1977-06-01
0 17.5 .0 .0 .0 .0 .0 .0 .0 FACE »21 »TW* ■■’■ "■ IIUI" »E«ICD! fOVE«-«LO 1963-1970 JANUARY TABLE 18 (CONTi IKEA 0021 TOINDADE...DIRECTION VIPSuS SE4 HEIGHTS IFTl IKEA 0024 ST, PETER AND PAUL ROCKS ,6N 29.3» s iu HGT 1-3 4-10 11-21 22-33 34-47 41« PCT 1...l". - L ■■■’■■’ • ’ " wwm PEIKOl iQVER-»LLI IS’OS-l1»?» I SFPTEMBfR TABLE 16 (CDNT1 IKEA 002« ST. PETER AND PAUL RCfKS
Bank-to-Turn Cruise Missile Terminal Guidance and Control Law Comparison.
1983-06-01
Me. aboma sae ,.i to 8"leeiSWwm ** f Rewe) .I SUPPLI01MENTARV MOTEU It. KEy WORM Cr# a OOWm@ &&. #1 00@00@Wp ad UEW~fltgp eek MrnS.) Bank-To-Turn...IIUI’ IUtfl- 0o 9 .- I % e*IPo’%LU3 0-0’-.j% o7U. ’ U k.246 "’. 4140 0-SW 4&6 6 J~ 1"IJ~ 1 LA t Lurnp-68’Ol- 00 goN44. 4S II- 03 t--0 - ’.0 stU oc o*3...0 1 U’- 0 1- U~- 04 3 t- .- 0 0 01 0.0 4140 3’ W 4O’J40 40404.040177( * 0 .0oOZ .0 4U. JJ~* ~1ZNZ ..00ZO~O000UnowZ -- a 0 0 3 * 0 e0-a0 3 % Z 14 01
Jackson, Wallace
2014-01-01
If you're an Android application developer, chances areyou're using fixed, scrolling, swipe-able, and other cutting-edge custom UIDesigns in your Android development projects. These UI Design approaches aswell as other Android ViewGroup UI layout containers are the bread and butterof Pro Android User Interface (UI) design and Android User Experience (UX)design and development.Using a top down approach, Pro Android UI shows you how todesign and develop the best user interface for your app, while taking intoaccount the varying device form factors in the increasingly fragmented Androidenvironment
Boduch, Adam
2013-01-01
Filled with a practical collection of recipes, jQuery UI Cookbook is full of clear, step-by-step instructions that will help you harness the powerful UI framework in jQuery. Depending on your needs, you can dip in and out of the Cookbook and its recipes, or follow the book from start to finish.If you are a jQuery UI developer looking to improve your existing applications, extract ideas for your new application, or to better understand the overall widget architecture, then jQuery UI Cookbook is a must-have for you. The reader should at least have a rudimentary understanding of what jQuery UI is
Ganatra, Sagar
2014-01-01
This book is an easy-to-follow guide full of hands-on examples that allows you to learn and build visually compelling web applications using the Kendo UI library. This book will do wonders for web developers having knowledge of HTML and Javascript and want to polish their skills in building applications using the Kendo UI library.
Anderson, Rupert
2015-01-01
This book is aimed at developers and technical testers who are looking for a quick way to take their SoapUI skills and understanding to the next level. Even if you are new to SoapUI but have basic Java skills and a reasonable grasp of RESTFul and Soap web services, then you should have no problem making use of this book.
Energy Technology Data Exchange (ETDEWEB)
Weissenbach, Kurt (ed.)
2016-02-16
The Baden-Wuerttemberg Environmental Information System (UIS BW), which was set up over 30 years ago, has developed into a strategic national policy instrument for precautionary environmental and climate protection. Its importance will continue to increase as digitalisation progresses. The associated framework concept (RK UIS) has been regularly updated since 1989. The RK UIS 2015 is a fundamental revision of the last framework concept from the year 2006. The legal, technical, technical and organizational requirements that have since been amended have been incorporated and reflected in their impact on the overall conceptual framework. The RK UIS 2015 documents recommendations and development goals for adapting the UIS BW to the changed targets and general conditions. The renewed conceptual framework forms the basis for the further development of the individual UIS components. [German] Das in ueber 30 Jahren aufgebaute Umweltinformationssystem Baden-Wuerttemberg (UIS BW) hat sich zu einem strategischen Instrument der Landespolitik fuer einen vorsorgenden Umwelt- und Klimaschutz entwickelt. Seine Bedeutung wird durch die fortschreitende Digitalisierung weiter zunehmen. Die zugehoerige Rahmenkonzeption (RK UIS) wird seit 1989 regelmaessig fortgeschrieben. Mit der RK UIS 2015 liegt eine grundlegende Ueberarbeitung der letzten Rahmenkonzeption aus dem Jahr 2006 vor. Die seitdem geaenderten rechtlichen, fachlichen, technischen und organisatorischen Anforderungen wurden aufgenommen und in ihren Auswirkungen auf den konzeptionellen Gesamtrahmen reflektiert. Die RK UIS 2015 dokumentiert Empfehlungen und Entwicklungsziele fuer die Anpassung des UIS BW an die veraenderten Zielvorgaben und Rahmenbedingungen. Der erneuerte konzeptionelle Gesamtrahmen bildet die Basis fuer die Weiterentwicklung der einzelnen UIS-Komponenten.
Zhang, Yuguang
2013-01-01
Written with an example-based approach, Building UIs with Wijmo leads you step by step through the implementation and customization of each library component and its associated resources. Reference tables of each configuration option, method, and event for each component are provided, alongside detailed explanations of how each widget is used.Building UIs with Wijmo is targeted at readers who are familiar with HTML, CSS, JavaScript, and jQuery, and have a basic understanding of web development. Although knowledge of jQuery UI is not mandatory, it would be a bonus as it is quite similar to Wijm
Luiz, Joseandro
2013-01-01
Get to grips with a new technology, understand what it is and what it can do for you, and then get to work with the most important features and tasks.The book is a Starter guide to learning ForgedUI. This book will start by unfolding the installation and creating a simple application using Titanium and ForgedUI, followed by taking you through the features to model an engaging UI and generate multi-platform code with Titanium, while covering the best design practice for Apple and Android application development. Last but not least, you will also come across the available resources where you can
Creating dynamic UI with Android fragments
Wilson, Jim
2013-01-01
A fast-paced tutorial that guides you through everything you need to know about dynamic UI design for Android devices.This book is for developers with a basic understanding of Android programming who would like to improve the appearance and usability of their applications. Whether you're looking to create a more interactive user experience, create more dynamically adaptive UIs, provide better support for tablets and smartphones in a single app, reduce the complexity of managing your app UIs, or you are just trying to expand your UI design philosophy, then this book is for you.
International Nuclear Information System (INIS)
Khan, M. N.; Hassan, T.; Shah, H.; Abid, S.; Raza, I.; Abbasi, S. S.
2015-01-01
Watershed Project organizing different professional trainings to create awareness about water saving technologies as solar powered irrigation system, drip irrigation, sprinkler irrigation, micro catchment, rooftop rainwater harvesting and irrigation scheduling. Therefore, the project activities also include the training of the professionals from the line departments for the demonstrated technologies to foster the process of adoption. For this purpose Climate and Alternate Energy Water Resources Institute, NARC, organized a professional training on Water Rehabilitation and Irrigation Technology Improvements in April, 2014 in collaboration with ICARDA and USDA. Twenty seven professionals from different organizations and departments namely; Al-Mustafa Development Network (ADN), Taleem Foundation, Islamic International University (IIUI) Islamabad, National Agricultural Research Centre (NARC), National Centre for Rural Development (NCRD), National Rural Support Programme (NRSP), On-Farm Water Management (OFWM), Water Management (WM), Potohar Organization for Development Advocacy (PODA), Quaid-i-Azam University (QAU) and Environmental Sciences actively participated in the professional training. The post-training assessment showed that it had positive impact on the awareness of professionals. Majority of the participants were strongly and merely agreed upon the training practicality, technologies adoption probability and its advantages at farmer's field. Overall, most of the training participants were satisfied with the knowledge sharing presentations about the specific technologies discussed during the training. (author)
Environmental Information System Baden-Wuerttemberg. RK UIS 2015 framework concept 2015
International Nuclear Information System (INIS)
Weissenbach, Kurt
2016-01-01
The Baden-Wuerttemberg Environmental Information System (UIS BW), which was set up over 30 years ago, has developed into a strategic national policy instrument for precautionary environmental and climate protection. Its importance will continue to increase as digitalisation progresses. The associated framework concept (RK UIS) has been regularly updated since 1989. The RK UIS 2015 is a fundamental revision of the last framework concept from the year 2006. The legal, technical, technical and organizational requirements that have since been amended have been incorporated and reflected in their impact on the overall conceptual framework. The RK UIS 2015 documents recommendations and development goals for adapting the UIS BW to the changed targets and general conditions. The renewed conceptual framework forms the basis for the further development of the individual UIS components. [de
Benzimidazole-functionalized Zr-UiO-66 nanocrystals for luminescent sensing of Fe3+ in water
International Nuclear Information System (INIS)
Dong, Yingying; Zhang, Hanzhuo; Lei, Fan; Liang, Mei; Qian, Xuefeng; Shen, Peilian; Xu, Hui; Chen, Zhihui; Gao, Junkuo; Yao, Juming
2017-01-01
Zr-based MOF structure UiO-66 exhibits unprecedented high thermal and chemical stability, making it to be one of the most used MOFs in various applications. Yet, the poor photoluminescent (PL) properties of UiO-66 limit its applications in luminescent sensing. Herein, a new benzimidazole-functionalized UiO-66 nanocrystal (UiO-66-BI) was successfully fabricated via microwave synthesis. UiO-66-BI displayed octahedral nanocrystal morphology with a diameter smaller than 200 nm and could disperse well in water and common organic solvents. UiO-66-BI demonstrated extended optical absorption in the visible-light region and efficiently improved PL emission compared with UiO-66 pristine. The sensing properties of UiO-66-BI nanocrystals towards different ions were studied, and the results demonstrated that UiO-66-BI showed excellent selective luminescent sensing of Fe 3+ ions in water.
Selective adsorption of cationic dyes by UiO-66-NH{sub 2}
Energy Technology Data Exchange (ETDEWEB)
Chen, Qi; He, Qinqin; Lv, Mengmeng; Xu, Yanli; Yang, Hanbiao; Liu, Xueting, E-mail: wmlxt@163.com; Wei, Fengyu, E-mail: weifyliuj@163.com
2015-02-01
Graphical abstract: - Highlights: • Two Zr(IV)-based MOFs can remove cationic dyes more effectively than anionic dyes. • UiO-66 has higher selectivity for cationic dyes after modification with NH{sub 2}. • The mechanism for adsorption selectivity is rationally proposed. - Abstract: Herein, two zirconium(IV)-based MOFs UiO-66 and UiO-66-NH{sub 2} had been successfully prepared by a facile solvothermal method and were characterized by X-ray diffraction (XRD), field emission transmission electron microscopy (FETEM), N{sub 2} adsorption–desorption (BET), X-ray photoelectron spectroscopy (XPS), and zeta potential. They exhibit small size, large surface area, and can remove cationic dyes from aqueous solution more effectively than anionic dyes. This adsorption selectivity is due to the favorable electrostatic interactions between the adsorbents and cationic dyes. Furthermore, owing to the individual micropore structure of UiO-66-NH{sub 2} and its more negative zeta potential resulted from the charge balance for the protonation of –NH{sub 2}, UiO-66-NH{sub 2} displays much higher adsorption capacity for cationic dyes and lower adsorption capacity for anionic dyes than UiO-66.
Benzimidazole-functionalized Zr-UiO-66 nanocrystals for luminescent sensing of Fe{sup 3+} in water
Energy Technology Data Exchange (ETDEWEB)
Dong, Yingying; Zhang, Hanzhuo; Lei, Fan; Liang, Mei; Qian, Xuefeng; Shen, Peilian [The Key laboratory of Advanced Textile Materials and Manufacturing Technology of Ministry of Education, National Engineering Lab for Textile Fiber Materials and Processing Technology (Zhejiang), College of Materials and Textiles, Zhejiang Sci-Tech University, Hangzhou 310018 (China); Xu, Hui, E-mail: huixu@cjlu.edu.cn [Institute of Coordination Bond Metrology and Engineering, College of Materials Science and Engineering, China Jiliang University, Hangzhou 310018 (China); Chen, Zhihui, E-mail: huixu.chen@gmail.com [The Key laboratory of Advanced Textile Materials and Manufacturing Technology of Ministry of Education, National Engineering Lab for Textile Fiber Materials and Processing Technology (Zhejiang), College of Materials and Textiles, Zhejiang Sci-Tech University, Hangzhou 310018 (China); Key Lab of Advanced Transducers and Intelligent Control System, Ministry of Education and Shanxi Province, College of Physics and Optoelectronics, Taiyuan University of Technology, Taiyuan 030024 (China); Gao, Junkuo, E-mail: jkgao@zstu.edu.cn [The Key laboratory of Advanced Textile Materials and Manufacturing Technology of Ministry of Education, National Engineering Lab for Textile Fiber Materials and Processing Technology (Zhejiang), College of Materials and Textiles, Zhejiang Sci-Tech University, Hangzhou 310018 (China); Yao, Juming [The Key laboratory of Advanced Textile Materials and Manufacturing Technology of Ministry of Education, National Engineering Lab for Textile Fiber Materials and Processing Technology (Zhejiang), College of Materials and Textiles, Zhejiang Sci-Tech University, Hangzhou 310018 (China)
2017-01-15
Zr-based MOF structure UiO-66 exhibits unprecedented high thermal and chemical stability, making it to be one of the most used MOFs in various applications. Yet, the poor photoluminescent (PL) properties of UiO-66 limit its applications in luminescent sensing. Herein, a new benzimidazole-functionalized UiO-66 nanocrystal (UiO-66-BI) was successfully fabricated via microwave synthesis. UiO-66-BI displayed octahedral nanocrystal morphology with a diameter smaller than 200 nm and could disperse well in water and common organic solvents. UiO-66-BI demonstrated extended optical absorption in the visible-light region and efficiently improved PL emission compared with UiO-66 pristine. The sensing properties of UiO-66-BI nanocrystals towards different ions were studied, and the results demonstrated that UiO-66-BI showed excellent selective luminescent sensing of Fe{sup 3+} ions in water.
UiO-66-NH2/GO Composite: Synthesis, Characterization and CO2 Adsorption Performance
Directory of Open Access Journals (Sweden)
Yan Cao
2018-04-01
Full Text Available In this work, a new composite materials of graphene oxide (GO-incorporated metal-organic framework (MOF(UiO-66-NH2/GO were in-situ synthesized, and were found to exhibit enhanced high performances for CO2 capture. X-ray diffraction (XRD, scanning electron microscope (SEM, N2 physical adsorption, and thermogravimetric analysis (TGA were applied to investigate the crystalline structure, pore structure, thermal stability, and the exterior morphology of the composite. We aimed to investigate the influence of the introduction of GO on the stability of the crystal skeleton and pore structure. Water, acid, and alkali resistances were tested for physical and chemical properties of the new composites. CO2 adsorption isotherms of UiO-66, UiO-66-NH2, UiO-66/GO, and UiO-66-NH2/GO were measured at 273 K, 298 K, and 318 K. The composite UiO-66-NH2/GO exhibited better optimized CO2 uptake of 6.41 mmol/g at 273 K, which was 5.1% higher than that of UiO-66/GO (6.10 mmol/g. CO2 adsorption heat and CO2/N2 selectivity were then calculated to further evaluate the CO2 adsorption performance. The results indicated that UiO-66-NH2/GO composites have a potential application in CO2 capture technologies to alleviate the increase in temperature of the earth’s atmosphere.
2011-02-16
... effectiveness and public accountability by focusing on program results, service quality, and customer satisfaction. Outcome Goal 1.3 in the Department's fiscal year (FY) 2011--2016 Strategic Plan--Help workers who... Measures The UI reemployment GPRA and UI Performs measures are defined as the percentage of all UI...
Geske, Eli
2013-01-01
A fast-paced, example-based guide to learning DHTMLX.""Learning DHTMLX Suite UI"" is for web designers who have a basic knowledge of JavaScript and who are looking for powerful tools that will give them an extra edge in their own application development. This book is also useful for experienced developers who wish to get started with DHTMLX without going through the trouble of learning its quirks through trial and error. Readers are expected to have some knowledge of JavaScript, HTML, Document Object Model, and the ability to install a local web server.
The UIS Model for Online Success
Bloemer, Bill
2009-01-01
This case study describes the philosophy underlying the delivery of online programs and courses at the University of Illinois-Springfield. The strategies used to implement the UIS model and the measures used to validate its success are outlined. These factors are reviewed in the context of the Sloan-C Five Pillars for quality learning environments.
Enhancement of Oxidative Desulfurization Performance over UiO-66(Zr) by Titanium Ion Exchange.
Ye, Gan; Qi, Hui; Li, Xiaolin; Leng, Kunyue; Sun, Yinyong; Xu, Wei
2017-07-19
Oxidative desulfurization is considered to be one of the most promising methods for producing ultra-low-sulfur fuels because it can effectively remove refractory sulfur-containing aromatic compounds under mild conditions. In this work, the oxidative desulfurization performance over UiO-66(Zr) is greatly enhanced by Ti ion exchange. This strategy is not only efficient for UiO-66(Zr) with crystal defects but also for UiO-66(Zr) with high crystallinity. In particular, the performance of UiO-66(Zr) with high crystallinity in the oxidative desulfurization of dibenzothiophene can be improved more than 11-fold, which can be mainly attributed to the introduction of active Ti sites. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
All-gas-phase synthesis of UiO-66 through modulated atomic layer deposition
Lausund, Kristian Blindheim; Nilsen, Ola
2016-11-01
Thin films of stable metal-organic frameworks (MOFs) such as UiO-66 have enormous application potential, for instance in microelectronics. However, all-gas-phase deposition techniques are currently not available for such MOFs. We here report on thin-film deposition of the thermally and chemically stable UiO-66 in an all-gas-phase process by the aid of atomic layer deposition (ALD). Sequential reactions of ZrCl4 and 1,4-benzenedicarboxylic acid produce amorphous organic-inorganic hybrid films that are subsequently crystallized to the UiO-66 structure by treatment in acetic acid vapour. We also introduce a new approach to control the stoichiometry between metal clusters and organic linkers by modulation of the ALD growth with additional acetic acid pulses. An all-gas-phase synthesis technique for UiO-66 could enable implementations in microelectronics that are not compatible with solvothermal synthesis. Since this technique is ALD-based, it could also give enhanced thickness control and the possibility to coat irregular substrates with high aspect ratios.
Low wage after unemployment - the effect of changes in the UI system
DEFF Research Database (Denmark)
Bolvig, Iben
Low-wage jobs in Denmark are characterized by short durations and a relatively high mobility to higher wage positions, but also to unemployment. This fact might to some extent be attributed to the generous Danish UI system. The theoretical prediction for this relation is twofold. First, a generous...... UI system will increase reservation wages and thereby increase the effective minimum wage. This will exclude the least productive individuals from employment and thereby increase the lowest skill level among employed individuals. Hence, the Danish low-wage earners will tend to be better qualified...... and their duration as low-wage earners will therefore tend to be shorter. Second, the generous benefit system will allow the unemployed person to wait for better jobs, and likewise, force the employing firms to provide jobs with better prospects. By exploiting several tightening of the Danish UI system during...
International Nuclear Information System (INIS)
Ahn, Jun-Ho; Ahn, Soon Kil; Lee, Michael
2012-01-01
Highlights: ► We recently discovered a potent and selective B-Raf inhibitor, UI-152. ► UI-152 displayed a selective cytotoxicity toward v-Ha-ras transformed cells. ► UI-152-induced growth inhibition was largely meditated by autophagy. ► UI-152 induced paradoxical activation of Raf-1. -- Abstract: In human cancers, B-Raf is the most frequently mutated protein kinase in the MAPK signaling cascade, making it an important therapeutic target. We recently discovered a potent and selective B-Raf inhibitor, UI-152, by using a structure-based drug design strategy. In this study, we examined whether B-Raf inhibition by UI-152 may be an effective therapeutic strategy for eliminating cancer cells transformed with v-Ha-ras (Ras-NIH 3T3). UI-152 displayed selective cytotoxicity toward Ras-NIH 3T3 cells while having little to no effect on non-transformed NIH 3T3 cells. We found that treatment with UI-152 markedly increased autophagy and, to a lesser extent, apoptosis. However, inhibition of autophagy by addition of 3-MA failed to reverse the cytotoxic effects of UI-152 on Ras-NIH 3T3 cells, demonstrating that apoptosis and autophagy can act as cooperative partners to induce growth inhibition in Ras-NIH 3T3 cells treated with UI-152. Most interestingly, cell responses to UI-152 appear to be paradoxical. Here, we showed that although UI-152 inhibited ERK, it induced B-Raf binding to Raf-1 as well as Raf-1 activation. This paradoxical activation of Raf-1 by UI-152 is likely to be coupled with the inhibition of the mTOR pathway, an intracellular signaling pathway involved in autophagy. We also showed for the first time that, in multi-drug resistant cells, the combination of UI-152 with verapamil significantly decreased cell proliferation and increased autophagy. Thus, our findings suggest that the inhibition of autophagy, in combination with UI-152, offers a more effective therapeutic strategy for v-Ha-ras-transformed cells harboring wild-type B-Raf.
Indian Academy of Sciences (India)
Page 1. Science Smiles. RKLaxman. It saves a lot of bother, If you programme it, it goes about on its own taking pictures of tourist and historical interests, and returns. R -E-S-O-NA-N-C-E-I-J-UI-Y-19-9-7----~-------~~-------------------. 5.
RAY-UI: A powerful and extensible user interface for RAY
Energy Technology Data Exchange (ETDEWEB)
Baumgärtel, P., E-mail: peter.baumgaertel@helmholtz-berlin.de; Erko, A.; Schäfers, F. [Institute for Nanometre Optics and Technology Helmholtz Zentrum Berlin für Materialien und Energie Albert-Einstein-Str. 15, 12489 Berlin (Germany); Witt, M. [Department Operation Accelerator BESSY II Helmholtz Zentrum Berlin für Materialien und Energie Albert-Einstein-Str. 15, 12489 Berlin (Germany); Baensch, J.; Fabarius, M.; Schirmacher, H. [Fachbereich VI – Informatik und Medien Beuth Hochschule für Technik Berlin, Luxemburger Str. 10, 13353 Berlin (Germany)
2016-07-27
The RAY-UI project started as a proof-of-concept for an interactive and graphical user interface (UI) for the well-known ray tracing software RAY [1]. In the meantime, it has evolved into a powerful enhanced version of RAY that will serve as the platform for future development and improvement of associated tools. The software as of today supports nearly all sophisticated simulation features of RAY. Furthermore, it delivers very significant usability and work efficiency improvements. Beamline elements can be quickly added or removed in the interactive sequence view. Parameters of any selected element can be accessed directly and in arbitrary order. With a single click, parameter changes can be tested and new simulation results can be obtained. All analysis results can be explored interactively right after ray tracing by means of powerful integrated image viewing and graphing tools. Unlimited image planes can be positioned anywhere in the beamline, and bundles of image planes can be created for moving the plane along the beam to identify the focus position with live updates of the simulated results. In addition to showing the features and workflow of RAY-UI, we will give an overview of the underlying software architecture as well as examples for use and an outlook for future developments.
Scoppettone, G. Gary; Rissler, Peter H.; Salgado, J. Antonio; Harry, Beverly
2013-01-01
We compared cui-ui (Chasmistes cujus) recruitment from two reaches of the Truckee River with histories of severe erosional downcutting caused by a decline in Pyramid Lake surface elevation. In 1975, Marble Bluff Dam (MBD) was constructed 5 kilometers upstream of the extant mouth of the Truckee River to stabilize the upstream reach of the river; the downstream reach of the river remained unstable and consequently unsuitable for cui-ui recruitment. By the early 2000s, there was a decrease in the Truckee River’s slope from MBD to Pyramid Lake after a series of wet years in the 1990s. This was followed by changes in river morphology and erosion abatement. These changes led to the question as to cui-ui recruitment potential in the Truckee River downstream of MBD. In 2012, more than 7,000 cui-ui spawners were passed upstream of MBD, although an indeterminate number of cui-ui spawned downstream of MBD. In this study, we compared cui-ui recruitment upstream and downstream of MBD during a Truckee River low-flow year (2012). Cui-ui larvae emigration to Pyramid Lake began earlier and ended later downstream of MBD. A greater number of cui-ui larvae was produced downstream of MBD than upstream. This also was true for native Tahoe sucker (Catostomus tahoensis) and Lahontan redside (Richardsonius egregius). The improved Truckee River stability downstream of MBD and concomitant cui-ui recruitment success is attributed to a rise in Pyramid Lake's surface elevation. A decline in lake elevation may lead to a shift in stream morphology and substrate composition to the detriment of cui-ui reproductive success as well as the reproductive success of other native fishes.
Lu, Annie Xi; McEntee, Monica; Browe, Matthew A; Hall, Morgan G; DeCoste, Jared B; Peterson, Gregory W
2017-04-19
Textiles capable of capture and detoxification of toxic chemicals, such as chemical-warfare agents (CWAs), are of high interest. Some metal-organic frameworks (MOFs) exhibit superior reactivity toward CWAs. However, it remains a challenge to integrate powder MOFs into engineered materials like textiles, while retaining functionalities like crystallinity, adsorptivity, and reactivity. Here, we present a simple method of electrospinning UiO-66-NH 2 , a zirconium MOF, with polyvinylidene fluoride (PVDF). The electrospun composite, which we refer to as "MOFabric", exhibits comparable crystal patterns, surface area, chlorine uptake, and simulant hydrolysis to powder UiO-66-NH 2 . The MOFabric is also capable of breaking down GD (O-pinacolyl methylphosphonofluoridae) faster than powder UiO-66-NH 2. Half-life of GD monitored by solid-state NMR for MOFabric is 131 min versus 315 min on powder UiO-66-NH 2 .
2012-06-22
... DEPARTMENT OF LABOR Employment and Training Administration Comment Request for Information Collection for Self-Employment Assistance (SEA) for UI Claimants, Extension Without Revisions AGENCY... changes. Title: Self-Employment Assistance for UI Claimants. OMB Number: 1205-0490. Affected Public: State...
Thermodynamics of Pore Filling Metal Clusters in Metal Organic Frameworks: Pd in UiO-66
DEFF Research Database (Denmark)
Vilhelmsen, Lasse; Sholl, David S.
2012-01-01
Metal organic frameworks (MOFs) have experimentally been demonstrated to be capable of supporting isolated transition-metal clusters, but the stability of these clusters with respect to aggregation is unclear. In this letter we use a genetic algorithm together with density functional theory...... calculations to predict the structure of Pd clusters in UiO-66. The cluster sizes examined are far larger than those in any previous modeling studies of metal clusters in MOFs and allow us to test the hypothesis that the physically separated cavities in UiO-66 could stabilize isolated Pd clusters. Our...... calculations show that Pd clusters in UiO-66 are, at best, metastable and will aggregate into connected pore filling structures at equilibrium....
Reflection of a Year Long Model-Driven Business and UI Modeling Development Project
Sukaviriya, Noi; Mani, Senthil; Sinha, Vibha
Model-driven software development enables users to specify an application at a high level - a level that better matches problem domain. It also promises the users with better analysis and automation. Our work embarks on two collaborating domains - business process and human interactions - to build an application. Business modeling expresses business operations and flows then creates business flow implementation. Human interaction modeling expresses a UI design, its relationship with business data, logic, and flow, and can generate working UI. This double modeling approach automates the production of a working system with UI and business logic connected. This paper discusses the human aspects of this modeling approach after a year long of building a procurement outsourcing contract application using the approach - the result of which was deployed in December 2008. The paper discusses in multiple areas the happy endings and some heartache. We end with insights on how a model-driven approach could do better for humans in the process.
Measuring quality of life in patients with stress urinary incontinence: is the ICIQ-UI-SF adequate?
Kurzawa, Zuzanna; Sutherland, Jason M; Crump, Trafford; Liu, Guiping
2018-05-08
The International Consultation on Incontinence Questionnaire Short Form (ICIQ-UI-SF) is a widely used four-item patient-reported outcome (PRO) measure. Evaluations of this instrument are limited, restraining user's confidence in the instrument. This study conducts a comprehensive evaluation of the ICIQ-UI-SF on a sample of urological surgery patients in Canada. One hundred and seventy-seven surgical patients with stress urinary incontinence completed the ICIQ-UI-SF pre-operatively. Methods drawing from confirmatory factor analysis (CFA), measures of reliability, item response theory (IRT), and differential item functioning were applied. Ceiling effects were examined. Ceiling effects were identified. In the CFA, the factor loadings of items one and two differed significantly (p McDonald's coefficient (0.65). The IRT found the instrument does not discriminate between individuals with low incontinence-related quality of life. Due to low/moderate reliability, the ICIQ-UI-SF can be used as a complement to other data or used to report aggregated surgical outcomes among surgical patients. If the primary objective is to measure quality of life, other PROs should be considered.
Heat-Treatment of Defective UiO-66 from Modulated Synthesis: Adsorption and Stability Studies
International Nuclear Information System (INIS)
Jiao, Yang; Liu, Yang; Zhu, Guanghui; Hungerford, Julian T.; Bhattacharyya, Souryadeep
2017-01-01
Defect engineering in metal-organic frameworks (MOFs) is an emerging strategy that can be used to control physical or chemical characteristics of MOFs, including adsorption behavior and textural, mechanical, and conductive properties. Understanding the impact of defects on textural properties and chemical stability of MOFs is imperative to the development of MOFs with tunable defect sites. In this work, systematic adsorption measurements were performed with three adsorbate molecules (SO 2 , benzene, and cyclohexane) to investigate changes in the pore size of defective UiO-66. Compared to the parent UiO-66, the defective UiO-66 shows significant changes in adsorption capacities among the selected adsorbate molecules, demonstrating that pore size is significantly enlarged by the missing cluster defects. BET surface area analysis and DFT calculations were also performed to interrogate the chemical stability of the defective MOFs after exposure to water and acidic environments. This work shows that pore size can be tuned as a function of defect concentration. Further, it is shown that the structural incorporation of trifluoroacetate groups in defective UiO-66 leads to an increase in average pore size without sacrificing chemical stability toward water and acidic species. The results of this work advance the understanding of textural properties and chemical stability of defect-engineered MOFs and also suggest a preparation method for synthesizing defective but stable MOFs.
235U isotope enrichment in the metastable levels of UI
International Nuclear Information System (INIS)
Gagne, J.M.; Demers, Y.; Dreze, C.; Pianarosa, P.
1983-01-01
We have used optical pumping to produce a substantial 235 U enrichment in the metastable levels of UI in the discharge afterglow of a hollow-cathode vapor generator. The measured isotope-enrichment factor for the level at 3800 cm -1 is approximately 20
Lammert, Martin; Wharmby, Michael T; Smolders, Simon; Bueken, Bart; Lieb, Alexandra; Lomachenko, Kirill A; Vos, Dirk De; Stock, Norbert
2015-08-14
A series of nine Ce(iv)-based metal organic frameworks with the UiO-66 structure containing linker molecules of different sizes and functionalities were obtained under mild synthesis conditions and short reaction times. Thermal and chemical stabilities were determined and a Ce-UiO-66-BDC/TEMPO system was successfully employed for the aerobic oxidation of benzyl alcohol.
Energy Technology Data Exchange (ETDEWEB)
Sha, Zhou [Department of Chemistry, National University of Singapore, 3 Science Drive 3, 117543 (Singapore); NUS Environmental Research Institute, National University of Singapore, 5A Engineering Drive 1, #02-01, 117411 (Singapore); Chan, Hardy Sze On [Department of Chemistry, National University of Singapore, 3 Science Drive 3, 117543 (Singapore); Wu, Jishan, E-mail: chmwuj@nus.edu.sg [Department of Chemistry, National University of Singapore, 3 Science Drive 3, 117543 (Singapore); NUS Environmental Research Institute, National University of Singapore, 5A Engineering Drive 1, #02-01, 117411 (Singapore)
2015-12-15
Highlights: • UiO-66 was an outstanding substrate due to its superior properties and stability. • Ag{sub 2}CO{sub 3}/UiO-66 photocatalyst was synthesized by a simple solution method. • Ag{sub 2}CO{sub 3}/UiO-66 had excellent RhB degrading activity under visible-light irradiation. • Higher surface area of Ag{sub 2}CO{sub 3} in Ag{sub 2}CO{sub 3}/UiO-66 led to the enhanced activity. • Diverse active species may participate in the process of RhB degradation. - Abstract: Because of their excellent properties, metal-organic frameworks (MOFs) are considered as ideal materials for the development of visible-light photocatalyst. Particularly, although increasing research interests have been put on MOF based photocatalysts, the MOF supported Ag{sub 2}CO{sub 3} as photocatalyst has not been reported in the field of water treatment. In this study, a zirconium based MOF, UiO-66, was incorporated with Ag{sub 2}CO{sub 3} through a convenient solution method and used for visible-light prompted dye degradation. Compared to the mixture of pristine UiO-66 and Ag{sub 2}CO{sub 3}, the developed Ag{sub 2}CO{sub 3}/UiO-66 composite exhibited enhanced photocatalytic activity to the degradation of rhodamine B (RhB) under visible-light irradiation. It was supposed that the participation of UiO-66 during the synthesis of Ag{sub 2}CO{sub 3} was crucial for such improvement. In addition, the Ag{sub 2}CO{sub 3}/UiO-66 composite demonstrated good structural stability after the degradation experiment, and most of its photocatalytic activity was still preserved after the recycle test. Moreover, the photocatalytic mechanism of the Ag{sub 2}CO{sub 3}/UiO-66 composite was investigated and a possible pathway of RhB degradation was also proposed.
Energy Technology Data Exchange (ETDEWEB)
Zhou, Jian-Jian; Wang, Rong; Liu, Xin-Ling; Peng, Fu-Min [School of Chemistry and Chemical Engineering and Innovation Lab for Clean Energy & Green Catalysis, Anhui University, Hefei 230601 (China); Li, Chuan-Hao, E-mail: chuanhao.li@yale.edu [School of Chemistry and Chemical Engineering and Innovation Lab for Clean Energy & Green Catalysis, Anhui University, Hefei 230601 (China); Department of Chemical & Environmental Engineering, Yale University, New Haven 06511 (United States); Teng, Fei [Jiangsu Key Laboratory of Atmospheric Environment Monitoring and Pollution Control, School of Environmental Sciences and Engineering, Nanjing University of Information Science and Technology, Nanjing 210044 (China); Yuan, Yu-Peng, E-mail: yupengyuan@ahu.edu.cn [School of Chemistry and Chemical Engineering and Innovation Lab for Clean Energy & Green Catalysis, Anhui University, Hefei 230601 (China); Jiangsu Key Laboratory of Atmospheric Environment Monitoring and Pollution Control, School of Environmental Sciences and Engineering, Nanjing University of Information Science and Technology, Nanjing 210044 (China)
2015-08-15
Graphical abstract: Enhanced photocatalytic hydrogen generation was achieved though constructing the CdS/UiO-66 MOF hybrids. In addition, the resultant hybrids show excellent photostability for hydrogen generation. - Highlights: • CdS nanoparticles were hydrothermally grown on UiO-66 octahedrons. • The resultant CdS/UiO-66 hybrids show enhanced photocatalytic H{sub 2} generation under visible light irradiation. • CdS/UiO-66 hybrids possess excellent photostability for long-term hydrogen generation. - Abstract: CdS nanoparticles acting as photosensitizer was grown in situ upon UiO-66 metal-organic framework octahedrons through a hydrothermal process. The resultant CdS/UiO-66 hybrid photocatalysts show remarkably active hydrogen evolution under visible light irradiation as compared to CdS and UiO-66 alone. The optimum hybrid with 16 wt% CdS loading shows a hydrogen production rate of 235 μmol h{sup −1}, corresponding to 1.2% quantum efficiency at 420 nm. The improved photocatalytic hydrogen production over hybrid CdS/UiO-66 is ascribed to the efficient interfacial charge transfer from CdS to UiO-66, which effectively suppresses the recombination of photogenerated electron-hole pairs and thereby enhancing the photocatalytic efficiency.
Next generation Zero-Code control system UI
CERN. Geneva
2017-01-01
Developing ergonomic user interfaces for control systems is challenging, especially during machine upgrade and commissioning where several small changes may suddenly be required. Zero-code systems, such as *Inspector*, provide agile features for creating and maintaining control system interfaces. More so, these next generation Zero-code systems bring simplicity and uniformity and brake the boundaries between Users and Developers. In this talk we present *Inspector*, a CERN made Zero-code application development system, and we introduce the major differences and advantages of using Zero-code control systems to develop operational UI.
Dual-Emitting UiO-66(Zr&Eu) Metal-Organic Framework Films for Ratiometric Temperature Sensing.
Feng, Ji-Fei; Liu, Tian-Fu; Shi, Jianlin; Gao, Shui-Ying; Cao, Rong
2018-06-20
A novel dual-emitting metal-organic framework based on Zr and Eu, named as UiO-66(Zr&Eu), was built using a clever strategy based on secondary building units. With the use of polymers, the obtained UiO-66(Zr&Eu) was subsequently deposited as thin films that can be utilized as smart thermometers. The UiO-66(Zr&Eu) polymer films can be used for the detection of temperature changes in the range of 237-337 K due to the energy transfer between the lanthanide ions (Eu in clusters) and the luminescent ligands, and the relative sensitivity reaches 4.26% K -1 at 337 K. Moreover, the sensitivity can be improved to 19.67% K -1 by changing the film thickness. In addition, the temperature-sensing performance of the films is superior to that of the powders, and the sensor can be reused 3 times without loss of performance.
Design Evaluation of UIS and In-vessel Fuel Transfer Machine for a 1200MWe SFR
Energy Technology Data Exchange (ETDEWEB)
Lee, Jae Han; Kim, Seok Hoon; Park, Chang Gyu; Lee, Su Yeon
2008-11-15
The report describes the structural applicability of the upper internal structure (UIS) and the in-vessel fuel transfer machine for a 1200MWe sodium cooled fast reactor (SFR) of a pool type. In the conceptual design, a two rotating plug type as a refueling system is considered. For the two rotating plug type, the diameters of large and small rotating plugs are determined by 7.2m and 5.6m, respectively. Through the use of an inner fuel transfer machine and the lift change machine with a fixed arm length of 1.10m installed on a small rotating plug, all the core assemblies are accessed within 7mm accuracy. The UIS diameter is determined by 4.7m, which includes the all control drive lines in upper part, the diameter of UIS lower part is restricted by 4.4 m to secure the rotation angle of a refueling machine.
Dissection of Resistance Genes to Pseudomonas syringae pv. phaseolicola in UI3 Common Bean Cultivar.
González, Ana M; Godoy, Luís; Santalla, Marta
2017-11-23
Few quantitative trait loci have been mapped for resistance to Pseudomonas syringae pv. phaseolicola in common bean. Two F₂ populations were developed from the host differential UI3 cultivar. The objective of this study was to further characterize the resistance to races 1, 5, 7 and 9 of Psp included in UI3. Using a QTL mapping approach, 16 and 11 main-effect QTLs for pod and primary leaf resistance were located on LG10, explaining up to 90% and 26% of the phenotypic variation, respectively. The homologous genomic region corresponding to primary leaf resistance QTLs detected tested positive for the presence of resistance-associated gene cluster encoding nucleotide-binding and leucine-rich repeat (NL), Natural Resistance Associated Macrophage (NRAMP) and Pentatricopeptide Repeat family (PPR) proteins. It is worth noting that the main effect QTLs for resistance in pod were located inside a 3.5 Mb genomic region that included the Phvul.010G021200 gene, which encodes a protein that has the highest sequence similarity to the RIN4 gene of Arabidopsis, and can be considered an important candidate gene for the organ-specific QTLs identified here. These results support that resistance to Psp from UI3 might result from the immune response activated by combinations of R proteins, and suggest the guard model as an important mechanism in pod resistance to halo blight. The candidate genes identified here warrant functional studies that will help in characterizing the actual defense gene(s) in UI3 genotype.
Superior removal of arsenic from water with zirconium metal-organic framework UiO-66
Wang, Chenghong; Liu, Xinlei; Chen, J. Paul; Li, Kang
2015-01-01
In this study, water stable zirconium metal-organic framework (UiO-66) has been synthesized and for the first time applied as an adsorbent to remove aquatic arsenic contamination. The as-synthesized UiO-66 adsorbent functions excellently across a broad pH range of 1 to 10, and achieves a remarkable arsenate uptake capacity of 303 mg/g at the optimal pH, i.e., pH = 2. To the best of our knowledge, this is the highest arsenate As(V) adsorption capacity ever reported, much higher than that of currently available adsorbents (5–280 mg/g, generally less than 100 mg/g). The superior arsenic uptake performance of UiO-66 adsorbent could be attributed to the highly porous crystalline structure containing zirconium oxide clusters, which provides a large contact area and plenty of active sites in unit space. Two binding sites within the adsorbent framework are proposed for arsenic species, i.e., hydroxyl group and benzenedicarboxylate ligand. At equilibrium, seven equivalent arsenic species can be captured by one Zr6 cluster through the formation of Zr-O-As coordination bonds. PMID:26559001
Superior removal of arsenic from water with zirconium metal-organic framework UiO-66.
