion of the macula that mimics congenital hypertrophy of the retinal pigment epithelium (RPE and combined hamartoma of the retina and the RPE; newer imaging modalities can help in diagnosis. We report three patients with presumed congenital simple RPE hamartoma, and describe the enhanced-depth imaging optical coherence tomography (EDI-OCT and fundus autofluorescence (FAF findings. Methods: Two patients were asymptomatic; one had an intraocular foreign body in addition to the hamartoma. All had a similar jet black, elevated lesion in the macula, sparing the fovea. EDI-OCT showed a characteristic hyperreflective layer with complete optical shadowing of the deeper layers; FAF showed pronounced hypoautofluorescence of the lesion. Conclusion: Multimodal imaging with FAF and EDI-OCT can help to differentiate simple RPE hamartoma from similar RPE lesions, and may serve as a useful adjunct to clinical diagnosis of this rare tumor. We present the second largest series of presumed congenital simple RPE hamartoma, and – to the best of our knowledge – the first report of FAF findings of this tumor.

  8. Bilateral vocal fold immobility: a 13 year review of etiologies, management and the utility of the Empey index.

    Science.gov (United States)

    Brake, Maria K; Anderson, Jennifer

    2015-06-26

    Bilateral vocal fold immobility (BVFI) is a rare diagnosis causing dyspnea, dysphonia and dysphagia. Management depends on respiratory performance, airway patency, vocal ability, and quality-of-life priorities. The authors review the presentation, management and outcome in patients diagnosed with BVFI. The utility and efficacy of the Empey index (EI) and the Expiratory Disproportion Index (EDI) are evaluated as an objective monitoring tools for BVFI patients. A 13-year retrospective review was performed of BVFI patients at St. Michael's Hospital, University of Toronto, a tertiary referral centre for laryngology. Forty-eight patients were included; 46 presented with airway obstruction symptoms. Tracheotomy was required for airway management in 40% of patients throughout the course of their treatment, which was reduced to 19% at the end of the study period. Twenty-one patients underwent endoscopic arytenoidectomy/cordotomy. Non-operative management included continuous positive airway pressure devices. Pulmonary function testing was carried out in 29 patients. Only a portion of the BVFI patients met the defined upper airway obstruction criteria (45% EI and 52% EDI). Seven patients had complete pre- and post-operative PFTs for comparison and all seven had ratios that significantly improved post-operatively which correlated clinically. The EI and EDI have limited use in evaluating patients with who have variable upper airway obstruction, but may be helpful in monitoring within subject airway function changes.

  9. Nanocrystalline-diamond thin films with high pH and penicillin sensitivity prepared on a capacitive Si-SiO{sub 2} structure

    Energy Technology Data Exchange (ETDEWEB)

    Poghossian, A. [Institute of Nano- and Biotechnologies (INB), Aachen University of Applied Sciences, Campus Juelich, Juelich (Germany); Institute of Bio- and Nanosystems (IBN-2), Research Centre Juelich GmbH, Juelich (Germany)], E-mail: a.poghossian@fz-juelich.de; Abouzar, M.H.; Razavi, A.; Baecker, M. [Institute of Nano- and Biotechnologies (INB), Aachen University of Applied Sciences, Campus Juelich, Juelich (Germany); Institute of Bio- and Nanosystems (IBN-2), Research Centre Juelich GmbH, Juelich (Germany); Bijnens, N. [Institute for Materials Research, Hasselt University, Diepenbeek (Belgium); Williams, O.A.; Haenen, K. [Institute for Materials Research, Hasselt University, Diepenbeek (Belgium); Division IMOMEC, IMEC vzw., Diepenbeek (Belgium); Moritz, W. [Humboldt University Berlin, Berlin (Germany); Wagner, P. [Institute for Materials Research, Hasselt University, Diepenbeek (Belgium); Schoening, M.J. [Institute of Nano- and Biotechnologies (INB), Aachen University of Applied Sciences, Campus Juelich, Juelich (Germany); Institute of Bio- and Nanosystems (IBN-2), Research Centre Juelich GmbH, Juelich (Germany)