Wang, Chenghong; Liu, Xinlei; Chen, J Paul; Li, Kang
2015-11-12
In this study, water stable zirconium metal-organic framework (UiO-66) has been synthesized and for the first time applied as an adsorbent to remove aquatic arsenic contamination. The as-synthesized UiO-66 adsorbent functions excellently across a broad pH range of 1 to 10, and achieves a remarkable arsenate uptake capacity of 303 mg/g at the optimal pH, i.e., pH = 2. To the best of our knowledge, this is the highest arsenate As(V) adsorption capacity ever reported, much higher than that of currently available adsorbents (5-280 mg/g, generally less than 100 mg/g). The superior arsenic uptake performance of UiO-66 adsorbent could be attributed to the highly porous crystalline structure containing zirconium oxide clusters, which provides a large contact area and plenty of active sites in unit space. Two binding sites within the adsorbent framework are proposed for arsenic species, i.e., hydroxyl group and benzenedicarboxylate ligand. At equilibrium, seven equivalent arsenic species can be captured by one Zr6 cluster through the formation of Zr-O-As coordination bonds.
Ab-initio Study of the Electron Mobility in a Functionalized UiO-66 Metal Organic Framework
Musho, Terence D.; Yasin, Alhassan S.
2018-03-01
This study leverages density functional theory accompanied with Boltzmann transport equation approaches to investigate the electronic mobility as a function of inorganic substitution and functionalization in a thermally stable UiO-66 metal-organic framework (MOF). The MOFs investigated are based on Zr-UiO-66 MOF with three functionalization groups of benzene dicarboxylate (BDC), BDC functionalized with an amino group (BDC + NH_2 ) and a nitro group (BDC + NO_2 ). The design space of this study is bound by UiO-66(M)-R, [M=Zr , Ti, Hf; R=BDC , BDC+NO_2 , BDC+NH_2 ]. The elastic modulus was not found to vary significantly over the structural modification of the design space for either functionalization or inorganic substitution. However, the electron-phonon scattering potential was found to be controllable by up to 30% through controlled inorganic substitution in the metal clusters of the MOF structure. The highest electron mobility was predicted for a UiO-66(Hf_5Zr_1 ) achieving a value of approximately 1.4× 10^{-3} cm^2 /V s. It was determined that functionalization provides a controlled method of modulating the charge density, while inorganic substitution provides a controlled method of modulating the electronic mobility. Within the proposed design space the electrical conductivity was able to be increased by approximately three times the base conductivity through a combination of inorganic substitution and functionalization.
Yan, Zhiming; Wu, Mei; Hu, Biqing; Yao, Minna; Zhang, Lan; Lu, Qiaomei; Pang, Jie
2018-03-23
In this work, metal-organic framework particles incorporated fibers (UiO-66/PAN nanofibers) were used as adsorbent in pipette tip solid phase extraction (PT-SPE) for the first time. The UiO-66/PAN nanofibers were fabricated by a facile electrospinning method and characterized by Fourier transform infrared spectroscopy, scanning electron microscopy, X-ray diffraction and nitrogen adsorption-desorption experiments. The UiO-66/PAN nanofibers were applied to assemble a novel PT-SPE cartridge for determination of four phytohormones followed by high performance liquid chromatography (HPLC). Several experimental parameters such as kinds of UiO-66/PAN nanofibers, the amount of UiO-66/PAN nanofibers, the effect of solution pH, ionic strength and desorption conditions were intensively investigated. Under the optimal conditions, the linear ranges of the phytohormones were in the range of 0.06-60 ng/mL with correlation coefficients above 0.992. The limits of detection were between 0.01 ng/mL to 0.02 ng/mL. The interday and intraday precision (RSD) for three replicate extractions of the four phytohormones (15 ng/mL for each) was in the range of 1.5-5.6%. The established method was successfully applied for the determination of phytohormones in watermelon and mung bean sprouts samples. The results showed that the electrostatic interaction between the positively charged UiO-66 and anionic forms of phytohormones played an important role in the extraction of the phytohormones. Copyright © 2018 Elsevier B.V. All rights reserved.
Dissection of Resistance Genes to Pseudomonas syringae pv. phaseolicola in UI3 Common Bean Cultivar
Directory of Open Access Journals (Sweden)
Ana M. González
2017-11-01
Full Text Available Few quantitative trait loci have been mapped for resistance to Pseudomonas syringae pv. phaseolicola in common bean. Two F2 populations were developed from the host differential UI3 cultivar. The objective of this study was to further characterize the resistance to races 1, 5, 7 and 9 of Psp included in UI3. Using a QTL mapping approach, 16 and 11 main-effect QTLs for pod and primary leaf resistance were located on LG10, explaining up to 90% and 26% of the phenotypic variation, respectively. The homologous genomic region corresponding to primary leaf resistance QTLs detected tested positive for the presence of resistance-associated gene cluster encoding nucleotide-binding and leucine-rich repeat (NL, Natural Resistance Associated Macrophage (NRAMP and Pentatricopeptide Repeat family (PPR proteins. It is worth noting that the main effect QTLs for resistance in pod were located inside a 3.5 Mb genomic region that included the Phvul.010G021200 gene, which encodes a protein that has the highest sequence similarity to the RIN4 gene of Arabidopsis, and can be considered an important candidate gene for the organ-specific QTLs identified here. These results support that resistance to Psp from UI3 might result from the immune response activated by combinations of R proteins, and suggest the guard model as an important mechanism in pod resistance to halo blight. The candidate genes identified here warrant functional studies that will help in characterizing the actual defense gene(s in UI3 genotype.
Vaadin 7 UI design by example beginner's guide
Duarte, Alejandro
2013-01-01
This book is a hands-on Beginner's Guide for developers who are new to Vaadin and/or Vaadin UI components. The book will teach readers through examples to use each of the exciting components to build and add various aspects of the user interface to their web apps.If you have experience with the Java language and want to create web applications that look good without having to deal with HTML, XML, and JavaScript, this book is for you. Basic Java programming skills are required, but no web development knowledge is needed at all.
Direct observations of the MOF (UiO-66) structure by transmission electron microscopy
Zhu, Liangkui; Zhang, Daliang; Xue, Ming; Li, Huan; Qiu, Shilun
2013-01-01
As a demonstration of ab initio structure characterizations of nano metal organic framework (MOF) crystals by high resolution transmission electron microscopy (HRTEM) and electron diffraction tomography methods, a Zr-MOF (UiO-66) structure
Ploskonka, Ann M; DeCoste, Jared B
2017-06-28
Metal-organic frameworks (MOFs) are versatile materials highly regarded for their porous nature. Depending on the synthetic method, various guest molecules may remain in the pores or can be systematically loaded for various reasons. Herein, we present a study that explores the effect of guest molecules on the adsorption and reactivity of the MOF in both the gas phase and solution. The differences between guest molecule interactions and the subsequent effects on their activity are described for each system. Interestingly, different effects are observed and described in detail for each class of guest molecules studied. We determine that there is a strong effect of alcohols with the secondary building unit of UiO MOFs, while Lewis bases have an effect on the reactivity of the -NH 2 group in UiO-66-NH 2 and adsorption by the coordinatively unsaturated copper sites in HKUST-1. These effects must be considered when determining synthesis and activation methods of MOFs toward various applications.
Yong Sam Lee; Sang Hyuk Kim; Byeong-Hee Mihn
2016-01-01
We analyze the design and specifications of the Sun-and-Stars Time-Determining group of instruments (Ilseong-jeongsi-ui, 日星定時儀) made during the Joseon dynasty. According to the records of the Sejong Sillok (Veritable Records of King Sejong), Sun-and-Stars Time-Determining Instruments measure the solar time of day and the sidereal time of night through three rings and an alidade. One such instrument, the Simplified Time-Determining Instrument (So-jeongsi-ui, 小定時儀), is made without ...
Donnadio, Anna; Narducci, Riccardo; Casciola, Mario; Marmottini, Fabio; D'Amato, Roberto; Jazestani, Mehdi; Chiniforoshan, Hossein; Costantino, Ferdinando
2017-12-06
Mixed membrane matrices (MMMs) made up with Nafion and nanocrystals of zirconium metal-organic framework (MOF) UiO-66 or the analogous sulfonated SO 3 H-UiO-66 were prepared by varying the filler loading and the size of the crystals. The combined effects of size and loading, together with the presence of sulfonic groups covalently linked to the MOFs, were studied with regard to the conductivity and mechanical properties of the obtained composite matrices. A large screening of membranes was preliminarily made and, on the most promising samples, an accurate conductivity study at different relative humidities and temperatures was also carried out. The results showed that membranes containing large crystals (200 nm average size) in low amounts (around 2%) displayed the best results in terms of proton conductivity values, reaching values by 30% higher than those of pure Nafion, while leaving the mechanical properties substantially unchanged. On the contrary, MMMs containing MOFs of small size (20 nm average size) did not show any conductivity improvements if compared to pure Nafion membranes. The effect of MOF sulfonation was negligible at low filler loading whereas it became important at loading values around 10%. Finally, membranes with a high filler loading (up to 60 wt %) of sulfonated UiO-66 showed a slight reduction of conductivity in comparison with membranes loaded at 20% of nonsulfonated ones.
Siarto, J.
2014-12-01
As more Earth science software tools and services move to the web--the design and usability of those tools become ever more important. A good user interface is becoming expected and users are becoming increasingly intolerant of websites and web applications that work against them. The Earthdata UI Pattern Library attempts to give these scientists and developers the design tools they need to make usable, compelling user interfaces without the associated overhead of using a full design team. Patterns are tested and functional user interface elements targeted specifically at the Earth science community and will include web layouts, buttons, tables, typography, iconography, mapping and visualization/graphing widgets. These UI elements have emerged as the result of extensive user testing, research and software development within the NASA Earthdata team over the past year.
Directory of Open Access Journals (Sweden)
Taehyung Lee
2014-01-01
Full Text Available Throughout the history of East Asian medicine, different kinds of acupuncture treatment experiences have been accumulated in classical medical texts. Reexamining knowledge from classical medical texts is expected to provide meaningful information that could be utilized in current medical practices. In this study, we used data mining methods to analyze the association between acupoints and patterns of disorder with the classical medical book DongUiBoGam of Korean medicine. Using the term frequency-inverse document frequency (tf-idf method, we quantified the significance of acupoints to its targeting patterns and, conversely, the significance of patterns to acupoints. Through these processes, we extracted characteristics of each acupoint based on its treating patterns. We also drew practical information for selecting acupoints on certain patterns according to their association. Data analysis on DongUiBoGam’s acupuncture treatment gave us an insight into the main idea of DongUiBoGam. We strongly believe that our approach can provide a novel understanding of unknown characteristics of acupoint and pattern identification from the classical medical text using data mining methods.
Wu, Hui; Chua, Yong Shen; Krungleviciute, Vaiva; Tyagi, Madhusudan; Chen, Ping; Yildirim, Taner; Zhou, Wei
2013-07-17
UiO-66 is a highly important prototypical zirconium metal-organic framework (MOF) compound because of its excellent stabilities not typically found in common porous MOFs. In its perfect crystal structure, each Zr metal center is fully coordinated by 12 organic linkers to form a highly connected framework. Using high-resolution neutron power diffraction technique, we found the first direct structural evidence showing that real UiO-66 material contains significant amount of missing-linker defects, an unusual phenomenon for MOFs. The concentration of the missing-linker defects is surprisingly high, ∼10% in our sample, effectively reducing the framework connection from 12 to ∼11. We show that by varying the concentration of the acetic acid modulator and the synthesis time, the linker vacancies can be tuned systematically, leading to dramatically enhanced porosity. We obtained samples with pore volumes ranging from 0.44 to 1.0 cm(3)/g and Brunauer-Emmett-Teller surface areas ranging from 1000 to 1600 m(2)/g, the largest values of which are ∼150% and ∼60% higher than the theoretical values of defect-free UiO-66 crystal, respectively. The linker vacancies also have profound effects on the gas adsorption behaviors of UiO-66, in particular CO2. Finally, comparing the gas adsorption of hydroxylated and dehydroxylated UiO-66, we found that the former performs systematically better than the latter (particularly for CO2) suggesting the beneficial effect of the -OH groups. This finding is of great importance because hydroxylated UiO-66 is the practically more relevant, non-air-sensitive form of this MOF. The preferred gas adsorption on the metal center was confirmed by neutron diffraction measurements, and the gas binding strength enhancement by the -OH group was further supported by our first-principles calculations.
2013-02-25
... elimination of the need to create and mail hard copy documents; Increasing accuracy and reducing errors (in... formatting requirements for the data exchanges of various UI applications that may impose a burden under the...
2010-08-30
... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-73,758] Bluescope Buildings North America, Including Workers Whose Unemployment Insurance (UI) Wages Are Reported Through Butler Manufacturing Company, Laurinburg, NC; Amended Certification Regarding Eligibility To Apply for Worker...
Directory of Open Access Journals (Sweden)
Marion Schelling
2018-02-01
Full Text Available We report on the successful functionalization of cotton fabrics with a water-stable metal–organic framework (MOF, UiO-66, under mild solvothermal conditions (80 °C and its ability to adsorb and degrade water micropollutants. The functionalized cotton samples were characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM, energy-dispersive X-ray spectroscopy (EDX, transmission electron microscopy (TEM, Fourier transform infrared spectroscopy (FTIR, and X-ray photoelectron spectroscopy (XPS. UiO-66 crystals grew in a uniform and conformal manner over the surface of the cotton fibers. The cotton fabrics functionalized with UiO-66 frameworks exhibited an enhanced uptake capacity for methylchlorophenoxypropionic acid (MCPP, a commonly used herbicide. The functionalized fabrics also showed photocatalytic activity, demonstrated by the degradation of acetaminophen, a common pharmaceutical compound, under simulated sunlight irradiation. These results indicate that UiO-66 can be supported on textile substrates for filtration and photocatalytic purposes and that these substrates can find applications in wastewater decontamination and micropollutant degradation.
Attitudes toward Learning about and Working with Computers of Students at UiTM
Hashim, Rugayah; Mustapha, Wan Narita
2004-01-01
The purpose of this study was to assess the attitudes toward learning about and working with computers of Universiti Teknologi MARA (UiTM), Shah Alam students. Attitudes were studied in an attempt to ascertain factors such as anxiety, confidence, liking and, usefulness at the university level. A total of 300 students at various stages of education…
2012-06-06
... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-80,525] Long Elevator & Machine Company, Inc., Including Workers Whose Unemployment Insurance (UI) Wages Were Reported Through Kone, Inc... former workers of Long Elevator & Machine Company, Inc., including workers whose unemployment insurance...
Effective UI The Art of Building Great User Experience in Software
Anderson, Jonathan; Wilson, Robb
2010-01-01
People expect effortless, engaging interaction with desktop and web applications, but producing software that generates enjoyable user experiences is much harder than many companies anticipate. With Effective UI, you'll learn proven user-experience strategies that will satisfy your clients and customers, drive business value, and increase brand strength. This book shows you how to capture the collaborative and cooperative spirit among designers, engineers, and management required for building engaging software. You'll also learn valuable methods for maintaining focus throughout the process -
Directory of Open Access Journals (Sweden)
Mohammed Kadhom
2017-06-01
Full Text Available Knowing that the world is facing a shortage of fresh water, desalination, in its different forms including reverse osmosis, represents a practical approach to produce potable water from a saline source. In this report, two kinds of Metal-Organic Frameworks (MOFs nanoparticles (NPs, UiO-66 (~100 nm and MIL-125 (~100 nm, were embedded separately into thin-film composite membranes in different weight ratios, 0%, 0.05%, 0.1%, 0.15%, 0.2%, and 0.3%. The membranes were synthesized by the interfacial polymerization (IP of m-phenylenediamine (MPD in aqueous solution and trimesoyl chloride (TMC in an organic phase. The as-prepared membranes were characterized by scanning electron microscopy (SEM, transmission electron microscopy (TEM, contact angle measurement, attenuated total reflection Fourier transform infrared (ATR FT-IR spectroscopy, and salt rejection and water flux assessments. Results showed that both UiO-66 and MIL-125 could improve the membranes’ performance and the impacts depended on the NPs loading. At the optimum NPs loadings, 0.15% for UiO-66 and 0.3% for MIL-125, the water flux increased from 62.5 L/m2 h to 74.9 and 85.0 L/m2 h, respectively. NaCl rejection was not significantly affected (UiO-66 or slightly improved (MIL-125 by embedding these NPs, always at >98.5% as tested at 2000 ppm salt concentration and 300 psi transmembrane pressure. The results from this study demonstrate that it is promising to apply MOFs NPs to enhance the TFC membrane performance for desalination.
Direct observations of the MOF (UiO-66) structure by transmission electron microscopy
Zhu, Liangkui
2013-01-01
As a demonstration of ab initio structure characterizations of nano metal organic framework (MOF) crystals by high resolution transmission electron microscopy (HRTEM) and electron diffraction tomography methods, a Zr-MOF (UiO-66) structure was determined and further confirmed by Rietveld refinements of powder X-ray diffraction. HRTEM gave direct imaging of the channels. © 2013 The Royal Society of Chemistry.
Fabrication of core-shell MIL-101(Cr)@UiO-66(Zr) nanocrystals for hydrogen storage
CSIR Research Space (South Africa)
Ren, Jianwei
2014-09-01
Full Text Available of the individual metal-organic framework (MOF) components and the coreeshell hybrid crystals were also characterized. The hydrogen storage capacity exhibited by the resulting core eshell nanocrystals was 26% and 60% higher than those of pure phase MIL-101 and Ui...
jQuery UI 1.10 the user interface library for jQuery
Libby, Alex
2013-01-01
This book consists of an easy-to-follow, example-based approach that leads you step-by-step through the implementation and customization of each library component.This book is for frontend designers and developers who need to learn how to use jQuery UI quickly. To get the most out of this book, you should have a good working knowledge of HTML, CSS, and JavaScript, and should ideally be comfortable using jQuery.
2010-04-29
... Dynamics Corporation, including on-site leased workers of Masterson Personnel and MRCI Workforce..., Inc., Including Workers Whose Unemployment Insurance (UI) Wages Are Paid Through Biomedical Dynamics... Biomedical Dynamics Corporation. Accordingly, the Department is amending this certification to property...
The Academic English Language Needs of Industrial Design Students in UiTM Kedah, Malaysia
Adzmi, Nor Aslah; Bidin, Samsiah; Ibrahim, Syazliyati; Jusoff, Kamaruzaman
2009-01-01
The purpose of this study was to analyse the academic English language lacks and needs of Industrial Design students in Universiti Teknologi MARA Kedah (UiTM). It highlights the lacks and needs for English for Academic Purposes in helping the students to succeed in the program through the usage of English language. The research tools used were in…
International Nuclear Information System (INIS)
Lobo, G.; Ladron de Guevara, D.; Perez, A.; Donoso, G.; Jimenez, C.; Arnello, F.; Vivanco, X.
2002-01-01
The aim of this study was to analyse the thyroid scintigraphy (TS) findings in 279 newborn with neonatal TSH (TSHnn) levels above 20 uUI/ml, detected in the national program of newborn screening of CH and phenylketonuria, and to compare them with: 1) final diagnosis, estimating its positive (PPV) and negative predictive value (NPV) and 2) TSHnn levels. Materials and Method: Thyroid scintigraphy of 279 newborn (57.3% girls) who presented TSHnn levels > 20 uUI/ml were revised, classifying them in eutopic gland (EuG), ectopic gland (EcG) and absence of contrast (AC). EuG was classified by visual and quantitative criteria in: normal contrast and size, goiter, and decreased contrast (DC). Tc99m-pertechnetate TS was performed average at 19th life's day (SD:11 days) with a gammacamera- computer system. The patients were separated according to hormonal confirmatory levels in: CH, hyperthyrotropinaemia (HT) and euthyroid. We compared TS results with final diagnosis and also with TSHnn levels (>= or 50 uUI/ml group (p<0.001). Moreover, the former group presented bigger proportion of CH newborns and of EcG scans than < 50uUI/ml patients (p<0.001). EcG and goiter condition had a PPV for CH of 100% and 79.6%, respectively. The NPV of normal TS was 86.7%. Conclusion: 1) Newborns with TSHnn levels larger than 20 uUI/ml show a high frequency of abnormal TS. 2) The EcG is highly predictive of CH. 3) Goiter and AC associated to TSHnn levels above 50 uUI/ml support strongly CH diagnosis. 4) Normal TS correspond very likely to euthyroid newborn, specially when TSHnn is lower than 50 uUI/ml
Directory of Open Access Journals (Sweden)
Rosa M. Pando-Álvarez
2012-04-01
Full Text Available El hipotiroidismo subclínico puede contribuir al desarrollo de patologías cardiovasculares y se ha demostrado que a partir de niveles de TSH >2,5uUI/mL se desarrolla disfunción endotelial. Objetivos: Determinar el grosor de la íntima media carotídea (GIMC, la presencia de placas en carótidas y el perfil metabólico en mujeres de edad media asintomáticas con TSH ≥2,5 uUI/mL y compararlas con aquellas con niveles <2,5 uUI/mL. Diseño: Estudio transversal y analítico. Lugar: Hospital Nacional Dos de Mayo e Instituto de Investigaciones Clínicas, Universidad Nacional Mayor de San Marcos, Lima, Perú. Participantes: Mujeres sin historia de enfermedad tiroidea, cardiovascular o diabetes. Intervenciones: En 60 mujeres sin historia de enfermedad tiroidea, cardiovascular o diabetes, con edad promedio de 53,8 ± 5,8 años, se determinó la tirotropina (TSH, colesterol total (CT, colesterol de densidad alta (HDL, triglicéridos (Tg, glucosa (G basal y a los 120 minutos (TTGO, insulina basal (Ins-B; se calculó las fracciones de colesterol de densidad baja (LDL, el nivel de insulinorresistencia (HOMA-IR, la presión arterial, perímetro de cintura abdominal, el índice de masa corporal (IMC y el GIMC mediante ecoDoppler. Principales medidas de resultados: TSH ≥2,5 uUI/mL, perfil metabólico y su relación con GIMC. Resultados: El 38,3% presentó TSH ≥2,5 y 61,7% TSH <2,5 uUI/mL. El 56% de mujeres con TSH ≥2,5 y 65% con TSH <2,5 uUI/ml fueron hipertensas, sin diferencia estadística. El perfil lipídico, G basal, Ins-B e índice HOMA-IR fueron semejantes en ambos grupos. Se observó niveles significativamente más altos del IMC, G a los 120 minutos, el GIMC en carótida izquierda y el mayor entre ambas carótidas en las mujeres con TSH ≥2,5 uUI/mL (p=0,03, p=0,01, p=0,008 y p=0,02, respectivamente. La presencia de placas en la carótida izquierda y en al menos una de las carótidas fue significativamente más frecuente entre aquellas con
Energy Technology Data Exchange (ETDEWEB)
Morris, William; Wang, Shunzhi; Cho, David; Auyeung, Evelyn; Li, Peng; Farha, Omar K.; Mirkin, Chad A. (King Abdulaziz); (NWU)
2017-04-07
Nanoscale UiO-66 Zr6(OH)4O4(C8O4H4)6 has been synthesized with a series of carboxylic acid modulators, R-COOH (where R = H, CH3, CF3, and CHCl2). The phase purity and size of each MOF was confirmed by powder X-ray diffraction, BET surface area analysis, and scanning transmission electron microscopy (STEM). Size control of UiO-66 crystals from 20 nm to over 1 μm was achieved, and confirmed by STEM. The colloidal stability of each MOF was evaluated by dynamic light scattering and was found to be highly dependent on the modulator conditions utilized in the synthesis, with both lower pKa and higher acid concentration resulting in more stable structures. Furthermore, STEM was carried out on both colloidally stable samples and those that exhibited a large degree of aggregation, which allowed for visualization of the different degrees of dispersion of the samples. The use of modulators at higher concentrations and with lower pKas leads to the formation of more defects, as a consequence of terephthalic acid ligands being replaced by modulator molecules, thereby enhancing the colloidal stability of the UiO-66 nanoparticles. These findings could have a significant impact on nanoscale MOF material syntheses and applications, especially in the areas of catalysis and drug delivery.
Image-receptor performance: a comparison of Trophy RVG UI sensor and Kodak Ektaspeed Plus film.
Ludlow, J; Mol, A
2001-01-01
Objective. This study compares the physical characteristics of the RVG UI sensor (RVG) with Ektaspeed Plus film. Dose-response curves were generated for film and for each of 6 available RVG modes. An aluminum step-wedge was used to evaluate exposure latitude. Spatial resolution was assessed by using a line-pair test tool. Latitude and resolution were assessed by observers for both modalities. The RVG was further characterized by its modulation transfer function. Exposure latitude was equal for film and RVG in the periodontal mode. Other gray scale modes demonstrated much lower latitude. The average maximum resolution was 15.3 line-pairs per millimeter (lp/mm) for RVG in high-resolution mode, 10.5 lp/mm for RVG in low-resolution mode, and 20 lp/mm for film (P <.0001). Modulation transfer function measurements supported the subjective assessments. In periodontal mode, the RVG UI sensor demonstrates exposure latitude similar to that of Ektaspeed Plus film. Film images exhibit significantly higher spatial resolution than the RVG images acquired in high-resolution mode.
AOM reconciling of crystal field parameters for UCl 3, UBr 3, UI 3 series
Gajek, Z.; Mulak, J.
1990-07-01
Available inelastic neutron scattering interpretations of crystal field effect in the uranium trihalides have been verified in terms of Angular Overlap Model. For UCl 3 a good reconciling of both INS and optical interpretations of crystal field effect has been obtained. On the contrary, the parameterizations for UBr 3 and UI 3 were found to be highly artificial and suggestion is given to experimentalists to reinterpret their INS spectra.
Synnøve des Bouvries karriere ved UiT, 1972–2014: Intervju og bibliografi
Directory of Open Access Journals (Sweden)
Per Pippin Aspaas
2014-11-01
Full Text Available The career of Synnøve des Bouvrie at the University of Tromsø, 1972–2014: Interview and bibliography. Synnøve des Bouvrie was born in Bussum near Amsterdam on 16 November 1944 as the child of a Norwegian mother and a Dutch father. After studies of classical philology at Leiden, she became one of the first lecturers at the University of Tromsø (UiT in September 1972. A true pioneer, she has fought relentlessly for gender equality and the preservation of the so-called «small» languages at the UiT. Mastering ten languages altogether, Synnøve’s own research has always been internationally oriented. Applying an anthropological perspective on the ancient societies, she has also studied the current study of ancient tragedies from a similar, detached perspective, by means of which she has been able to single out national trends and historical contingency in cutting-edge research. Moreover, this «rare bird in Ultima Thule» is a staunch advocate for the active use of Latin in teaching and research and a prominent member of the Academia Latinitati Fovendae. In Tromsø too, she has been active in another academy, the cross-disciplinary Academia Borealis, of which she is the serving president. Moreover, she has taught and helped establish courses in various subjects outside her field of specialty at the UiT, like a cross-disciplinary course on Graeco-Roman art, archaeology, literature and history (Antikkens kultur and comparative literature (Allmenn litteratur. The interview is highly personal, crammed with anecdotes from Synnøve’s private life and deliberations on how her upbringing may have influenced her choices as an academic. The bibliography lists her publications from 1972 to the present. In the interview she reveals that a monograph on Euripides can be expected to be published soon with an international publisher. In the appendix several illustrations are included, with captions in English.
jQuery UI 1.7 the user interface library for jQuery
Wellman, Dan
2009-01-01
An example-based approach leads you step-by-step through the implementation and customization of each library component and its associated resources in turn. To emphasize the way that jQuery UI takes the difficulty out of user interface design and implementation, each chapter ends with a 'fun with' section that puts together what you've learned throughout the chapter to make a usable and fun page. In these sections you'll often get to experiment with the latest associated technologies like AJAX and JSON. This book is for front-end designers and developers who need to quickly learn how to use t
Woldringh, C.; Wijngaart, M.A.G. van den; Albers-Heitner, P.; Lycklama á Nijeholt, A.A.B.; Lagro-Janssen, A.L.M.
2007-01-01
The objective of this study was to test the short- and long-term effects of pelvic floor muscle training (PFMT) during pregnancy in women at risk, i.e. women who were already affected by urinary incontinence (UI) during pregnancy. The intervention consisted of three sessions of PFMT between week 23
Woldringh, C.; Wijngaart, M.A.G. van den; Albers-Heitner, P.; Lycklama á Nijeholt, A.A.B.; Lagro-Janssen, A.L.M.
2007-01-01
The objective of this study was to test the short- and long-term effects of pelvic floor muscle training (PFMT) during pregnancy in women at risk, i.e. women who were already affected by urinary incontinence (UI) during pregnancy. The intervention consisted of three sessions of PFMT between week 23
C-QDs@UiO-66-(COOH)2 Composite Film via Electrophoretic Deposition for Temperature Sensing.
Feng, Ji-Fei; Gao, Shui-Ying; Shi, Jianlin; Liu, Tian-Fu; Cao, Rong
2018-03-05
Temperature plays a crucial role in both scientific research and industry. However, traditional temperature sensors, such as liquid-filled thermometers, thermocouples, and transistors, require contact to obtain heat equilibrium between the probe and the samples during the measurement. In addition, traditional temperature sensors have limitations when being used to detect the temperature change of fast-moving samples at smaller scales. Herein, the carbon quantum dots (C-QDs) functionalized metal-organic framework (MOF) composite film, a novel contactless solid optical thermometer, has been prepared via electrophoretic deposition (EPD). Instead of terephthalic acid (H 2 BDC), 1',2',4',5'-benzenetetracarboxylic (H 4 BTEC) acid was employed to construct a UiO-66 framework to present two uncoordinated carboxylic groups decorated on the pore surface. The uncoordinated carboxylic groups can generate negative charges, which facilitates the deposition of film on the positive electrode during the EPD process. Moreover, UiO-66-(COOH) 2 MOFs can absorb C-QDs from the solution and prevent C-QDs from aggregating, and the well-dispersed C-QDs impart fluorescence characteristics to composites. As-synthesized composite film was successfully used to detect temperature change in the range of 97-297 K with a relative sensitivity up to 1.3% K -1 at 297 K.
An UI Layout Files Analyzer for Test Data Generation
Directory of Open Access Journals (Sweden)
Paul POCATILU
2014-01-01
Full Text Available Prevention actions (trainings, audits and inspections (tests, validations, code reviews are the crucial factors in achieving a high quality level for any software application simply because low investments in this area are leading to significant expenses in terms of corrective actions needed for defect fixing. Mobile applications testing involves the use of various tools and scenarios. An important process is represented by test data generation. This paper proposes a test data generator (TDG system for mobile applications using several sources for test data and it focuses on the UI layout files analyzer module. The proposed architecture aims to reduce time-to-market for mobile applications. The focus is on test data generators based on the source code, user interface layout files (using markup languages like XML or XAML and application specifications. In order to assure a common interface for test data generators, an XML or JSON-based language called Data Specification Language (DSL is proposed.
Taddei, Marco; Tiana, Davide; Casati, Nicola; van Bokhoven, Jeroen A; Smit, Berend; Ranocchiari, Marco
2017-01-04
The use of mixed-linker metal-organic frameworks (MIXMOFs) is one of the most effective strategies to modulate the physical-chemical properties of MOFs without affecting the overall crystal structure. In many instances, MIXMOFs have been recognized as solid solutions, with random distribution of ligands, in agreement with the empirical rule known as Vegard's law. In this work, we have undertaken a study combining high-resolution powder X-ray diffraction (HR-PXRD) and density functional theory (DFT) calculations with the aim of understanding the reasons why UiO-66-based amino- and bromo-functionalized MIXMOFs (MIXUiO-66) undergo cell expansion obeying Vegard's law and how this behaviour is related to their physical-chemical properties. DFT calculations predict that the unit cell in amino-functionalized UiO-66 experiences only minor expansion as a result of steric effects, whereas major modification to the electronic features of the framework leads to weaker metal-linker interaction and consequently to the loss of stability at higher degrees of functionalization. For bromo-functionalized UiO-66, steric repulsion due to the size of bromine yields a large cell expansion, but the electronic features remain very similar to pristine UiO-66, preserving the stability of the framework upon functionalization. MIXUiO-66 obtained by either direct synthesis or by post-synthetic exchange shows Vegard-like behaviour, suggesting that both preparation methods yield solid solutions, but the thermal stability and the textural properties of the post-synthetic exchanged materials do not display a clear dependence on the chemical composition, as observed for the MOFs obtained by direct synthesis.
A novel approach for UI charge reduction using AMI based load prioritization in smart grid
Directory of Open Access Journals (Sweden)
Avani Pujara
2017-09-01
Full Text Available System frequency is vital part for power system balance. As per India Electricity Grid code frequency should be in the range of 49.5 Hz–50.5 Hz. Deviation from above mentioned range is charged as Unscheduled Interchange (UI charge. This paper proposes a new method for load and frequency control based on control of third parameter of three-part Availability Based Tariff (ABT i.e. Unscheduled Interchange charges. New circuit is designed considering prioritization of load and using Advanced Metering Infrastructure (AMI under Smart Grid environment.
Directory of Open Access Journals (Sweden)
Yong Sam Lee
2016-09-01
Full Text Available We analyze the design and specifications of the Sun-and-Stars Time-Determining group of instruments (Ilseong-jeongsi-ui, 日星定時儀 made during the Joseon dynasty. According to the records of the Sejong Sillok (Veritable Records of King Sejong, Sun-and-Stars Time-Determining Instruments measure the solar time of day and the sidereal time of night through three rings and an alidade. One such instrument, the Simplified Time-Determining Instrument (So-jeongsi-ui, 小定時儀, is made without the essential component for alignment with the celestial north pole. Among this group of instruments, only two bronze Hundred-Interval-Ring Sundials (Baekgak-hwan-Ilgu, 百刻環日晷 currently exist. A comparison of the functions of these two relics with two Time-Determining Instruments suggests that the Hundred-Interval-Ring Sundial is a Simplified Sundial (So-ilyeong, 小日影, as recorded in the Sejong Sillok and the Seongjong Sillok (Veritable Records of King Seongjong. Furthermore, the Simplified Sundial is a model derived from the Simplified Time-Determining Instrument. During the King Sejong reign, the Sun-and-Stars Time-Determining Instruments were used in military camps of the kingdom’s frontiers, in royal ancestral rituals, and in royal astronomical observatories.
Lee, Yong Sam; Kim, Sang Hyuk; Mihn, Byeong-Hee
2016-09-01
We analyze the design and specifications of the Sun-and-Stars Time-Determining group of instruments (Ilseong-jeongsi-ui, 日星定時儀) made during the Joseon dynasty. According to the records of the Sejong Sillok (Veritable Records of King Sejong), Sun-and-Stars Time-Determining Instruments measure the solar time of day and the sidereal time of night through three rings and an alidade. One such instrument, the Simplified Time-Determining Instrument (So-jeongsi-ui, 小定時儀), is made without the essential component for alignment with the celestial north pole. Among this group of instruments, only two bronze Hundred-Interval-Ring Sundials (Baekgak-hwan-Ilgu, 百刻環日晷) currently exist. A comparison of the functions of these two relics with two Time-Determining Instruments suggests that the Hundred-Interval-Ring Sundial is a Simplified Sundial (So-ilyeong, 小日影), as recorded in the Sejong Sillok and the Seongjong Sillok (Veritable Records of King Seongjong). Furthermore, the Simplified Sundial is a model derived from the Simplified Time-Determining Instrument. During the King Sejong reign, the Sun-and-Stars Time-Determining Instruments were used in military camps of the kingdom’s frontiers, in royal ancestral rituals, and in royal astronomical observatories.
Directory of Open Access Journals (Sweden)
Rolando Quintana Aput
2011-03-01
Full Text Available The present paper encloses the analysis of some troubles related to the development of theoretical design concerning the undergraduate thesis at the Cuban University of Informatics Sciences (UIS. This analysis proves to be decisive due to the existing demand for improving professionals training in the fields of investigation related to computing world.
Nazari, Marziyeh; Rubio-Martinez, Marta; Babarao, Ravichandar; Ayad Younis, Adel; Collins, Stephen F.; Hill, Matthew R.; Duke, Mikel C.
2018-01-01
Routine water quality monitoring is required in drinking and waste water management. A particular interest is to measure concentrations of a range of diverse contaminants on-site or remotely in real time. Here we present metal organic framework (MOF) integrated optical fiber sensor that allows for rapid optical measurement based on fast Fourier transform (FFT) spectrum analysis. The end-face of these glass optical fibers was modified with UiO-66(Zr) MOF thin film by in situ hydrothermal synthesis for the detection of the model contaminants, Rhodamine-B and 4-Aminopyridine, in water. The sensing mechanism is based on the change in the optical path length of the thin film induced by the adsorption of chemical molecules by UiO-66. Using FFT analysis, various modes of interaction (physical and chemical) became apparent, showing both irreversible changes upon contact with the contaminant, as well as reversible changes according to actual concentration. This was indicated by the second harmonic elevation to a certain level translating to high sensitivity detection.
Timmermans, Luc; Falez, Freddy; Mélot, Christian; Wespes, Eric
2013-09-01
A urinary incontinence impairment rating must be a highly accurate, non-invasive exploration of the condition using International Classification of Functioning (ICF)-based assessment tools. The objective of this study was to identify the best evaluation test and to determine an impairment rating model of urinary incontinence. In performing a cross-sectional study comparing successive urodynamic tests using both the International Consultation on Incontinence Questionnaire-Urinary Incontinence-Short Form (ICIQ-UI-SF) and the 1-hr pad-weighing test in 120 patients, we performed statistical likelihood ratio analysis and used logistic regression to calculate the probability of urodynamic incontinence using the most significant independent predictors. Subsequently, we created a template that was based on the significant predictors and the probability of urodynamic incontinence. The mean ICIQ-UI-SF score was 13.5 ± 4.6, and the median pad test value was 8 g. The discrimination statistic (receiver operating characteristic) described how well the urodynamic observations matched the ICIQ-UI-SF scores (under curve area (UDA):0.689) and the pad test data (UDA: 0.693). Using logistic regression analysis, we demonstrated that the best independent predictors of urodynamic incontinence were the patient's age and the ICIQ-UI-SF score. The logistic regression model permitted us to construct an equation to determine the probability of urodynamic incontinence. Using these tools, we created a template to generate a probability index of urodynamic urinary incontinence. Using this probability index, relative to the patient and to the maximum impairment of the whole person (MIWP) relative to urinary incontinence, we were able to calculate a patient's permanent impairment. Copyright © 2012 Wiley Periodicals, Inc.
Tian, Chen; Zhao, Jian; Ou, Xinwen; Wan, Jieting; Cai, Yuepeng; Lin, Zhang; Dang, Zhi; Xing, Baoshan
2018-03-20
p-Arsanilic acid ( p-ASA) is an emerging organoarsenic pollutant comprising both inorganic and organic moieties. For the efficient removal of p-ASA, adsorbents with high adsorption affinity are urgently needed. Herein, amine-modified UiO-67 (UiO-67-NH 2 ) metal-organic frameworks (MOFs) were synthesized, and their adsorption affinities toward p-ASA were 2 times higher than that of the pristine UiO-67. Extended X-ray absorption fine structure (EXAFS), X-ray photoelectron spectroscopy (XPS), and density functional theory (DFT) calculation results revealed adsorption through a combination of As-O-Zr coordination, hydrogen bonding, and π-π stacking, among which As-O-Zr coordination was the dominant force. Amine groups played a significant role in enhancing the adsorption affinity through strengthening the As-O-Zr coordination and π-π stacking, as well as forming new adsorption sites via hydrogen bonding. UiO-67-NH 2 s could remove p-ASA at low concentrations (<5 mg L -1 ) in simulated natural and wastewaters to an arsenic level lower than that of the drinking water standard of World Health Organization (WHO) and the surface water standard of China, respectively. This work provided an emerging and promising method to increase the adsorption affinity of MOFs toward pollutants containing both organic and inorganic moieties, via modifying functional groups based on the pollutant structure to achieve synergistic adsorption effect.
Evidence for a chemical clock in oscillatory formation of UiO-66
Goesten, M. G.; de Lange, M. F.; Olivos-Suarez, A. I.; Bavykina, A. V.; Serra-Crespo, P.; Krywka, C.; Bickelhaupt, F. M.; Kapteijn, F.; Gascon, Jorge
2016-06-01
Chemical clocks are often used as exciting classroom experiments, where an induction time is followed by rapidly changing colours that expose oscillating concentration patterns. This type of reaction belongs to a class of nonlinear chemical kinetics also linked to chaos, wave propagation and Turing patterns. Despite its vastness in occurrence and applicability, the clock reaction is only well understood for liquid-state processes. Here we report a chemical clock reaction, in which a solidifying entity, metal-organic framework UiO-66, displays oscillations in crystal dimension and number, as shown by X-ray scattering. In rationalizing this result, we introduce a computational approach, the metal-organic molecular orbital methodology, to pinpoint interaction between the tectonic building blocks that construct the metal-organic framework material. In this way, we show that hydrochloric acid plays the role of autocatalyst, bridging separate processes of condensation and crystallization.
Experience with short notice (SNRI) and unannounced (UI) inspections in Sweden
International Nuclear Information System (INIS)
Andre, E.; Dahlin, G.