    2009-10-30

    A capacitive field-effect EDIS (electrolyte-diamond-insulator-semiconductor) sensor with improved pH and penicillin sensitivity has been realised using a nanocrystalline-diamond (NCD) film as sensitive gate material. The NCD growth process on SiO{sub 2} as well as an additional surface treatment in oxidising medium have been optimised to provide high pH-sensitive, non-porous O-terminated films without damage of the underlying SiO{sub 2} layer. The surface morphology of O-terminated NCD thin films and the layer structure of EDIS sensors have been studied by scanning electron microscopy (SEM) and transmission electron microscopy (TEM) methods. To establish the relative coverage of the surface functional groups generated by the oxidation of NCD surfaces, X-ray photoelectron spectroscopy analysis was carried out. The hydrophilicity of NCD thin films has been studied by water contact-angle measurements. A nearly Nernstian pH sensitivity of 54-57 mV/pH has been observed for O-terminated NCD films treated in an oxidising boiling mixture for 80 min and in oxygen plasma. The high pH-sensitive properties of O-terminated NCD have been used to develop an EDIS-based penicillin biosensor. A freshly prepared penicillin biosensor possesses a high sensitivity of 85 mV/decade in the concentration range of 0.1-2.5 mM penicillin G. The lower detection limit is 5 {mu}M.

  10. A facile electrochemical intercalation and microwave assisted exfoliation methodology applied to screen-printed electrochemical-based sensing platforms to impart improved electroanalytical outputs.

    Science.gov (United States)

    Pierini, Gastón D; Foster, Christopher W; Rowley-Neale, Samuel J; Fernández, Héctor; Banks, Craig E

    2018-06-12

    Screen-printed electrodes (SPEs) are ubiquitous with the field of electrochemistry allowing researchers to translate sensors from the laboratory to the field. In this paper, we report an electrochemically driven intercalation process where an electrochemical reaction uses an electrolyte as a conductive medium as well as the intercalation source, which is followed by exfoliation and heating/drying via microwave irradiation, and applied to the working electrode of screen-printed electrodes/sensors (termed EDI-SPEs) for the first time. This novel methodology results in an increase of up to 85% of the sensor area (electrochemically active surface area, as evaluated using an outer-sphere redox probe). Upon further investigation, it is found that an increase in the electroactive area of the EDI-screen-printed based electrochemical sensing platforms is critically dependent upon the analyte and its associated electrochemical mechanism (i.e. adsorption vs. diffusion). Proof-of-concept for the electrochemical sensing of capsaicin, a measure of the hotness of chillies and chilli sauce, within both model aqueous solutions and a real sample (Tabasco sauce) is demonstrated in which the electroanalytical sensitivity (a plot of signal vs. concentration) is doubled when utilising EDI-SPEs over that of SPEs.

  11. The complexities of HIPAA and administration simplification.

    Science.gov (United States)

    Mozlin, R

    2000-11-01

    The Health Insurance Portability and Accessibility Act (HIPAA) was signed into law in 1996. Although focused on information technology issues, HIPAA will ultimately impact day-to-day operations at multiple levels within any clinical setting. Optometrists must begin to familiarize themselves with HIPAA in order to prepare themselves to practice in a technology-enriched environment. Title II of HIPAA, entitled "Administration Simplification," is intended to reduce the costs and administrative burden of healthcare by standardizing the electronic transmission of administrative and financial transactions. The Department of Health and Human Services is expected to publish the final rules and regulations that will govern HIPAA's implementation this year. The rules and regulations will cover three key aspects of healthcare delivery: electronic data interchange (EDI), security and privacy. EDI will standardize the format for healthcare transactions. Health plans must accept and respond to all transactions in the EDI format. Security refers to policies and procedures that protect the accuracy and integrity of information and limit access. Privacy focuses on how the information is used and disclosure of identifiable health information. Security and privacy regulations apply to all information that is maintained and transmitted in a digital format and require administrative, physical, and technical safeguards. HIPAA will force the healthcare industry to adopt an e-commerce paradigm and provide opportunities to improve patient care processes. Optometrists should take advantage of the opportunity to develop more efficient and profitable practices.