2013-01-01
Integrated Safeguards (IS) has been implemented in Sweden since 15 January, 2009. This presentation will describe some of the preparations that were done to facilitate the change to new safeguards. For Sweden, the IAEA drew the necessary conclusions late 2008 to start IS-implementation. There is a mixture of short notice random inspections and unannounced inspections. During 2008 discussions with the IAEA, the Commission, the State authority and operators were performed to pave the road towards IS. The most difficult task was the LEU (Low Enrichment Uranium Fuel) fuel fabrication plant but also for the state authority to arrange so that its inspectors can, with very short notice, get to the facilities. This presentation will describe how we in Sweden have come to organise the implementation of IS on all levels including the communication ways with the IAEA and the European Commission. The experience gained from the SNRIs (Short Notice Reported Inspections) and UIs (Unannounced inspections) that have been conducted in Sweden will be presented. The paper is followed by the slides of the presentation. (authors)
Comparison between RVG UI sensor and Kodak InSight film for detection of incipient proximal caries
International Nuclear Information System (INIS)
Matsuda, Yukiko; Hanazawa, Tomomi; Seki, Kenji; Araki, Kazuyuki; Okano, Tomohiro
2002-01-01
The purpose of this study was to compare the efficacy of the four combination modes of Trophy Radio Visio Graphy (RVG) UI sensor (Trex-Trophy Radiology Inc., Marne-la-Valee, France) and Kodak InSight film (Eastman Kodak Co., Rochester, NY) for detecting proximal dental caries. Thirty extracted human upper premolars were selected. Of 60 surfaces, 25 had carious lesions in the form of small cavities, and the rest showed no evidence of caries as verified by a micro computed tomogram (micro CT; XCT Research SA+, Stratec Medizintechnik GmbH, Pforzheim, Germany). All teeth were radiographed with the paralleling technique (60 kV, 40 cm focus-to-sensor distance). Four combination modes (high-resolution caries mode-HRC; high-sensitivity caries mode-HSC; high-resolution periodontal mode-HRP; and high-resolution endo mode-HRE) were used. Exposure was set at 0.12 sec for HRC, 0.08 sec for HSC, 0.16 sec for HRP, 0.12 sec for HRE, and 0.16 sec for the Kodak InSight film. The resulting images were evaluated by three oral radiologists. The same three observers evaluated the digital images, and were allowed to use the contrast and brightness controls in doing so. Possible differences in receiver operating characteristic (ROC) curve areas among image modalities were assessed by the Friedman test. The mean ROC curve areas were 0.66±0.11 for HRC, 0.78±0.02 for HSC, 0.76±0.04 for HRE, 0.77±0.04 for HRP, and 0.71±0.09 for the Kodak InSight film. There were no statistically significant differences between HRC, HSC, HRE, HRP and the Kodak InSight film in terms of proximal caries detection. The four modes of RVG UI system are each a viable alternative to intraoral film for the detection of incipient dental caries. (author)
Yao, Bing-Jian; Jiang, Wei-Ling; Dong, Ying; Liu, Zhi-Xian; Dong, Yu-Bin
2016-07-18
Metal-organic frameworks (MOFs) are widely used as porous materials in the fields of adsorption and separation. However, their practical application is largely hindered by limitations to their processability. Herein, new UiO-66-Urea-based flexible membranes with MOF loadings of 50 (1), 60 (2), and 70 wt % (3) were designed and prepared by post-synthetic polymerization of UiO-66-NH2 nanoparticles and a polyurethane oligomer under mild conditions. The adsorption behavior of membrane 3 towards four hydrophilic dyes, namely, eosin Y (EY), rhodamine B (RB), malachite green (MG), and methylene blue (MB), in aqueous solution was studied in detail. It exhibits strong adsorption of EY and RB but weak adsorption of MG and MB in aqueous solution. Owing to the selective adsorption of these hydrophilic dyes, membrane 3 can remove EY and RB from aqueous solution and completely separate EY/MB, RB/MG, and RB/MB mixtures in aqueous solution. In addition, the membrane is uniformly textured, easily handled, and can be reused for dye adsorption and separation. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Mayer-Foell, R.; Keitel, A.; Geiger, W. (eds.)
2001-12-01
Information and communication technology facilitates data acquisition, recording, evaluation and transmission in many fields of society, but even experts tend to get lost in the flood of data that are available. In order to make it possible to integrate new technological developments in information systems, the Minister of Environment and Transportation continues the project AJA (''Application of JAVA-based solutions'') which was started in 2000. AJA is a sequel to the GLOBUS project which was terminated in 1999. (GLOBUS - Globale Umweltsachdaten im UIS Baden-Wuerttemberg und anderen Systemen). [German] Die Bereiche Umwelt, Verkehr und Verwaltung profitieren bei der Erhebung, Erfassung, Auswertung, Darstellung und Weitergabe ihrer Daten in hohem Masse von Informations- und Kommunikationstechnik (IuK). Manche Darstellungsweisen und Berechnungen werden dadurch erst moeglich. Uebergreifende Zusammenhaenge koennen mit Hilfe der IuK aufgezeigt werden. Die Verwaltung muss Technologien einsetzen, wie sie in der Wirtschaft fuer die Zusammenfuehrung von verteilten Unternehmensdaten verwendet werden, um Entscheidungs grundlagen fuer die Unternehmenspolitik zu liefern (z.B. Data Warehouse). In solchen ''Warenhaeusern von Daten'' finden sich oft nur Experten zurecht. Unsere Herausforderung ist es, diese komplexen Zusammenhaenge nicht nur dem Experten, sondern auch dem Buerger auf moeglichst einfache und wirtschaftliche Weise zu vermitteln. Dem Buerger ist der freie Zugang zu Informationen ueber die Umwelt zu ermoeglichen. Wir sind damit auf dem Wege zu einem Marktplatz von Daten und Informationen fuer den Buerger und die Verwaltung. Um neue technologische Entwicklungen in Informationssystemen einsetzen zu koennen, fuehrt das Ministerium fuer Umwelt und Verkehr (UVM) das 2000 begonnene FuE-Vorhaben AJA ''Anwendung JAVA-basierter Loesungen'' fort. AJA baut auf dem 1999 abgeschlossenen Vorhaben GLOBUS (Globale
Institute of Scientific and Technical Information of China (English)
王晓霞
2011-01-01
民国初期的回族虽然在经济及社会发展方面仍在较低层次上徘徊,但在思想与文化方面却受到近世以来涌入中国的新思潮、新文化气象以及国内新文化运动的影响,出现了回族新文化运动的热潮,回族知识分子一方面以兴学校、办报刊觉醒民众,另一方面也对回族宗教与社会习俗进行反思与改革,要求回族在应对时代变化中实现自身的社会发展。宗教观念上大力提倡“理性”与“改良”意识,对一些闭塞与异化的宗教观念要求“正本清源”,力求“精义”;在回族社会生活习俗方面则更多地强调与新事物之间要“适应”与“协调”。%Although the Hui nationality' s social and economic development in the early Republic of China and is at a low level, their ideological and cultural are affected by the new ideas, the new culture atmosphere , the new culture movement pouring into modern China. The emergence of Hui nationality' s new culture movement appeared, the HUI intellectuals arouse people by establishing schools, publishing newspapers on one hand and ask the Hui nationality to realize the social self - development by reflecting and innovating from the social customs and the I-Iui nationality' s religious on the other. The consciousness of rationality and improvement are advocated in religious consciousness, and some closed and alienated religious consciousness has been reformed radically and aimed for essence. The adaptation and coordination for the new things are more emphasized in the Hui nationality' s social life and custom.
Gesture language use in natural UI: pen-based sketching in conceptual design
Ma, Cuixia; Dai, Guozhong
2003-04-01
Natural User Interface is one of the important next generation interactions. Computers are not just the tools of many special people or areas but for most people. Ubiquitous computing makes the world magic and more comfortable. In the design domain, current systems, which need the detail information, cannot conveniently support the conceptual design of the early phrase. Pen and paper are the natural and simple tools to use in our daily life, especially in design domain. Gestures are the useful and natural mode in the interaction of pen-based. In natural UI, gestures can be introduced and used through the similar mode to the existing resources in interaction. But the gestures always are defined beforehand without the users' intention and recognized to represent something in certain applications without being transplanted to others. We provide the gesture description language (GDL) to try to cite the useful gestures to the applications conveniently. It can be used in terms of the independent control resource such as menus or icons in applications. So we give the idea from two perspectives: one from the application-dependent point of view and the other from the application-independent point of view.
Directory of Open Access Journals (Sweden)
Ruth Zárate-Rueda
2016-01-01
Full Text Available Ante las dinámicas sociales del mundo actual, la educación a distancia se ha convertido en la principal estrategia orientada al aumento de capacidades y oportunidades para alcanzar niveles óptimos de bienestar social. No obstante, a pesar de programas flexibles que facilitan la vinculación universitaria como Tecnología y Gestión Empresarial, ofertados por el Instituto de Proyección Regional y Educación a Distan - cia-IPRED de la Universidad Industrial de Santander - UIS, el número de graduados en comparación con los ingresantes no es el esperado: durante el periodo 2007-2009 se identificó un índice de abandono del 55 % y 28% respectivamente. Este estudio cuantitativo de diseño descriptivo a partir de la muestra aleatoria estratificada permite la identificación de características, patrones de conducta y actitudes, para señalar los comportamientos concretos de los desertores. Como resultado, se estableció que las motivaciones socioeconómicas de aban - dono escolar están interconectadas con otras variables, afirmando un fenómeno multicausal que orienta a la construcción de estrategias socialmente responsables de seguimiento y permanencia, en procura de su disminución, en el marco de la Responsabilidad Social de la UIS.
Nur Hidayah binti Mohd Razali; Wan Mohamad Asyraf
2014-01-01
Electrical consumption is increasing rapidly in Malaysia due to the sustenance of a modern economy way of living. Recently, the Vice Chancellor of University Technology MARA, Tan Sri Dato? Professor Ir Dr Sahol Hamid Abu Bakar has shown a great deal of concern regarding the high electrical energy consumption in UiTM?s main campus in Shah Alam. This study seeks to evaluate the factors that contribute to high electrical energy consumption in the Faculty of Computer and Mathematical Sciences (FS...
Directory of Open Access Journals (Sweden)
Aura Cecilia Pedraza Marín
2016-02-01
Full Text Available Desde el año 2008 el programa de Emprendimiento de la Universidad Industrial de Santander (UIS guía a los estudiantes a proponer soluciones a las necesidades, los problemas y los deseos presentes en la comunidad, mediante trabajos de grado que desarrollan ideas innovadoras y generan empleo. Esta investigación, que surge de la necesidad de contar con información acerca de las debilidades, fortalezas y oportunidades de mejora de esta opción de trabajo de grado, evalúa los resultados de la implementación de la modalidad práctica en creación de empresas en los programas de pregrado de la UIS. En el estudio se identificaron los proyectos de grado de la modalidad y se caracterizaron de acuerdo con el programa académico, el sector económico y el equipo emprendedor. Los resultados muestran que algunos graduados logran desarrollar sus propias empresas y, en consecuencia, es valioso apoyar esta modalidad y seguir incentivando la cultura empresarial en la institución.
Directory of Open Access Journals (Sweden)
Yuri Analia
2013-07-01
Full Text Available Smile is a non-verbal communication to express spontaneous feelings and emotions. Most patients that come to have orthodontic treatments want to have an attractive smile, but before the treatment smile has not yet been studied. There are eight components to make ideal frontal smile: lip line, smile arc, upper lip curve, buccal corridor, symmetry of smile, occlusal plane, dental and gingival components. This study was descriptive in design, in order to obtain frontal smile description before orthodontic treatment of RSGMP FKG UI patients that were grouped according to facial form, age, and gender. The results of the study show that patient smile before orthodontic treatment frequently exhibits medium lip line and the mean of incisor display at 75% of clinical crown. Most subjects show gingival display of 2 mm or less. On the smile arc, the most common features are straight smile and consonant smile. Equally common smile arc positions are those touching and not touching lower lip. The average buccal corridor is in medium smile, and thus most subjects have straight upper lip curves and symmetric smiles.DOI: 10.14693/jdi.v15i1.80
Technological Readiness of UiTM students in Using Mobile Phones in their English Language Classroom
Directory of Open Access Journals (Sweden)
Agelyia a/p Murugan
2017-04-01
Full Text Available Mobile Assisted Language Learning (MALL by using devices such as mobile phones is an ideal learning platform for learners to acquire language and share knowledge beyond the confines of a fixed location. By utilising the mobile applications available via smartphone, learners can engage in collaborative networks and find information that they need in a variety of diverse environments. This paper shares the findings of a research at UiTM to determine the technological readiness of the students by measuring their digital skills using the Digital Competence Framework (EU. 50 students from the English language proficiency course were purposively sampled because they have been exposed to MALL by their lecturer participated in this research. Their responses were collected through an online questionnaire. The findings showed that all 50 of the students owned a smartphone. 82.6% of the students did not attend any training on how to use the smartphones. 80.4% of the students have their own storing strategies and nearly 90% of the students reported having the following technological skills in operating their smartphone such as accessing applications, ability to record, share and produce technological resources. The findings reiterate that to ensure successful MALL, educators need to be aware of the background and technological skills of the learners before embedding m-learning into the English Language lessons. View it in PDF
Syahrom, N. S.; Nasrudin, N. S.; Mohamad Yasin, N.; Azlan, N.; Manap, N.
2017-08-01
It has been reported that students are already accumulating substantial debt from higher education fees and their spending habit are at a critical stage. These situations cause the youngsters facing bankruptcy if they cannot improve their saving habit. Many researches have acknowledged that the determinants of saving habit include financial management, parental socialization, peer influence, and self-control. However, there remains a need for investigating the relationship between these determinants in order to avoid bankruptcy among youngsters. The objectives of this study are to investigate the relationship between saving habit determinants and to generate a statistical model based on the determinants of saving habit. Data collection method used is questionnaire and its scope is undergraduate students of UiTM Negeri Sembilan, Kampus Seremban. Samples are chosen by using stratified probability sampling technique and cross-sectional method is used as the research design. The results are then analysed by using descriptive analysis, reliability test, Pearson Correlation, and Multiple Linear Regression analysis. It shows that saving habit and self-control has no relationship. It means that students with less self-control tend to save less. A statistical model has been generated that incorporated this relationship. This study is significant to help the students save more by having high self-control.
Café as third place and the creation of a unique space of interaction in UI Campus
Nurliani Lukito, Yulia; Puspita Xenia, Anneli
2017-12-01
The emergence of modern cafés is an interesting phenomenon in the city and it is related to globalization and the creation of urban public space. This paper explores the idea of café as third place and social interaction occurs in the café with Starbucks café as the focus of discussion. We argue that modern café like Starbucks offers a comforting and neutral ground for social interaction but some other characteristic of social interaction come up as the result of modern technology. Oldenburg distinguishes third places as public places on neutral ground where people can gather and interact (Oldenburg, 1991). In contrast to first places (home) and second places (work), third places serve as places for creative and social interaction and often considered anchors of community life. The characteristic of cafés as third space relates to the social interaction occurs at the neighborhood that in terms may enhances quality of life and provide social bounding. With the development of information technology, some characteristics of third places are changed although third places still become an important medium for social interaction as well as in increasing the ability of the city to be more adaptable to changes. Conversation is still the main activity at third place but many people use their electronic devices alongside face-to-face conversations. As a method, this study uses direct observations and qualitative analyses of UI Starbucks in as case studies.
Directory of Open Access Journals (Sweden)
Taimur Kayani
2017-01-01
Full Text Available Brecht’s ‘canonical’ literary work’s indigenization in Pakistan can offer a valuable transcultural adaptation study because it was performed through a radical theatre with a distinct dramaturgy and political philosophy in two different cultural contexts and historical frame of references. As the foremost representative of Brecht’s radical dramaturgy, philosophy and literary works in Pakistan since 1983, Ajoka theatre utilized these adaptations as socio-political spaces to challenge dominant discourses on the rise of dictatorship and capitalism in Pakistan. Prior studies explored the formal elements of these adaptations of The Resistible Rise of Arturo Ui(1942 : visual and aural and the intellectual content i.e. political dimension of this ‘social action theatre’ is still unexamined. This contextual reading attempts to fulfill this ‘gap’ by conducting a seminal contextual criticism on ‘literary representations’ of Pakistani pro-capitalist dictators in selected transcultural adaptations of Brecht’s work in light of new historicism and Hutcheon’s Theory of Adaptation. The article also explores how in the second phase Brecht’s social and political philosophy is reflected in Ajoka’s signature plays, Bala King (1997 and The Third Knock (1970.
African Journals Online (AJOL)
external evidence in the evaluation of mentalistic linguistic theories ..... The basic question with which §3 deals can be formulated as follows in terms ..... According to FFG (1975:526), their remarks quoted in (9) have a bearing on the potential ...
2-domination number of generalized Petersen graphs
Indian Academy of Sciences (India)
35
{vi,ui,ui+k,vi+k} (see Figure 1) . Suppose that Di = Vi ∩D. Since the degree of both ui and ui+k in P(2k, k) are two, so (i) ui ∈ D or vi,ui+k ∈ D and (ii) ui+k ∈ D or ui,vi+k ∈ D. It follows |Di| = |D ∩ {vi,ui,ui+k,vi+k}| ≥ 2 for every i. On the other hand, for each vertex v of P(2k, k), there are exactly two sets Vi such that v belongs to ...
Unigene BLAST: CBRC-RNOR-20-0133 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-20-0133 gnl|UG|Rn#S14181288 UI-R-DO1-cms-c-10-0-UI.s1 UI-R-DO1 Rattus nor...vegicus cDNA clone UI-R-DO1-cms-c-10-0-UI 3', mRNA sequence /clone=UI-R-DO1-cms-c-10-0-UI /clone_end=3' /gb=BQ202827 /gi=20419292 /ti=154455115 /ug=Rn.83937 /len=645 0.001 44% ...
Body mass index and adult female urinary incontinence
DEFF Research Database (Denmark)
Mommsen, Søren; Foldspang, Anders
1994-01-01
rate of response was 85%, and the present analysis comprises 2,589 women who supplied information about their body weight and height. The period prevalence of all UI, stress UI, urge UI, and mixed stress and urge UI was 17%, 15%, 9%, and 7%, respectively. The mean body mass index (BMI) was 22.7 kg/m2......The aim of the present investigation was to study the possible role of obesity in the etiology of adult female urinary incontinence (UI). A random population sample of 3,114 women aged 30–59 years were mailed a questionnaire concerning UI and, among other things, body weight and height. The overall....... Irrespective of other risk indicators, BMI was positively associated with UI prevalence (OR, 1.07/BMI unit; Pstress UI prevalence, with cystitis in predicting urge UI, and with both in predicting mixed UI. Stress UI proved to be the UI type most closely...
Prevalence and risk factors of urinary incontinence in Chinese women: a population-based study.
Ge, Jing; Yang, Peng; Zhang, Yi; Li, Xinyu; Wang, Quanyi; Lu, Yongxian
2015-03-01
To estimate the current prevalence rate of urinary incontinence (UI) and to identify risk factors in Chinese women, we conducted a population-based survey in 3058 women in Beijing, China, in 2009. The prevalence rate of UI was estimated to be 22.1%, with stress UI (12.9%) being more prevalent than urgency UI (1.7%) and mixed UI (7.5%). The prevalence rates of UI, urgency UI, and mixed UI increased with age, with the highest recorded in participants aged ≥70 years. However, stress UI was most commonly seen in participants aged 50 to 69 years. Risk factors for UI included aging, lower education background, older age of menarche, menstrual disorder, pregnancy history, episiotomy, chronic pelvic pain, gynecological disease, other chronic diseases, constipation, fecal incontinence, lower daily water intake, and frequency of high protein intake. UI is a common disorder in Chinese women, and many risk factors are able to affect the development of UI. © 2011 APJPH.
Albers-Heitner, P; Bekkers, L; Moossdorff, H; Berghmans, B; Verdonk, P
2016-01-01
The authors studied whether family history of urinary incontinence (UI) is associated with pre- and postpartum UI. In 2010, Dutch postpartum women at three months were approached to fill in a Web-based questionnaire on UI and risk factors (body mass index, BMI), parity, pelvic organ prolapse, and family history. Results were analyzed with Chi-square and logistic regression analyses. 162 (61%) questionnaires were analyzed, 76 (47%) women reported UI before, during and/or after pregnancy, of which 34% also reported a UI family history. Sixteen (19%) out of 84 women without UI reported UI family history (p = 0.05). BMI was associated with prepartum UI (p = 0.035), but the association disappears when adding family history. Women with unknown UI family history had higher risk for postpartum U. UI family history is associated with UI during pregnancy. More awareness and research is needed whether adding family history questions on UI in prepartum consultations improves timely prevention.
DEFF Research Database (Denmark)
Lam, Gitte Wrist; Foldspang, Anders; Elving, Lisbeth Bach
1992-01-01
indicated the workplace and 66% the home as principal sites of UI occurrence. Thirty-one percent had experienced UI in specific situations such as during anxiety, sexual intercourse, or sleep. Nineteen percent had abstained from social activities, 17% from non-intimate social activity and 6% from sexual...... with episodes of UI occurring at home and in specific situations such as during anxiety and sleep. The experience of UI during sexual intercourse was related to all types of abstention. The perception of UI as a social or hygienic problem depended on the duration since first UI episode as well as social context...... and abstention. The everyday life consequences of UI are widespread and may cause serious relational problems for the individual. Stress UI manifests itself as a somatic condition leading to abstention from sport and other non-intimate social activities. Urge UI and the role of the experience of UI during sexual...
The interaction of stress and urgency urinary incontinence and its effect on quality of life.
Minassian, Vatché A; Sun, Haiyan; Yan, Xiaowei S; Clarke, Deseraé N; Stewart, Walter F
2015-02-01
The objective was to estimate the impact of stress and urgency urinary incontinence (UI) on the quality of life (QOL), and to determine whether the impact varies according to UI severity. We used data from the General Longitudinal Overactive Bladder Evaluation-UI study in women. Stress and urgency UI symptom severity scores ranged from 0 to 8. We used logistic regression to test the relation among different severity levels of stress and urgency UI, and their interaction with the Incontinence Impact Questionnaire (IIQ-7). This was categorized according to percentage ranges as 0-40% (reference), 41-80%, and 81-100%. Both stress and urgency UI were significantly associated with IIQ-7. Higher scores had higher odds ratios (ORs). The OR for urgency vs stress UI was greater at the same severity level. For instance, comparing IIQ-7 quintiles (0-40% vs 41-80%), the OR for an association with an urgency UI score of 5-6 was 5.27 (95% CI = 3.78-7.33) vs 2.76 (95% CI = 2.07-3.68) for a stress UI score of 5-6. Both UI subtypes were more strongly related to the upper (81-100%) than the to the lower (41-80%) quintiles. There was a strong positive urgency UI and stress UI interaction with the upper (i.e., 81-100%) but not the two next lower (41-80%) quintiles. The impact of UI subtypes on QOL varies according to the score of IIQ-7, stress and urgency UI, and their interaction. Urgency vs stress UI has a stronger impact. The effect is greatest for high IIQ-7 scores with a significant share mediated by the interaction of the two UI subtypes.
Predictors and reasons for help-seeking behavior among women with urinary incontinence.
Schreiber Pedersen, Louise; Lose, Gunnar; Høybye, Mette Terp; Jürgensen, Martina; Waldmann, Annika; Rudnicki, Martin
2018-04-01
The aim of the study was to evaluate the predictors and reasons for help-seeking behavior among women with urinary incontinence (UI) in Germany and Denmark. This international postal survey was conducted in 2014. In each country, 4,000 women of at least 18 years of age were randomly selected. The questionnaires included validated items regarding help-seeking behavior and the ICIQ-UI SF. UI was defined as any involuntary loss of urine. Binary logistic regression analysis was used to assess factors predicting help-seeking behavior. Reasons for seeking or not seeking help were evaluated in terms of the severity of UI and as the most frequently reported. Of 1,063 Danish women with UI, 25.3% had consulted a physician compared with 31.4% of 786 German women with UI (p = 0.004). The severity and duration of UI, and actively seeking information regarding UI, were significant independent predictors of help-seeking behavior. Women with slight/moderate UI did not seek help because they did not consider UI as a problem, whereas of women with severe/very severe UI, German women reported that other illnesses were more important and Danish women reported that they did not have enough resources to consult a physician. Only a small proportion of women with UI had consulted a physician, and the driving forces for help-seeking behavior were severity and duration of UI and actively seeking information regarding UI. Public information campaigns might enhance consultation rates providing that passively receiving and actively seeking information have the same effects on help-seeking behavior. We show for the first time that reasons for not consulting a physician for UI vary depending on the severity of the UI.
Cystitis as a correlate of female urinary incontinence
DEFF Research Database (Denmark)
Mommsen, S.; Foldspang, Anders; Elving, Lisbeth Bach
1994-01-01
of episodes of cystitis and UI related to cystitis in adult life, and prevalence of relative risks, as indicated by odds ratio (OR), of UI conditional on cystitis experience. Results indicated that the 1987 period prevalences of UI provoked by physical stress and UI associated with a feeling of urge were 15......-reported data based on postal questionnaires. The sample consisted of 3114 women, out of whom 2613 (84%) delivered the information requested. The main outcome measures were period prevalence in 1987 of episodes of UI provoked by physical stress and UI associated with a feeling of urge, prevalence of experience......% and 9%, respectively. Forty-five per cent reported a history of cystitis and 10% of UI during episodes of cystitis. Both UI provoked by stress and UI associated with a feeling of urge were significantly correlated to cystitis (OR 2.1, P
Preventing urinary incontinence during pregnancy and postpartum: a review.
Wesnes, Stian Langeland; Lose, Gunnar
2013-06-01
Urinary incontinence (UI) is a common condition in association with pregnancy. Incident UI in pregnancy or postpartum are significant risk factors for UI later in life. Epidemiological studies on UI during pregnancy and postpartum list numerous variables associated with UI. For women, the main focus is on pelvic floor muscle training to prevent UI. However, several other modifiable risk factors are likely to contribute to prevention of UI during pregnancy and postpartum. This review investigated modifiable risk factors for UI during pregnancy and postpartum and also reviewed randomized controlled trials on prevention of UI in association with pregnancy. Systematic searches for publications until September 2012 on prevention of UI during pregnancy and postpartum were performed. Based on available evidence, the following recommendations to prevent UI during pregnancy and postpartum were made: women should be advised not to smoke before or during pregnancy (grade B), aim at normal weight before pregnancy (grade B), and aim at regaining prepregnancy weight postpartum (grade B). Occasional low-intensity training should be advocated (grade B), and constipation should be avoided during pregnancy (grade B) and postpartum (grade C). Women should be advised to perform pelvic floor muscle training during pregnancy and postpartum (grade A) and to use perineal warm packs during delivery (grade B). Cesarean section to prevent UI cannot be recommended (grade D). If lifestyle recommendations are addressed in association with pregnancy, incidence of UI during pregnancy and postpartum is likely to decrease.
Martin-Martin, Sergio; Pascual-Fernandez, Angela; Alvarez-Colomo, Cristina; Calvo-Gonzalez, Raul; Muñoz-Moreno, Marife; Cortiñas-Gonzalez, Jose Ramon
2014-05-01
To determine the prevalence of urinary incontinence (UI) before pregnancy, in the third trimester and postpartum. To analyze its influence on quality of life and associated potential risk factors and the efficacy of pelvic floor exercises. Prospective study in 413 pregnant women. The modified ICIQ-SF incontinence questionnaire was given to the pregnant women at the end of the third quarter. This questionnaire was administered by telephone at 3 and 6 months postpartum. The influence of several risk factors for UI in pregnancy and postpartum were analyzed. Patients with persistent UI at 6 months postpartum were trained to do pelvic floor exercises. Patients with UI before pregnancy were excluded from the study. UI in the third trimester was 31%. Analyzed risk factors did not condition a higher percentage of UI. Prevalence of UI was 11.3% at 3 months postpartum and 6.9% at 6 months. 70% of the incontinent patients already had it during pregnancy and it appeared de novo post-delivery in 30% of the patients. Prevalence of UI after delivery was higher in women with UI in pregnancy and lower in caesarean cases. Most women improved with pelvic floor exercises. Analysed risk factors did not significantly increase UI in pregnancy. Prevalence of UI after delivery is higher in women with UI in pregnancy and lower in caesarean cases. Postpartum pelvic floor exercises for three months in patients with persistent stress UI at 6 months postpartum clearly improved the degree of continence.
Energy Technology Data Exchange (ETDEWEB)
Lin, Kun-Yi Andrew, E-mail: linky@nchu.edu.tw [Department of Environmental Engineering, National Chung Hsing University, 250 Kuo-Kuang Road, Taichung, Taiwan (China); Chen, Shen-Yi [Department of Environmental Engineering, National Chung Hsing University, 250 Kuo-Kuang Road, Taichung, Taiwan (China); Jochems, Andrew P. [New Mexico Bureau of Geology & Mineral Resources and New Mexico Institute of Mining & Technology, Socorro, NM (United States)
2015-06-15
Phosphate is one of the most concerning compounds in wastewater streams and a main nutrient that causes eutrophication. To eliminate the phosphate pollution, Metal Organic Frameworks (MOFs) are proposed in this study as adsorbents to remove phosphate from water. The zirconium-based MOF, UiO-66, was selected as representative MOF given its exceptional stability in water. To investigate the effect of an amine functional group, UiO-66-NH2 was also prepared using an amine-substituted ligand. The adsorption kinetics and isotherm reveal that UiO-66-NH2 exhibited higher adsorption capacities than UiO-66 possibly due to the amine group. However, the interaction between phosphate and zirconium sites of UiO MOFs might be the primary factor accounting for the phosphate adsorption to UiO MOFs. UiO MOFs also exhibited a high selectivity towards phosphate over other anions such as bromate, nitrite and nitrate. Furthermore, UiO MOFs were found to adsorb phosphate and to completely remove diluted phosphate in urine. We also found that UiO MOFs could be easily regenerated and re-used for phosphate adsorption. These findings suggest that UiO MOFs can be effective and selective adsorbents to remove phosphate from water as well as urine. - Highlights: • UiO-66 as the first type of MOFs was used to remove phosphate from water and urine. • The amine group in UiO MOFs was found to enhance the phosphate adsorption. • UiO-66 exhibited a high adsorption selectivity towards phosphate over other anions. • UiO-66 could be easily regenerated and re-used with 85% regeneration efficiency.
Specific obstetrical risk factors for urinary versus anal incontinence 4 years after first delivery.
Fritel, X; Khoshnood, B; Fauconnier, A
2013-09-01
Delivery can be complicated by urinary or anal incontinence (UI or AI). We hypothesized that the mechanisms of injury may differ for UI and AI. Hence, obstetrical risk factors may be specific for different types of incontinence. Data on maternal characteristics were collected at first delivery. Data on incontinence were obtained by a questionnaire completed by 627 women 4 years after first delivery. UI was defined by "Do you have involuntary loss of urine" and AI by "Do you have involuntary loss of flatus or stool". A multinomial logistic regression analysis was conducted to assess risk factors for UI only, AI only, and UI+AI. Twenty-two percent of women reported UI only, 6.5% AI only, and 6.5% both. Risk factors associated with UI only were age (at first delivery)≥ 30 (OR 2.27 [95% CI 1.47-3.49]), pre-existing UI (6.44 [2.19-19.0]) and pregnancy UI (3.64 [2.25-5.91]). Risk factors associated with AI only were length of the second active stage> 20minutes (2.86 [1.15-7.13]) and third degree perineal tear (20.9 [1.73-252]). Significant predictors of UI+AI were age ≥ 30 (2.65 [1.29-5.46]), no epidural (4.29 [1.65-11.1]), third degree perineal tear (20.0 [1.28-314]), and UI before pregnancy (32.9 [9.00-120]). Cesarean delivery was not significantly associated with UI, AI, or UI+AI, although for all three outcomes, the adjusted odds ratios were substantially less than one. We found specific associations between obstetrical risk factors and urinary versus anal incontinence 4 years after first delivery. Our results are consistent with the hypothesis that the underlying mechanisms of injury differ for UI and AI. Copyright © 2013 Elsevier Masson SAS. All rights reserved.
Pettersen, Renate; Stien, Ragnar; Wyller, Torgeir B
2007-05-01
To describe a clinical subtype of urinary incontinence (UI) after a stroke, i.e. with impaired awareness of the need to void (IA-UI), and to compare it to urge UI after a stroke for the risk factors and medium-term outcome. In a consecutive sample of 315 hospitalized stroke patients who were clinically stable and able to communicate, 65 with UI were identified (27 urge UI, 38 IA-UI). All had a comprehensive clinical assessment and cerebral computed tomography (CT). Cysto-urethrometry was performed in seven patients with IA-UI. Of the 38 patients with IA-UI, 16 were partially aware of leakage, but not of bladder fullness; the remaining 22 denied leakage. Patients with IA-UI were more functionally impaired (P=0.001), had more visible new CT lesions (24 of 38 vs 10 of 27, P=0.04) and less frontal lobe involvement (seven of 24 vs seven of 10, P=0.05) than those with urge UI. Ten of 12 patients with parietal lobe involvement denied leakage; no particular lesion pattern was found in those with partial awareness. Two patients had normal cysto-urethrometry, four showed terminal detrusor overactivity, and one had an incompetent urethral closure mechanism. In all, bladder sensation was reduced or absent. Only two of the surviving patients had regained continence after 1 year, whereas half of those with urge UI had become continent. IA-UI after a stroke differs from urge UI in clinical and prognostic respects, and probably reflects greater brain damage. It might explain the prognostic importance of stroke-related UI. There are various urodynamic patterns. Patients with better preserved insight might benefit from early awareness training and even from additional medical treatment if bladder overactivity is present; this needs further investigation.
Pizzoferrato, Anne-Cécile; Fauconnier, Arnaud; Bader, Georges; de Tayrac, Renaud; Fort, Julie; Fritel, Xavier
2016-07-01
Obstetric trauma during childbirth is considered a major risk factor for postpartum urinary incontinence (UI), particularly stress urinary incontinence. Our aim was to investigate the relation between postpartum UI, mode of delivery, and urethral descent, and to define a group of women who are particularly at risk of postnatal UI. A total of 186 women were included their first pregnancy. Validated questionnaires about urinary symptoms during pregnancy, 2 and 12 months after delivery, were administered. Urethral descent was assessed clinically and by ultrasound at inclusion. Multivariate logistic regression analysis was used to determine the risk factors for UI during pregnancy, at 2 months and 1 year after first delivery. The prevalence of UI was 38.6, 46.5, 35.6, and 34.4 % at inclusion, late pregnancy, 2 months postpartum, and 1 year postpartum respectively. No significant association was found between UI at late pregnancy and urethral descent assessed clinically or by ultrasound. The only risk factor for UI at 2 months postpartum was UI at inclusion (OR 6.27 [95 % CI 2.70-14.6]). The risk factors for UI at 1 year postpartum were UI at inclusion (6.14 [2.22-16.9]), body mass index (BMI), and urethral descent at inclusion, assessed clinically (7.21 [2.20-23.7]) or by ultrasound. The mode of delivery was not associated with urethral descent. Prenatal urethral descent and UI during pregnancy are risk factors for UI at 1 year postpartum. These results indicate that postnatal UI is more strongly influenced by susceptibility factors existing before first delivery than by the mode of delivery.
Peterson, Gregory W; Lu, Annie X; Epps, Thomas H
2017-09-20
This work investigates the processing-structure-activity relationships that ultimately facilitate the enhanced performance of UiO-66-NH 2 metal-organic frameworks (MOFs) in electrospun polystyrene (PS) fibers for chemical warfare agent detoxification. Key electrospinning processing parameters including solvent type (dimethylformamide [DMF]) vs DMF/tetrahydrofuran [THF]), PS weight fraction in solution, and MOF weight fraction relative to PS were varied to optimize MOF incorporation into the fibers and ultimately improve composite performance. It was found that composites spun from pure DMF generally resulted in MOF crystal deposition on the surface of the fibers, while composites spun from DMF/THF typically led to MOF crystal deposition within the fibers. For cases in which the MOF was incorporated on the periphery of the fibers, the composites generally demonstrated better gas uptake (e.g., nitrogen, chlorine) because of enhanced access to the MOF pores. Additionally, increasing both the polymer and MOF weight percentages in the electrospun solutions resulted in larger diameter fibers, with polymer concentration having a more pronounced effect on fiber size; however, these larger fibers were generally less efficient at gas separations. Overall, exploring the electrospinning parameter space resulted in composites that outperformed previously reported materials for the detoxification of the chemical warfare agent, soman. The data and strategies herein thus provide guiding principles applicable to the design of future systems for protection and separations as well as a wide range of environmental remediation applications.
The Effect of Unemployment Insurance Exhaustion
DEFF Research Database (Denmark)
Lyk-Jensen, Stéphanie; Weatherall, Cecilie Dohlmann
In this article we investigate how the long-term unemployed react to the threat of running out of unemployment insurance (UI) in a system in which other social benefits are available. The empirical analysis is based on very precise administrative records of unemployment spells in Denmark...... risk model to estimate the conditional probability of leaving unemployment to enter employment or receive other social benefits. We restrict our analysis to men aged 25-44 in 1998. Our results show that even for men having an initial UI entitlement for 4 years the threat of running out of UI indeed....... To identify the effect of UI exhaustion, we exploit the 1999 legislative change in the duration of benefit that progressively reduced regular UI entitlement from five to four years. According to time of entry into the UI system, all UI recipients had their potential UI period shortened. We use a competing...
Matthew S. Rutledge
2013-01-01
Both unemployment insurance (UI) extensions and the availability of disability benefits have disincentive effects on job search. But UI extensions can reduce the efficiency cost of disability benefits if UI recipients delay disability application until they exhaust their unemployment benefits. This paper, the first to focus on the effect of UI extensions on disability applications, investigates whether UI eligibility, extension, and exhaustion affect the timing of disability applications and ...
Directory of Open Access Journals (Sweden)
Roghaye Komeilifar
2017-07-01
Full Text Available Background: Urinary incontinence (UI is a common health problem and has a profound effect on the quality of life and psychosocial aspects of the affected women. The aim of this study was to investigate the prevalence and risk factors of UI in reproductive age women. Methods: This cross-sectional study was conducted on 2000 reproductive age women from February to June 2015. The women were selected from all of the primary health care centers of Dezful, using easy access sampling method. Body mass index (BMI was measured and data were collected by demographic, detailed information regarding obstetric and International Consultation on Incontinence Questionnaire- Urinary incontinence – Short Form(ICIQ-SF ICIQ-SF questionnaires. Results: The women’s mean age was 33.6±8, and 57.7% (1154 of them reported UI. The prevalence of UI subtypes was recorded in 38.2% (441 stress UI (SUI, 44.9% (518 mixed UI, and 16.9% (195 urge UI. There was a significant association between the mean of pregnancies, mean of deliveries, mode of delivery, abortion, neonate>4 kg, irregular menstruation and UI (P<0.05. Multiple logistic regression analysis showed that age, irregular menstruation and vaginal delivery increased the risk of UI in this age group. Conclusion: The findings suggest that a significant proportion of reproductive age women were undiagnosed with UI and MUI was the most common type of UI in this age group. Regular menstruation was a protective factor but older age and vaginal delivery were risk factors for UI in this study.
Townsend, Mary K; Curhan, Gary C; Resnick, Neil M; Grodstein, Francine
2011-04-01
Evidence suggests that race affects the prevalence and incidence of urinary incontinence (UI) in women. But little is known about racial differences in the rates of remission, improvement, and progression of UI in women. We sought to compare changes in UI frequency over two years among Asian, black, and white women with UI. Participants in the Nurses' Health Study and the Nurses' Health Study II responded to mailed questionnaires (in 2000 and 2002, and 2001 and 2003, respectively), giving information on race and the frequency of UI. Prospective analyses were conducted over two years from data gathered on 57,900 women, ages 37 to 79, who had at least monthly UI at baseline. Over the two two-year study periods, black women were significantly more likely than white women to report remission of UI (14% versus 9%, respectively), and Asian women were significantly more likely than white women to report less frequent UI (40% versus 31%, respectively). Improvement was more common in older black women than in older white women, but rates of improvement were comparable between younger black and younger white women. Black women were less likely than white women to report more frequent UI at follow-up (30% versus 34%, respectively), and, after adjusting for health and lifestyle factors, the difference was borderline statistically significant. Changes in the frequency of UI appear to vary by race, even after adjustment for risk factors. These findings may account for some of the previously observed differences in UI prevalence across racial groups. Although UI is a common condition in women of all races, nurses and other clinicians should be aware that its presentation may vary according to race. Such an understanding could increase clinicians' confidence in discussing UI with patients, reducing the possibility that the condition goes unrecognized. epidemiology, progression, race, remission, urinary incontinence.
Directory of Open Access Journals (Sweden)
Seyhan Sönmez
2017-12-01
Full Text Available Objectives: The aim of this study was to determine the patient and UI-related factors affecting help seeking behavior of Turkish women with undiagnosed urinary incontinence Methods: This cross-sectional study was conducted on 490 female patients aged > 18 years old and were seen in general gynecology outpatients’ clinic of Denizli State Hospital. According to referral complaint and results of UDI-6 questionnaire, the participants were classified into 3 groups: Group A: Help seeker patient, Group B: Non help seeker patient and Group C: Continent patient. Results: Overall UI prevelance was 24%. Nearly two thirds ( 67% of the UI patients do not complaint about their UI symptoms unless they were asked specifically about UI. Consultation rate increased with age, duration of incontinence, menopause and the severity of UI. After logistic regression analyses, only increasing age, UDI-6 score and severity (SSS were found to be associated independently with help seeking behavior. Conclusions: This study showed that, older, more bothered and severe UI patients visit physician and seek medical help. Still nearly half of women who are suffering from clinically significant UI remain undiagnosed and untreated. Regardless the visiting reason if its asked specifically for UI symptoms by using simple questionnaires, we can reveal and diagnose this patients’ group that is suffering from UI but yet keeps it disguise . Keywords: Urinary incontinence, help seeking behavior, undiagnosed urinary incontinence
Directory of Open Access Journals (Sweden)
Rhea J Longley
Full Text Available Malaria, caused by the Plasmodium parasite, remains a serious global public health concern. A vaccine could have a substantial impact on eliminating this disease, alongside other preventative measures. We recently described the development of three novel, viral vectored vaccines expressing either of the antigens PfUIS3, PfLSA1 and PfLSAP2. Each vaccination regimen provided high levels of protection against chimeric parasite challenge in a mouse model, largely dependent on CD8+ T cells. In this study we aimed to further characterize the induced cellular immune response to these vaccines. We utilized both the IFNγ enzyme-linked immunosorbent spot assay and intracellular cytokine staining to achieve this aim. We identified immunodominant peptide responses for CD4+ and CD8+ T cells for each of the antigens in BALB/c, C57BL/6 and HLA-A2 transgenic mice, creating a useful tool for researchers for subsequent study of these antigens. We also compared these immunodominant peptides with those generated from epitope prediction software, and found that only a small proportion of the large number of epitopes predicted by the software were identifiable experimentally. Furthermore, we characterized the polyfunctionality of the induced CD8+ T cell responses. These findings contribute to our understanding of the immunological mechanisms underlying these protective vaccines, and provide a useful basis for the assessment of these and related vaccines as clinical constructs.
Pizzoferrato, Anne-Cécile; Fauconnier, Arnaud; Quiboeuf, Emeline; Morel, Karine; Schaal, Jean-Patrick; Fritel, Xavier
2014-11-01
Our aim was to study risk factors associated with prevalence, incidence, and remission of UI 4 and 12 years after first delivery. Seven hundred seventy-four nulliparous women who gave birth in 1996 in two French maternity units at term received a questionnaire about their urinary symptoms in 2000 and again in 2008. Two hundred thirty-six women returned a questionnaire about UI 4 and 12 years after first delivery. Four groups of women were built: (A) women continent 4 and 12 years after first delivery; (B) women continent at 4 and incontinent at 12 years; (C) women incontinent at 4 and continent at 12 years; and (D) women incontinent at 4 and 12 years. Multivariate logistic regressions were used to determine risk factors of UI prevalence (groups B + D vs. A + C), incidence (B vs. A), remission (C vs. D), and onset of UI (D vs. Factors associated with UI 12 years after first pregnancy were: BMI (OR = 1.17 [95%CI: 1.04-1.32], by 1 kg/m(2) ) and increasing BMI (1.43 [1.19-1.73]), first child's weight (1.08 [1.001-1.16], by 100 g) and UI during first pregnancy (3.77 [1.83-7.76]). Factors associated with UI incidence were age at first delivery (0.86 [0.75-0.98]) and high BMI (1.24 [1.05-1.45]). Increasing BMI, UI during first pregnancy, and heavy first child reduce the likelihood of UI remission (0.37 [0.20-0.68], 0.11 [0.02-0.63], and 0.73[0.59-0.91], respectively). UI during first pregnancy could be indicative of individual susceptibility to UI. Obesity appears to be a modifiable factor for remission of UI in women. © 2013 Wiley Periodicals, Inc.
Drury, Craig F; Yang, Xueming; Reynolds, W Dan; Calder, Wayne; Oloya, Tom O; Woodley, Alex L
2017-09-01
Less than 50% of applied nitrogen (N) fertilizer is typically recovered by corn ( L.) due to climatic constraints, soil degradation, overapplication, and losses to air and water. Two application methods, two N sources, and two inhibitors were evaluated to reduce N losses and enhance crop uptake. The treatments included broadcast urea (BrUrea), BrUrea with a urease inhibitor (BrUrea+UI), BrUrea with a urease and a nitrification inhibitor (BrUrea+UI+NI), injection of urea ammonium nitrate (InjUAN), and injected with one or both inhibitors (InjUAN+UI, InjUAN+UI+NI), and a control. The BrUrea treatment lost 50% (64.4 kg N ha) of the applied N due to ammonia volatilization, but losses were reduced by 64% with BrUrea+UI+NI (23.0 kg N ha) and by 60% with InjUAN (26.1 kg N ha). Ammonia losses were lower and crop yields were greater in 2014 than 2013 as a result of the more favorable weather when N was applied in 2014. When ammonia volatilization was reduced by adding a urease inhibitor, NO emissions were increased by 30 to 31% with BrUrea+UI and InjUAN+UI compared with BrUrea and InjUAN, respectively. Pollution swapping was avoided when both inhibitors were used (BrUrea+UI+NI, InjUAN+UI+NI) as both ammonia volatilization and NO emissions were reduced, and corn grain yields increased by 5% with BrUrea+UI+NI and by 7% with InjUAN+UI+NI compared with BrUrea and InjUAN, respectively. The combination of two N management strategies (InjUAN+UI+NI) increased yields by 19% (12.9 t ha) compared with BrUrea (10.8 t ha). Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.
Fritel, Xavier; Panjo, Henri; Varnoux, Noëlle; Ringa, Virginie
2014-09-01
Our main objective was to analyze individual determinants that lead middle-aged women to seek medical care for urinary incontinence (UI). Observational longitudinal study among GAZEL cohort participants: 2,640 women aged 50-62 completed a self-administered questionnaire at baseline. Eight years later (2008) 2,273 (86%) responded to a follow-up questionnaire. Seeking care for UI was defined as any consultation for UI during the 8-year follow-up period. Individual determinants considered in the regression analysis were social and demographic characteristics, social relations, UI type and severity, and other health factors. Among 1,192 women reporting incontinence at baseline, 24.4% had visited a physician at least once for UI during the follow-up period (56.0% of those reporting severe UI). The care-seeking rate increased with age at baseline. Multivariate analysis showed that women who reported severe UI (OR = 4.1; 95% CI 2.6-6.5), mixed UI (2.0; 1.3-3.0), or neurologic disease (1.6; 1.1-2.6), had weak social support (1.4; 1.0-2.0), or talked about their UI with close friends or family (1.5; 1.0-2.1) were more likely to seek care for UI. A model including these factors had a 78% probability of correctly differentiating women with incontinence who chose to seek care from those who did not. Our analysis could not take factors related to the organization of health services into account. Women do not always seek care for UI, even when it is severe. Besides UI severity and type, consultation is associated with aging, weak social support, conversation about it with close friends and family, and neurologic disorders. © 2013 Wiley Periodicals, Inc.
Lee, Dennis T; Zhao, Junjie; Oldham, Christopher J; Peterson, Gregory W; Parsons, Gregory N
2017-12-27
Metal-organic frameworks (MOFs) chemically bound to polymeric microfibrous textiles show promising performance for many future applications. In particular, Zr-based UiO-66-family MOF-textiles have been shown to catalytically degrade highly toxic chemical warfare agents (CWAs), where favorable MOF/polymer bonding and adhesion are attained by placing a nanoscale metal-oxide layer on the polymer fiber preceding MOF growth. To date, however, the nucleation mechanism of Zr-based MOFs on different metal oxides and how product performance is affected are not well understood. Herein, we provide new insight into how different inorganic nucleation films (i.e., Al 2 O 3 , ZnO, or TiO 2 ) conformally coated on polypropylene (PP) nonwoven textiles via atomic layer deposition (ALD) influence the quality, overall surface area, and the fractional yield of UiO-66-NH 2 MOF crystals solvothermally grown on fiber substrates. Of the materials explored, we find that TiO 2 ALD layers lead to the most effective overall MOF/fiber adhesion, uniformity, and a rapid catalytic degradation rate for a CWA simulant, dimethyl p-nitrophenyl phosphate (DMNP) with t 1/2 = 15 min, 580-fold faster than the catalytic performance of untreated PP textiles. Interestingly, compared to ALD TiO 2 and Al 2 O 3 , ALD ZnO induces a larger MOF yield in solution and mass loading on PP fibrous mats. However, this larger MOF yield is ascribed to chemical instability of the ZnO layer under MOF formation condition, leading to Zn 2+ ions that promote further homogeneous MOF growth. Insights presented here improve understanding of compatibility between active MOF materials and substrate surfaces, which we believe will help advanced MOF composite materials for a variety of useful functions.
Nodular Hashitoxicosis - treatment with iodine-131
International Nuclear Information System (INIS)
Jara Yorg, J.A.; Ruiz Perez, V.; Acosta, N.
2004-01-01
Present case presents a patient of 58 years old of feminine sex with records of Tiroiditis of Hashimoto TSH of15 UI/ml (VN 0.5-4.0) who has been treated orally with sodium levotiroxina (100 ucg/dia) on a daily basis during 3 years with antibodies antimicrosomal or antitiroperoxidasa (TPO ab) with a value of 1/1550 UI/ml, with court 50 UI/ml and antitiroglobuliana (ATG ab) with values of 1/320 UI/ml with court 100 positive UI/ml [es
Correlates of urinary incontinence in pregnancy
DEFF Research Database (Denmark)
Hvidman, Lone; Foldspang, Anders; Mommsen, S.
2002-01-01
for the nulliparous and the primiparous, respectively. The present data suggest pregnancy UI not to be provoked by the mere onset of pregnancy, but by increasing hormonal concentrations or local tissue changes caused by hormones, whereas there was no support for a theory based on increasing pressure on the bladder......In a population sample, the period prevalence of urinary incontinence (UI) during pregnancy was found to be 19.9% and 24.1% among 352 nulliparous and 290 primiparous women, respectively. The first UI episode ever was experienced by 16.7% and 7.0% during the two last trimesters of the first...... and second pregnancies, respectively. None of the pregnancy-specific risk factors, such as emesis and birthweight, was significantly associated with UI during pregnancy. Previous UI was a significant risk factor for period prevalent UI during pregnancy, explaining 34% and 83% of pregnancy UI...
Directory of Open Access Journals (Sweden)
Mihajlo Firak
2010-01-01
Full Text Available In order to combine a photovoltaic module and an electrolyzer to produce hydrogen from water, an intermediate DC/DC converter can be used to adapt output power features of the module to input power features of the electrolyzer. This can also be done without using electronics, which results in saving as much as 700 USD/kW, as previous investigation has shown. A more sophisticated investigation should be carried out with the aim of improving high system efficiency, resulting in matching the photovoltaic module maximum power point trajectory (the maximum power point path in the U-I plane as a result of solar irradiance change to the operating characteristic of the electrolyzer. This paper presents an analysis of the influences of photovoltaic module electric properties, such as series and parallel resistance and non-ideality factor, on the maximum power point trajectory at different levels of solar irradiance. The possibility of various inclinations (right - vertical - left in relation to an arbitrary chosen operating characteristic of the electrolyzer is also demonstrated. Simulated results are obtained by using Matlab/Simulink simulations of the well known one-diode model. Simulations have been confirmed with experiments on a real photovoltaic module where solar irradiance, solar cell temperature, electric current, and voltage in the circuit with variable ohmic resistance have been measured.
2010-10-11
2 2 4.5 0.5 2613.02 4.5 0.5 2613.02 A 6515NCM050448 AUDIOMETER EA 1 1 25 3 2155 25 3 2155 D 6530007709220 BASIN EMESIS STEEL KIDNEY SHAPE 500ML EA...Total qty used (UI) Total wt used (UI) Total cube used (UI) Total cost used (UI) Equipment 6530007709220 BASIN EMESIS STEEL KIDNEY SHAPE 500ML
Characterization of Pelvic Floor Symptoms in Women of Northeastern Liberia
Bowling, C. Bryce; Munoz, Oxana; Gerten, Kimberly A.; Mann, MerryLynn; Taryor, Rebecca; Norman, Andy M.; Szychowski, Jeff M.; Richter, Holly E.
2013-01-01
Objective To characterize prevalence and quality of life (QoL) impact of urinary incontinence (UI), fecal incontinence (FI), and pelvic organ prolapse (POP) symptoms in women of Liberia. Methods A questionnaire addressing symptoms and QoL impact of UI, FI and POP was administered to women in a community setting in Ganta, Liberia. Questionnaires were analyzed to determine prevalence rates, QoL impact, and risk factors for these conditions. Results 424 participants were surveyed; 1.7% reported UI, 0.10% reported any form of FI, and 3.3% reported some degree of POP symptoms. QoL responses varied among symptom groups. Previous hysterectomy, cesarean delivery, vaginal deliveries, and body mass index had no significant association with UI, FI, or POP. Participants with UI symptoms were more likely to report FI symptoms (p=0.002). Conclusion Prevalence rates for UI, FI and POP in this population are low; there was a significant association of FI symptoms in subjects with UI. PMID:20206351
Professor Svein Stølen, Rector of the University of Oslo, Norway
AUTHOR|(CDS)2070299
2018-01-01
Professor Svein Stølen, Rector of the University of Oslo, Norway, signing the CERN guestbook in the presence of Martin Steinacher, Director for Finance and Human Resources. The other members of the visiting Norwegian delegations were Prof. Per Morten Sandset (Vice Rector, UiO), Prof. Margareth Hagen (Vice rector, University of Bergen (UiB)), Prof. Morten Dæhlen (Dean, Faculty of Mathematics and Natural Sciences, UiO), Prof. Helge K. Dahle (Dean, Department of Physics, UiB), Prof. Jøran I. Moen (Head, Department of Physics, UiO), Prof. Øyvind Frette (Head Department of Physics and Technology, UiB), Prof. Alexander L. Read (Chairperson, Norwegian CERN project leaders committee), Prof. Eivind Osnes (Norwegian CERN delegate), Dr Bjørg Mikalsen (Adviser, Faculty of Mathematics and Natural Sciences, UiO), Dr Liv Furuberg (Norwegian CERN delegate; Special Adviser, Research Council of Norway) and Dr Hanne Hvatum (Senior Advisor, Ministry of Education and Research, Norway).
Insurance Status and Differences in Treatment and Survival of Testicular Cancer Patients.
Kamel, Mohamed H; Elfaramawi, Mohammed; Jadhav, Supriya; Saafan, Ahmed; Raheem, Omer A; Davis, Rodney
2016-01-01
To explore the relationship between insurance status and differences in treatment and survival of testicular cancer patients. The Surveillance, Epidemiology, and End Results (SEER) database was utilized for this study. Between 2007 and 2011, 5986 testicular cancer patients were included in the SEER database. Patients were classified into nonseminoma and seminoma groups. We compared mortality rates, metastasis (M+) at diagnosis, and rates of adjuvant treatments between the uninsured (UI) and insured (I) populations. Overall, 2.64% of UI vs 1.36% of I died from testicular cancer (P = .025) and 16.73% of UI vs 10.52% of I had M+ at diagnosis (P testicular cancer (P = .326) and 25.92% of UI vs 18.46% of I had M+ at diagnosis (P = .0007). Also 17.28% of UI vs 20.88% of I had retroperitoneal lymph node dissection (RPLND; P = .1). In the seminoma group, 1.06% of UI vs 0.33% of I died from testicular cancer (P = .030) and 7.43% of UI vs 4.81% of I had M+ at diagnosis (P = .029). Also 34.75% of UI vs 48.4% of I received adjuvant radiation (P = .0083). The lack of health insurance predicted poor survival after adjusting for tumor stage, receiving adjuvant radiation or RPLND. UI testicular cancer patients present with more advanced cancer stages and have higher mortality rates than I patients. UI seminoma patients received less adjuvant radiation. This may be related to lack of access to care or more advanced cancer stage at diagnosis. Copyright © 2016. Published by Elsevier Inc.
MacArthur, C; Wilson, D; Herbison, P; Lancashire, R J; Hagen, S; Toozs-Hobson, P; Dean, N; Glazener, C
2016-05-01
To investigate the extent of persistent urinary incontinence (UI) 12 years after birth, and association with delivery-mode history and other factors. Twelve-year longitudinal cohort study. Maternity units in Aberdeen, Birmingham, and Dunedin. Women who returned questionnaires 3 months and 12 years after index birth. Data on all births over a period of 12 months were obtained from the units and then women were contacted by post. Persistent UI reported at 12 years, with one or more previous contact. Of 7879 women recruited at 3 months, 3763 (48%) responded at 12 years, with 2944 also having responded at 6 years; non-responders had similar obstetric characteristics. The prevalence of persistent UI was 37.9% (1429/3763). Among those who had reported UI at 3 months, 76.4% reported it at 12 years. Women with persistent UI had lower SF12 quality of life scores. Compared with having only spontaneous vaginal deliveries (SVDs), women who delivered exclusively by caesarean section were less likely to have persistent UI (odds ratio, OR 0.42, 95% CI 0.33-0.54). This was not the case in women who had a combination of caesarean section and SVD births (OR 1.01, 95% CI 0.78-1.30). Older age at first birth, greater parity, and overweight/obesity were associated with persistent UI. Of 54 index primiparae with UI before pregnancy, 46 (85.2%) had persistent UI. This study, demonstrating that UI persists to 12 years in about three-quarters of women, and that risk was only reduced with caesarean section if women had no other delivery mode, has practice implications. A longitudinal study of 3763 women showed a prevalence of persistent UI 12 years after birth of 37.9%. © 2015 Royal College of Obstetricians and Gynaecologists.
Esterification of jatropha oil via ultrasonic irradiation with auto-induced temperature-rise effect
International Nuclear Information System (INIS)
Andrade-Tacca, Cesar Augusto; Chang, Chia-Chi; Chen, Yi-Hung; Manh, Do-Van; Chang, Ching-Yuan; Ji, Dar-Ren; Tseng, Jyi-Yeong; Shie, Je-Lueng
2014-01-01
Auto-induced temperature-rise effects of ultrasonic irradiation (UI) on the esterification performance of jatropha oil (JO) were studied. Comparisons with other methods of mechanical mixing (MM) and hand shaking mixing were made. Major system parameters examined include: esterification time (t E ), settling time (t S ) after esterification and temperature. Properties of acid value (AV), iodine value (IV), kinematic viscosity (KV) and density of JO and ester product were measured. The esterification conversion efficiencies (η) were determined and assessed. Sulfuric acid was used to catalyze the esterification using methyl alcohol. For esterification without temperature control, η at t E = 10 and 30 min for UI of 56.73 and 83.23% are much higher than those for MM of 36.76 and 42.48%, respectively. At t E = 10 min, the jatropha oil esters produced via UI and MM respectively possess AV of 15.82 and 23.12 mg KOH/g, IV of 111.49 and 113.22 g I 2 /100 g, KV of 22.41 and 22.51 mm 2 /s and density of 913.8 and 913.58 kg/m 3 , showing that UI is much better than MM in enhancing the reduction of AV. The t E exhibits more vigorous effect on AV for UI than MM. The UI offers auto-induced temperature-rise, improving the mixing and esterification extents. - Highlights: • Esterification of jatropha oil is pronounced under ultrasonic irradiation (UI). • UI can auto-induce temperature rise. • The induced temperature rise assists the mixing of UI in enhancing esterification. • UI offers better esterification than mechanical mixing with external heating. • An 83.23% reduction of FFA in jatropha-ester is achievable via UI in 30 min
Biswas, Bijit; Bhattacharyya, Aritra; Dasgupta, Aparajita; Karmakar, Anubrata; Mallick, Nazrul; Sembiah, Sembagamuthu
2017-01-01
Urinary incontinence (UI) is a chronic debilitating disease which is often under reported, but laid significant impact on one's quality of life (QoL) thus is of public health importance. The aim of this study is to find out proportion of rural women have UI, its associated risk factors and treatment-seeking behavior, QoL of affected women. This was a cross-sectional clinic-based study conducted from October 2016 to January 2017 among 177 women aged 50 years or above attending a rural health facility with a structured schedule. Data were analyzed using appropriate statistical methods by SPSS (version 16). Forty-nine (27.7%) out of 177 women were found having UI. The most prevalent type of UI was stress UI (51.0%), followed by mixed UI (32.7%) and urge UI (16.3%). In bivariate analysis, study participants who were illiterate, having a history of prolonged labor, having a history of gynecological operation, normal vaginal deliveries (NVDs) (>3), diabetic, having chronic cough, having constipation, and having lower urinary tract symptoms (LUTS) had shown significantly greater odds of having UI. In multivariable illiteracy (adjusted odds ratio [AOR] - 2.41 [1.02-5.69]), NVDs (AOR - 3.37 [1.54-7.37]), a history of gynecological operation (AOR - 3.84 [1.16-12.66]), chronic cough (AOR - 2.69 [1.21-5.99]), LUTS (AOR - 2.63 [1.15-6.00]) remained significant adjusted with other significant variable in bivariate analysis. Those with mixed UI had 5.33 times higher odds having unfavorable QoL. Only 30.6% sought medical help. Treatment-seeking behavior shown negative correlation with QoL while fecal incontinence and LUTS shown possitive correlation. The study revealed that rural women are indeed at high risk of developing UI. Majority of them did not sought treatment for UI which is matter of concern. Generating awareness regarding UI may help to improve health-seeking behavior and QoL.
Directory of Open Access Journals (Sweden)
Bijit Biswas
2017-01-01
Full Text Available Context: Urinary incontinence (UI is a chronic debilitating disease which is often under reported, but laid significant impact on one's quality of life (QoL thus is of public health importance. Aims: The aim of this study is to find out proportion of rural women have UI, its associated risk factors and treatment-seeking behavior, QoL of affected women. Methods: This was a cross-sectional clinic-based study conducted from October 2016 to January 2017 among 177 women aged 50 years or above attending a rural health facility with a structured schedule. Data were analyzed using appropriate statistical methods by SPSS (version 16. Results: Forty-nine (27.7% out of 177 women were found having UI. The most prevalent type of UI was stress UI (51.0%, followed by mixed UI (32.7% and urge UI (16.3%. In bivariate analysis, study participants who were illiterate, having a history of prolonged labor, having a history of gynecological operation, normal vaginal deliveries (NVDs (>3, diabetic, having chronic cough, having constipation, and having lower urinary tract symptoms (LUTS had shown significantly greater odds of having UI. In multivariable illiteracy (adjusted odds ratio [AOR] - 2.41 [1.02–5.69], NVDs (AOR - 3.37 [1.54–7.37], a history of gynecological operation (AOR - 3.84 [1.16–12.66], chronic cough (AOR - 2.69 [1.21–5.99], LUTS (AOR - 2.63 [1.15–6.00] remained significant adjusted with other significant variable in bivariate analysis. Those with mixed UI had 5.33 times higher odds having unfavorable QoL. Only 30.6% sought medical help. Treatment-seeking behavior shown negative correlation with QoL while fecal incontinence and LUTS shown possitive correlation. Conclusions: The study revealed that rural women are indeed at high risk of developing UI. Majority of them did not sought treatment for UI which is matter of concern. Generating awareness regarding UI may help to improve health-seeking behavior and QoL.
[Prevalence and risk factors of urinary incontinence in female workers of hotels].
Fontana, L; Falconi, G; Di Martino, T; Iavicoli, I
2007-01-01
The International Continence Society defines urinary incontinence (UI) as "a condition in which involuntary loss of urine is a social or hygienic problem and is objectively demonstrable". There are three different jorms of UI. stress urinary incontinence, urge urinary incontinence and mixed incontinence. The aim of this study was to investigate the prevalence of UI in a group of female workers in the hotel sector. The International Consultation on Incontinence Questionnaire Urinary Incontinence short form (ICIQ-UI Short Form) was administered to all female workers and data were collected about age, body mass index, number of vaginal and Caesarean delivery. Results showed a prevalence of UI widely bigger in the plans waitress than in video display terminal workers and suggest the hypothesis that manual handling of loads representing a possible occupational risk for UI.
Directory of Open Access Journals (Sweden)
Fernando José Benesi
2009-08-01
Full Text Available Com o propósito de avaliar o perfil bioquímico de algumas enzimas, em potras sadias da raça BH (Brasileiro de Hipismo, utilizaram-se 380 amostras de plasma sangüíneo colhidas de 19 animais desde o nascimento até 24 meses de vida. Na análise dos resultados evidenciou-se que os valores médios das enzimas FA (fosfatase alcalina e CK (creatina quinase foram máximos entre o nascimento e 24 horas de vida (FA-1995.50 UI/ ; CK-189.13UI/L, enquanto que para a LD (lactato desidrogenase e GGT (gama glutamiltransferase as maiores magnitudes ocorreram, respectivamente, entre 3 e 4 dias (LD-479.11UI/L e aos 10 dias de idade (GGT-18.70UI/L. As FA, CK, LD e GGT, mostraram diminuições dos valores médios, respectivamente, até 6 meses (FA-323.50UI/L, 20 dias (CK-51UI/ L, 19 meses (LD-214.00UI/L e 4 meses (GGT-11.40UI/L estabilizando-se a seguir, com pequenas variações. A atividade da AST (aspartato aminotransferase que foi mínima logo após o nascimento (AST- 43.38UI/L, aumentou até os sete dias de vida (AST-110.89UI/L, e a seguir diminuiu progressivamente, com pequenas oscilações, até o final do estudo. Todas as enzimas avaliadas sofreram variações influenciadas pelo fator etário, particularmente no período inicial de vida dos animais estudados.
Liang, Ching-Chung; Wu, Ming-Ping; Lin, Shu-Jen; Lin, Yu-Jr; Chang, Shuenn-Dhy; Wang, Hui-Hsuan
2013-01-01
This study was conducted to investigate the prevalence of and contributing factors to urinary incontinence (UI) in women 5 years after their first birth and to evaluate the associations of UI with delivery mode and quality of life. Between 2005 July and 2006 March, primiparous women who delivered at term in a tertiary hospital were recruited into this cohort study. Immediately postpartum, the women completed a structured urogynecological questionnaire regarding lower urinary tract symptoms. Then the same urogynecological questionnaire, the Incontinence Impact Questionnaire (IIQ-7), and the Urinary Distress Inventory (UDI-6) were mailed to them 5 years later to follow up on UI. Three hundred and twelve women responding to the mailed questionnaires were included in the analyses. The prevalence 5 years after first delivery of stress (SUI) and urge (UUI) UI were 43.6 % and 19.2 %, respectively. Women with UI during their first pregnancy were more likely to develop UI 5 years postpartum than those without it; women who delivered their first child vaginally had a greater incidence of UI than those having cesarean birth; UUI in women following cesarean delivery more negatively impacted emotional health than it did following vaginal birth, whereas the impact of SUI did not significantly differ between delivery groups. UI during the first pregnancy and vaginal delivery in primiparous women may predict an increased risk of having UI 5 years after delivery. UUI adversely affected women's emotional health, especially in those undergoing cesarean section.
Predictive Risk Factors for Impaired Quality of Life in Middle-Aged Women with Urinary Incontinence
Directory of Open Access Journals (Sweden)
Youn-Jung Son
2010-12-01
Full Text Available Purpose Urinary incontinence (UI has substantial and important impacts on quality of life (QoL. The purpose of this study was to identify the associated risk factors of QoL in middle-aged women with UI. Methods The participants were 127 women aged 40-64 years who experienced UI. Data were collected from October to November, 2008 using a self-reported questionnaires. The data were analyzed through t-test, one-way ANOVA, Scheffe test, and multiple linear regression with SPSS ver. 16.0 program. Results The distribution of UI severity was mild 18.1%, moderate 40.2% and severe 41.7%. In univariate analysis, differences in the score for QoL according to participants' characteristics were statistically significant on the type of delivery, number of births and severity of UI. In multiple linear regression analysis after adjustment of other variables, the most powerful predictor of QoL is severity of UI. Number of births was also significant predictor. These two variables explained 25% of variance in QoL of women with UI. Conclusions UI is highly prevalent and causes suffering and impaired QoL among middle-aged women, but it stands beyond our attention. The results of this study suggest that women with moderate to severe UI should be screened for QoL by health care providers regularly. Further research is needed to determine comprehensive factors including psychosocial factors predicting the QoL for incontinent women.
The prevalence of urinary incontinence in community-dwelling married women: a matter of definition.
Vandoninck, Vera; Bemelmans, Bart L H; Mazzetta, Chiara; Robertson, Chris; Keech, Martin; Boyle, Peter; Kiemeney, Lambertus A
2004-12-01
To determine the prevalence of female urinary incontinence (UI) and its impact on quality of life. In a Dutch national postal questionnaire survey, 1460 spouses of 1771 men in the town of Boxmeer, age-stratified and randomly selected, were asked to participate. The prevalence of UI in the women was assessed in two ways. First, a total score on a short UI-specific questionnaire differentiated them into three groups, i.e. no symptoms (score 0-2), minimally (3-6) or severely incontinent (7-14). Second, a self-reported UI prevalence was calculated by asking respondents if they ever had urine loss. To conform to the International Continence Society standard definition, spouses were also asked to complete a general (Short Form-12) and lower urinary tract disease-specific quality-of-life questionnaire, and were asked about their need to seek help. The questionnaires were returned by 1071 women (mean age 57 years, range 29-79; response rate 73%); 34% were regarded as minimally and 12% as severely incontinent. The self-reported UI rate was 40%. Disease-specific and general quality of life was significantly lower for women with UI than for those with minimal or no urine loss; 38% of incontinent respondents had consulted a physician for their UI, and among respondents with minimal complaints this was 28%. Up to 46% of the married female population had some degree of UI, and severe UI significantly compromised their quality of life.
Predicting delay to treatment of urinary incontinence among urban community-dwelling women in China
Directory of Open Access Journals (Sweden)
Chen Wu
2015-03-01
Conclusion: Women who were older, had lower subjective UI severity, and who reported only stress or urgency UI tended to delay treatment longer; such patients should be targeted for health education and intervention regarding UI in urban communities.
Scribante, Andrea; Sfondrini, Maria Francesca; Collesano, Vittorio; Tovt, Gaia; Bernardinelli, Luisa; Gandini, Paola
2017-01-01
Dental hygienists are often faced with patients wearing lingual orthodontic therapy, as ultrasonic instrumentation (UI) is crucial for oral health. As the application of external forces can lead to premature bonding failure, the aim of this study was to evaluate the effect of UI on shear bond strength (SBS) and on adhesive remnant index (ARI) of different lingual orthodontic brackets. 200 bovine incisors were divided into 10 groups. Four different lingual (STB, Ormco; TTR, Rocky Mountain Orthodontics; Idea, Leone; 2D, Forestadent) and vestibular control (Victory, 3M) brackets were bonded. UI was performed in half of specimens, whereas the other half did not receive any treatment. All groups were tested with a universal testing machine. SBS and ARI values were recorded. Statistical analysis was performed (significance: P = 0.05). TTR, Idea, and 2D lingual brackets significantly lowered SBS after UI, whereas for other braces no effect was recorded. Appliances with lower mesh area significantly reduced their adhesion capacity after UI. Moreover groups subjected to UI showed higher ARI scores than controls. UI lowered SBS of lingual appliances of small dimensions so particular care should be posed avoiding prolonged instrumentation around bracket base during plaque removal. Moreover, UI influenced also ARI scores.
Human-system interface evaluation system for advanced control room based on SQL database
International Nuclear Information System (INIS)
Zhang Yan; Zhou Zhiwei; Bian Zhiqiang; Xu Li
2005-01-01
User Interface (UI) plays an important role in the advanced control room (ACR) of a nuclear power plant (NPP). In this paper, we present a rule-based ACR Human-system Interface Evaluation System (AHSIES) using expert system technology, which can evaluate UI design shortcomings, propose modification suggestions, and help designer improve the ACR interface design. AHSIES consists of four programs: the UI Editor, the Operation Procedure Manager, the Operation Simulator and the UI Design Evaluator. These four parts respectively function for: editing a set of UI icons employed as the operation screens of an advanced control room; for editing operation procedures aiming at any specified operation with simple language; for simulate the operation sequences dynamically and recording the relevant information for design performance of the UIs; and for evaluating both static and dynamic performance of the ACR UI design according to well established design guidelines and criteria with the information gained from the first three programs. Microsoft SQL Server 2000 DBMS is adopted to manage the voluminous data and its complex relationships. The preliminary test application of AHSIES for a simplified ACR UI design of a PWR NPP has shown that the expert evaluation system is capable of achieving satisfactory evaluation results. (authors)
Directory of Open Access Journals (Sweden)
Sônia Terezinha dos Anjos Lopes
1993-12-01
Full Text Available Foram usados 50 eqüinos sadios provenientes do Batalhão de Polícia Montada da Brigada Militar em Santa Maria, RS, sendo 43 machos e 7 fêmeas com idade variadas a partir de 3 anos. Foram colhidos 10ml de sangue da jugular para determinação dos valores da atividade sérica das enzimas aspartato-aminotransferase (AST, desidrogenase lática (DHL, gama-glutamiltransferase (gGT e fosfatase alcalina sérica (FAS. Os resultados encontrados para AST foi de 101 - 190U/I com média de 130UI; DHL foi de 100 - 421 U/l com média de 182U/I; gGT foi de 2 - 27U/I com média de 6.5U/I e FAS foi de 103 - 335U/I com média de 190U/I. A partir de outubro/1992 estes valores passaram a ser referência no laboratório de Patologia Clínica do Hospital de Clinicas Veterinárias da Universidade Federal de Santa Maria.
Directory of Open Access Journals (Sweden)
Ji Seon Kim
2010-12-01
Full Text Available Purpose The aim of this study was to identify the relationship between urinary incontinence (UI and low back pain (LBP discomfort and disability, static balance, and demographic factors. Methods A total of 348 women aged 20-80 years were included in this cross-sectional study. The general characteristics of the subjects and the main outcome (UI condition, LBP discomfort, LBP disability, and static balance ability were assessed by using clinical questionnaires and assessment tools. Results Of all the subjects, 22.8% had experienced UI. Women with UI showed a significantly higher relationship of LBP and disability, and static balance ability (P<0.01. We found a significant correlation between UI, age, LBP and disability, and static balance ability (P<0.01. Conclusions These findings suggest that UI correlates negatively with LBP discomfort, LBP disability, and static balance ability. Further studies should focus on the identification of the precise mechanisms underlying UI and its related physical symptoms and on the development of therapeutic strategies to manage this condition.
Prevalence of Urinary Incontinence among Elderly Women in Yazd, Iran: A Population-Based Study
Directory of Open Access Journals (Sweden)
Mohammad Ali Morowatisharifabad
2015-06-01
Conclusion: Regarding the high prevalence of UI, especially stress UI and it's relation with some diseases such as diabetes and obesity, any intervention programs aimed to increase the healthy life style among women may be effective in management of UI.
2010-05-05
...., Automotive Experience Division, Including Workers Whose Unemployment Insurance (UI) Wages Are Paid Through... unemployment insurance (UI) tax account, under the name Hoover Universal. Accordingly, the Department is... Division, including workers whose unemployment insurance (UI) wages are paid through Hoover Universal...
Adult women's experiences of urinary incontinence: a systematic review of qualitative evidence.
Mendes, Adilson; Hoga, Luiza; Gonçalves, Bruna; Silva, Pâmela; Pereira, Priscilla
2017-05-01
Women are affected dramatically by urinary incontinence (UI). This disease is currently considered as epidemic. The objective of this review is to identify, through the best available evidence, how women experience UI worldwide. The current review included studies of adult women who had experienced UI. Women with UI from various social and cultural settings were included in this review. Qualitative data including, but not limited to, study designs such as phenomenology, grounded theory, ethnography, action research and feminist research were included in this review. All aspects related to the experience of UI endured by women were considered. An initial search of MEDLINE (PubMed) and CINAHL was done, followed by the exploration of all the databases and all identified studies, published in English, Spanish, French and Portuguese. The databases searched were CINAHL, PubMed, PsycINFO, Lilacs, Scielo, BVS, BVS-Psi, Scopus, Embase, Sociological Abstracts, Dissertation Abstracts International and the University of São Paulo Dissertations and Thesis bank and gray literature. Each primary study was assessed by two independent reviewers for methodological quality. The Joanna Briggs Institute Qualitative Appraisal and Review Instrument (JBI-QARI) data extraction form for interpretive and critical research was used to appraise the methodological quality of all papers. Qualitative data were extracted using the JBI-QARI. Qualitative research findings were synthesized using the JBI-QARI. From the 28 studies were included, 189 findings were extracted and they were grouped into 25 categories and eight synthesized findings: (i) cultural and religious backgrounds and personal reluctance contribute to delays in seeking UI treatment; (ii) the inevitable and regrettable problem of UI endured silently and alone affects women's daily activities and their social roles; (iii) poor knowledge and the vague nature of the symptoms mask the fact that UI is a disease; (iv) the experiences
Loc Luu, Cam; Thuy Van Nguyen, Thi; Nguyen, Tri; Nguyen, Phung Anh; Hoang, Tien Cuong; Ha, Cam Anh
2018-03-01
By dip-coating technique the thin films of nano-photocatalysts TiO2, Cr-doped TiO2, LaBO3 perovskites (B = Fe, Mn, and Co) prepared by sol-gel method, and UiO66-NH2 prepared by a solvothermal were obtained and employed for gas phase degradation of p-xylene. Physicochemical characteristics of the catalysts were examined by the methods of BET, SEM, TEM, XRD, FT-IR, TGA, Raman and UV-vis spectroscopies. The thickness of film was determined by a Veeco-American Dektek 6M instrument. The activity of catalysts was evaluated in deep photooxidation of p-xylene in a microflow reactor at room temperature with the radiation sources of a UV (λ = 365 nm) and LED lamps (λ = 400-510 nm). The obtained results showed that TiO2 and TiO2 doped Cr thin films was featured by an anatase phase with nanoparticles of 10-100 nm. Doping TiO2 with 0.1%mol Cr2O3 led to reduce band gap energy from 3.01 down to 1.99 eV and extend the spectrum of photon absorption to the visible region (λ = 622 nm). LaBO3 perovkite thin films were also featured by a crystal phase with average particle nanosize of 8-40 nm, a BET surface area of 17.6-32.7 m2 g-1 and band gap energy of 1.87-2.20 eV. UiO66-NH2 was obtained in the ball shape of 100-200 nm, a BET surface area of 576 m2 g-1 and a band gap energy of 2.83 eV. The low band gap energy nano-photocatalysts based on Cr-doped TiO2 and LaBO3 perovskites exhibited highly stable and active for photo-degradation of p-xylene in the gas phase under radiation of UV-vis light. Perovskite LaFeO3 and Cr-TiO2 thin films were the best photocatalysts with a decomposition yield being reached up to 1.70 g p-xylene/g cat.
2013-07-22
... Request; National Longitudinal Study of Unemployment Insurance Recipients (NLS-UI) AGENCY: Office of the... during and after benefit collection, and customers' satisfaction levels with the UI program. The study... National Longitudinal Study of Unemployment Insurance Recipients (NLS- UI). Comments are requested to...
DEFF Research Database (Denmark)
Brostrøm, Søren; Lose, G.
2008-01-01
Many women suffer from urinary incontinence (UI). During and after pregnancy, women are advised to perform pelvic floor muscle training (PFMT) to prevent the development of UI. In established UI, PFMT is prescribed routinely as first-line treatment. Published studies are small, underpowered...
Directory of Open Access Journals (Sweden)
Alaettin Unsal
2013-06-01
Full Text Available Aim: To determination of prevalence of Urinary incontinence (UI, and to evaluation of relationship between UI and depression in women. Material and methods: This study is a cross-sectional type research, was realized between 05 July 2011 to 25 August 2011, among 20 and over aged women that living in Beylikova district centre. The study group was occurred 500 women. The presence of UI, its type and severity were evaluated according to criteria recommended by the International Continence Society. For the purpose of the questionnaire form prepared by the study, households were visited one by one, filled with face to face method. Beck Depression Inventory (BDI was used for evaluation of depression. Chi-square test and Logistic Regression Analyses were used in statistical analyses. For statistical significance, p<0.05 were approved. Results: The ages of women were between 20 to 81 years, and average age was 46.97±15.65 years. Prevalence of UI was found 41.4% (n=207. Of the UI cases were 35.7% stress incontinence, 15.5% urge incontinence, 48.8% mixed type. Of the cases were 95 (45.9% low severity, 60 (29.0% middle severity, 52 (25.1% high severity. In this study, UI was an important risk factor in illiterates (OR: 6.617, no smoking (OR: 1.868, obes (OR: 2.777, persons with anyone chronicle disease that diagnosed by doctor (OR: 4.711, enuresis nocturna hystory in childhood age (OR: 2.600, large baby history in women who had given birth (OR: 1.947, and menopause (OR: 2.497. Prevalence of depression was found 25.4% (n=127. Prevalence of depression was higher found in the women with UI, stress type UI, and high severity UI (for each one; p<0.05. Conclusion: In this study, it was determinate that UI an important health problem in the women, and depression prevalence was higher in the women with UI. [TAF Prev Med Bull 2013; 12(3.000: 231-242
Gartland, D; Donath, S; MacArthur, C; Brown, S J
2012-10-01
To investigate the contribution of obstetric risk factors to persistent urinary incontinence (UI) between 4 and 18 months postpartum. Prospective pregnancy cohort. Six metropolitan public hospitals in Victoria, Australia. A total of 1507 nulliparous women recruited to the Maternal Health Study in early pregnancy (≤24 weeks of gestation). Data from hospital records and self-administered questionnaires/telephone interviews at ≤24 and 30-32 weeks of gestation and at 3, 6, 9, 12 and 18 months postpartum analysed using logistic regression. Persistent UI 4-18 months postpartum in women continent before pregnancy. Of the women who were continent before pregnancy, 44% reported UI 4-18 months postpartum, and 25% reported persistent UI (symptoms at multiple follow ups). Compared with spontaneous vaginal birth, women who had a caesarean before labour (adjusted odds ratio [aOR] 0.4, 95% confidence interval [95% CI] 0.2-0.9), in first-stage labour (aOR 0.4, 95% CI 0.2-0.6) or in second-stage labour (aOR 0.4, 95% CI 0.2-1.0) were less likely to report persistent UI 4-18 months postpartum. Prolonged second-stage labour in women who had an operative vaginal birth was associated with increased likelihood of UI (aOR 2.5, 95% CI 1.3-4.6). Compared with women who were continent in pregnancy, women reporting UI in pregnancy had a seven-fold increase in odds of persistent UI (aOR 7.4, 95% CI 5.1-10.7). Persistent UI is common after childbirth and is more likely following prolonged labour in combination with operative vaginal birth. The majority of women reporting persistent UI at 4-18 months postpartum also experienced symptoms in pregnancy. © 2012 The Authors BJOG An International Journal of Obstetrics and Gynaecology © 2012 RCOG.