  12. Nutritional management of anorexic patients with and without fluoxetine: 1-year follow-up.

    Science.gov (United States)

    Ruggiero, Giovanni M; Mauri, Massimo C; Omboni, Anna C; Volonteri, Lucia S; Dipasquale, Savina; Malvini, Lara; Redaelli, Gabriella; Pasqualinotto, Lucia; Cavagnini, Francesco

    2003-05-01

    This study evaluated the efficacy of nutritional management with and without fluoxetine (FLX) in anorexia nervosa diagnosed according to Diagnostic and Statistical Manual of Mental Disorders (DSM-IV) criteria. Twenty-one patients, with a mean body mass index (BMI) of 15.21+/-2.33 kg/m(2), were treated with nutritional management and FLX at a mean dosage of 30.00+/-9.35 mg (pharmacological group); seventy-four patients, with a mean BMI of 14.24+/-2.16 kg/m(2), were treated only with nutritional management (nutritional group). Clinical evaluation was carried out under single-blind conditions at basal time and after 3, 6, and 12 months by a structured clinical interview, the Eating Disorder Interview based on Longitudinal Interval Follow-Up Evaluation (EDI-LIFE) and using a self-reported questionnaire, the Eating Disorder Inventory (EDI). BMI significantly increased in both the two treatment groups. In addition, the increase shown by the pharmacological group appeared near the beginning of treatment (i.e., at T1) and it was significantly higher than the increase shown by the nutritional group. Physical exercise showed a significant decrease in the pharmacological treatment group. On the other hand, fear of fatness and the scores of the subscales of the EDI significantly decreased in the nutritional treatment group. In terms of weight, the pharmacological group presented the higher amount of therapeutic success.

  13. Food survey: levels and potential health risks of chromium, lead, zinc and copper content in fruits and vegetables consumed in Algeria.

    Science.gov (United States)

    Cherfi, Abdelhamid; Abdoun, Samira; Gaci, Ouardia

    2014-08-01

    A food survey was carried out with the aim to investigate the levels of lead (Pb), zinc (Zn), copper (Cu) and chromium (Cr) in various fruits and vegetables sold in Algeria. Concentrations (mg/kgdry wt.) in selected foodstuffs were detected within the following ranges: 4-29.49, 11.17-49, 12.33-39.33 and 3-16.33 for Cu, Zn, Pb and Cr respectively. The food ingestion rate of the selected items was investigated by self-administered questionnaires which were filled by a total of 843 people randomly recruited at the exit of markets. The potential health risk for consumers was investigated by estimating the daily intake (EDI) and the target hazard quotient (THQ) for each heavy metal. For all foodstuffs, the EDI and the THQ were below the threshold values for Cu, Zn and Cr while they exceeded the thresholds for Pb (EDI: 15.66μgPb/kg body weight/day; THQ: 4.37), indicating an obvious health risk over a life time of exposure. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. Monitoring and risk assessment of pesticides in fresh omija (Schizandra chinensis Baillon) fruit and juice.

    Science.gov (United States)

    Jeong, Hye Ran; Lim, Sung Jin; Cho, Jae Young

    2012-02-01

    Schizandra chinensis Baillon, or omija, is a fruit native to northeast Asia that is cultivated in South Korea and China. Fresh omija fruit has been used in beverages, traditional East Asian medicine and cosmetics because of its complex flavor and pharmacological effectiveness. The objective of this study was to analyze residue levels of 33 kinds of pesticides on fresh omija fruits and in omija juices produced in South Korea. A risk assessment of the pesticides in omija juice was conducted by calculating EDI and ADI. Most of the pesticide levels were below the LOD in fresh omija fruits. Among the detected compounds, the most frequently detected pesticide was ethoprophos. The EDIs of ethoprophos, pendimethalin and hexaconazole were 5.89E-03, 7.08E-04 and 4.73E-05, respectively. The percent of EDI to ADI of ethoprophos, pendimethalin and hexaconazole was 28.0%, 13.6% and 4.5%, respectively. The results of this research concluded that the detected pesticides are not harmful to human beings. Published by Elsevier Ltd.