Directory of Open Access Journals (Sweden)
Cynthia A Mannion
Full Text Available The present study examined back pain (BP and/or urinary incontinence (UI impact on the ability to perform daily tasks at 12 months after childbirth in healthy reproductive women who sought maternity care in community based family practice clinics.This study is a secondary analysis from the All Our Babies Study, a prospective, community-based pregnancy cohort in Calgary, Alberta. Maternal self-reported information on demographics, lifestyle, experiences with pregnancy and childbirth, occurrence of BP, UI and consequent impairment of daily tasks were collected by questionnaires administered before 25 weeks, at 34-36 weeks gestation and at 4 and 12 months postpartum. The occurrence and severity of BP and UI at one year after childbirth was assessed using descriptive and bivariate analyses. Logistic regression models examined the association between demographic and obstetrical variables and the severity of functional impairment due to UI and BP.From 1574 women with singleton pregnancies included in the study, 1212 (77% experienced BP, 773 (49% UI, and 620 (40% both BP and UI. From the 821 women reporting impairment of daily tasks due to BP, 199 (24 % were moderately and 90 (11% severely affected with the remainder, 532 (64% being mildly affected. From 267 women with functional impairment due to UI, 52 (19% reported moderately to severe impairment in their ability to perform daily tasks. Obesity and parity were risk factors for impairment of daily functioning due to BP, whereas obesity and vaginal delivery increased the risk of moderate to severe impairment due to UI.BP and UI are common occurrences 1 year after childbirth. Maternal performance of daily tasks and women's health and quality of life are more often impaired due to BP than UI. Our study brings new evidence of the risk factors that predict severity and impact of these conditions on women functioning at 12 months postpartum.
Urinary Incontinence as a Predictor of Death: A Systematic Review and Meta-Analysis.
Directory of Open Access Journals (Sweden)
Gregor John
Full Text Available The association between urinary incontinence (UI and increased mortality remains controversial. The objective of our study was to evaluate if this association exists.We performed a systematic review and meta-analysis of observational studies comparing death rates among patients suffering from UI to those without incontinence. We searched in Medline, Embase and the Cochrane library using specific keywords. Studies exploring the post-stroke period were excluded. Hazard ratios (HR were pooled using models with random effects. We stratified UI by gender and by UI severity and pooled all models with adjustment for confounding variables.Thirty-eight studies were retrieved. When compared to non-urinary incontinent participants, UI was associated with an increase in mortality with pooled non adjusted HR of 2.22 (95%CI 1.77-2.78. The risk increased with UI severity: 1.24 (95%CI: 0.79-1.97 for light, 1.71 (95%CI: 1.26-2.31 for moderate, and 2.72 (95%CI: 1.90-3.87 for severe UI respectively. When pooling adjusted measures of association, the resulting HR was 1.27 (95%CI: 1.13-1.42 and increased progressively for light, moderate and severe UI: 1.07 (95%CI: 0.79-1.44, 1.25 (95%CI: 0.99-1.58, and 1.47 (95%CI: 1.03-2.10 respectively. There was no difference between genders.UI is a predictor of higher mortality in the general and particularly in the geriatric population. The association increases with the severity of UI and persists when pooling models adjusted for confounders. It is unclear if this association is causative or just reflects an impaired general health condition. As in most meta-analyses of observational studies, methodological issues should be considered when interpreting results.
Higher TSH Levels Within the Normal Range Are Associated With Unexplained Infertility.
Orouji Jokar, Tahereh; Fourman, Lindsay T; Lee, Hang; Mentzinger, Katherine; Fazeli, Pouneh K
2018-02-01
Unexplained infertility (UI), defined as the inability to conceive after 12 months of unprotected intercourse with no diagnosed cause, affects 10% to 30% of infertile couples. An improved understanding of the mechanisms underlying UI could lead to less invasive and less costly treatment strategies. Abnormalities in thyroid function and hyperprolactinemia are well-known causes of infertility, but whether thyrotropin (TSH) and prolactin levels within the normal range are associated with UI is unknown. To compare TSH and prolactin levels in women with UI and women with a normal fertility evaluation except for an azoospermic or severely oligospermic male partner. Cross-sectional study including women evaluated at a large academic health system between 1 January 2000 and 31 December 2012 with normal TSH (levels within the normal range of the assay and ≤5 mIU/L) and normal prolactin levels (≤20 ng/mL) and either UI (n = 187) or no other cause of infertility other than an azoospermic or severely oligospermic partner (n = 52). TSH and prolactin. Women with UI had significantly higher TSH levels than controls [UI: TSH 1.95 mIU/L, interquartile range: (1.54, 2.61); severe male factor: TSH 1.66 mIU/L, interquartile range: (1.25, 2.17); P = 0.003]. This finding remained significant after we controlled for age, body mass index, and smoking status. Nearly twice as many women with UI (26.9%) had a TSH ≥2.5 mIU/L compared with controls (13.5%; P < 0.05). Prolactin levels did not differ between the groups. Women with UI have higher TSH levels compared with a control population. More studies are necessary to determine whether treatment of high-normal TSH levels decreases time to conception in couples with UI. Copyright © 2017 Endocrine Society
Prevalence and risk factors of urinary incontinence among Chinese women in Shanghai.
Liu, Bo; Wang, Lei; Huang, Sheng-Song; Wu, Qiang; Wu, Deng-Long
2014-01-01
A group of healthy females were randomly sampled in Shanghai for the purpose of evaluating the prevalence of urinary incontinence (UI) among Chinese women and its associated risk factors. 5,467 registered female residents aged from 20 years were randomly sampled from four communities in Shanghai, and the Bristol Female Lower Urinary Tract Symptoms Questionnaire (the International Consultation Incontinence Questionnaire) was adopted. Detailed information regarding pregnancy, menstruation, and several demographic variables was also collected. Data were subsequently analyzed using McNemar's test, univariate analysis, multinomial logistic regression models, and binary logistic regression models. The prevalence rate of UI was estimated to be 23.3%. The rate of stress UI (SUI) was 14.0% (761/5433), which was more prevalent than the rate of urgency UI (UUI) and mixed UI (MUI), which were 3.0% (164/5433) and 6.3% (341/5433), respectively. The risk factors associated with developing UI included aging, lack of education, poor living environment (specifically in the rural area), intense manual labor, the absence of physical exercise, hyperlipemia, diabetes, nocturia, consumption of greasy food, divorce or widowing, chronic pelvic pain (CPP), pelvic organ prolapse (POP), frequent urinary tract infection, and vaginal delivery without episiotomy. We also observed that most Chinese women were not aware of UI, which prevented them from seeking early treatment. Urinary incontinence is a common disorder among Chinese women in Shanghai, and many risk factors contribute to the development of UI. Most Chinese women were not aware of UI, which prevented them from seeking early treatment.
Alappattu, Meryl; Neville, Cynthia; Beneciuk, Jason; Bishop, Mark
2016-01-01
The objective of this study was to examine the frequency and types of urinary incontinence (UI) in patients seeking outpatient physical therapy for neuro-musculoskeletal conditions. Retrospective cross-sectional analysis. A convenience sample of patients that positively responded to a UI screening question was included in this study. Data were collected for age, sex, and primary treatment condition classified into one of the following (i.e., urinary dysfunction, fecal dysfunction, pelvic pain, spine, neurological disorders, or extremity disorders); UI type (i.e., mixed, urge, stress, or insensible); UI symptom severity; and quality of life (QoL) impact. Frequency of UI type, symptom severity, health-related quality of life (HRQoL) impact, and pad use were compared between treatment groups. The mean age of the sample (n = 599) was 49.8 years (SD = 18.5) and 94.7% were female. The urinary dysfunction group comprised 44.2% of the total sample, followed by the spine group with 25.7% and pelvic pain with 17.2%. The urinary dysfunction group scored significantly higher on UI symptom severity and impact on QoL compared to the pelvic pain and spine groups, but not compared to the extremity disorders, fecal dysfunction, or neurological disorder group. These preliminary data indicate that UI is a condition afflicting many individuals who present to outpatient physical therapy beyond those seeking care for UI. We recommend using a simple screening measure for UI and its impact on HRQoL as part of a routine initial evaluation in outpatient physical therapy settings.
Gaibullaev, A A; Iskandarova, G T; Abdurizaev, A A
2016-04-01
To estimate prevalence and types of urinary incontinence (UI) among women living in the South Priaralye region, and to analyze risk factors associated with UI. The population-based study was conducted by nested-typological method. Analysis was carried out on the data of 1487 women collected by a standard ICIQ-SF questionnaire, an assessment tool for female urinary incontinence recommended by the European Association of Urology. The study showed that the prevalence of UI among women aged 18 years and older in the South Priaralye region was 27%. The predominant type of the disease was stress UI since in 44.8% of women, the uncontrolled urine loss occurred during exercise. In 16.1% of women urgent type UI was observed, and in 38.6% mixed type of UI was found. The most significant risk factors for UI were recurrent urinary tract infection (odds ratio (OR) of 5.9 (95% confidence interval (CI) 4.12-8.38), gynecological disease (OR 2.7 (95% CI 1.99-3.59), enuresis in childhood (OR 2.4 (95% CI 1.21-4.88), constipation (OR = 2.1 (95% CI 1.45-2.93) the number of births (OR = 1.2 (95% CI 1,05-1.28), and occupation, namely work involving physical strain (odds ratio of 1.2 (95% CI 1.04-1.43). In the area of the South Priaralye, more than a fourth of adult females were found to have a UI. Understanding the nature and risk factors for UI will allow planning the resources required to provide treatment and preventive measures in the future.
2011-01-26
... Known as Catawba Sox, Inc. Including Workers Whose Unemployment Insurance UI) Wages Are Paid Through...., had their wages reported under a separated unemployment insurance (UI) tax account under the name..., LLC, formerly known as Catawba Sox, Inc., including workers whose unemployment insurance (UI) wages...
2011-05-05
... commitment to performance excellence and client-centered services. As part of UI Performs, a comprehensive...) Handbook 336, 18th Edition: ``Unemployment Insurance (UI) State Quality Service Plan Planning (SQSP) and... proposed extension to ET Handbook 336, 18th Edition: ``Unemployment Insurance (UI) State Quality Service...
Kok, Gulsah; Seven, Memnun; Guvenc, Gulten; Akyuz, Aygul
2016-01-01
The purpose of this study was to determine the prevalence of and risk factors for urinary incontinence (UI) during pregnancy and to evaluate its effect on health-related quality of life. Descriptive, cross-sectional study. The sample of the study comprised 287 pregnant women attending an outpatient clinic located in a research and training hospital in Ankara, Turkey. Data were collected using an investigator-developed questionnaire that included 2 validated instruments, the International Consultation on Incontinence Questionnaire Short Form and Incontinence Quality of Life scale. The prevalence of UI in the study population was 21.3% (n = 61). Cumulative scores in pregnant women who "always" experienced UI and those who expressed a "large amount" of UI were lower than women with milder UI. Logistic regression analysis found associations between UI and age in years (odds ratio [OR] = 3.833; 95% confidence interval [CI], 1.763-8.332), parity (OR = 2.539; 95% CI, 1.135-5.675), third trimester versus first trimester (OR = 3.206; 95% CI, 1.178-8.725), and prior use of hormonal contraceptives (OR = 0.209; 95% CI, 0.085-0.513). Urinary incontinence is prevalent among pregnant women. Age, parity, and gestational week were associated with an increased likelihood of UI during pregnancy. Prior use of contraceptive hormones was associated with a reduced risk of UI during pregnancy.
Directory of Open Access Journals (Sweden)
Priscila Tavares Zizzi
Full Text Available Abstract OBJECTIVE To analyse pelvic floor muscle strength (PFMS and urinary and anal incontinence (UI and AI in the postpartum period. METHOD Cross-sectional study carried out with women in their first seven months after child birth. Data were collected through interviews, perineometry (Peritron™, and the International Consultation on Incontinence Questionnaire-Short Form (ICIQ-SF. RESULTS 128 women participated in the study. The PFMS mean was 33.1 (SD=16.0 cmH2O and the prevalence of UI and AI was 7.8% and 5.5%, respectively. In the multiple analyses, the variables associated with PFMS were type of birth and cohabitation with a partner. Newborn’s weight, previous pregnancy, UI during pregnancy, and sexual activity showed an association with UI after child birth. Only AI prior to pregnancy was associated with AI after childbirth. CONCLUSION Vaginal birth predisposes to the reduction of PFMS, and caesarean section had a protective effect to its reduction. The occurrence of UI during pregnancy is a predictor of UI after childbirth, and women with previous pregnancies and newborns with higher weights are more likely to have UI after childbirth.AI prior to pregnancy is the only risk factor for its occurrence after childbirth. Associations between PFMS and cohabitation with a partner, and between UI and sexual activity do not make possible to conclude that these variables are directly associated.
Han, Jian-hua; Wu, Lian; Yu, Song-lin; Fang, Hui-ling; Kamg, Wei-ming; Cheng, Xin-qi; Lu, Jie; Yu, Jian-chun; Qiu, Ling
2015-04-01
To assess the clinical application value of iodine metabolism biomarkers in assessing iodine nutrition status in surgically treated patients with thyroid disease. Blood,morning urine and 24-hour urine samples were collected in 31 healthy volunteers and in 30 surgically treated patients with thyroid disease before and after surgery. Iodine concentration was analyzed by inductively coupled plasma mass spectrometry. The iodine metabolism biomarkers including serum iodine (SI), morning urine iodine(UI), morning urine iodine/urine creatinine ratio (UI/UCr), 24-hour urine iodine (24 h UI), and 24-hour urine iodine excretion (24 h UIE) were evaluated in these two groups. In addition, the validation coincidence rate of iodine metabolism biomarkers in healthy volunteers to different reference ranges including World Health Organization, Mayo Clinic, and Quest Diagnostics were calculated. The UI/UCr ratio of pre-operative thyroid disease patients was significantly lower than that of healthy volunteers (P0.05) between these two groups. The SI, UI ,and 24 h UI in postoperative thyroid disease patients were significantly higher than those of the pre-operative patients (all Piodine metabolism biomarkers. The UI/UCr ratio may be used for iodine nutrition evaluation in surgically treated patients with thyroid disease.
Kirurgisk behandling af urininkontinens hos kvinder
DEFF Research Database (Denmark)
Ammendrup, A.C.; Sørensen, Helle Christina; Sander, Pia
2010-01-01
: In total, 94 operating gynaecologists and urologists were identified, 63 responded (71%) of whom 49 (78%) performed UI surgery. UI surgeons were gynaecologists 43 (88%) of these 24 (49%) were urogynecologists (working more than 50% with urogynecology) and five (10%) urologists. Tension-free Vaginal Tape......INTRODUCTION: During the last decade, minimal invasive procedures have been introduced for treatment of urinary incontinence (UI) in women leading to shorter hospitalisation and fewer complications. The aim of this study was to outline clinical practice and attitudes among Danish UI surgeons....... MATERIAL AND METHODS: Surgeons performing UI procedures were identified and mailed a questionnaire in 2007 concerning 2006. Questions included specialisation, number of procedures, type of surgery, complications and attitude towards learning surgery and maintaining a sufficient level of routine. RESULTS...
Solans-Domènech, Maite; Sánchez, Emília; Espuña-Pons, Montserrat
2010-03-01
To estimate frequency and severity and to identify risk factors of urinary incontinence (UI) and anal incontinence during pregnancy and after delivery in previously continent nulliparous women. We designed a cohort study of healthy, continent, nulliparous pregnant women attending public health care services. The field work was conducted during the control visits of the three trimesters of pregnancy, at the time of delivery, and postpartum. A self-administered questionnaire was used to assess UI (validated and adapted) and anal incontinence. Frequency of UI and anal incontinence and their confidence intervals (95% CIs) were calculated. The correlations between the severity of UI and the degree of effect on daily life were also estimated. Multivariable Cox models were applied to estimate hazard ratios for both incontinences (urinary/anal) during pregnancy and postpartum. The cumulative incidence rate during pregnancy was 39.1% (95% CI 36.3-41.9) for UI and 10.3% (95% CI 8.3-12.3) for anal incontinence. The correlation between severity of UI and effect on daily life was moderate. Age, baseline body mass index, and family history of UI were significantly associated with the occurrence of UI during pregnancy, while age and excess weight gain during pregnancy were associated with the occurrence of anal incontinence during pregnancy. Postpartum, the identified risk factors for both incontinences were incontinence during pregnancy and vaginal delivery. The occurrence of UI and anal incontinence during the postpartum period is related to the presence of incontinence in pregnancy, and vaginal delivery increases the risk of persistent incontinence. Some risk factors for both incontinences during pregnancy and postpartum are related to lifestyles and obstetric practices.
Directory of Open Access Journals (Sweden)
Roya Kelishadi
2016-09-01
Full Text Available Background: This study uses data of the global burden of diseases (GBD study 2010 to report death, disability-adjusted life year (DALYs, years of life lived with disability (YLDs and years of life lost due to premature mortality (YLLs, attributed to suboptimal breastfeeding by age and gender during 1990 to 2010 in Iran. Materials and Methods:The GBD assessments were used, together with estimates of death and DALYs due to specific risk factors to calculate the attributed burden of each risk factor exposure compared with the theoretical-minimum-risk exposure. Uncertainties in the distribution of exposure, relative risks, and relevant outcomes were incorporated into estimates of mortality attributable and burden and were presented as 95 % uncertainty interval (UI. Results:In both genders, the age standardized DALYs rates and the age standardized death rate [(from 5 (95% UI: 2-8 to 1 (95% UI: 0-2 per 100,000 populations], attributed to breastfeeding, had a decreasing trends. The age standardized YLD rate increased from 7 (95% UI: 2-15 to 10 (95% UI: 3-23 per 100,000 populations in boys and, from 7(95% UI: 2-16 to 11(95% UI: 3-26 per 100,000 populations in girls. The YLD changes showed some variation according to age categories. For both genders, the age standardizes YLL rate decreased from 395 (95% UI: 185-681 per 100,000 populations to 111(95% UI: 42-213 per 100,000 populations. Conclusion: The burden attributed to suboptimal breastfeeding had a considerable reduction rate from 1990 to 2010. Additional studies on burden of exclusive breastfeeding with more accurate data are recommended for policies make decision.
Risk of postpartum urinary incontinence associated with pregnancy and mode of delivery
DEFF Research Database (Denmark)
Foldspang, Anders; Hvidman, Lone; Mommsen, Søren
2004-01-01
Aim. The aim was to estimate the postpartum urinary incontinence (PP UI) impact of precursory UI during pregnancy (PR UI) and delivery performed by cesarean section (CS) vs. vaginal childbirth (VC). Methods. Among the members of two population samples, in total 8610 women aged 20–59 years, 1232...
Espuña Pons, M; Puig Clota, M
2006-01-01
The self-assessment of quality of life (QoL) of women with urinary symptoms may help in selecting the best treatment in each case. Epidemiologic, observational, cross-sectional and multicentric study of 674 women who underwent to a gynecology unit with symptoms suggesting Overactive Bladder, with or without urinary incontinence (UI). All women fill out the King's Health Questionnaire. Sociodemographic data and a complete register of urinary symptoms and the degree of afectation which caused, were also collected. Most frequent symptoms were "frequency" (612 women-90.8%), followed by "urgency" (562-83.4%), "nocturia" (543-80.6%) and "stres UI" (535-79.4%). Symptoms of "frecuency", "nocturia", "urgency" and "urgency UI" were more frequent in women aged 65 or under 65 years and that of "stress UI", in women over 65 years (79.8% vs 77.9%). 210 women did not fill out all the KHQ dimensions, mainly "Personal Limitations", "Personal Relationship", "Social limitations" and "Incontinence Impact". Global KHQ score was38.3 (SD=19.2). Higher scores (worse QoL) corresponded to "Incontinence Impact", "Severity Measures", "Personal Limitations" and "Role Limitations". Variables associated to global KHQ score were (multiple linear regression): age, BMI, urgency UI, UI in sexual intercourse, frequent urinary infections. QoL impact in women with urinary symptoms is important. The symptoms with higher association with QoL are: UI in sexual intercourse, urgency UI and frequent urinary infections.
Prospective analyses of female urinary incontinence symptoms following total hip arthroplasty.
Okumura, Keiko; Yamaguchi, Kumiko; Tamaki, Tatsuya; Oinuma, Kazuhiro; Tomoe, Hikaru; Akita, Keiichi
2017-04-01
Some patients with hip osteoarthritis report that urinary incontinence (UI) is improved following total hip arthroplasty (THA). However, the type and severity of UI remain unclear. In this study, we hypothesize that both stress urinary incontinence (SUI) and urge urinary incontinence (UUI) are improved after THA. We assess the characteristics of UI and discuss the anatomical factors related to UI and THA for improved treatment outcome. Fifty patients with UI who underwent direct anterior-approach THA were evaluated. Type of UI was assessed using four questionnaires: Core Lower Urinary Tract Symptom Score (CLSS), Urogenital Distress Inventory Short Form (UDI-6), International Prostate Symptom Score (IPSS), and Overactive Bladder Symptom Score (OABSS). Uroflowmetry and postvoid residual urine were measured using ultrasound technology. Hip-joint function was evaluated using Western Ontario and McMaster Universities Osteoarthritis Index (WOMAC) and range of motion (ROM). Of the 50 patients, 21 had SUI, 16 had mixed urinary incontinence (MUI), and eight had urgency urinary incontinence (UUI). In total, 36 patients were better than improved (72 %). The rate of cured and improved was 76 % for SUI, 100 % MUI, and 50 % UUI. The improvement of ROM was more significant in cured or improved patients than in stable or worse patients. Improvement in mild UI may be an added benefit for those undergoing THA for hip-joint disorders. These data suggest that for patients with hip-joint disorder, hip-joint treatment could prove to also be a useful treatment for UI.
Directory of Open Access Journals (Sweden)
Jeongok Park
2015-06-01
Full Text Available Purpose: The purpose of this study was to examine the prevalence of urinary incontinence (UI in community-dwelling Korean women 60 years or older, and to identify factors associated with self-reported and medically diagnosed UI. Methods: This study was a secondary analysis of data from the 2008 Actual Living Condition of the Elderly and Welfare Need Survey, which used a stratified two-stage cluster sampling method to select a representative sample of 8,961 elderly Korean women. Results: Of the 8,961 women in this study, 579 (6.5% had self-reported UI, and 209 (2.3% were medically diagnosed with UI. As patient age and exercise ability of the upper extremities increased, risk for self-reported UI decreased (odds ratio [OR], 0.98; 95% confidence interval [CI], 0.96–0.99; OR, 0.99; 95% CI, 0.98–0.99, respectively. In contrast, as the number of limited instrumental activities of daily living (IADL increased, the risk for self-reported UI increased (OR, 1.30; 95% CI, 1.24–1.35. Overweight women were 1.94 times more likely to have self-reported UI compared to underweight women. Women with a history of stroke or asthma were more likely to have self-reported UI compared to women with no history. Also, women who reported being in good health were less likely to have UI, compared to women who reported being in poor health (OR, 0.47; 95% CI, 0.31–0.70. Medically diagnosed UI was negatively associated with the number of limited IADL and exercise ability scores for the lower extremities (OR, 0.86; 95% CI, 0.80–0.92; OR, 0.98; 95% CI, 0.97–0.99, respectively. In contrast, as the exercise ability score for the upper extremities increased, so did the risk for medically diagnosed UI (OR, 1.02; 95% CI, 1.01–1.03. Conclusions: An interventional program for home visit health services is needed for incontinent women who are highly dependent on others for IADL.
Lee, Seung-Joon; Yoon, Tae-Ung; Kim, Ah-Reum; Kim, Seo-Yul; Cho, Kyung-Ho; Hwang, Young Kyu; Yeon, Jei-Won; Bae, Youn-Sang
2016-12-15
The separation of xenon/krypton mixtures is important for both environmental and industrial purposes. The potential of three hydrothermally stable MOFs (MIL-100(Fe), MIL-101(Cr), and UiO-66(Zr)) for use in Xe/Kr separation has been experimentally investigated. From the observed single-component Xe and Kr isotherms, isosteric heat of adsorption (Q st o ), and IAST-predicted Xe/Kr selectivities, we observed that UiO-66(Zr) has the most potential as an adsorbent among the three candidate MOFs. We performed dynamic breakthrough experiments with an adsorption bed filled with UiO-66(Zr) to evaluate further the potential of UiO-66(Zr) for Xe/Kr separation under mixture flow conditions. Remarkably, the experimental breakthrough curves show that UiO-66(Zr) can efficiently separate the Xe/Kr mixture. Furthermore, UiO-66(Zr) maintains most of its Xe and Kr uptake capacity, as well as its crystallinity and internal surface area, even after exposure to gamma radiation (2kGy) for 7h and aging for 16 months under ambient conditions. This result indicates that UiO-66(Zr) can be considered to be a potential adsorbent for Xe/Kr mixtures under both ambient and radioactive conditions. Copyright © 2016 Elsevier B.V. All rights reserved.
Tinkering with Technology: A Library Workshop to Support 4-H Youth Development
Hendrix, Beth; Williamson, Evan
2017-01-01
When University of Idaho (UI) Extension brought the Idaho 4-H Teen Conference to UI's main campus, the conference organizers collaborated with UI librarians to organize a workshop in the library's newly established makerspace, the Making, Innovating, and Learning Laboratory (MILL). In the MILL, the students used cutting-edge technology to foster…
McDonald, Sheila W.; Tough, Suzanne C.
2015-01-01
Objective The present study examined back pain (BP) and/or urinary incontinence (UI) impact on the ability to perform daily tasks at 12 months after childbirth in healthy reproductive women who sought maternity care in community based family practice clinics. Methods This study is a secondary analysis from the All Our Babies Study, a prospective, community-based pregnancy cohort in Calgary, Alberta. Maternal self-reported information on demographics, lifestyle, experiences with pregnancy and childbirth, occurrence of BP, UI and consequent impairment of daily tasks were collected by questionnaires administered before 25 weeks, at 34-36 weeks gestation and at 4 and 12 months postpartum. The occurrence and severity of BP and UI at one year after childbirth was assessed using descriptive and bivariate analyses. Logistic regression models examined the association between demographic and obstetrical variables and the severity of functional impairment due to UI and BP. Results From 1574 women with singleton pregnancies included in the study, 1212 (77%) experienced BP, 773 (49%) UI, and 620 (40%) both BP and UI. From the 821 women reporting impairment of daily tasks due to BP, 199 (24 %) were moderately and 90 (11%) severely affected with the remainder, 532 (64%) being mildly affected. From 267 women with functional impairment due to UI, 52 (19%) reported moderately to severe impairment in their ability to perform daily tasks. Obesity and parity were risk factors for impairment of daily functioning due to BP, whereas obesity and vaginal delivery increased the risk of moderate to severe impairment due to UI. Conclusions BP and UI are common occurrences 1 year after childbirth. Maternal performance of daily tasks and women’s health and quality of life are more often impaired due to BP than UI. Our study brings new evidence of the risk factors that predict severity and impact of these conditions on women functioning at 12 months postpartum. PMID:26083252
Eliasson, Kerstin; Edner, Ann; Mattsson, Eva
2008-05-01
The aim of this study was to examine the occurrence of urinary incontinence (UI) in mostly nulliparous women with a history of regular organised trampoline training as adolescents and to identify possible predictors. Female trampolinists in Sweden with licence for trampolining between 1995--1999 (n = 305), with a median age of 21 (range 18-44) years answered retrospectively a validated questionnaire. Competition with double somersaults had been performed by 85 women, the "competition group" (CG), while 220 women comprised the "recreational group" (RG). Of the trampolinists with UI during trampolining, 76% continued to leak. In CG, 57% and, in RG, 48% reported current UI. Strong predictors for UI were inability to interrupt micturition (p trampolining (p trampolining after menarche increased the risk of UI (p trampolining cannot be ruled out.
Andersen, Lea Laird; Møller, Lars Mikael Alling; Gimbel, Helga
2015-12-01
Lower urinary tract symptoms (LUTS) are common after hysterectomy and increase after menopause. We aimed to compare subtotal with total abdominal hysterectomy regarding LUTS, including urinary incontinence (UI) subtypes, 14 years after hysterectomy. Main results from this randomized clinical trial have been published previously; the analyses covered in this paper are exploratory. We performed a long-term questionnaire follow-up of women in a randomized clinical trial (n = 319), from 1996 to 2000 comparing subtotal with total abdominal hysterectomy. Of the randomized women, ten had died and five had left Denmark; 304 women were contacted. For univariate analyses, a χ(2)-test was used, and for multivariate analyses, we used logistic regression. The questionnaire was answered by 197 (64.7 %) women (subtotal 97; total 100). More women had subjective stress UI (SUI) in the subtotal group (n = 60; 62.5 %) compared with the total group (n = 45; 45 %), with a relative risk (RR) of 1.39 [95 % confidence interval (CI) 1.06-1.81; P = 0.014]. No difference was seen between subtotal and total abdominal hysterectomy in other LUTS. Factors associated with UI were UI prior to hysterectomy, local estrogen treatment, and body mass index (BMI) > 25 kg/m(2). High BMI was primarily associated with mixed UI (MUI) and urgency symptoms. Predictors of bothersome LUTS were UI and incomplete bladder emptying. The difference in the frequency of subjectively assessed UI between subtotal and total abdominal hysterectomy (published previously) is caused by a difference in subjectively assessed SUI; UI prior to hysterectomy and high BMI are related to UI 14 years after hysterectomy. The trial is registered on clinicaltrials.gov under Nykoebing Falster County Hospital Record sj-268: Total versus subtotal hysterectomy: http://clinicaltrials.gov/ct2/show/NCT01880710?term=hysterectomy&rank=27.
Directory of Open Access Journals (Sweden)
Jeongok Park
2016-06-01
Full Text Available Purpose: The purpose of this study was to determine the prevalence of urinary incontinence (UI and analyze its association with instrumental activities of daily living (IADL and benign prostatic hyperplasia (BPH in community-dwelling older men in Korea. Methods: This study was a secondary analysis of data from the Actual Living Condition of the Elderly and Welfare Need Survey conducted in the year 2008. Data was subjected to hierarchical logistic regression analysis to examine the association of IADL and BPH with UI in older men, entering IADL and BPH in model 1, and age, body mass index (BMI and education in model 2, and then comorbidities and walking speed in model 3. Results: Of 6,185 men, 243 (3.9% had self-reported UI. The prevalence of UI was 1.8% in men aged 60–64 years and 11.7% in those aged 85 years and above, indicating an increase in the prevalence of UI with their age. IADL and BPH remained the only significant factors associated with UI in model 1 (odds ratio [OR], 1.54; 95% confidence interval [CI], 1.44–1.64 and OR, 2.73; 95% CI, 1.47–5.10, respectively, model 2 (OR, 1.50; 95% CI, 1.40–1.61 and OR, 2.68; 95% CI, 1.42–5.07, and model 3 (OR, 1.43; 95% CI, 1.32–1.54 and OR, 2.58; 95% CI, 1.36–4.90. Conclusions: IADL limitations and presence of BPH were associated with UI in older men after controlling for BMI, education, comorbidities, and walking speed. Thus, UI should be assessed in older Korean men with IADL decline and BPH. Gender-sensitive interventions to attenuate IADL limitations and manage BPH should be developed and applied to improve UI in older men.
Brown, Stephanie J; Donath, Susan; MacArthur, Christine; McDonald, Ellie A; Krastev, Ann H
2010-02-01
Few studies have examined associations of prepregnancy urinary incontinence (UI). Multicentre prospective pregnancy cohort study (n = 1,507) using standardised measures to assess frequency and severity of UI. Prevalence of UI increased from 10.8% in the 12 months before the index pregnancy to 55.9% in the third trimester. Stress incontinence (36.9%) and mixed incontinence (13.1%) were more common during pregnancy than urge incontinence alone (5.9%). UI before pregnancy was associated with childhood enuresis (adjusted odds ratio (AdjOR) = 2.4, 95% confidence interval (CI) 1.6-3.4), higher maternal body mass index (AdjOR = 2.3, 95% CI 1.4-3.8), and previous miscarriages or terminations (AdjOR = 1.6, 95% CI 1.1-2.3). The strongest predictor of incident UI in pregnancy was occasional leakage (less than once a month) before pregnancy (AdjOR = 3.6, 95% CI 2.8-4.7). Further research is needed to elucidate the complex interplay of prepregnancy and pregnancy-related factors in the aetiology of UI in nulliparous women.
Directory of Open Access Journals (Sweden)
Yuan Wen-Chao
2017-01-01
Full Text Available As Linux gets more popular around the world, the advantage of the open source on software makes people do automated UI test by unified testing framework. UI software testing can guarantee the rationality of User Interface of Linux and accuracy of the UI’s widgets. In order to set free from fuzzy and repeated manual testing, and improve efficiency, this paper achieves automation testing of UI under Linux, and proposes a method to identify and test UI widgets under Linux, which is according to element tree of DogTail automaton testing framework. It achieves automation test of UI under Linux. According to this method, Aiming at the product of Red Hat Subscription Manager under Red Hat Enterprise Linux, it designs the automation test plan of this series of product’s dialogs. After many tests, it is indicated that this plan can identify UI widgets accurately and rationally, describe the structure of software clearly, avoid software errors and improve efficiency of the software. Simultaneously, it also can be used in the internationalization testing for checking translation during software internationalization.
Fluorescent molecule incorporated metal-organic framework for fluoride sensing in aqueous solution
Energy Technology Data Exchange (ETDEWEB)
Zhao, Xudong, E-mail: zhaoxd_tykj@163.com; Wang, Yuanyang; Hao, Xiuli; Liu, Wen, E-mail: 13700509372@163.com
2017-04-30
Highlights: • Fluorescein sodium was successfully encapsulated in UiO-66 via in-situ synthesis. • FS@UiO-66 is one of the few Zr-MOF-based probes for fluoride so far. • FS@UiO-66 is a highly effective, fast-response and naked-eye sensor for fluoride. - Abstract: In this work, the fluorescent molecule (fluorescein sodium, FS) was successfully incorporated in the zirconium-based MOF (UiO-66) via in-situ synthesis method, which can be confirmed by FTIR spectra and fluorescence microscopic images. Based on this in-situ synthesis strategy, FS molecule can be immobilized tightly in the framework. Furthermore, the resulting FS@UiO-66 demonstrates to be a highly selective, real-time and naked-eye chemical sensor for fluoride in aqueous solution, which is mainly due to the release of FS molecule from FS@UiO-66 into the aqueous solution. Meanwhile, to the best of our knowledge, such Zr-MOF-based fluoride sensor is very rare so far. These results provide a promising approach to rationally design novel MOF-based fluorescent sensor for the target molecules.
John, Gregor; Primmaz, Steve; Crichton, Siobhan; Wolfe, Charles
2018-01-01
To explore the relationship between indwelling urinary catheters (IUCs), urinary incontinence (UI), and death in the poststroke period and to determine when, after the neurological event, UI has the best ability to predict 1-year mortality. In a prospective observational study, 4477 patients were followed up for 1 year after a first-ever stroke. The impact of UI or urinary catheters on time to death was adjusted in a Cox model for age, sex, Glasgow Coma Scale, prestroke and poststroke Barthel Index, swallow test, motor deficit, diabetes, and year of inclusion. The predictive values of UI assessed at the maximal deficit or 7 days after a stroke were compared using receiver-operating curves. UI at the maximal neurological deficit and urinary catheters within the first week after the stroke were present in 43.9% and 31.2% patients, respectively. They were both associated with 1-year mortality in unadjusted and adjusted analysis (hazard ratio [HR], 1.78, 95% confidence interval [CI], 1.46-2.19, and HR, 1.84, 95% CI 1.54-2.19). Patients with UI and urinary catheters had twice the mortality rate of incontinent patients without urinary catheters (HR, 10.24; 95% CI, 8.72-12.03 versus HR, 4.70; 95% CI, 3.88-5.70; P year mortality than UI assessed at the maximal neurological deficit. IUCs in the poststroke period is associated with death, especially among incontinent patients. UI assessed at 1 week after the neurological event has the best predictive ability. Copyright © 2018 National Stroke Association. Published by Elsevier Inc. All rights reserved.
Huang, Hongwei; Yang, Jann N.; Zhou, Li
2009-03-01
An early detection of structural damages is critical for the decision making of repair and replacement maintenance in order to guarantee a specified structural reliability. Consequently, the structural damage detection, based on vibration data measured from the structural health monitoring (SHM) system, has received considerable attention recently. The traditional time-domain analysis techniques, such as the least square estimation (LSE) method and the extended Kalman filter (EKF) approach, require that all the external excitations (inputs) be available, which may not be the case for some SHM systems. Recently, these two approaches have been extended to cover the general case where some of the external excitations (inputs) are not measured, referred to as the LSE with unknown inputs (LSE-UI) and the EKF with unknown inputs (EKF-UI). Also, new analysis methods, referred to as the sequential non-linear least-square estimation with unknown inputs and unknown outputs (SNLSE-UI-UO) and the quadratic sum-square error with unknown inputs (QSSE-UI), have been proposed for the damage tracking of structures when some of the acceleration responses are not measured and the external excitations are not available. In this paper, these newly proposed analysis methods will be compared in terms of accuracy, convergence and efficiency, for damage identification of structures based on experimental data obtained through a series of experimental tests using a small-scale 3-story building model with white noise excitation. The capability of the LSE-UI, EKF-UI, SNLSE-UI-UO and QSSE-UI approaches in tracking the structural damages will be demonstrated.
Bodhare, Trupti N; Valsangkar, Sameer; Bele, Samir D
2010-07-01
There have been few community-based epidemiological studies on urinary incontinence (UI) evaluating the risk factors and impact on quality of life (QOL) in India. This study was designed (1) to estimate age-specific prevalence and risk factors of UI among women aged 35 years and above in a rural area and (2) to analyze the impact of UI on the QOL of incontinent women. A cross-sectional descriptive study was conducted. A semi-structured questionnaire assessing socio-demographic factors, severity and type of incontinence, and obstetrical and other risk factors along with impact on QOL was administered in two clusters (villages) in Karimnagar district through multistage cluster sampling. In a sample of 552 women, 53 (10%) reported episodes of UI. The prevalence of UI showed significant association with increasing age (P < 0.01). Fifty-seven percent of the women had symptoms of stress incontinence, 23% of urge, and 20% mixed symptoms. Obstetrical factors associated with UI included high parity (P < 0.003), young age at first childbirth (P < 0.01), forceps delivery (P < 0.001), and prolonged labor (P < 0.001). Chronic constipation, chronic cough, and history of urinary tract infection were predictors of UI in regression analysis (Nagelkerke R (2)= 0.7). Women with stress incontinence had the severest perceived impact on QOL on a five-point scale questionnaire, mean 24.87 (95% CI 21.26-28.47). One in 10 women reported episodes of UI with impaired QOL. The outcome is predicted both by obstetric and other risk factors.
A user interface framework for the Square Kilometre Array: concepts and responsibilities
Marassi, Alessandro; Brajnik, Giorgio; Nicol, Mark; Alberti, Valentina; Le Roux, Gerhard
2016-07-01
The Square Kilometre Array (SKA) project is responsible for developing the SKA Observatory, the world's largest radio telescope, with eventually over a square kilometre of collecting area and including a general headquarters as well as two radio telescopes: SKA1-Mid in South Africa and SKA1-Low in Australia. The SKA project consists of a number of subsystems (elements) among which the Telescope Manager (TM) is the one involved in controlling and monitoring the SKA telescopes. The TM element has three primary responsibilities: management of astronomical observations, management of telescope hardware and software subsystems, management of data to support system operations and all stakeholders (operators, maintainers, engineers and science users) in achieving operational, maintenance and engineering goals. Operators, maintainers, engineers and science users will interact with TM via appropriate user interfaces (UI). The TM UI framework envisaged is a complete set of general technical solutions (components, technologies and design information) for implementing a generic computing system (UI platform). Such a system will enable UI components to be instantiated to allow for human interaction via screens, keyboards, mouse and to implement the necessary logic for acquiring or deriving the information needed for interaction. It will provide libraries and specific Application Programming Interfaces (APIs) to implement operator and engineer interactive interfaces. This paper will provide a status update of the TM UI framework, UI platform and UI components design effort, including the technology choices, and discuss key challenges in the TM UI architecture, as well as our approaches to addressing them.
International Nuclear Information System (INIS)
Oliveira, Raquel Araujo de
2015-01-01
The advent of ubiquitous computing and the increasing variety of platforms and devices change user expectations in terms of user interfaces. Systems should be able to adapt themselves to their context of use, i.e., the platform (e.g. a PC or a tablet), the users who interact with the system (e.g. administrators or regular users), and the environment in which the system executes (e.g. a dark room or outdoor). The capacity of a UI to withstand variations in its context of use while preserving usability is called plasticity. Plasticity provides users with different versions of a UI. Although it enhances UI capabilities, plasticity adds complexity to the development of user interfaces: the consistency between multiple versions of a given UI should be ensured. Given the large number of possible versions of a UI, it is time-consuming and error prone to check these requirements by hand. Some automation must be provided to verify plasticity.This complexity is further increased when it comes to UIs of safety-critical systems. Safety-critical systems are systems in which a failure has severe consequences. The complexity of such systems is reflected in the UIs, which are now expected not only to provide correct, intuitive, non-ambiguous and adaptable means for users to accomplish a goal, but also to cope with safety requirements aiming to make sure that systems are reasonably safe before they enter the market. Several techniques to ensure quality of systems in general exist, which can also be used to safety-critical systems. Formal verification provides a rigorous way to perform verification, which is suitable for safety-critical systems. Our contribution is an approach to verify safety-critical interactive systems provided with plastic UIs using formal methods. Using a powerful tool-support, our approach permits:-The verification of sets of properties over a model of the system. Using model checking, our approach permits the verification of properties over the system formal
Designing with the mind in mind simple guide to understanding user interface design guidelines
Johnson, Jeff
2014-01-01
In this completely updated and revised edition of Designing with the Mind in Mind, Jeff Johnson provides you with just enough background in perceptual and cognitive psychology that user interface (UI) design guidelines make intuitive sense rather than being just a list or rules to follow. Early UI practitioners were trained in cognitive psychology, and developed UI design rules based on it. But as the field has evolved since the first edition of this book, designers enter the field from many disciplines. Practitioners today have enough experience in UI design that they have been exposed to
Wu, Ying; Chen, Huiyong; Liu, Defei; Xiao, Jing; Qian, Yu; Xi, Hongxia
2015-03-18
The adsorption and separation properties of benzene and toluene on the zirconium-based frameworks UiO-66, -67, -68, and their functional analogues UiO-Phe and UiO-Me2 were studied using grand canonical Monte Carlo simulations, density functional theory, and ideal adsorbed solution theory. Remarkable higher adsorption uptakes of benzene and toluene at low pressures on UiO-Phe and -Me2 were found compared to their parent framework UiO-67. It can be ascribed to the presence of functional groups (aromatic rings and methyl groups) that significantly intensified the adsorption, majorly by reducing the effective pore size and increasing the interaction strength with the adsorbates. At high pressures, the pore volumes and accessible surfaces of the frameworks turned out to be the dominant factors governing the adsorption. In the case of toluene/benzene separation, toluene selectivities of UiOs showed a two-stage separation behavior at the measured pressure range, resulting from the greater interaction affinities of toluene at low pressures and steric hindrance effects at high pressures. Additionally, the counterbalancing factors of enhanced π delocalization and suitable pore size of UiO-Phe gave rise to the highest toluene selectivity, suggesting the ligand functionalization strategy could reach both high adsorption capacity and separation selectivity from aromatic mixtures at low concentrations.
Building a Relationship between Robot Characteristics and Teleoperation User Interfaces.
Mortimer, Michael; Horan, Ben; Seyedmahmoudian, Mehdi
2017-03-14
The Robot Operating System (ROS) provides roboticists with a standardized and distributed framework for real-time communication between robotic systems using a microkernel environment. This paper looks at how ROS metadata, Unified Robot Description Format (URDF), Semantic Robot Description Format (SRDF), and its message description language, can be used to identify key robot characteristics to inform User Interface (UI) design for the teleoperation of heterogeneous robot teams. Logical relationships between UI components and robot characteristics are defined by a set of relationship rules created using relevant and available information including developer expertise and ROS metadata. This provides a significant opportunity to move towards a rule-driven approach for generating the designs of teleoperation UIs; in particular the reduction of the number of different UI configurations required to teleoperate each individual robot within a heterogeneous robot team. This approach is based on using an underlying rule set identifying robots that can be teleoperated using the same UI configuration due to having the same or similar robot characteristics. Aside from reducing the number of different UI configurations an operator needs to be familiar with, this approach also supports consistency in UI configurations when a teleoperator is periodically switching between different robots. To achieve this aim, a Matlab toolbox is developed providing users with the ability to define rules specifying the relationship between robot characteristics and UI components. Once rules are defined, selections that best describe the characteristics of the robot type within a particular heterogeneous robot team can be made. A main advantage of this approach is that rather than specifying discrete robots comprising the team, the user can specify characteristics of the team more generally allowing the system to deal with slight variations that may occur in the future. In fact, by using the
Building a Relationship between Robot Characteristics and Teleoperation User Interfaces
Directory of Open Access Journals (Sweden)
Michael Mortimer
2017-03-01
Full Text Available The Robot Operating System (ROS provides roboticists with a standardized and distributed framework for real-time communication between robotic systems using a microkernel environment. This paper looks at how ROS metadata, Unified Robot Description Format (URDF, Semantic Robot Description Format (SRDF, and its message description language, can be used to identify key robot characteristics to inform User Interface (UI design for the teleoperation of heterogeneous robot teams. Logical relationships between UI components and robot characteristics are defined by a set of relationship rules created using relevant and available information including developer expertise and ROS metadata. This provides a significant opportunity to move towards a rule-driven approach for generating the designs of teleoperation UIs; in particular the reduction of the number of different UI configurations required to teleoperate each individual robot within a heterogeneous robot team. This approach is based on using an underlying rule set identifying robots that can be teleoperated using the same UI configuration due to having the same or similar robot characteristics. Aside from reducing the number of different UI configurations an operator needs to be familiar with, this approach also supports consistency in UI configurations when a teleoperator is periodically switching between different robots. To achieve this aim, a Matlab toolbox is developed providing users with the ability to define rules specifying the relationship between robot characteristics and UI components. Once rules are defined, selections that best describe the characteristics of the robot type within a particular heterogeneous robot team can be made. A main advantage of this approach is that rather than specifying discrete robots comprising the team, the user can specify characteristics of the team more generally allowing the system to deal with slight variations that may occur in the future. In fact, by
Global Burden of Hypertension and Systolic Blood Pressure of at Least 110 to 115 mm Hg, 1990-2015.
Forouzanfar, Mohammad H; Liu, Patrick; Roth, Gregory A; Ng, Marie; Biryukov, Stan; Marczak, Laurie; Alexander, Lily; Estep, Kara; Hassen Abate, Kalkidan; Akinyemiju, Tomi F; Ali, Raghib; Alvis-Guzman, Nelson; Azzopardi, Peter; Banerjee, Amitava; Bärnighausen, Till; Basu, Arindam; Bekele, Tolesa; Bennett, Derrick A; Biadgilign, Sibhatu; Catalá-López, Ferrán; Feigin, Valery L; Fernandes, Joao C; Fischer, Florian; Gebru, Alemseged Aregay; Gona, Philimon; Gupta, Rajeev; Hankey, Graeme J; Jonas, Jost B; Judd, Suzanne E; Khang, Young-Ho; Khosravi, Ardeshir; Kim, Yun Jin; Kimokoti, Ruth W; Kokubo, Yoshihiro; Kolte, Dhaval; Lopez, Alan; Lotufo, Paulo A; Malekzadeh, Reza; Melaku, Yohannes Adama; Mensah, George A; Misganaw, Awoke; Mokdad, Ali H; Moran, Andrew E; Nawaz, Haseeb; Neal, Bruce; Ngalesoni, Frida Namnyak; Ohkubo, Takayoshi; Pourmalek, Farshad; Rafay, Anwar; Rai, Rajesh Kumar; Rojas-Rueda, David; Sampson, Uchechukwu K; Santos, Itamar S; Sawhney, Monika; Schutte, Aletta E; Sepanlou, Sadaf G; Shifa, Girma Temam; Shiue, Ivy; Tedla, Bemnet Amare; Thrift, Amanda G; Tonelli, Marcello; Truelsen, Thomas; Tsilimparis, Nikolaos; Ukwaja, Kingsley Nnanna; Uthman, Olalekan A; Vasankari, Tommi; Venketasubramanian, Narayanaswamy; Vlassov, Vasiliy Victorovich; Vos, Theo; Westerman, Ronny; Yan, Lijing L; Yano, Yuichiro; Yonemoto, Naohiro; Zaki, Maysaa El Sayed; Murray, Christopher J L
2017-01-10
Elevated systolic blood (SBP) pressure is a leading global health risk. Quantifying the levels of SBP is important to guide prevention policies and interventions. To estimate the association between SBP of at least 110 to 115 mm Hg and SBP of 140 mm Hg or higher and the burden of different causes of death and disability by age and sex for 195 countries and territories, 1990-2015. A comparative risk assessment of health loss related to SBP. Estimated distribution of SBP was based on 844 studies from 154 countries (published 1980-2015) of 8.69 million participants. Spatiotemporal Gaussian process regression was used to generate estimates of mean SBP and adjusted variance for each age, sex, country, and year. Diseases with sufficient evidence for a causal relationship with high SBP (eg, ischemic heart disease, ischemic stroke, and hemorrhagic stroke) were included in the primary analysis. Mean SBP level, cause-specific deaths, and health burden related to SBP (≥110-115 mm Hg and also ≥140 mm Hg) by age, sex, country, and year. Between 1990-2015, the rate of SBP of at least 110 to 115 mm Hg increased from 73 119 (95% uncertainty interval [UI], 67 949-78 241) to 81 373 (95% UI, 76 814-85 770) per 100 000, and SBP of 140 mm Hg or higher increased from 17 307 (95% UI, 17 117-17 492) to 20 526 (95% UI, 20 283-20 746) per 100 000. The estimated annual death rate per 100 000 associated with SBP of at least 110 to 115 mm Hg increased from 135.6 (95% UI, 122.4-148.1) to 145.2 (95% UI 130.3-159.9) and the rate for SBP of 140 mm Hg or higher increased from 97.9 (95% UI, 87.5-108.1) to 106.3 (95% UI, 94.6-118.1). For loss of DALYs associated with systolic blood pressure of 140 mm Hg or higher, the loss increased from 95.9 million (95% uncertainty interval [UI], 87.0-104.9 million) to 143.0 million (95% UI, 130.2-157.0 million) [corrected], and for SBP of 140 mm Hg or higher, the loss increased from 5.2 million (95% UI, 4.6-5.7 million) to 7
Risk factors for urinary incontinence among women aged 60 or over with hypertension in Taiwan
Directory of Open Access Journals (Sweden)
Keng-Ming Chang
2014-06-01
Conclusion: UI can be a frequent and annoying problem for aged women. In women with H/T, UI is significantly related to risk factors such as age, DM, BMI, and urinary diseases. In addition, BMI is considered a key risk factor for H/T. Therefore, effective control of BMI would help in controlling H/T and UI in aged women.
Fritel, Xavier; de Tayrac, Renaud; Bader, Georges; Savary, Denis; Gueye, Ameth; Deffieux, Xavier; Fernandez, Hervé; Richet, Claude; Guilhot, Joëlle; Fauconnier, Arnaud
2015-08-01
To compare, in an unselected population of nulliparous pregnant women, the postnatal effect of prenatal supervised pelvic floor muscle training with written instructions on postpartum urinary incontinence (UI). In a randomized controlled trial in two parallel groups, 282 women were recruited from five university teaching hospitals in France and randomized during the second trimester of pregnancy. The physiotherapy group received prenatal individually supervised exercises. Both groups received written instructions about how to perform exercises at home. Women were blindly assessed at baseline, end of pregnancy, and 2 and 12 months postpartum. The primary outcome measured was UI severity, assessed with an International Consultation on Incontinence Questionnaire-Urinary Incontinence Short Form score (range 0-21; 1-5 is slight UI) at 12 months postpartum; other outcomes were UI prevalence and pelvic floor troubles assessed using self-administered questionnaires. To give a 1-point difference in UI severity score, we needed 91 women in each group (standard deviation 2.4, α=0.05, β=0.20, and bilateral analysis). Between February 2008 and June 2010, 140 women were randomized in the physiotherapy group and 142 in the control group. No difference was observed between the two groups in UI severity, prevalence, or pelvic floor troubles at baseline, end of pregnancy, and at 2 and 12 months postpartum. At 12 months postpartum, the primary outcome was available for 190 women (67.4%); mean UI severity was 1.9 in the physiotherapy group compared with 2.1 in the control group (P=.38). Prenatal supervised pelvic floor training was not superior to written instructions in reducing postnatal UI. ClinicalTrials.gov; www.clinicaltrials.gov, NCT00551551. I.
Extending the Use of Highly Porous and Functionalized MOFs to Th(IV) Capture.
Zhang, Nan; Yuan, Li-Yong; Guo, Wen-Lu; Luo, Shi-Zhong; Chai, Zhi-Fang; Shi, Wei-Qun
2017-08-02
Thorium separation has recently become a hot topic because of the potential application of thorium as a future nuclear fuel, while metal-organic framework (MOF) materials have received much attention in the separation field due to their unique properties. Herein, a highly porous and stable MOF, UiO-66, and its carboxyl derivatives (UiO-66-COOH and UiO-66-(COOH) 2 ) were synthesized and explored for the first time for Th(IV) capture from a weak acidic solution. Although the introduction of carboxyl groups into UiO-66 leads to an obvious decrease in the surface area and pore volume, the adsorbability toward Th(IV) is greatly enhanced. At pH = 3.0, the saturated sorption capacity for Th(IV) into UiO-66-(COOH) 2 reached 350 mg/g, representing one of the largest values for Th(IV) capture by solid extraction. Moreover, the functionalized MOFs show fast sorption kinetics and desirable selectivity toward Th(IV) over a range of competing metal ions. A possible mechanism for the selective recognition of Th(IV) by these MOFs was explored on the basis of extended X-ray absorption fine structure and Fourier transform infrared analysis. It is concluded that UiO-66-COOH and UiO-66-(COOH) 2 sorb Th(IV) through the coordination of carboxyl anions in the pores of the MOFs, whereas in the case of UiO-66, both the precipitation and the exchange with the organic solvent contribute to the Th(IV) uptake. This study contributes to the assessment of the feasibility of MOFs applied in actinides separation and better understanding of actinides sorption behavior in this kind of hybrid porous solid materials.
Comparison of reading speed with 3 different log-scaled reading charts.
Buari, Noor Halilah; Chen, Ai-Hong; Musa, Nuraini
2014-01-01
A reading chart that resembles real reading conditions is important to evaluate the quality of life in terms of reading performance. The purpose of this study was to compare the reading speed of UiTM Malay related words (UiTM-Mrw) reading chart with MNread Acuity Chart and Colenbrander Reading Chart. Fifty subjects with normal sight were randomly recruited through randomized sampling in this study (mean age=22.98±1.65 years). Subjects were asked to read three different near charts aloud and as quickly as possible at random sequence. The charts were the UiTM-Mrw Reading Chart, MNread Acuity Chart and Colenbrander Reading Chart, respectively. The time taken to read each chart was recorded and any errors while reading were noted. Reading performance was quantified in terms of reading speed as words per minute (wpm). The mean reading speed for UiTM-Mrw Reading Chart, MNread Acuity Chart and Colenbrander Reading Chart was 200±30wpm, 196±28wpm and 194±31wpm, respectively. Comparison of reading speed between UiTM-Mrw Reading Chart and MNread Acuity Chart showed no significant difference (t=-0.73, p=0.72). The same happened with the reading speed between UiTM-Mrw Reading Chart and Colenbrander Reading Chart (t=-0.97, p=0.55). Bland and Altman plot showed good agreement between reading speed of UiTM-Mrw Reading Chart with MNread Acuity Chart with the Colenbrander Reading Chart. UiTM-Mrw Reading Chart in Malay language is highly comparable with standardized charts and can be used for evaluating reading speed. Copyright © 2013 Spanish General Council of Optometry. Published by Elsevier Espana. All rights reserved.
Between suffering and hope: rehabilitation from urinary incontinence as an intervening component.
Delarmelindo, Rita de Cássia Altino; Parada, Cristina Maria Garcia de Lima; Rodrigues, Rosalina Aparecida Partezani; Bocchi, Silvia Cristina Mangini
2013-07-01
This is a qualitative study seeking to understand Brazilian women's experience of urinary incontinence (UI) and design a representative theoretical model for the experience. Theoretical saturation occurred after analysis of the 18th non-directive interview in accordance with Grounded Theory. Two phenomena emerged: living with the challenges of UI and experiencing the hope and disappointment of rehabilitation from UI. Upon re-alignment of the components, the core category emerged, namely: between suffering and hope--rehabilitation from urinary incontinence as an intervening component. From the analysis in light of symbolic interactionism, pregnancy and vaginal birth were observed to be symbols of women's vulnerability to the suffering from living with the moral and physio-psychosocial challenges of UI. It is also inferred that the lack of consideration of the Unified Health System (SUS) in investing in the process of rehabilitation from UI may be having a negative effect on the incentive programs for promoting vaginal birth. Most of all, it reveals the ongoing suffering of women with UI, most of whom do not have access to rehabilitation due to the lack of programs geared to the real needs of these users of the Unified Health System.
Yin, Changxi; Gan, Lijun; Ng, Denny; Zhou, Xie; Xia, Kai
2007-01-01
Cytoplasmic male sterile (CMS) rice Zhenshan 97A (ZS97A) has been widely used in hybrid rice production in China. However, ZS97A suffers from serious panicle enclosure, which blocks normal pollination and greatly reduces seed production of hybrid rice. Little is known about the cause of panicle closure in ZS97A. In this study, it was found that the occurrence of cytoplasmic male sterility caused a deficiency of indole-3-acetic acid (IAA) in ZS97A panicles, and less IAA was provided to the uppermost internode (UI). Further, it was found that the decreased panicle-derived IAA caused a gibberellin A(1) (GA(1)) deficiency in the UI by the down-regulation of OsGA3ox2 transcript level. Reduced GA(1) level in the UI led to decreases of both cell number and cell elongation, resulting in a shortened UI. The shortened UI was unable to push the panicle out of the flag leaf sheath that remained normal, which resulted in panicle enclosure in ZS97A. These findings suggest that decreased panicle-derived IAA reduces the GA(1) level in the UI, causing panicle enclosure in CMS rice ZS97A.
Directory of Open Access Journals (Sweden)
Shuichiro Kobayashi
Full Text Available ABSTRACT Purpose: To determine the predictive factors for postoperative urinary incontinence (UI following holmium laser enucleation of the prostate (HoLEP during the initial learning period. Patients and Methods: We evaluated 127 patients with benign prostatic hyperplasia who underwent HoLEP between January 2011 and December 2013. We recorded clinical variables, including blood loss, serum prostate-specific antigen levels, and the presence or absence of UI. Blood loss was estimated as a decline in postoperative hemoglobin levels. The predictive factors for postoperative UI were determined using a multivariable logistic regression analysis. Results: Postoperative UI occurred in 31 patients (24.4%, but it cured in 29 patients (93.5% after a mean duration of 12 weeks. Enucleation time >100 min (p=0.043 and blood loss >2.5g/dL (p=0.032 were identified as significant and independent risk factors for postoperative UI. Conclusions: Longer enucleation time and increased blood loss were independent predictors of postoperative UI in patients who underwent HoLEP during the initial learning period. Surgeons in training should take care to perform speedy enucleation maneuver with hemostasis.
User interface user's guide for HYPGEN
Chiu, Ing-Tsau
1992-01-01
The user interface (UI) of HYPGEN is developed using Panel Library to shorten the learning curve for new users and provide easier ways to run HYPGEN for casual users as well as for advanced users. Menus, buttons, sliders, and type-in fields are used extensively in UI to allow users to point and click with a mouse to choose various available options or to change values of parameters. On-line help is provided to give users information on using UI without consulting the manual. Default values are set for most parameters and boundary conditions are determined by UI to further reduce the effort needed to run HYPGEN; however, users are free to make any changes and save it in a file for later use. A hook to PLOT3D is built in to allow graphics manipulation. The viewpoint and min/max box for PLOT3D windows are computed by UI and saved in a PLOT3D journal file. For large grids which take a long time to generate on workstations, the grid generator (HYPGEN) can be run on faster computers such as Crays, while UI stays at the workstation.
Between suffering and hope: rehabilitation from urinary incontinence as an intervening component
Directory of Open Access Journals (Sweden)
Rita de Cássia Altino Delarmelindo
2013-07-01
Full Text Available This is a qualitative study seeking to understand Brazilian women's experience of urinary incontinence (UI and design a representative theoretical model for the experience. Theoretical saturation occurred after analysis of the 18th non-directive interview in accordance with Grounded Theory. Two phenomena emerged: living with the challenges of UI and experiencing the hope and disappointment of rehabilitation from UI. Upon re-alignment of the components, the core category emerged, namely: between suffering and hope - rehabilitation from urinary incontinence as an intervening component. From the analysis in light of symbolic interactionism, pregnancy and vaginal birth were observed to be symbols of women's vulnerability to the suffering from living with the moral and physio-psychosocial challenges of UI. It is also inferred that the lack of consideration of the Unified Health System (SUS in investing in the process of rehabilitation from UI may be having a negative effect on the incentive programs for promoting vaginal birth. Most of all, it reveals the ongoing suffering of women with UI, most of whom do not have access to rehabilitation due to the lack of programs geared to the real needs of these users of the Unified Health System.
Prevalence of urinary incontinence and lower urinary tract symptoms in school-age children.
Akil, Ipek Ozunan; Ozmen, Dilek; Cetinkaya, Aynur Cakmakci
2014-07-08
To investigate the prevalence of lower urinary tract symptoms (LUTS) and urinary incontinence (UI) in elementary school aged children in Manisa. Dysfunctional Voiding and Incontinence Scoring System (DVIS) which was developed in Turkey is used. A total of 416 children, 216 (51.9%) male and 200 (48.1%) female were recruited in this study. Mean age of children was 10.35 ± 2.44 years (median10 years). Daytime UI frequency was 6.7% (28 child), nocturnal incontinence 16.6% (69 child) and combined daytime and nocturnal incontinence 4.1% (17 child). There was no statistically significant difference in the prevalence of nocturnal and or daytime UI between male and female gender. Mean DVIS score was 2.65 ± 3.95 and gender did not affect total DVIS points. The mean ages of achieving daytime bowel and bladder control were all significantly correlated with DVIS points. DVIS points were positively correlated with the history of UI of the family. Total points were increased when the father was unemployed. UI negatively influences health related quality of life of the family and child, so it is important that awareness of the UI and symptoms of lower urinary tract dysfunction.
Self-reported urinary incontinence in elderly and its associated factors
Directory of Open Access Journals (Sweden)
Alisson Fernandes Bolina
2013-05-01
Full Text Available Household survey, cross-sectional and observational study that aimed to verify the socio-demographic factors and self-reported morbidities associated with urinary incontinence (UI. The research was carried out between August and December 2008 with 2,142 elderly people. We used a semi-structured instrument, and performed a descriptive analysis and logistic regression (p<0.05. Most were female and with income of up to one minimum wage. UI prevailed among those aged 70├80 years, widowed and uneducated; for the group without UI: 60├70 years, married or living with partner and 4├8 years of study. The factors associated with increased chances of presenting UI were: 70├80 years and 80 years and older, no education and obesity. It is important to pay attention to the factors associated with UI in the development of effective actions on health prevention.
Directory of Open Access Journals (Sweden)
Trupti N Bodhare
2010-01-01
Results : In a sample of 552 women, 53 (10% reported episodes of UI. The prevalence of UI showed significant association with increasing age (P < 0.01. Fifty-seven percent of the women had symptoms of stress incontinence, 23% of urge, and 20% mixed symptoms. Obstetrical factors associated with UI included high parity (P < 0.003, young age at first childbirth (P < 0.01, forceps delivery (P < 0.001, and prolonged labor (P < 0.001. Chronic constipation, chronic cough, and history of urinary tract infection were predictors of UI in regression analysis (Nagelkerke R 2 = 0.7. Women with stress incontinence had the severest perceived impact on QOL on a five-point scale questionnaire, mean 24.87 (95% CI 21.26-28.47. Conclusion : One in 10 women reported episodes of UI with impaired QOL. The outcome is predicted both by obstetric and other risk factors.
Dwyer-Lindgren, Laura; Bertozzi-Villa, Amelia; Stubbs, Rebecca W; Morozoff, Chloe; Shirude, Shreya; Naghavi, Mohsen; Mokdad, Ali H; Murray, Christopher J L
2017-09-26
Chronic respiratory diseases are an important cause of death and disability in the United States. To estimate age-standardized mortality rates by county from chronic respiratory diseases. Validated small area estimation models were applied to deidentified death records from the National Center for Health Statistics and population counts from the US Census Bureau, National Center for Health Statistics, and Human Mortality Database to estimate county-level mortality rates from 1980 to 2014 for chronic respiratory diseases. County of residence. Age-standardized mortality rates by county, year, sex, and cause. A total of 4 616 711 deaths due to chronic respiratory diseases were recorded in the United States from January 1, 1980, through December 31, 2014. Nationally, the mortality rate from chronic respiratory diseases increased from 40.8 (95% uncertainty interval [UI], 39.8-41.8) deaths per 100 000 population in 1980 to a peak of 55.4 (95% UI, 54.1-56.5) deaths per 100 000 population in 2002 and then declined to 52.9 (95% UI, 51.6-54.4) deaths per 100 000 population in 2014. This overall 29.7% (95% UI, 25.5%-33.8%) increase in chronic respiratory disease mortality from 1980 to 2014 reflected increases in the mortality rate from chronic obstructive pulmonary disease (by 30.8% [95% UI, 25.2%-39.0%], from 34.5 [95% UI, 33.0-35.5] to 45.1 [95% UI, 43.7-46.9] deaths per 100 000 population), interstitial lung disease and pulmonary sarcoidosis (by 100.5% [95% UI, 5.8%-155.2%], from 2.7 [95% UI, 2.3-4.2] to 5.5 [95% UI, 3.5-6.1] deaths per 100 000 population), and all other chronic respiratory diseases (by 42.3% [95% UI, 32.4%-63.8%], from 0.51 [95% UI, 0.48-0.54] to 0.73 [95% UI, 0.69-0.78] deaths per 100 000 population). There were substantial differences in mortality rates and changes in mortality rates over time among counties, and geographic patterns differed by cause. Counties with the highest mortality rates were found primarily in central Appalachia
Directory of Open Access Journals (Sweden)
Paul R Torgerson
2015-12-01
Full Text Available Foodborne diseases are globally important, resulting in considerable morbidity and mortality. Parasitic diseases often result in high burdens of disease in low and middle income countries and are frequently transmitted to humans via contaminated food. This study presents the first estimates of the global and regional human disease burden of 10 helminth diseases and toxoplasmosis that may be attributed to contaminated food.Data were abstracted from 16 systematic reviews or similar studies published between 2010 and 2015; from 5 disease data bases accessed in 2015; and from 79 reports, 73 of which have been published since 2000, 4 published between 1995 and 2000 and 2 published in 1986 and 1981. These included reports from national surveillance systems, journal articles, and national estimates of foodborne diseases. These data were used to estimate the number of infections, sequelae, deaths, and Disability Adjusted Life Years (DALYs, by age and region for 2010. These parasitic diseases, resulted in 48.4 million cases (95% Uncertainty intervals [UI] of 43.4-79.0 million and 59,724 (95% UI 48,017-83,616 deaths annually resulting in 8.78 million (95% UI 7.62-12.51 million DALYs. We estimated that 48% (95% UI 38%-56% of cases of these parasitic diseases were foodborne, resulting in 76% (95% UI 65%-81% of the DALYs attributable to these diseases. Overall, foodborne parasitic disease, excluding enteric protozoa, caused an estimated 23.2 million (95% UI 18.2-38.1 million cases and 45,927 (95% UI 34,763-59,933 deaths annually resulting in an estimated 6.64 million (95% UI 5.61-8.41 million DALYs. Foodborne Ascaris infection (12.3 million cases, 95% UI 8.29-22.0 million and foodborne toxoplasmosis (10.3 million cases, 95% UI 7.40-14.9 million were the most common foodborne parasitic diseases. Human cysticercosis with 2.78 million DALYs (95% UI 2.14-3.61 million, foodborne trematodosis with 2.02 million DALYs (95% UI 1.65-2.48 million and foodborne
Directory of Open Access Journals (Sweden)
Midthjell Kristian
2009-09-01
Full Text Available Abstract Background Previous studies have shown an association between diabetes mellitus (DM and urinary incontinence (UI in women, especially severe UI. The purpose of this study was to investigate whether diabetes related variables could explain this association. Methods The study is part of the EPINCONT study, which is based on the large Nord-Trøndelag Health Study 2 (HUNT 2, performed in the county of Nord-Trøndelag, Norway, during the years 1995 - 1997. Questions on diabetes and UI were answered by a total of 21 057 women aged 20 years and older. Of these 685 were identified as having diabetes, and thus comprise the population of our study. A variety of clinical and biochemical variables were recorded from the participants. Results Blood-glucose, HbA1c, albumine:creatinine ratio (ACR, duration of diabetes, diabetes treatment, type of diabetes, cholesterol and triglycerides did not significantly differ in women with and without UI in crude analyses. However, the diabetic women with UI had more hospitalizations during the last 12 months, more homecare, and a higher prevalence of angina and use of oestrogene treatment (both local and oral/patch. After adjusting for age, BMI, parity and smoking, there were statistically significant associations between any UI and angina (OR 1.89; 95% CI: 1.22 - 2.93, homecare (OR 1.72; 95% CI: 1.02 - 2.89, and hospitalization during the last 12 months (OR 1.67; 95% CI: 1.18 - 2.38. In adjusted analyses severe UI was also significantly associated with the same variables, and also with diabetes drug treatment (OR 2.10; 95% CI: 1.07 - 4.10 and stroke (OR 2.47; 95% CI: 1.09 - 5.59. Conclusion No single diabetes related risk factor seems to explain the increased risk for UI among women with diabetes. However, we found associations between UI and some clinical correlates of diabetes.
Tang, Derek H; Colayco, Danielle C; Khalaf, Kristin M; Piercy, James; Patel, Vaishali; Globe, Denise; Ginsberg, David
2014-03-01
To evaluate the impact of urinary incontinence (UI) on healthcare resource utilization (HRU), health-related quality of life (HRQoL) and productivity measures in patients with overactive bladder (OAB). This retrospective, cross-sectional study used data from the Adelphi OAB/UI Disease Specific Programme, a multinational survey of patient- and physician-reported data, fielded between November 2010 and February 2011. The primary patient groups of interest were those with OAB, both with and without UI. Health-related quality of life and productivity measures were derived from the EuroQoL-5D, the Incontinence Quality of Life questionnaire, the Overactive Bladder Questionnaire, and the Work Productivity and Activity Impairment Questionnaire. Measures of HRU included OAB-related surgeries, OAB-related hospitalizations, incontinence pads, anticholinergic use and physician visits. Multivariate linear regression models and literature-based minimal clinically important differences were used to assess statistically significant and clinically meaningful differences in HRQoL and productivity measures between patients with OAB with UI and those without UI. A total of 1 730 patients were identified, with a mean age of 60.7 years, and 77.0% of them were women, 84.2% were non-Hispanic whites, and 71% were incontinent. Bivariate analyses showed that HRU was significantly higher among patients with OAB with UI than among those without UI in all categories except for the number of OAB-related physician visits. In both bivariate and multivariate analyses, incontinent patients presented with clinically and statistically significantly lower HRQoL and productivity measures with respect to all study endpoints, except for percentage of work time missed due to their OAB/UI. Urinary incontinence was associated with significantly higher HRU and lower HRQoL and productivity in this population of patients with OAB from five different countries. In addition to clinical considerations, the
Risk factors for postpartum urinary incontinence
Directory of Open Access Journals (Sweden)
Lígia da Silva Leroy
2016-04-01
Full Text Available Abstract OBJECTIVE: To investigate the risk factors for postpartum urinary incontinence (UI and its characteristics. METHOD: This was a case-control study with 344 puerperal women (77 cases and 267 controls with up to 90 days postpartum. In a single session, participants were given a questionnaire with sociodemographic and clinical data and two others that assessed urine leakage, leakage situations, and type of UI. RESULTS: Stress UI was present in 45.5% of the women, incidents of urine leakage several times a day in 44.2%, of which 71.4% were in small amounts and 57.1% when coughing or sneezing. In 70.1% of cases, UI began during pregnancy and remained through the postpartum period. After running a binary logistic regression model, the following factors remained in the final model: UI during pregnancy (OR 12.82, CI 95% 6.94 - 23.81, p<0.0001, multiparity (OR 2.26, CI 95% 1.22 - 4.19, p=0.009, gestational age at birth greater or equal to 37 weeks (OR 2.52, CI 95% 1.16 - 5.46, p=0.02 and constipation (OR 1.94, CI 95% 1.05 - 5.46, p=0.035. CONCLUSION: Most often, UI first appeared during pregnancy and remained through the postpartum period. Urinary incontinence during pregnancy, multiparity, gestational age at birth greater or equal to 37 weeks, and constipation were presented as risk factors. In the studied group, stress UI was more frequent.
Salvatore, S; Serati, M; Laterza, R; Uccella, S; Torella, M; Bolis, P-F
2009-12-01
To evaluate the prevalence of urinary stress incontinence (USI) in menstruating women practising recreational sports activity, to detect specific sports with a stronger association with urinary incontinence (UI) and to evaluate risk factors possibly related to this condition. Epidemiological study. Non-competitive sports organisations in the province of Varese, Italy. 679 women of fertile age, practising recreational sports activity. Anonymous questionnaire on UI. The questionnaire included questions about patients' general characteristics, occurrence of UI in relation to sport or daily general activities, time of onset of this condition, frequency of leakage episodes, correlation of incontinence with types of movements or sports, subjective impression of being limited on such occasions and/or necessity to modify the type of sport. UI was reported by 101 women (14.9%). Of these, 32 (31.7%) complained of UI only during sports activity, 48 (47.5%) only during daily life and 21 (20.8%) in both circumstances. Body mass index and parity were significantly associated with the risk of UI. Looking at the different sports activities, a higher rate of incontinence was found in women participating in basketball (16.6%), athletics (15%), and tennis or squash (11%). 10.4% of women abandoned their favourite sport, because of USI, and a further 20% limited the way they practised their favourite sport to reduce leakage episodes. Female UI affects a significant proportion of young women practising non-competitive sports activity; it can cause abandonment of the sport or limitation of its practice.
Aller, R; de Luis, D A; Izaola, O; de la Fuente, B; Bachiller, R
2014-01-01
Hyperaminotransferasemia is an important problem in obese patients. We decide to examine the changes in hyperaminotransferasemia after weight reduction in obese patients with and without NAFLD secondary to a high monounsaturated fat vs. a high polyunsaturated fat hypocaloric diets. A population of 306 obese patients was randomly allocated to two groups: Diet M (high monounsaturated fat hypocaloric diet) and Diet P (high polyunsaturated fat hypocaloric diet). Patients were classified as group I (obese subjects; n=262) when serum ALT activity was normal or group II (NAFLD patients; n=44) when serum ALT activity was (≥ 43 UI/L). In NAFLD group with diet M, BMI, weight, fat mass, waist circumference, systolic blood pressure, total cholesterol, LDL cholesterol), insulin and HOMA-R decreased. In NAFLD group with diet P, BMI, weight, fat mass, waist circumference, systolic blood pressure, total cholesterol, LDL cholesterol), insulin and HOMA-R decreased, too. In NAFLD group, alanine aminotransferase [(diet M) -20.3±19.2 UI/L vs. (diet P) -14.2±20.1 UI/L], aspartate aminotransferase [(diet M) -11.3±12.2 UI/L vs. (diet P) -11.1±10.1 UI/L], and gammaglutamyl transferase [(diet M) -18.1±12.2 UI/L vs. (diet P) -10.9±20.1 UI/L] improved with both diets. We showed that weight reduction secondary to two hypocaloric diets was associated with improvement in hypertransaminasemia and insulin resistance in NAFLD patients.
Directory of Open Access Journals (Sweden)
L. Skaal
2011-01-01
Full Text Available Background: Urinary incontinence (UI is a common problem among females and has been associated with significant decreased quality of life. Few women seek help for this condition with only a few who consult physiotherapy treatment.Purpose: To determine the prevalence of urinary incontinence and its impact on quality of life among the university women in South Africa.Method: A quantitative cross-sectional study design with 145 women ran-domly selected from the university. A questionnaire was used to determine UI Diagnosis; Impact on Qol and treatment seeking tendencies. BMI was meas-ured objectively. ethical clearance was obtained from University. Data was analysed using SPSS 17.0Results: Forty six(32% women reported to having UI. Risk factors associated with UI included age, race, and obesity. UI had a significant negative impact on quality of life and only 4.4% of participants with UI consulted physio-therapy for this condition.Conclusion: There is a high prevalence of UI among the women at this university with a significant impact on quality of life.The role of Physiotherapy in management of UI has been demonstrated and there is therefore a need to empower women with non-invasive treatment options, like physiotherapy.
High-power Magnetotherapy: A New Weapon in Urinary Incontinence?
Vadalà, Maria; Palmieri, Beniamino; Malagoli, Andrea; Laurino, Carmen
2017-06-18
Urinary incontinence (UI) is one of the most common urinary system diseases that mostly affects women but also men. We evaluated the therapeutic efficacy of functional magnetic stimulation (FMS) as potential UI treatment with improvements in the pelvic floor musculature, urodynamic tests and quality of life. A total of 20 UI patients (10 females and 10 men, mean age 64, 14 years), including 10 with stress UI, four with urgency UI and six with mixed UI, were treated with FMS (20 min/session) twice a week for 3 weeks. The patients' impressions, records in urinary diaries, and scores of three life stress questionnaires (overactive bladder symptom questionnaire [OAB-q], urogenital distress inventory questionnaire-short form [UDI-6], incontinence impact questionnaire-short form [IIQ-7]) were performed pre- and post-treatment. Significant reductions (P < 0.01) of micturition number and nocturia after magnetic treatment were evidenced. The urodynamic tests recorded a significant increase in cystometric capacity (147 ± 51.3%), in maximum urethral closure pressure (110 ± 34%), in urethral functional length (99.8 ± 51.8%), and in pressure transmission ratio (147 ± 51.3%) values compared with the baseline values. These preliminary findings suggest that FMS with Magneto STYM (twice weekly for 3 weeks) improves the UI and may be an effective treatment for this urogenital disease. © 2017 John Wiley & Sons Australia, Ltd.
Do Thyroxine and Thyroid-Stimulating Hormone Levels Reflect Urinary Iodine Concentrations?
Soldin, Offie P.; Tractenberg, Rochelle E.; Pezzullo, John C.
2013-01-01
The toxicity of environmental chemicals such as nitrates, thiocynates, and perchlorates, some therapeutics, and dietary goitrogens can lower thyroidal iodine uptake and result in hypothyroidism and goiter. Iodine sufficiency, essential for normal thyroid hormone synthesis, is critical during gestation to assure that sufficient thyroxine (T4) and iodine reach the developing fetus. Spot urinary iodide (UI) measurements are used globally to indicate and monitor iodine sufficiency of populations. In individuals, however, UI are not routinely measured; instead, normal serum thyroid-stimulating hormone (TSH) and T4 concentrations serve as surrogate indicators of iodine sufficiency as well as thyroidal health. Our objective was to examine the relationship between UI concentrations and serum T4 and TSH concentrations in individuals in an ‘‘iodine-sufficient population.’’ Using a cross-sectional sample of the US population (n = 7628) from the National Health and Nutrition Examination Survey (NHANES III; 1988–1994) database, we examined the relationship among UI, T4, and TSH in pregnant and nonpregnant women and in men (15–44 years). There was a lack of relationship between UI (or UI/Cr) concentrations and serum T4 or TSH concentrations. Therefore, TSH and T4 are not appropriate markers of UI concentrations in this population. Monitoring the status of iodine nutrition of individuals in the United States may be important because serum TSH and T4 concentrations do not indicate low iodine status. PMID:15795649
Extended unemployment and UI benefits
Robert G. Valletta; Katherine Kuang
2010-01-01
During the current labor market downturn, unemployment duration has reached levels well above its previous highs. Analysis of unemployment data suggests that extended unemployment insurance benefits have not been important factors in the increase in the duration of unemployment or in the elevated unemployment rate.
Libby, Alex
2012-01-01
A practical tutorial with powerful yet simple projects that are quick to implement. This book is aimed at developers who have prior jQuery knowledge, but may not have any prior experience with jQuery Tools. It is possible that they may have started with the basics of jQuery Tools, but want to learn more about how it can be used, as well as get ideas for future projects.
Portraying User Interface History
DEFF Research Database (Denmark)
Jørgensen, Anker Helms
2008-01-01
history. Next the paper analyses a selected sample of papers on UI history at large. The analysis shows that the current state-of-art is featured by three aspects: Firstly internalism, in that the papers adress the technologies in their own right with little contextualization, secondly whiggism...... in that they largely address prevailing UI technologies, and thirdly history from above in that they focus on the great deeds of the visionaries. The paper then compares this state-of-art in UI history to the much more mature fields history of computing and history of technology. Based hereon, some speculations......The user interface is coming of age. Papers adressing UI history have appeared in fair amounts in the last 25 years. Most of them address particular aspects such as an innovative interface paradigm or the contribution of a visionary or a research lab. Contrasting this, papers addressing UI...
Coupled diffusion systems with localized nonlinear reactions
DEFF Research Database (Denmark)
Pedersen, M.; Lin, Zhigui
2001-01-01
This paper deals with the blowup rate and profile near the blowup time for the system of diffusion equations uit - δui = ui+1Pi(x0, t), (i = 1,...,k, uk+1 := uu) in Ω × (0, T) with boundary conditions ui = 0 on ∂Ω × [0, T). We show that the solution has a global blowup. The exact rate...
Micro adénome à prolactine à l'âge de la ménopause | Barka | Pan ...
African Journals Online (AJOL)
L'examen physique confirme la galactorrhée et la biologie montre une hyperprolactinémie à 2735 mUI /L, FSH = 15,1 UI/L et LH = 4,1UI/L. L'IRM hypophysaire montre un adénome gauche de 8mm. L'évolution sous traitement dopaminergique était marqué par la reprise transitoire des cycles et apparition de bouffées de ...