  15. Nanocrystalline-diamond thin films with high pH and penicillin sensitivity prepared on a capacitive Si-SiO2 structure

    International Nuclear Information System (INIS)

    Poghossian, A.; Abouzar, M.H.; Razavi, A.; Baecker, M.; Bijnens, N.; Williams, O.A.; Haenen, K.; Moritz, W.; Wagner, P.; Schoening, M.J.

    2009-01-01

    A capacitive field-effect EDIS (electrolyte-diamond-insulator-semiconductor) sensor with improved pH and penicillin sensitivity has been realised using a nanocrystalline-diamond (NCD) film as sensitive gate material. The NCD growth process on SiO 2 as well as an additional surface treatment in oxidising medium have been optimised to provide high pH-sensitive, non-porous O-terminated films without damage of the underlying SiO 2 layer. The surface morphology of O-terminated NCD thin films and the layer structure of EDIS sensors have been studied by scanning electron microscopy (SEM) and transmission electron microscopy (TEM) methods. To establish the relative coverage of the surface functional groups generated by the oxidation of NCD surfaces, X-ray photoelectron spectroscopy analysis was carried out. The hydrophilicity of NCD thin films has been studied by water contact-angle measurements. A nearly Nernstian pH sensitivity of 54-57 mV/pH has been observed for O-terminated NCD films treated in an oxidising boiling mixture for 80 min and in oxygen plasma. The high pH-sensitive properties of O-terminated NCD have been used to develop an EDIS-based penicillin biosensor. A freshly prepared penicillin biosensor possesses a high sensitivity of 85 mV/decade in the concentration range of 0.1-2.5 mM penicillin G. The lower detection limit is 5 μM.

  16. Serial single molecule electron diffraction imaging: diffraction background of superfluid helium droplets

    Science.gov (United States)

    Zhang, Jie; He, Yunteng; Lei, Lei; Alghamdi, Maha; Oswalt, Andrew; Kong, Wei

    2017-08-01

    In an effort to solve the crystallization problem in crystallography, we have been engaged in developing a method termed "serial single molecule electron diffraction imaging" (SS-EDI). The unique features of SS-EDI are superfluid helium droplet cooling and field-induced orientation: together the two features constitute a molecular goniometer. Unfortunately, the helium atoms surrounding the sample molecule also contribute to a diffraction background. In this report, we analyze the properties of a superfluid helium droplet beam and its doping statistics, and demonstrate the feasibility of overcoming the background issue by using the velocity slip phenomenon of a pulsed droplet beam. Electron diffraction profiles and pair correlation functions of ferrocene-monomer-doped droplets and iodine-nanocluster-doped droplets are presented. The timing of the pulsed electron gun and the effective doping efficiency under different dopant pressures can both be controlled for size selection. This work clears any doubt of the effectiveness of superfluid helium droplets in SS-EDI, thereby advancing the effort in demonstrating the "proof-of-concept" one step further.

  17. Coupled-spin filtered MR imaging in a low field

    International Nuclear Information System (INIS)

    Baudouin, C.J.; Bryant, D.J.; Coutts, G.A.; Bydder, G.M.; Young, I.R.

    1990-01-01

    This paper investigates the use of an editing method of imaging using spin-echo sequences with differing radio-frequency (RF) pulses for lipid imaging in poor fields and to compare it with solvent-suppression methods. A technique of echo difference imaging (EDI) has been described in which two data sets are acquired: a normal spin-echo sequence (90-180) and a 90-90 spin-echo sequence. The intrinsic signal of uncoupled spins in the EDI method is one-half that of the conventional sequence, so that subtracting twice the EDI signal from the conventional signal should result in signal cancellation. With coupled spins, the application of the second 90 degrees pulse results in coherence transfer, and echo magnitude will not be one-half that of the 90-180 echo. This method of lipid imaging may be less vulnerable to field inhomogeneity than are solvent-suppression methods. Phantom and in vivo studies were performed at 0.15 T (TE = 44 msec and various TRs)

  18. Skill of Predicting Heavy Rainfall Over India: Improvement in Recent Years Using UKMO Global Model

    Science.gov (United States)

    Sharma, Kuldeep; Ashrit, Raghavendra; Bhatla, R.; Mitra, A. K.; Iyengar, G. R.; Rajagopal, E. N.