Kim, Dennis; Kobayashi, Leslie; Chang, David; Fortlage, Dale; Coimbra, Raul
2014-01-01
The development of respiratory failure requiring an emergent unplanned intubation (UI) is a potentially preventable complication associated with increased morbidity and mortality. The objective of this study was to develop a clinical risk index for UI based on readily available clinical data to assist in the identification of trauma patients at risk for this complication. We also sought to determine the impact of UI on patient outcomes. This is a 3-year retrospective analysis of our Level 1 trauma center registry to identify all patients requiring a UI. Patients who required a UI were compared with patients who were never intubated. An additive risk index consisting of 10 clinical variables was created using the final significant variables from a stepwise logistic regression model. The sensitivity and specificity of every possible index score were calculated and added together to calculate the "gain in certainty" values. During the 3-year period, 7,552 patients were admitted, of whom 967 (12.8%) required intubation. Of these, 55 (5.7%) underwent a UI. The final risk index consisted of 10 variables as follows: age 55 years to 64 years, age 65 years or older, male sex, Glasgow Coma Scale (GCS) score of 9 to 13, seizures, chronic obstructive pulmonary disease, traumatic brain injury, four or more rib fractures, spine fractures, and long-bone fractures. Gain in certainty was maximized at an index score of 4, with the highest combined sensitivity and specificity of 86.0% and 74.9%, respectively. The probability of UI increased from 0.9% at a score of 1 to 2.9% at 4 and 43% at 9. UI was associated with increased overall complications, length of stay, and mortality (p the development of an additive risk index. Prospective validation of the risk index is potentially warranted. Diagnostic study, level III.
Nocturia and associated morbidity in a Danish population of men and women aged 60-80 years
DEFF Research Database (Denmark)
Bing, M.H.; Moller, L.A.; Jennum, P.
2008-01-01
OBJECTIVE To evaluate the association between nocturia and medical diseases, medication, urinary incontinence (UI), recurrent cystitis, smoking, alcohol, parity, hysterectomy, pelvic organ prolapse surgery, UI surgery. and prostate surgery. SUBJECTS AND METHODS The previously validated questionna......OBJECTIVE To evaluate the association between nocturia and medical diseases, medication, urinary incontinence (UI), recurrent cystitis, smoking, alcohol, parity, hysterectomy, pelvic organ prolapse surgery, UI surgery. and prostate surgery. SUBJECTS AND METHODS The previously validated...... associated with nocturia irrespective of severity. Nocturia of >= 1 voids was significantly associated with body mass index (BMI), hypertension, and smoking; and nocturia of >= 2 voids with gender, l diabetes and recurrent cystitis, as well as between nocturia of >= 3 voids and gender, lung disease, diabetes...
International Nuclear Information System (INIS)
Barbosa, Michelle C.; Messmer, Nigel R.; Brazil, Tayra R.; Marciano, Fernanda R.; Lobo, Anderson O.
2013-01-01
Nanohydroxyapatite (nHAp) powders were produced via aqueous precipitation by adopting four different experimental conditions, assisted or non-assisted by ultrasound irradiation (UI). The nHAp powders were characterized by X-ray diffraction, energy-dispersive X-ray fluorescence, Raman and attenuated total reflection Fourier transform infrared spectroscopies, which showed typical surface chemical compositions of nHAp. Analysis found strong connections between UI and the crystallization process, crystal growth properties, as well as correlations between calcination and substitution reactions. - Highlights: ► Nanohydroxyapatite powders were produced via aqueous precipitation. ► Three methodologies were compared, such as: dropwise, mixture and ultrasound irradiation (UI). ► Analysis found strong connections between UI and the crystallization process
Energy Technology Data Exchange (ETDEWEB)
Barbosa, Michelle C.; Messmer, Nigel R.; Brazil, Tayra R.; Marciano, Fernanda R.; Lobo, Anderson O., E-mail: loboao@yahoo.com
2013-07-01
Nanohydroxyapatite (nHAp) powders were produced via aqueous precipitation by adopting four different experimental conditions, assisted or non-assisted by ultrasound irradiation (UI). The nHAp powders were characterized by X-ray diffraction, energy-dispersive X-ray fluorescence, Raman and attenuated total reflection Fourier transform infrared spectroscopies, which showed typical surface chemical compositions of nHAp. Analysis found strong connections between UI and the crystallization process, crystal growth properties, as well as correlations between calcination and substitution reactions. - Highlights: ► Nanohydroxyapatite powders were produced via aqueous precipitation. ► Three methodologies were compared, such as: dropwise, mixture and ultrasound irradiation (UI). ► Analysis found strong connections between UI and the crystallization process.
Urinary incontinence and weight change during pregnancy and postpartum: a cohort study.
Wesnes, Stian Langeland; Hunskaar, Steinar; Bo, Kari; Rortveit, Guri
2010-11-01
Weight gain during pregnancy may contribute to increased urinary incontinence (UI) during and after pregnancy, but scientific support is lacking. The effect of weight loss on UI postpartum is unclear. From 1999 to 2006, investigators in the Norwegian Mother and Child Cohort Study recruited pregnant women during pregnancy. This study was based on 12,679 primiparous women who were continent before pregnancy. Data were obtained from questionnaires answered at weeks 15 and 30 of pregnancy and 6 months postpartum. Weight gain greater than the 50th percentile during weeks 0-15 of pregnancy was weakly associated with higher incidence of UI at week 30 compared with weight gain less than or equal to the 50th percentile. Weight gain greater than the 50th percentile during pregnancy was not associated with increased prevalence of UI 6 months postpartum. For each kilogram of weight loss from delivery to 6 months postpartum among women who were incontinent during pregnancy, the relative risk for UI decreased 2.1% (relative risk = 0.98, 95% confidence interval: 0.97, 0.99). Weight gain during pregnancy does not seem to be a risk factor for increased incidence or prevalence of UI during pregnancy or postpartum. However, weight loss postpartum may be important for avoiding incontinence and regaining continence 6 months postpartum.
Simultaneous Mean and Covariance Correction Filter for Orbit Estimation.
Wang, Xiaoxu; Pan, Quan; Ding, Zhengtao; Ma, Zhengya
2018-05-05
This paper proposes a novel filtering design, from a viewpoint of identification instead of the conventional nonlinear estimation schemes (NESs), to improve the performance of orbit state estimation for a space target. First, a nonlinear perturbation is viewed or modeled as an unknown input (UI) coupled with the orbit state, to avoid the intractable nonlinear perturbation integral (INPI) required by NESs. Then, a simultaneous mean and covariance correction filter (SMCCF), based on a two-stage expectation maximization (EM) framework, is proposed to simply and analytically fit or identify the first two moments (FTM) of the perturbation (viewed as UI), instead of directly computing such the INPI in NESs. Orbit estimation performance is greatly improved by utilizing the fit UI-FTM to simultaneously correct the state estimation and its covariance. Third, depending on whether enough information is mined, SMCCF should outperform existing NESs or the standard identification algorithms (which view the UI as a constant independent of the state and only utilize the identified UI-mean to correct the state estimation, regardless of its covariance), since it further incorporates the useful covariance information in addition to the mean of the UI. Finally, our simulations demonstrate the superior performance of SMCCF via an orbit estimation example.
El-Azab, Ahmed S; Shaaban, Omar M
2010-01-27
Existing questionnaires to assess barriers against consultation for urinary incontinence (UI) are not appropriate for use in the Middle East culture. The aim of this study was to explore barriers against seeking help for UI and introducing a questionnaire that assess these barriers among those women. This is important before proceeding to any educational programs or having interval clinical audits to help incontinent women. 1- Screening for UI. Women - aged 20 years and older, attending the outpatient Urology and Gynaecology clinics were invited to participate and interviewed by a research nurse. The UDI-6 was administered to assess the presence and type of UI. Women with UI as their chief complaint were excluded. 2- Interviewing study subjects for possible barriers. Subjects who had UI - as determined by the UDI-6-were first asked an open question "what prevented you from seeking medical consultation for urine leakage?"." They were then asked the proposed questions to assess possible barriers. We developed a preliminary questionnaire based on a review of reasons for not seeking incontinence care from the literature and the response of UI sufferers to the open question in this study. The questionnaire was modified many times to reach this final form. 3- Pilot Study to assess characteristics of the questionnaire. Validity and reliability of the final version of the questionnaire were assessed in a small pilot study including 36 women who completed questionnaire at initial visit and again after 2 weeks. Of the 1231 subjects who agreed to participate in the study, 348 reported having UI. About 80% of incontinent women have never sought medical advice. Factors significantly associated with seeking help were husband encouragement, prayer affection and having severe UI. Common barriers were embarrassment and assuming UI as a normal part of aging. A pilot study included 36 women to assess the psychometric properties of the questionnaire after modifying it. The number of
"東, 恒人"; "ヒガシ, ツネヒト"; Tsunehito", "Higashi
1991-01-01
"Through sense organs, we detect various perception information with or without will. These information have two characteristics, that is, logical information, LI, have characteristics of transmitting various meanings and unlogical information, UI, have characteristics of causing various emotion. There are LI process, UI process, and compound process of LI and UI in information process. But it is not clear how these information are processed and by what model each process is represented. In t...
Effect of Rad 51 overexpression on chromosomal stability and radiation sensitivity in tumour cells
International Nuclear Information System (INIS)
Jend, C.; Stuerzbecher, H.W.; Dikomey, E.; Borgmann, K.
2004-01-01
The present study was dedicated to examining the effects of Rad51 overexpression on genomic instability, expressed in terms of chromosomal aberrations in G1 and G2 phases following X-ray irradiation. For this purpose an osteosarcoma cell line (Ui-OS) which shows inducing Rad51 overexpression (UiRad5-2) after stable transfection was compared with an isogenetic line (UiLacZ) which overexpresses beta-galactosidase instead of Rad51 [de
Zhu, Lan; Li, L; Lang, Jing-he; Xu, T
2012-05-01
We sought to characterize risk factors of urinary incontinence (UI) during pregnancy and the postpartum period in primiparous women in China. We enrolled 10,098 women from the seven regions of China ≥28 weeks' gestation from September 2007 to May 2009 and administered the Bristol Female Lower Urinary Tract Symptoms questionnaire to estimate the presence of different types of UI during late pregnancy (37 to 42 weeks' gestation) and at 6 weeks and 6 months postpartum. We also collected details of pregnancy and childbirth and demographic data. McNemar's test, multinomial logistic regression models, and binary logistic regression models were used. Multivariable analysis revealed six independent risk factors for SUI: age, more frequent exercise, alcohol consumption, higher body mass index, larger waist circumference, and history of constipation. For those with no UI in late pregnancy, 3.7% and 3.0% developed new cases at 6 weeks and 6 months postpartum, respectively. Risk factors for UI at 6 months were frequent exercise, rural residence, perineal laceration, and lateral episiotomy. Prevalence of all UI was 26.7% in late pregnancy, 9.5% at 6 weeks postpartum, and 6.8% at 6 months postpartum. Most cases were stress urinary incontinence (18.6%, 6.9%, and 5.0%, at the respectively times). Rates of UI in primiparous women in China are consistent with those reported elsewhere. Rural location, frequent exercise, and birth-related injuries are risk factors for UI at 6 months postpartum.
Directory of Open Access Journals (Sweden)
AGRIPINA SAPCALIU
2007-10-01
Full Text Available Although biochemical analyses of the blood were and are still used for the routinediagnosis and especially for the metabolic survey in farm animals, such analyses, maybe applied for the honeybee hemolymph (as a paraclinic examination. The aim of thisexperimental study was to investigate and to determine the reference values of themain biochemical parameters in the hemolymph of the healthy honeybees of Apismellifera carpathica. The honeybee samples were collected in order to analyze thehealth condition of the respective colony. All the samples coming from sick colonieswere removed, only healthy adult honeybees coming from strong colonies were keptand used for hemolymph collection. By special methods, samples of hemolymph (300μl/sample collected from about 50 individuals, were analyzed both during the activeseason (spring/summer and the inactive season (autumn/winter. The study wascarried out on 50 samples of undiluted hemolymph taken from a total number of about2,500 honeybees. The following 21 biochemical parameters were analyzed: GLU(mg/dl, HDL-c (mg/dl, ALP (UI/l, T-cho (mg/dl, Tprot (mg/dl, Alb. (g/dl, BUN(mg/dl, LDH (UI/l, CPK (UI/l, Mg (mg/dl, FRA (μm/l, IP (mg/dl, GGT (UI/l,GOT (UI/l, GPT (UI/l, Ca (mg/dl, Cre (mg/dl, Amy (UI/l, T–BIL (mg/dl, TG(mg/dl, UA (mg/dl. The test was carried out after the collection and processing of thesamples using the SPOTCHEM EZSP4430, equipment with dry kits, the slides technique,respectively.
Directory of Open Access Journals (Sweden)
Bo Ae Lee
2017-12-01
Full Text Available Purpose Pelvic floor muscle exercise (PFME is a therapeutic option for urinary incontinence (UI. However, studies of the efficacy of PFME on UI in patients with cognitive impairment (CI are lacking. Therefore, we evaluated the effect of PFME on UI in elderly women with mild CI. Methods A total of 150 women with mild CI or Alzheimer disease and UI were screened using the International Consultation on Incontinence Questionnaire-Short Form (ICIQ-SF. Cognitive function and behavioral symptoms were evaluated by the Mini-Mental State Examination and Barthel’s Activities of Daily Living. The patients were randomly divided into a control group (n=46 and a PFME group (n=52, 6 sessions of PFME for 12 weeks. The primary outcome was the change in UI episodes measured with a frequency volume chart (FVC. The secondary outcomes were other FVC parameters and the ICIQ-SF scores. Results A total of 82 women (control group: 40 and PFME group: 42 completed the study. After 12 weeks of PFME, the mean number of UI episodes per 24 hours decreased by 1.6 (from 3.3 to 1.7 in the PFME group and by 0.5 (from 3.4 to 2.9 in the control group (P<0.001 between groups. The mean number of micturition episodes and total ICIQ-SF scores improved in the PFME group to a significantly greater extent than in the control group (P<0.001. Conclusions Supervised PFME can be a good therapeutic option for improving UI in elderly women with CI.
Bourne, Rupert R A; Flaxman, Seth R; Braithwaite, Tasanee; Cicinelli, Maria V; Das, Aditi; Jonas, Jost B; Keeffe, Jill; Kempen, John H; Leasher, Janet; Limburg, Hans; Naidoo, Kovin; Pesudovs, Konrad; Resnikoff, Serge; Silvester, Alex; Stevens, Gretchen A; Tahhan, Nina; Wong, Tien Y; Taylor, Hugh R
2017-09-01
Global and regional prevalence estimates for blindness and vision impairment are important for the development of public health policies. We aimed to provide global estimates, trends, and projections of global blindness and vision impairment. We did a systematic review and meta-analysis of population-based datasets relevant to global vision impairment and blindness that were published between 1980 and 2015. We fitted hierarchical models to estimate the prevalence (by age, country, and sex), in 2015, of mild visual impairment (presenting visual acuity worse than 6/12 to 6/18 inclusive), moderate to severe visual impairment (presenting visual acuity worse than 6/18 to 3/60 inclusive), blindness (presenting visual acuity worse than 3/60), and functional presbyopia (defined as presenting near vision worse than N6 or N8 at 40 cm when best-corrected distance visual acuity was better than 6/12). Globally, of the 7·33 billion people alive in 2015, an estimated 36·0 million (80% uncertainty interval [UI] 12·9-65·4) were blind (crude prevalence 0·48%; 80% UI 0·17-0·87; 56% female), 216·6 million (80% UI 98·5-359·1) people had moderate to severe visual impairment (2·95%, 80% UI 1·34-4·89; 55% female), and 188·5 million (80% UI 64·5-350·2) had mild visual impairment (2·57%, 80% UI 0·88-4·77; 54% female). Functional presbyopia affected an estimated 1094·7 million (80% UI 581·1-1686·5) people aged 35 years and older, with 666·7 million (80% UI 364·9-997·6) being aged 50 years or older. The estimated number of blind people increased by 17·6%, from 30·6 million (80% UI 9·9-57·3) in 1990 to 36·0 million (80% UI 12·9-65·4) in 2015. This change was attributable to three factors, namely an increase because of population growth (38·4%), population ageing after accounting for population growth (34·6%), and reduction in age-specific prevalence (-36·7%). The number of people with moderate and severe visual impairment also increased, from 159·9 million
Dietary Macronutrient and Energy Intake and Urinary Incontinence in Women
Maserejian, Nancy N.; Giovannucci, Edward L.; McVary, Kevin T.; McGrother, Catherine; McKinlay, John B.
2010-01-01
Weight loss involving diet modification improves urinary incontinence (UI) in women, but little is known about dietary correlates of UI. The authors examined intakes of total energy, carbohydrate, protein, and fats in relation to UI in a cross-sectional sample of 2,060 women in the population-based Boston Area Community Health Survey (2002–2005). Data were collected from in-person home interviews and food frequency questionnaires. Logistic regression was used to calculate odds ratios and 95% ...
Specific obstetrical risk factors for urinary versus anal incontinence 4years after first delivery.
Fritel , Xavier; Khoshnood , Babak; Fauconnier , Arnaud
2013-01-01
International audience; AIM: Delivery can be complicated by urinary or anal incontinence (UI or AI). We hypothesized that the mechanisms of injury may differ for UI and AI. Hence, obstetrical risk factors may be specific for different types of incontinence. DESIGN: Data on maternal characteristics were collected at first delivery. Data on incontinence were obtained by a questionnaire completed by 627 women 4years after first delivery. UI was defined by "Do you have involuntary loss of urine" ...
Risk factors for postpartum urinary incontinence
Lígia da Silva Leroy; Adélia Lúcio; Maria Helena Baena de Moraes Lopes
2016-01-01
Abstract OBJECTIVE: To investigate the risk factors for postpartum urinary incontinence (UI) and its characteristics. METHOD: This was a case-control study with 344 puerperal women (77 cases and 267 controls) with up to 90 days postpartum. In a single session, participants were given a questionnaire with sociodemographic and clinical data and two others that assessed urine leakage, leakage situations, and type of UI. RESULTS: Stress UI was present in 45.5% of the women, incidents of urine...
International Nuclear Information System (INIS)
Zedgenidze, G.A.; Narkevich, K.Ya.
1987-01-01
To substantiate the expediency of choosing either vizualization method, a comparative analysis of advantages and disadvantages of roentgen computerized tomography (CT) and ultrasonic investigation (UI) has been performed. Conditions of using CT and UI in developing countries emphasising on organizational and technical and esepecially clinical-diagnostic aspects of this problem have been analysed as well. A manual on clinical indications and correct CT and UI use from the point of view of methodology has been compiled
Should Unemployment Insurance Vary with the Unemployment Rate? Theory and Evidence
Kroft, Kory; Notowidigdo, Matthew J.
2012-01-01
We study how optimal unemployment insurance (UI) benefits vary over the business cycle by estimating how the moral hazard cost and the consumption smoothing benefit of UI vary with the unemployment rate. We find that the moral hazard cost is procyclical, greater when the unemployment rate is relatively low. By contrast, our evidence suggests that the consumption smoothing benefit of UI is acyclical. Using these estimates to calibrate our job search model, we find that a one standard deviation...
Evaluating the Usability of Pinchigator, a system for Navigating Virtual Worlds using Pinch Gloves
Hamilton, George S.; Brookman, Stephen; Dumas, Joseph D. II; Tilghman, Neal
2003-01-01
Appropriate design of two dimensional user interfaces (2D U/I) utilizing the well known WIMP (Window, Icon, Menu, Pointing device) environment for computer software is well studied and guidance can be found in several standards. Three-dimensional U/I design is not nearly so mature as 2D U/I, and standards bodies have not reached consensus on what makes a usable interface. This is especially true when the tools for interacting with the virtual environment may include stereo viewing, real time trackers and pinch gloves instead of just a mouse & keyboard. Over the last several years the authors have created a 3D U/I system dubbed Pinchigator for navigating virtual worlds based on the dVise dV/Mockup visualization software, Fakespace Pinch Gloves and Pohlemus trackers. The current work is to test the usability of the system on several virtual worlds, suggest improvements to increase Pinchigator s usability, and then to generalize about what was learned and how those lessons might be applied to improve other 3D U/I systems.
User Interface Framework for the National Ignition Facility (NIF)
International Nuclear Information System (INIS)
Fisher, J M; Bowers, G A; Carey, R W; Daveler, S A; Herndon Ford, K B; Ho, J C; Lagin, L J; Lambert, C J; Mauvais, J; Stout, E A; West, S L
2007-01-01
A user interface (UI) framework supports the development of user interfaces to operate the National Ignition Facility (NIF) using the Integrated Computer Control System (ICCS). [1] This framework simplifies UI development and ensures consistency for NIF operators. A comprehensive, layered collection of UIs in ICCS provides interaction with system-level processes, shot automation, and subsystem-specific devices. All user interfaces are written in Java, employing CORBA to interact with other ICCS components. ICCS developers use these frameworks to compose two major types of user interfaces: broadviews and control panels. Broadviews provide a visual representation of the NIF beamlines through interactive schematic drawings. Control panels provide status and control at a device level. The UI framework includes a suite of display components to standardize user interaction through data entry behaviors, common connection and threading mechanisms, and a common appearance. With these components, ICCS developers can more efficiently address usability issues in the facility when needed. The ICCS UI framework helps developers create consistent and easy-to-understand user interfaces for NIF operators
Directory of Open Access Journals (Sweden)
Enav Z. Zusman MSc
2017-05-01
Full Text Available Objective: To test the effect of a follow-up clinic on urinary incontinence (UI and nocturia among older adults with hip fracture. Method: Fifty-three older adults (≥65 years 3 to 12 months following hip fracture were enrolled and randomized to receive usual care plus the intervention (B4, or usual care (UC only. The B4 group received management by health professionals, with need-based referrals. UI, nocturia, and quality of life were measured with questionnaires at baseline, 6 months, and 12 months. Results: There were 48 participants included in this analysis, and at baseline, 44% of study participants self-reported UI. At final assessment, six out of 24 B4 participants and 12 out of 24 UC participants reported UI. Four out of five study participants reported nocturia at baseline; this did not decrease during the study. Discussion : Following hip fracture, many older adults report UI and most report nocturia. Health professionals should be aware of the high occurrence of urinary symptoms among older adults post hip fracture.
Prevalence and risk factors for urinary and fecal incontinence in brazilian women
Directory of Open Access Journals (Sweden)
Joao L. Amaro
2009-10-01
Full Text Available Objective: To evaluate prevalence and risk factors of fecal and urinary incontinence (UI in Brazilian women. Material and Methods: 685 women older than 20 years of age answered a questionnaire about urinary and fecal symptoms, clinical and obstetric antecedents. They were grouped according to presence or absence of UI. Results: Urinary and fecal incontinence was reported in 27% and 2% of cases, respectively. Mean age of incontinent women was significantly higher than continent ones. Incontinent women had a mean number of micturitions significantly higher than the continent ones. On average, incontinent women had higher rate of pregnancies and vaginal delivery when compared to the continent ones. Body mass index (BMI was significantly higher in incontinent participants and in women with no UI complaints (27.35 vs. 24.95, p < 0.05. Fecal incontinence prevalence was 2% and occurred exclusively in patients with UI. Conclusions: Vaginal delivery and high BMI have been identified as risk factors for UI development while aging and number of pregnancies may be correlated factors.
Immobilization of silver nanoparticles in Zr-based MOFs: induction of apoptosis in cancer cells
Han, Congcong; Yang, Jian; Gu, Jinlou
2018-03-01
Silver nanoparticles (AgNPs) are a potential class of nanomaterial for antibiosis and chemotherapeutic effects against human carcinoma cells. However, the DNA-damaging ability of free AgNPs pose the critical issues in their biomedical applications. Herein, we demonstrated a facile method to capture Ag+ ions and reduce them into active AgNPs within Zr-based metal-organic frameworks (MOFs) of UiO-66 with a mild reductant of DMF (AgNPs@UiO-66(DMF)). The average diameters of UiO-66 carriers and AgNPs were facilely controlled to be 140 and 10 nm, respectively. The obtained UiO-66 nanocarriers exhibited excellent biocompatibility and could be effectively endocytosed by cancer cells. Additionally, the AgNPs@UiO-66(DMF) could rapidly release Ag+ ions and efficiently inhibit the growth of cancer cells. The half maximal inhibitory concentration (IC50) values of the encapsulated AgNPs were calculated to be 2.7 and 2.45 μg mL-1 for SMMC-7721 and HeLa cells, respectively, which were much lower than those of free AgNPs in the reported works. Therefore, the developed AgNPs@UiO-66(DMF) not only maintained the therapeutic effect against cancer cells but also reduced the dosage of free AgNPs in chemotherapy treatment. [Figure not available: see fulltext.
Xu, Dongjuan; Liu, Nana; Qu, Haili; Chen, Liqin; Wang, Kefang
2016-01-01
To investigate the relationships among symptom severity, coping styles, and quality of life (QOL) in community-dwelling women with urinary incontinence (UI). A total of 592 women with UI participated in this cross-sectional study. Bivariate Pearson's correlation was used to examine the correlations between symptom severity, coping styles, and QOL. Multivariate regression models and Sobel tests were used to test the mediating effect of coping styles. Additionally, a multiple mediator model was used to examine the mediating role of coping styles collectively. All regression models were adjusted for age, education, marital status, income, duration of UI, and type of UI. Participants tended to use avoidant and palliative coping styles and not use instrumental coping style. Avoidant and palliative coping styles were associated with poor QOL, and partially mediated the association between symptom severity and QOL. Nearly 73% of the adverse effect of symptom severity on QOL was mediated by avoidant and palliative coping styles. The use of avoidant and palliative coping styles was higher with more severe urine leakage, and QOL tended to be poorer. Coping styles should be addressed in UI management. It may be of particular value to look closely at negative coping styles and implement education and training of patients in improving their coping skills related to managing UI, which will in turn improve their QOL.
Park, Sunah; Yeoum, SoonGyo; Kim, Yoonjung; Kwon, Hye Jin
The purpose of this study was to explore the self-management experiences of Korean women with urinary incontinence (UI). Descriptive, qualitative study using focus groups. Twenty-two community-dwelling women, 65 years and older, participated in 3 focus-group interviews. Participants were recruited from 2 elderly halls and 1 senior welfare center in South Korea. Three focus group interviews comprising 6 to 8 individuals were conducted in a quiet venue at the elderly hall or senior welfare center. Two investigators performed the interviews; one acted as moderator and one as notetaker; interviews began with scripted open-ended questions. All interviews were electronically recorded and transcribed verbatim. Using an inductive thematic approach, data were first analyzed by the first and second authors; and all 4 authors contributed to coding and agreed on final themes. Korean women perceived UI as a loss of dignity, an odor problem, an uncontrollable disease, and a life impairment. Thematic analysis revealed 4 themes regarding the self-management experience of UI: preserving self-respect in the sociocultural environment, deodorizing the smell, keeping the secret of uncontrollability, and adjusting to an impaired life. Women in this study used various daily-living strategies to manage UI, but they mainly implemented strategies to keep UI a secret, including restrictions in activities of daily living. Educational approaches are needed to inform women with UI about more effective management skills.
Huovinen, Ville; Viljakainen, Heli; Hakkarainen, Antti; Saukkonen, Tero; Toiviainen-Salo, Sanna; Lundbom, Nina; Lundbom, Jesper; Mäkitie, Outi
2015-11-01
Obesity increases bone marrow fat (BMF) content. The association between early obesity and bone marrow fatty acid composition is unknown. We measured BMF unsaturation index (UI) in normal-weight and overweight young adults with a known weight status in early childhood and tested the relationship between BMF UI and exercise history, glycemic state, and other clinical characteristics. The study included 18 normal-weight (BMI young adults aged 15-27 years. BMF UI was assessed with magnetic resonance proton spectroscopy optimized to reduce water interference. Exercise information was obtained with a pedometer accompanied with the history of recent physical activity. Blood samples (insulin, glucose, HbA1c) and body characteristics (BMI, waist-to-hip ratio, body fat composition) were assessed. BMF UI was not affected by obesity at the time of study or before age 7 years. BMF UI increased with age in normal-weight and overweight subjects (R=0.408, p=0.015) but did not associate with gender, physical activity or body fat composition; a suggestive association was observed with glucose (R=-0.289, p=0.10). The association of BMF UI with age in early adulthood may represent normal maturation of bone marrow. There was a trend toward an association with blood glucose, warranting further studies. Copyright © 2015 Elsevier Inc. All rights reserved.
Prevalence and treatment of post partum urinary incontinence
Directory of Open Access Journals (Sweden)
Siv Mørkved
2009-10-01
Full Text Available SUMMARYChildbirth is often considered the main etiological factor in the development of female urinary incontinence(UI. For that reason women in the western countries have been encouraged to engage in post partumpelvic floor muscle (PFM exercise in order to strengthen the pelvic floor. However, the effect of post partumPFM exercise has been sparsely documented. The aim of this article is to review and discuss literaturerelated to prevalence of post partum UI and effect of post partum PFM exercise in the treatment of UI. Thereported prevalence of UI post partum varies from 0.7% to 44%. The variation may be explained bydifferent definitions of UI used in the questionnaires and that the registration of incontinence was done atdifferent intervals after delivery. A few studies have tried to evaluate the effect of post natal PFM exercise.Some have evaluated PFM strength, others the frequency of UI. PFM strength is difficult to measure andthe reliability and validity of the methods used is open to question. Another flaw in some of the previousstudies is the training protocol applied to improve PFM strength. Mørkved and Bø tried to take intoaccount the above mentioned methodological considerations, in a study aiming to evaluate the effect ofpost partum PFM exercise. The results demonstrate that post partum PFM exercise is effective instrengthening the PFM and in the treatment of UI. However, success of PFM exercise is dependent uponboth the training frequency and intensity. This requires a closer follow up of the post partum women, thanthe written information that usually serves this purpose at the present time.Key words : physiotherapy, pelvic floor muscles, urinary incontinence, post partum exercise, prevalence
Manso, M; Alexandre, B; Antunes-Lopes, T; Martins-da-Silva, C; Cruz, F
2018-05-01
Urinary incontinence (UI) is a complication of radical prostatectomy (RP) and transurethral resection of the prostate (TURP). The gold-standard treatment is the artificial urinary sphincter, however, new treatments have been investigated. To examine the outcome of an adjustable transobturator male system (ATOMS ® ) in men with UI after prostatic surgery in a low to medium volume continence center. Twenty-five men with UI were implanted with ATOMS ® system between 2012 and 2014. The most common indication was UI after RP (92%), followed by UI after TURP (8%). Eleven patients (44%) had received adjuvant external beam radiotherapy (RT). Patients were considered to be 'dry' if they stopped wearing pads or needed just one protective pad per day; and improved if the daily number of pads used decreased by at least half. The Incontinence Quality of Life questionnaire (ICIQ-SF) was used, adding a verbal question about the satisfaction of the patient considering the outcome. After a mean follow-up of 21.56 months, 64% were dry and 8% revealed a significant improvement. The success of the procedure was negatively correlated with the severity of the previous UI and with previous treatment with RT. Concerning patients satisfaction, 84% of the patients would repeat the procedure. ATOMS ® offers good rates of cure and improvement of UI after prostatic surgery with a reasonable rate of minor complications. The results of this study, performed in a low to medium volume continence center, are comparable to the results achieved in high volume continence centers. Copyright © 2017 AEU. Publicado por Elsevier España, S.L.U. All rights reserved.
Peñalvo, José L; Cudhea, Frederick; Micha, Renata; Rehm, Colin D; Afshin, Ashkan; Whitsel, Laurie; Wilde, Parke; Gaziano, Tom; Pearson-Stuttard, Jonathan; O'Flaherty, Martin; Capewell, Simon; Mozaffarian, Dariush
2017-11-27
Fiscal interventions are promising strategies to improve diets, reduce cardiovascular disease and diabetes (cardiometabolic diseases; CMD), and address health disparities. The aim of this study is to estimate the impact of specific dietary taxes and subsidies on CMD deaths and disparities in the US. Using nationally representative data, we used a comparative risk assessment to model the potential effects on total CMD deaths and disparities of price subsidies (10%, 30%) on fruits, vegetables, whole grains, and nuts/seeds and taxes (10%, 30%) on processed meat, unprocessed red meats, and sugar-sweetened beverages. We modeled two gradients of price-responsiveness by education, an indicator of socioeconomic status (SES), based on global price elasticities (18% greater price-responsiveness in low vs. high SES) and recent national experiences with taxes on sugar-sweetened beverages (65% greater price-responsiveness in low vs. high SES). Each price intervention would reduce CMD deaths. Overall, the largest proportional reductions were seen in stroke, followed by diabetes and coronary heart disease. Jointly altering prices of all seven dietary factors (10% each, with 18% greater price-responsiveness by SES) would prevent 23,174 (95% UI 22,024-24,595) CMD deaths/year, corresponding to 3.1% (95% UI 2.9-3.4) of CMD deaths among Americans with a lower than high school education, 3.6% (95% UI 3.3-3.8) among high school graduates/some college, and 2.9% (95% UI 2.7-3.5) among college graduates. Applying a 30% price change and larger price-responsiveness (65%) in low SES, the corresponding reductions were 10.9% (95% UI 9.2-10.8), 9.8% (95% UI 9.1-10.4), and 6.7% (95% UI 6.2-7.6). The latter scenario would reduce disparities in CMD between Americans with lower than high school versus a college education by 3.5 (95% UI 2.3-4.5) percentage points. Modest taxes and subsidies for key dietary factors could meaningfully reduce CMD and improve US disparities.
Bø, K; Pauck Øglund, G; Sletner, L; Mørkrid, K; Jenum, A K
2012-10-01
To investigate prevalence of urinary incontinence (UI) in a multi-ethnic population of pregnant women, and to analyse for possible associations of the known risk factors for UI in such a population. Population-based cross-sectional study. All pregnant women in three administrative city districts attending the Child Health Clinics. Out of 823 women identified in the [corrected] first trimester, 772 (94%) [corrected] agreed to participate in the study at 28 weeks of gestation. Inclusion criteria were: healthy women at 20 weeks of gestation or less and able to communicate in Norwegian, Arabic, English, Sorani, Somali, Tamil, Turkish, Urdu or Vietnamese. Differences between ethnic groups were tested by simple descriptive statistics. Associations were estimated by logistic regression analysis and presented as crude (cOR) and adjusted (aOR) odds ratios. Prevalence of UI as ascertained using the International Consultation on Incontinence Questionnaire-urinary incontinence-short form. Prevalence rates of UI at 28 weeks of gestation were 26% for women of African origin, 36% for women of Middle Eastern origin, 40% for women of East Asian origin, 43% for women of South Asian origin and 45% for women of European/North American origin. The difference was significant between women of African and European/North American origins (P = 0.011) and between women of African and South Asian origins (P = 0.035). Age (aOR 1.05; 95% CI 1.01-1.09) and parity (aOR 2.34; 95% CI 1.66-3.28) were positively associated with the prevalence of UI in pregnancy. Women of African origin had significantly reduced odds for UI (aOR 0.42; 95% CI 0.20-0.87). East Asian and African women reported the highest perceived impact of UI in pregnancy. A high prevalence of UI was found in a multi-ethnic pregnant population. © 2012 The Authors BJOG An International Journal of Obstetrics and Gynaecology © 2012 RCOG.
Predictors of urinary incontinence between abdominal obesity and non-obese male adults.
Li, Dongmei; Xu, Yi; Nie, Qingbin; Li, Yan; Mao, Gengsheng
2017-09-01
To investigate factors that may be associated with urinary incontinence (UI) in abdominal obese and non-obese adult males. Data were analyzed for 2671 men (≥40 years of age) who participated in the National Health and Nutrition Examination Survey (2005-2008). We define abdominal obesity as a waist circumference >102 cm. Men with Incontinence Severity Index ≥3 were defined as having UI. Logistic regression analyses were used to identify factors associated with stress and urge UI. Multivariate analysis found that in abdominal obese men, stress UI was associated with enlarged prostate (odds ratio [OR] = 2.20, 95% confidence interval [CI]: 1.16-4.16), chronic respiratory tract disease (OR = 2.78, 95% CI: 1.55-4.97), and major depression (OR = 4.79, 95% CI: 1.79-12.84). In non-obese men, arthritis was associated with stress UI (odds ratio = 3.37, 95% CI: 1.06-10.73). Urge UI in abdominally obese men was associated with age ≥65 years (OR = 1.67, 95% CI: 1.05-2.67), being non-Hispanic black (OR = 1.63, 95% CI: 1.06-2.52), and with enlarged prostate (OR = 2.30, 95% CI: 1.54-3.40), arthritis (OR = 1.39, 95% CI: 1.03-1.88), and major depression (OR = 2.96, 95% CI: 1.89-4.64). Urge UI in non-obese men was associated with current smoking (OR = 1.79, 95% CI: 1.01-3.17), major depression (OR = 2.60, 95% CI: 1.33-5.09) and vitamin D deficiency (OR = 1.61, 95% CI: 1.01-2.59). Factors associated with urinary incontinence varied with abdominal obesity status and type of UI. The findings identify important contributors to urinary incontinence that clinicians should consider to help manage and effectively treat the condition.
Preventing urinary incontinence during pregnancy and postpartum
DEFF Research Database (Denmark)
Wesnes, Stian Langeland; Lose, Gunnar
2013-01-01
focus is on pelvic floor muscle training to prevent UI. However, several other modifiable risk factors are likely to contribute to prevention of UI during pregnancy and postpartum. This review investigated modifiable risk factors for UI during pregnancy and postpartum and also reviewed randomized...... (grade B) and postpartum (grade C). Women should be advised to perform pelvic floor muscle training during pregnancy and postpartum (grade A) and to use perineal warm packs during delivery (grade B). Cesarean section to prevent UI cannot be recommended (grade D). If lifestyle recommendations......: women should be advised not to smoke before or during pregnancy (grade B), aim at normal weight before pregnancy (grade B), and aim at regaining prepregnancy weight postpartum (grade B). Occasional low-intensity training should be advocated (grade B), and constipation should be avoided during pregnancy...
Structure and Extensions of the User Information Satisfaction Construct
Directory of Open Access Journals (Sweden)
Clive Wrigley
1997-05-01
Full Text Available User Information Satisfaction (UIS remains one of the most important constructs in Information Systems research. This paper investigates the application of them UIS instrument across a number of key variables including respondent characteristics. Several findings emerge from a survey of 379 IS and non-IS managers: First, the UIS factors are stable and generalizable. Second, the level of satisfaction varies quite substantially when compared to prior UIS reports, although the IS product satisfaction dominates. Third, IS managers, not surprisingly, evaluate their systems significantly higher than non-IS managers, indicating the importance of stakeholders in evaluating Information Systems success. Finally, respondents evaluate their internal systems differently than their inter-organizational systems, indicating that in the IS evaluation process system type must be considered as a moderating variable.
Directory of Open Access Journals (Sweden)
Xiao-Juan Wan
2014-03-01
Conclusion: UI patients should receive individualised intervention. Healthcare workers can provide targeted intervention to patients bothered by UI to alleviate symptoms, decrease the sense of stigma, and increase confidence in coping with symptoms to decrease bothersomeness.
Park, Sangki; Oh, Jungmo
2018-05-01
The current commonly used nitrogen oxides (NOx) emission reduction techniques employ hydrocarbons (HCs), urea solutions, and exhaust gas emissions as the reductants. Two of the primary denitrification NOx (DeNOx) catalyst systems are the HC-lean NOx trap (HC-LNT) catalyst and urea-selective catalytic reduction (urea-SCR) catalyst. The secondary injection method depends on the type of injector, injection pressure, atomization, and spraying technique. In addition, the catalyst reaction efficiency is directly affected by the distribution of injectors; hence, the uniformity index (UI) of the reductant is very important and is the basis for system optimization. The UI of the reductant is an indicator of the NOx conversion efficiency (NCE), and good UI values can reduce the need for a catalyst. Therefore, improving the UI can reduce the cost of producing a catalytic converter, which are expensive due to the high prices of the precious metals contained therein. Accordingly, measurement of the UI is an important process in the development of catalytic systems. Two of the commonly used methods for measuring the reductant UI are (i) measuring the exhaust emissions at many points located upstream/downstream of the catalytic converter and (ii) acquisition of a reductant distribution image on a section of the exhaust pipe upstream of the catalytic converter. The purpose of this study is to develop a system and measurement algorithms to measure the exothermic response distribution in the exhaust gas as the reductant passes through the catalytic converter of the SCR catalyst system using a set of thermocouples downstream of the SCR catalyst. The system is used to measure the reductant UI, which is applied in real-time to the actual SCR system, and the results are compared for various types of mixtures for various engine operating conditions and mixer types in terms of NCE.
Cost Effectiveness of a Sugar-Sweetened Beverage Excise Tax in the U.S.
Long, Michael W; Gortmaker, Steven L; Ward, Zachary J; Resch, Stephen C; Moodie, Marj L; Sacks, Gary; Swinburn, Boyd A; Carter, Rob C; Claire Wang, Y
2015-07-01
Reducing sugar-sweetened beverage consumption through taxation is a promising public health response to the obesity epidemic in the U.S. This study quantifies the expected health and economic benefits of a national sugar-sweetened beverage excise tax of $0.01/ounce over 10 years. A cohort model was used to simulate the impact of the tax on BMI. Assuming ongoing implementation and effect maintenance, quality-adjusted life-years gained and disability-adjusted life-years and healthcare costs averted were estimated over the 2015-2025 period for the 2015 U.S. Costs and health gains were discounted at 3% annually. Data were analyzed in 2014. Implementing the tax nationally would cost $51 million in the first year. The tax would reduce sugar-sweetened beverage consumption by 20% and mean BMI by 0.16 (95% uncertainty interval [UI]=0.06, 0.37) units among youth and 0.08 (95% UI=0.03, 0.20) units among adults in the second year for a cost of $3.16 (95% UI=$1.24, $8.14) per BMI unit reduced. From 2015 to 2025, the policy would avert 101,000 disability-adjusted life-years (95% UI=34,800, 249,000); gain 871,000 quality-adjusted life-years (95% UI=342,000, 2,030,000); and result in $23.6 billion (95% UI=$9.33 billion, $54.9 billion) in healthcare cost savings. The tax would generate $12.5 billion in annual revenue (95% UI=$8.92, billion, $14.1 billion). The proposed tax could substantially reduce BMI and healthcare expenditures and increase healthy life expectancy. Concerns regarding the potentially regressive tax may be addressed by reduced obesity disparities and progressive earmarking of tax revenue for health promotion. Copyright © 2015 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.