    2017-11-01

    The quantitative precipitation forecast (QPF) performance for heavy rains is still a challenge, even for the most advanced state-of-art high-resolution Numerical Weather Prediction (NWP) modeling systems. This study aims to evaluate the performance of UK Met Office Unified Model (UKMO) over India for prediction of high rainfall amounts (>2 and >5 cm/day) during the monsoon period (JJAS) from 2007 to 2015 in short range forecast up to Day 3. Among the various modeling upgrades and improvements in the parameterizations during this period, the model horizontal resolution has seen an improvement from 40 km in 2007 to 17 km in 2015. Skill of short range rainfall forecast has improved in UKMO model in recent years mainly due to increased horizontal and vertical resolution along with improved physics schemes. Categorical verification carried out using the four verification metrics, namely, probability of detection (POD), false alarm ratio (FAR), frequency bias (Bias) and Critical Success Index, indicates that QPF has improved by >29 and >24% in case of POD and FAR. Additionally, verification scores like EDS (Extreme Dependency Score), EDI (Extremal Dependence Index) and SEDI (Symmetric EDI) are used with special emphasis on verification of extreme and rare rainfall events. These scores also show an improvement by 60% (EDS) and >34% (EDI and SEDI) during the period of study, suggesting an improved skill of predicting heavy rains.

  19. Self-esteem in patients treated for anorexia nervosa.

    Science.gov (United States)

    Karpowicz, Ewa; Skärsäter, Ingela; Nevonen, Lauri

    2009-10-01

    Anorexia nervosa (AN) mainly affects girls or women between 13 and 45 years of age. According to previous studies, one of the reasons for the desire to be thin is low self-esteem. The purpose of the study was to examine the self-esteem of 38 female patients with AN between 16 and 25 years of age, before and after 3 months of treatment at a specialist ward for eating disorders in Göteborg, Sweden. A quantitative pre- and post-assessment based on two self-rating questionnaires, the Rosenberg Self-Esteem Scale (RSE-S) and three subscales (weight phobia, body dissatisfaction, and ineffectiveness) of Eating Disorder Inventory-2 (EDI-2), together with body mass index (BMI), were used in the study, which was conducted between June 2005 and March 2008. The results reveal that self-esteem, BMI, weight phobia, and body dissatisfaction improved significantly between pre- and post-treatment. The RSE-S and EDI-2 ineffectiveness correlate highly with one another, which lends support to convergent validity, and the internal consistency was high for both the RSE-S and EDI-2 ineffectiveness. The results indicate that the treatment was effective, as both patients' self-esteem and BMI increased after completed treatment, which was the primary goal of the treatment at this ward. Future studies should focus on follow up and the way self-esteem manifests itself at different points in time within an individual.

  20. Energy savings in distillation via identification of useful configurations

    Science.gov (United States)

    Shah, Vishesh Hemanshu

    with low heat duties. The heat duty requirements are estimated using the Underwood equations. Application of these frameworks has provided an array of distillation configurations that can potentially have up to 50% lower heat duty than the currently used distillation configuration for petroleum crude distillation. Since petroleum crude distillation is a highly energy-intensive process, these configurations have tremendous potential to improve the energy efficiency of a refinery. Furthermore, we provide evidence to disprove some conventional notions about thermally coupled configurations. We also describe some previously unknown distillation configurations that use less than (n-1) distillation columns for an n-component separation. We demonstrate that these novel distillation configurations have significantly lower heat duties than the currently known distillation configurations with less than (n-1) columns. Since these configurations have one or more distillation columns that produce sidestreams, a quick screening tool based on Underwood's equations cannot be used to estimate the heat duty requirements of these configurations. Therefore, we lay the foundation for equations analogous to Underwood's equations to estimate the minimum heat duty requirements of such distillation configurations.