Effect of ultrasound irradiation on the production of nHAp/MWCNT nanocomposites
Energy Technology Data Exchange (ETDEWEB)
Lobo, Anderson O., E-mail: aolobo@univap.br [Laboratory of Biomedical Nanotechnology, Development Research Institute (IP and D), Universidade do Vale do Paraiba (Univap), Av. ShishimaHifumi, 2911, São José dos Campos, 12244-000 SP (Brazil); Zanin, Hudson [Associated Laboratory for Sensors and Materials (LAS), National Institute for Space Research (INPE), Av. dos Astronautas 1758, São José dos Campos, 12227-010 SP (Brazil); Siqueira, Idalia A.W.B.; Leite, Nelly C.S.; Marciano, Fernanda R. [Laboratory of Biomedical Nanotechnology, Development Research Institute (IP and D), Universidade do Vale do Paraiba (Univap), Av. ShishimaHifumi, 2911, São José dos Campos, 12244-000 SP (Brazil); Corat, Evaldo J. [Associated Laboratory for Sensors and Materials (LAS), National Institute for Space Research (INPE), Av. dos Astronautas 1758, São José dos Campos, 12227-010 SP (Brazil)
2013-10-15
Large amounts of nanohydroxyapatite (nHAp)-multiwall carbon nanotube (MWCNT) nanocomposites are produced by two different aqueous precipitation methods. The ultrasonic irradiation (UI) and slow-drip addition under continuous magnetic stirring (DMS) methods were used to investigate the precipitation of nHAp acicular crystals. Calcium-nitrate, diammonium hydrogen phosphate, and ammonium hydroxide were used as precursor reagents. Superhydrophilic MWCNT were also employed. XPS analysis evidences that the functionalized MWCNTs are composed of 18 to 20 at.% of oxygen and that this property influences the nHAp formation. The high surface area of the MWCNT decreases the mean free path of ions, favoring the nHAp formation assisted by UI. The crystallinity was evaluated using the Scherrer equation. Semi-qualitative energy dispersive spectroscopy (EDS) analysis showed that the main components of HAp powders were calcium and phosphorus in the ratio Ca/P around of 1.67. Bioactivity properties of the nHAp/MWCNT-UI nanocomposites could be evaluated after 14 days soaking in simulated body fluid medium. Scanning electron microscopy, EDS, Fourier transform infrared attenuated total reflection spectroscopy, and X-ray diffraction techniques proved that the apatites formed on the surface and to points that the nHAp/MWCNT-UI have potential biological applications. - Highlights: • Nanohydroxyapatite/multiwalled carbon nanotube nanocomposites were produced via aqueous precipitation. • Two methodologies were compared, such as: dropwise and ultrasound irradiation (UI). • Analysis found strong connections between UI and the crystallization process.
Albers-Heitner, Pytha; Winkens, Ron; Berghmans, Bary; Joore, Manuela; Nieman, Fred; Severens, Johan; Lagro-Janssen, Toine
2013-06-01
Urinary incontinence (UI) is a very common problem, but existing guidelines on UI are not followed. To bring care in line with guidelines, we planned an intervention to involve nurse specialists on UI in primary care and assessed this in a randomised controlled trial. Alongside this intervention, we assessed consumer satisfaction among patients and general practitioners (GPs). Patients' satisfaction with the care provided by either nurse specialists (intervention group) or GPs (control group), respectively, was measured with a self-completed questionnaire. GPs' views on the involvement of nurse specialists were measured in a structured telephone interview. The patient satisfaction score on the care offered by nurse specialists was 8.4 (scale 1-10), vs. 6.7 for care-as-usual by GPs. Over 85% of patients would recommend nurse specialist care to their best friends and 77% of the GPs considered the role of the nurse specialist to be beneficial, giving it a mean score of 7.2. Although the sample was relatively small and the stability of the results only provisionally established, substituting UI care from GP to nurse specialist appears to be welcomed by both patients and GPs. Small changes like giving additional UI-specific information and devoting more attention to UI (which had been given little attention before) would provide a simple instrument to stimulate patients to change their behaviour in the right direction. © 2012 Nordic College of Caring Science.
International Nuclear Information System (INIS)
Sugandhavanija, Pornpimol; Sukchai, Sukruedee; Ketjoy, Nipon; Klongboonjit, Sakol
2011-01-01
Most of the literatures related to university-industry (U-I) and technology transfer assume that the collaboration particularly the U-I joint research is beneficial to both university and industry which as a result underpins the sustainable development of economics and living standards of developed and developing countries. The U-I joint research for photovoltaic technology transfer in a developing country like Thailand should have been increased considering the fact that (i) the government implemented various strategies to support the renewable energy research and market development, (ii) the university aimed to be ''research-based university and (iii) the Thai photovoltaic industry struggle for competitiveness and survival in the global market. However, evidence revealed that the university and industry conducted little number of U-I joint projects. In this paper, we investigate the factors influencing the effective U-I joint research for photovoltaic technology transfer (UIJRPTT). In an attempt to better understand the influence of the factors, the path model with factors related to characteristics and perspectives of the university and the industry as well as joint research mechanism and their linkages to higher growth and improved economic and quality performance of the U-I joint research is developed and validated. The developed model empirically explains interaction between the factors and the outcome factors and can assist the government, the university and the industry to devise target strategies to improve the growth and performance of UIJRPTT. (author)
Energy Technology Data Exchange (ETDEWEB)
Matson, Ellen M.; Kiernicki, John J.; Fanwick, Phillip E.; Bart, Suzanne C. [Department of Chemistry, Purdue University, West Lafayette, IN (United States)
2016-06-15
The generation of uranium(III) alkyls supported by hydrotris(pyrazolyl)borate (Tp) and pentamethylcyclopentadienyl (Cp*) ligands is reported. Mixed ancillary ligand frameworks were synthesized by treating TpUI{sub 2}(THF){sub 3} (1) and Cp*UI{sub 2}(THF){sub 3} with potassium hydrotris(pyrazolyl)borate salts. Addition of one equivalent of potassium hydrotris(3,5-dimethylpyrazolyl)borate (Tp*) generated TpTp*UI (2), while treatment of Cp*UI{sub 2}(THF){sub 3} with either KTp or KTp* resulted in the respective formation of Cp*TpUI(THF) (3) or Cp*Tp*UI(THF) (4). Alkylation of 2 with KCH{sub 2}Ph or NaCH{sub 2}SiMe{sub 3} furnished TpTp*UCH{sub 2}Ph (2-CH{sub 2}Ph) or TpTp*UCH{sub 2}SiMe{sub 3} (2-CH{sub 2}SiMe{sub 3}). Similarly, treatment of 3 with NaCH{sub 2}SiMe{sub 3} formed Cp*TpUCH{sub 2}SiMe{sub 3} (3-CH{sub 2}SiMe{sub 3}), whereas treatment of 4 with KCH{sub 2}Ph generated Cp*Tp*UCH{sub 2}Ph (4-CH{sub 2}Ph). All compounds were characterized by multinuclear NMR, IR, and electronic absorption spectroscopy. Compounds 2-CH{sub 2}Ph, 3, and 3-CH{sub 2}SiMe{sub 3} were structurally characterized using X-ray crystallography as well. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
International Nuclear Information System (INIS)
Sato, Hiroyuki; Igarashi, Minoru; Kimura, Nobuyuki; Kamide, Hideki
2002-01-01
In the feasibility studies of Commercialized Fast Breeder Reactor Cycle System, a compact reactor vessel is considered from economical improvement point of a sodium cooled loop type fast reactor. The flow field was visualized by water experiment for a reactor vessel with 'a column type UIS (Upper Internal Structure)', which has a slit for fuel handling mechanism and is useful for a compact fast reactor. In this research, the 1/20 scale test equipment using water was made to understand coolant flow through a slit of a column type UIS' and fundamental behavior of reactor upper plenum flow. In the flow visualization tests, tracer particles were added in the water, and illuminated by the slit-shaped pulse laser. The flow visualization image was taken with a CCD camera. We obtained fluid velocity vectors from the visualization image using the Particle Imaging Velocimetry (PIV). The results are as follows. 1. Most of coolant flow through a slit of 'column type UIS' arrived the dip plate directly. In the opposite side of a slit, most of coolant flowed toward reactor vessel wall before it arrived the dip plate. 2. The PIV was useful to measure the flow field in the reactor vessel. The obtained velocity field was consistent with the flow visualization result. 3. The jet through the UIS slit was dependent on the UIS geometry. There is a possibility to control the jet by the UIS geometry. (author)
What Is the Real Impact of Urinary Incontinence on Female Sexual Dysfunction? A Case Control Study
Directory of Open Access Journals (Sweden)
Mariana Rhein Felippe, ScM
2017-03-01
Conclusion: Women with UI were more likely to be sexual abstinent than continent women. Furthermore, women with UI showed less sexual desire, sexual comfort, and sexual satisfaction than their counterparts despite having a similar frequency of sexual activity.
Design study for KALIMER upper internal structure and reactor refueling system
International Nuclear Information System (INIS)
Park, Jin Ho
1996-09-01
The design study for the KALIMER upper internal structure (UIS) and reactor refueling system has been described. Two distinct features are plug-in UIS and extended refueling outage. For the UIS system, the functional, structural and material requirements have been determined and the accommodation approaches to meet these functional requirements described. For the refueling system, the functional, structural, process and I and C (Instrument and Control) requirements have been established and the accommodation approaches for the functional and process requirements described. The impact on plant availability due to extension of the refueling outage has also been investigated. The accommodation approaches for UIS system show that the design concept of the system will satisfy the functional requirements with a few design issues to be resolved, such as UIS plug in/out handling system and cask design. It is also shown that the functional and process requirements of the refueling system are achievable with the design of the IVTM cask and related transfer system and the extended refueling outage has little effect (within 1%) on the plant availability if extra refueling time do not exceed 1 week. 1 refs. (Author)
Villoro, Renata; Merino, María; Hidalgo-Vega, Alvaro; Jiménez, Margarita; Martínez, Lucía; Aracil, Javier
2016-12-01
To describe Health-Related Quality of Life (HRQOL) and healthcare resource utilization in women aged 60 and over in Spain. Descriptive analysis of primary data from the Spanish National Health Survey, 2012. Utility indices were obtained through the EQ5D5L questionnaire included in the survey, and utilization rates of consultations, hospitalizations, emergency services, and medication intake. HRQOL and utilization rates were systematically compared between women diagnosed with UI, women diagnosed with other chronic conditions (OCC) and healthy women of the same age. Utility indices were 0.47 in UI women versus 0.78 and 0.96 in women diagnosed with OCC and healthy women, respectively. Each year 351,675 Quality Adjusted Life Years are lost in Spain due to UI in the population of women aged 60 and over. Resource utilization of these women was significantly higher than that of other women. UI has a larger impact on both HRQOL and healthcare consumption in women who are aged 60 and over, than OCC. Appropriate treatment of UI might entail an important gain in terms of HRQOL and a significant reduction in healthcare consumption in Spain. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Radioisotopic measurement of glomerular filtration rate in severe chronic renal failure
International Nuclear Information System (INIS)
LaFrance, N.D.; Drew, H.H.; Walser, M.
1988-01-01
In order to determine the best method for routine measurement of glomerular filtration rate (GFR) in severe renal failure, we compared simultaneously the urinary clearances of [/sup 99m/Tc] diethylenetriaminepentaacetic acid (DTPA) (UD), [ 125 I]iothalamate (UI), 24-hr creatinine clearance (UC) and plasma clearance of [/sup 99m/Tc]DTPA (PD), based on three plasma samples. In 60 studies in 22 patients with serum creatinine values of 2 to 8 mg/dl, UD and UI were almost identical: UD = 0.358 +/- 0.976 UI +/- 0.87 ml/min, r = 0.990. However, PD overestimated UD by a large and variable extent: PD = 11.3 +/- 0.843 UD +/- 5.5 ml/min, r = 0.694, and was inconsistent in sequential measurements in individual patients. UC also overestimated urinary isotope clearance: UC = 4.2 + 0.95 UI +/- 3.9 ml/min, r = 0.865. Sequential measurements of GFR in five patients with severe but stable renal failure (mean GFR 5.9 ml/min) showed an average standard deviation of only 0.83 ml/min. Thus both UD and UI appear to be reliable and precise measures of GFR in severe renal failure
Design study for KALIMER upper internal structure and reactor refueling system
Energy Technology Data Exchange (ETDEWEB)
Park, Jin Ho [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)
1996-09-01
The design study for the KALIMER upper internal structure (UIS) and reactor refueling system has been described. Two distinct features are plug-in UIS and extended refueling outage. For the UIS system, the functional, structural and material requirements have been determined and the accommodation approaches to meet these functional requirements described. For the refueling system, the functional, structural, process and I and C (Instrument and Control) requirements have been established and the accommodation approaches for the functional and process requirements described. The impact on plant availability due to extension of the refueling outage has also been investigated. The accommodation approaches for UIS system show that the design concept of the system will satisfy the functional requirements with a few design issues to be resolved, such as UIS plug in/out handling system and cask design. It is also shown that the functional and process requirements of the refueling system are achievable with the design of the IVTM cask and related transfer system and the extended refueling outage has little effect (within 1%) on the plant availability if extra refueling time do not exceed 1 week. 1 refs. (Author).
Household unemployment and the labour supply of married women
DEFF Research Database (Denmark)
Bingley, Paul; Walker, Ian
1997-01-01
of spouses. A model of labour supply is estimated for married women allowing for endogenous unemployment durations of husbands and wives, using 43531 married couples drawn from UK Family Expenditure Surveys 1978-92. Evaluating the impact of the reform requires that we distinguish between transfer programme......A recent reform to the UK Unemployment Insurance (UI) system has reduced the duration of entitlement from 12 to 6 months. The UI and welfare systems interact in the UK in such a way that exhaustion of UI for married individuals has potentially large disincentive effects on the labour supply...... induced incentive effects and any correlation between labour supply and wages within couples; complementarily between the leisure times of spouses; and a discouraged worker effect. We find that shifting households with a medium duration unemploymed husband from UI onto Income Support, the main UK welfare...
The menopause and urinary incontinence
DEFF Research Database (Denmark)
Foldspang, Anders; Mommsen, Søren
1994-01-01
The objective was to study the possible role of the menopause in adult female urinary incontinence (UI) etiology, using a cross-sectional population study comprising a random sample of adult females and self-reported data based on postal questionnaires. The study group comprised 915 women who...... prevalence in 1987 of episodes of stress and urge urinary incontinence; prevalence of menopause and exposure to childbirth, gynecologic surgery, cystitis and obesity as indicated by body mass index more than 29; prevalence relative risks, as indicated by odds ratio of UI conditional on menopause and other...... the year of final menstruation. The findings suggest perimenopausal processes rather than the menopause in general to be responsible for an increased risk of developing UI. The elevation of UI prevalence in the perimenopause may reflect the adjustment of the female continence mechanism to function...
Systematic Assessment of the Impact of User Roles on Network Flow Patterns
2017-09-01
a system at IP address c_IPj can be expressed as D[ui][c_ip j]. Specifying use of a specific protocol ( prk ), server port (spl) and distant end IP...address (e_ipm) can be expressed as D[ui][c_ip j][ prk ][spl][e_ipm]. 3.2 Patterns Within Flow Sets We define patterns within a set of Netflow records as...address, protocol, server port, and endpoint IP address (D[ui][c_ip j][ prk ][spl][e_ipm]) we identified sequential flow pairs, matching each flow with
Predictors and reasons for help-seeking behavior among women with urinary incontinence
DEFF Research Database (Denmark)
Pedersen, Louise Schreiber; Lose, Gunnar; Hoybye, Mette Terp
2018-01-01
INTRODUCTION AND HYPOTHESIS: The aim of the study was to evaluate the predictors and reasons for help-seeking behavior among women with urinary incontinence (UI) in Germany and Denmark. METHODS: This international postal survey was conducted in 2014. In each country, 4,000 women of at least 18...... years of age were randomly selected. The questionnaires included validated items regarding help-seeking behavior and the ICIQ-UI SF. UI was defined as any involuntary loss of urine. Binary logistic regression analysis was used to assess factors predicting help-seeking behavior. Reasons for seeking...
Entrepreneurial Moral Hazard in Income Insurance
DEFF Research Database (Denmark)
Ejrnæs, Mette; Hochguertel, Stefan
We study risk behavior of Danish self-employed entrepreneurs, whose income risk may be driven by both exogenous factors and effort choice (moral hazard). Partial insurance is available through voluntary unemployment insurance (UI). Additional incentives to sign insurance contracts stem from a UI......-embedded, government-subsidized early retirement (ER) program, giving benefits that are unrelated to business risk. Indeed, we argue that the self-employeds' incentives to insure themselves stem from the ER plan rather than from the UI cover. We show how to use a policy reform to identify moral hazard in observed...
Long-term effect of hysterectomy on urinary incontinence in Taiwan
Directory of Open Access Journals (Sweden)
Ching-Hung Hsieh
2011-09-01
Conclusion: There is a high prevalence of UI among women who have performed hysterectomy, but there is no significant relationship between UI and route of hysterectomy, reason for hysterectomy, including cervical cancer and uterine prolapsed, or year after hysterectomy.
Directory of Open Access Journals (Sweden)
E.E.A. Ribeiro
2008-06-01
Full Text Available Determinou-se o perfil do ionograma e enzimas hepáticas de cutias (Dasyprocta sp. saudáveis, criadas em cativeiro, como também se avaliou a influência de sexo, idade e interação sexo-idade. Foi adotado um delineamento inteiramente ao acaso, em arranjo fatorial 2 x 4 (dois sexos e quatro faixas etárias, com três repetições, totalizando 24 cutias. Foram determinados os valores para o cálcio (Ca, fósforo (P, cloretos (Cl, aspartato aminotransferase (AST, alanina aminotransferase (ALT, fosfatase alcalina (FA e gama-glutamiltransferase (GGT. Os valores médios obtidos foram: Ca= 7,62+2,59mg/dl; P= 3,91+1,41mg/dl; Cl= 58,63+16,45mg/dl; AST= 119,54+79,35UI/ml; ALT= 28,08+15,53UI/ml; FA= 26,95+14,01UI/ml e GGT= 25,34+19,44UI/ml. O valor de P foi maior nas fêmeas e da FA nos machos. Os níveis de FA diminuíram com o aumento da idade.This research studied the profile of the ionogram and hepatic enzymes of healthy agoutis (Dasyprocta sp. raised in captivity as well as evaluated the influence of gender, age and interaction gender-age. It was used a completely randomized design, in a factorial arrangement of 2 x 4 (two genders and four age groups, with three repetitions, totaling 24 agoutis. The values were determined for calcium (Ca, phosphorus (P, chlorides (Cl, aspartate aminotransaminase (AST, alanine aminotransaminase (ALT, alkaline phosphatase (ALP, and gamma-glutamyltransferase (GGT. The mean values were: Ca= 7.62±2.59mg/dl; P= 3.91±1.41mg/dl; Cl= 58.63±16,45mg/dl; AST= 119.54±79.35UI/ml; ALT= 28.08±15.53UI/ml; ALP= 26.95±14.01UI/ml, and GGT= 25.34±19.44UI/ml. The value of P was larger in females and ALP in males. As the age increased, levels of ALP decreased.
2013-07-02
...,537B] Monta Vista Software, LLC, a Subsidiary of Cavium, Inc., Including Workers Whose Unemployment..., a Subsidiary of Cavium, Inc., Including Workers Whose Unemployment Insurance (UI) Wages are Reported..., Inc., Including Workers Whose Unemployment Insurance (UI) Wages, are Reported Through Trinet HR...
Ehlman, Katie; Wilson, Amy; Dugger, Renee; Eggleston, Brandon; Coudret, Nadine; Mathis, Sherri
2012-01-01
Urinary incontinence (UI) poses challenges for nursing home personnel. The authors of this study explored differences in attitude and knowledge about UI among registered nurses, licensed practical nurses, and certified nursing assistants working in skilled nursing homes before and after study interventions.
Iodine in Enteral and Parenteral Nutrition
Zimmermann, M.B.; Crill, C.M.
2010-01-01
Iodine deficiency (ID) has multiple adverse effects on growth and development due to inadequate thyroid hormone production. Methods for assessment of iodine nutrition in individuals include the urinary iodine concentration (UI), thyroid size and thyroid function tests. The UI measured in several
DEFF Research Database (Denmark)
Schreiber Pedersen, Louise; Lose, Gunnar; Høybye, Mette Terp
2017-01-01
INTRODUCTION: Urinary incontinence (UI) is a prevalent condition that interferes with women's health-related quality of life. Prevalence rates from earlier studies are wide-ranging, due to heterogeneity in methodology, definition of UI and the populations included. We aimed to determine the preva...
Giuliani, E.; Morrison, A.; Pietrobelli, C.; Rabelloti, R.
2010-01-01
Research on University–industry (U-I) linkages and their determinants has increased significantly in the past few years. However, there is still controversy on the key factors explaining the formation of U-I linkages, and especially related to individual researcher characteristics. This paper
Enhancement of nerve structure segmentation by a correntropy-based pre-image approach
Directory of Open Access Journals (Sweden)
J. Gil-González
2017-05-01
Full Text Available Peripheral Nerve Blocking (PNB is a commonly used technique for performing regional anesthesia and managing pain. PNB comprises the administration of anesthetics in the proximity of a nerve. In this sense, the success of PNB procedures depends on an accurate location of the target nerve. Recently, ultrasound images (UI have been widely used to locate nerve structures for PNB, since they enable a noninvasive visualization of the target nerve and the anatomical structures around it. However, UI are affected by speckle noise, which makes it difficult to accurately locate a given nerve. Thus, it is necessary to perform a filtering step to attenuate the speckle noise without eliminating relevant anatomical details that are required for high-level tasks, such as segmentation of nerve structures. In this paper, we propose an UI improvement strategy with the use of a pre-image-based filter. In particular, we map the input images by a nonlinear function (kernel. Specifically, we employ a correntropybased mapping as kernel functional to code higher-order statistics of the input data under both nonlinear and non-Gaussian conditions. We validate our approach against an UI dataset focused on nerve segmentation for PNB. Likewise, our Correntropy-based Pre-Image Filtering (CPIF is applied as a pre-processing stage to segment nerve structures in a UI. The segmentation performance is measured in terms of the Dice coefficient. According to the results, we observe that CPIF finds a suitable approximation for UI by highlighting discriminative nerve patterns.
Cuthbert, Scott C; Rosner, Anthony L
2012-03-01
The purpose of this case series is to describe the chiropractic management of 21 patients with daily stress and occasional total urinary incontinence (UI). Twenty-one case files of patients 13 to 90 years of age with UI from a chiropractic clinic were reviewed. The patients had a 4-month to 49-year history of UI and associated muscle dysfunction and low back and/or pelvic pain. Eighteen wore an incontinence pad throughout the day and night at the time of their appointments because of unpredictable UI. Patients were evaluated for muscle impairments in the lumbar spine, pelvis, and pelvic floor and low back and/or hip pain. Positive manual muscle test results of the pelvis, lumbar spine muscles, and pelvic floor muscles were the most common findings. Lumbosacral dysfunction was found in 13 of the cases with pain provocation tests (applied kinesiology sensorimotor challenge); in 8 cases, this sensorimotor challenge was absent. Chiropractic manipulative therapy and soft tissue treatment addressed the soft tissue and articular dysfunctions. Chiropractic manipulative therapy involved high-velocity, low-amplitude manipulation; Cox flexion distraction manipulation; and/or use of a percussion instrument for the treatment of myofascial trigger points. Urinary incontinence symptoms resolved in 10 patients, considerably improved in 7 cases, and slightly improved in 4 cases. Periodic follow-up examinations for the past 6 years, and no less than 2 years, indicate that for each participant in this case-series report, the improvements of UI remained stable. The patients reported in this retrospective case series showed improvement in UI symptoms that persisted over time.
Loohuis, Anne M M; Wessels, Nienke J; Jellema, Petra; Vermeulen, Karin M; Slieker-Ten Hove, Marijke C; van Gemert-Pijnen, Julia E W C; Berger, Marjolein Y; Dekker, Janny H; Blanker, Marco H
2018-02-02
We aim to assess whether a purpose-developed mobile application (app) is non-inferior regarding effectiveness and cost-effective when used to treat women with urinary incontinence (UI), as compared to care as usual in Dutch primary care. Additionally, we will explore the expectations and experiences of patients and care providers regarding app usage. A mixed-methods study will be performed, combining a pragmatic, randomized-controlled, non-inferiority trial with an extensive process evaluation. Women aged ≥18 years, suffering from UI ≥ 2 times per week and with access to a smartphone or tablet are eligible to participate. The primary outcome will be the change in UI symptom scores at 4 months after randomization, as assessed by the International Consultation on Incontinence Modular Questionnaire UI Short Form. Secondary outcomes will be the change in UI symptom scores at 12 months, as well as the patient-reported global impression of improvement, quality of life, change in sexual functioning, UI episodes per day, and costs at 4 and 12 months. In parallel, we will perform an extensive process evaluation to assess the expectations and experiences of patients and care providers regarding app usage, making use of interviews, focus group sessions, and log data analysis. This study will assess both the effectiveness and cost-effectiveness of app-based treatment for UI. The combination with the process evaluation, which will be performed in parallel, should also give valuable insights into the contextual factors that influence the effectiveness of such a treatment. © 2018 The Authors. Neurourology and Urodynamics Published by Wiley Periodicals, Inc.
Dumoulin, Chantale; Hay-Smith, Jean; Habée-Séguin, Gabrielle Mac; Mercier, Joanie
2015-04-01
Pelvic floor muscle training (PFMT) is a commonly used physical therapy for women with urinary incontinence (UI). To determine the effects of PFMT for women with UI in comparison to no treatment, placebo or other inactive control treatments. Cochrane Incontinence Group Specialized Register, (searched 15 April 2013). Randomized or quasi-randomized trials in women with stress, urgency or mixed UI (based on symptoms, signs, or urodynamics). At least two independent review authors carried out trial screening, selection, risk of bias assessment and data abstraction. Trials were subgrouped by UI diagnosis. The quality of evidence was assessed by adopting the (GRADE) approach. Twenty-one trials (1281 women) were included; 18 trials (1051 women) contributed data to the meta-analysis. In women with stress UI, there was high quality evidence that PFMT is associated with cure (RR 8.38; 95% CI 3.68 to 19.07) and moderate quality evidence of cure or improvement (RR 17.33; 95% CI 4.31 to 69.64). In women with any type of UI, there was also moderate quality evidence that PFMT is associated with cure (RR 5.5; 95% CI 2.87-10.52), or cure and improvement (RR 2.39; 95% CI 1.64-3.47). The addition of seven new trials did not change the essential findings of the earlier version of this review. In this iteration, using the GRADE quality criteria strengthened the recommendations for PFMT and a wider range of secondary outcomes (also generally in favor of PFMT) were reported. © 2014 Wiley Periodicals, Inc.
Prevalence and factors associated with urinary incontinence in climacteric
Directory of Open Access Journals (Sweden)
Máyra Cecilia Dellú
Full Text Available SUMMARY Objective: To estimate the prevalence and identify associated factors to urinary incontinence (UI in climacteric women. Method: In a cross-sectional study with a stratified random sample, 1,200 women aged between 35 and 72 years were studied, enrolled in the Family Health Strategy in the city of Pindamonhangaba, São Paulo. Urinary incontinence was investigated using the International Consultation of Incontinence Questionnaire - Short Form, while associated factors were assessed based on a self-reported questionnaire with socio-demographic, obstetric and gynecological history, morbidities and drug use. The prevalence of urinary incontinence was estimated with a 95% confidence interval (95CI and the associated factors were identified through multiple logistic regression model performed using Stata software, version 11.0. Results: Women had a mean age of 51.9 years, most were in menopause (59.4%, married (87.5%, Catholic (48.9%, and declared themselves black or brown (47.2%. The mean age of menopause of women with UI was 47.3 years. The prevalence of UI was 20.4% (95CI: 17.8-23.1%. The factors associated with UI were urinary loss during pregnancy (p=0.000 and after delivery (p=0.000, genital prolapse (p=0.000, stress (p=0.001, depression (p=0.002, and obesity (p=0.006. Conclusion: The prevalence of UI was lower but similar to that found in most similar studies. Factors associated with the genesis of UI were urinary loss during pregnancy and after delivery, genital prolapse and obesity.
Energy Technology Data Exchange (ETDEWEB)
Weidemann, R.; Ebel, R.; Mayer-Foell, R. (eds.)
2005-11-15
The development of the Xfa-Web information systems started about 10 years ago with AlfaWeb. Further functions and further scientific information systems were implemented successively. After this development period, which was quite long for an application in electronic data processing, a reassessment of the potential further development was necessary. In view of the fact that not a single scientific document had been implemented in the XfaWeb systems in all this time, the Umweltinformationssystem Baden-Wuerttemberg (UIS) was considered in general, with the final goal of developing a concept for future management of UIS scientific documents. Suggestions for better integration of UIS components for document handling were to be taken into account, and the contents of the XfaWeg systems were to be integrated in UIS in a higher degree than before. Redundancies between systems were to be removed by integrating information from the original system in a dynamic manner whenever possible. Simplification and standardisation of updating are further goals. The study describes the current method and XfaWeb tools. The results of an enquiry among XfaWeb project managers and users of the system are taken into account as well as the access statistics. A table is presented of UIS components handling scientific documents. Specifications are presented for a new conception of the XfaWeb systems, and the current state of the art is presented. Finally, a general concept for integration of UIS components and a special concept for a successor system to XfaWeb are presented. (orig.)
Hyperthyroidism and female urinary incontinence: a population-based cohort study.
Chung, Shiu-Dong; Chen, Yi-Kuang; Chen, Yi-Hua; Lin, Herng-Ching
2011-11-01
The imbalanced autonomic nervous system present in hyperthyroidism may cause lower urinary tract symptoms. Urinary incontinence (UI) is the most bothersome lower urinary tract symptom; however, in the literature, reports regarding urinary dysfunction and/or incontinence among hyperthyroid patients are scarce. This population-based cohort study aimed to examine the relationship between hyperthyroidism in women and the risk of developing UI in Taiwan. This study used data from the Longitudinal Health Insurance Database. For this study, 10,817 female patients diagnosed with hyperthyroidism from 2001 to 2005 were recruited together with a comparison cohort of 54,085 matched enrollees who did not have a history of hyperthyroidism. All patients were tracked for a 3-year period from their index date to identify those who had a subsequent UI. The stratified Cox proportional hazards models were used to compute the risk of UI between study and comparison cohorts. During the follow-up period, of 64,169 patients, 173 (1·60%) from the hyperthyroidism group and 560 (1·04%) from the comparison group, had a diagnosis of UI. The regression analysis showed that, after adjusting for monthly income, geographic region, urbanization level of the community in which the patient resided, obesity and hysterectomy, patients with hyperthyroidism were more likely to have UI during the 3-year follow-up period than the comparison patients (hazard ratio = 1·54; 95% CI = 1·30-1·83; P hyperthyroidism at the 3-year follow-up. © 2011 Blackwell Publishing Ltd.
Indian Academy of Sciences (India)
and trace out a circle on the sphere (see Figure 1). What will be the area of the spherical cap thus formed? Sur- prisingly, the same formula applies! - the area is 1r L2 , as earlier. The proof is not too difficult. In fact there are several proofs available. Perhaps the simplest way is to use the method used by Archimedes to show ...
UI Review Results and NARAC Response
Energy Technology Data Exchange (ETDEWEB)
Fisher, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Eme, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kim, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Fischer, K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Donetti, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-03-08
This report describes the results of an inter-program design review completed February 16th, 2017, during the second year of a FY16-FY18 NA-84 Technology Integration (TI) project to modernize the core software system used in DOE/NNSA's National Atmospheric Release Advisory Center (NARAC, narac.llnl.gov). This review focused on the graphical user interfaces (GUI) frameworks. Reviewers (described in Appendix 2) were selected from multiple areas of the LLNL Computation directorate, based on their expertise in GUI and Web technologies.
Albers-Heitner, P.C.; Lagro-Janssen, A.L.M.; Joore, M.M.; Berghmans, B.L.; Nieman, F.F.; Venema, P.P.; Severens, J.J.; Winkens, R.R.
2011-01-01
BACKGROUND: Urinary incontinence (UI) primary care management is substandard, offering care rather than cure despite the existence of guidelines that help to improve cure. Involving nurse specialists on incontinence in general practice could be a way to improve care for UI patients. AIMS: We studied
Gowachirapant, S.; Winichagoon, P.; Wyss, L.; Tong, B.; Baumgartner, J.; Boonstra, A.; Zimmermann, M.B.
2009-01-01
The median urinary iodine concentration (UI) in school-aged children is recommended for assessment of iodine nutrition in populations. If the median UI is adequate in school-aged children, it is usually assumed iodine intakes are also adequate in the remaining population, including pregnant women.
2012-06-19
... PERFORMS, the performance management system for the UI program. UI PERFORMS incorporates a strategic... collection request (ICR) titled, ``Tax Performance System,'' to the Office of Management and Budget (OMB) for... for OMB Review; Comment Request; Tax Performance System ACTION: Notice. SUMMARY: The Department of...
Slieker- ten Hove, Marijke; Pool-Goudzwaard, A.L.; Eijkemans, MJ; Steegers-Theunissen, R. P M; Burger, CW; Vierhout, ME
2010-01-01
BACKGROUND: Urinary incontinence (UI) and anal incontinence (AI) are complaints with impact on quality of life (QOL). Few data are available on prevalence of double incontinence (DI) in the general female population. OBJECTIVE: To determine prevalence of UI, AI, and DI, their associations with age,
Urinary incontinence in the Netherlands : Prevalence and associated risk factors in adults
Linde, J. Marleen; Nijman, Rien J. M.; Trzpis, Monika; Broens, Paul M. A.
AimsTo determine the prevalence and risk factors associated with urinary incontinence (UI) among adults in the Netherlands. MethodsIn this cross-sectional study, we included 1257 respondents aged18 years, who completed the validated Groningen Defecation and Fecal Continence Checklist. UI was defined
The Match Quality Gains from Unemployment Insurance
Centeno, Mario
2004-01-01
The benefits of unemployment insurance (UI) by measuring its effect in match quality are assessed. The relationship between post-unemployment job tenure and measures of the state level UI generosity and the unemployment rate at the time of the job is analyzed, using NLSY data.
Directory of Open Access Journals (Sweden)
Paola Mangieri
2003-03-01
íveis maiores do que o normal. Os níveis de FSH e LH foram normais de acordo com a idade e sexo: homens - FSH = 4,0±2,9 mUI/ml (VN =1 a 10,5 mUI/ml; LH = 6,1±6,3 mUI/ml (VN =2 a 12 mUI/ml; mulheres - pré-menopausa: FSH = 2,5±1,5 mUI/ml (VN =2,4 a 9,3 mUI/ml; LH 3,9±5,1 mUI/ml (VN =2 a 15 µUI/ml; pós-menopausa: FSH = 48,3±18,5 mUI/ml (valor normal =31 a 134 mUI/ml; LH = 29±13,8 mUI/ml (VN =16 a 64 mUI/ml. Os níveis de TSH foram 3,9±5,2 µUI/ml (VN =0,5 a 4,7 µUI/ml e cinco pacientes (14,2 % tiveram níveis maiores do que o normal. Os níveis de triiodotironina (T3 foram de 66,4±18,7 ng/dl (VN = 45 a 137 ng/dl e cinco pacientes (14,2% tiveram níveis menores do que o normal (33,8±9 ng/dl. Os níveis de tiroxina (T4 (VN= 4,5 a 12,5 µg/dl foram de 7,4±1,7 µg/dl e dois pacientes (5,6 % tiveram níveis menores do que o normal. Anticorpos antitireoglobulina e antimicrossomal não foram detectados. Conclusões: nas primeiras 24 horas seguindo o quadro ictal, as anormalidades observadas nas dosagens hormonais podem ser devidas ao estresse provocado pelo sangramento intracraniano; as alterações observadas nos hormônios tireoidianos sugerem que os pacientes com hemorragia subaracnoidea podem desenvolver a síndrome do doente eutireoideo.
A spike at benefit exhaustion: Still possible after four years of unemployment
DEFF Research Database (Denmark)
Lyk-Jensen, Stéphanie; Weatherall, Cecilie Dohlmann
European policymakers wonder whether the long-term unemployed can still find jobs if the benefit period is shortened. We investigate this question by analysing how long-term unemployed react to the threat of running out of unemployment insurance (UI) after receiving it for almost four years....... The empirical analysis is based on very precise administrative records of men’s unemployment spells. To identify the effect of UI exhaustion, we exploit a legislative change in the duration of benefits that progressively reduced UI entitlement from five to four years. Our results show a spike 3-6 months before...
Simulating calving-front changes of Greenland’s marine-terminating glaciers
DEFF Research Database (Denmark)
Haubner, Konstanze
glacier retreat to a certain degree and foremost define the variation of retreat rates. The thesis implies the importance of incorporating glacier-front dynamics into ice sheet models in order to match observations and verifies atmospheric and oceanic forcing as important triggers for glacier retreat...... UI outlet glaciers. The change in mass flux resulting from the prescribed glacier retreat contributes to 70% of UI’s mass change over the simulation periods. The residual mass change is due to surface mass balance. A second simulation on the fastest UI glacier (UI-1) reveals that frontal melt rates...
International Nuclear Information System (INIS)
Kobayashi, Jun; Ezure, Toshiki; Tanaka, Masaaki; Kamide, Hideki
2016-01-01
Design study of an advanced large-scale sodium-cooled fast reactor (SFR) has been conducted in JAEA. In the region between the bottom of the Upper Internal Structure (UIS) and the core outlet, the hot sodium from the fuel subassembly mixes with the cold sodium from the neighbor control rod (CR) channel. Therefore, temperature fluctuation due to mixing fluids at different temperatures may cause high cycle thermal fatigue at the bottom of the UIS. In the advanced design, installation of a flow guide structure named Flow-Collector (FC) to the backup control rod (BCR) guide tube is considered to enhance reliable operation of self-actuated shutdown system (SASS) and to ensure reactor shutdown operation. Previously, water experiments without the FC model had been examined in JAEA to investigate effective countermeasures to the significant temperature fluctuation generation at the bottom of the UIS. Since the FC may affect the thermal mixing behavior at the bottom of the UIS, influence of the FC on characteristics of the temperature fluctuation around the BCR channels was investigated using a water experimental facility with structure model of the FC. Through the experiment, small influence of the FC on the temperature fluctuation distribution at the bottom of the UIS was indicated. (author)
Novel Application of Statistical Methods to Identify New Urinary Incontinence Risk Factors
Directory of Open Access Journals (Sweden)
Theophilus O. Ogunyemi
2012-01-01
Full Text Available Longitudinal data for studying urinary incontinence (UI risk factors are rare. Data from one study, the hallmark Medical, Epidemiological, and Social Aspects of Aging (MESA, have been analyzed in the past; however, repeated measures analyses that are crucial for analyzing longitudinal data have not been applied. We tested a novel application of statistical methods to identify UI risk factors in older women. MESA data were collected at baseline and yearly from a sample of 1955 men and women in the community. Only women responding to the 762 baseline and 559 follow-up questions at one year in each respective survey were examined. To test their utility in mining large data sets, and as a preliminary step to creating a predictive index for developing UI, logistic regression, generalized estimating equations (GEEs, and proportional hazard regression (PHREG methods were used on the existing MESA data. The GEE and PHREG combination identified 15 significant risk factors associated with developing UI out of which six of them, namely, urinary frequency, urgency, any urine loss, urine loss after emptying, subject’s anticipation, and doctor’s proactivity, are found most highly significant by both methods. These six factors are potential candidates for constructing a future UI predictive index.
Development of Alloy 718 tubular product for nuclear-reactor internals
International Nuclear Information System (INIS)
1981-01-01
The Upper Internals Structure (UIS) of the Clinch River Breeder Reactor Plant (CRBRP) provides mixing and flow direction of the core outlet flow. Alloy 718 tubes are the major components used in the UIS to provide this flow direction. The UIS is located directly above the reactor core and is exposed to a severe environment. This environment consists of high temperature sodium, alternating temperatures induced by mixing high temperature core assembly outlet flow with cooler core assembly outlet flow and rapid changes in temperature of the core outlet flow. The paper presents the UIS configuration, functions and environmental conditions that led to the selection of Alloy 718 as the material used to protect the basic UIS structure and to provide flow direction. The use of Alloy 718 is derived from the technology produced from the Department of Energy sponsored development programs. Alloy 718 tubes are made by a roll-extrusion process. The paper describes the tube fabrication process, the development of a finish sanding procedure and the results of high temperature thermal cycle testing. The high temperature thermal cycle testing generates peak strains on the metal surfaces, where the surface effects have a maximum influence on the fatigue strength. 9 figs., 2 tabs
Postrzeganie problemu nietrzymania moczu przez kobiety w Polsce
Directory of Open Access Journals (Sweden)
Piotr Radziszewski
2011-10-01
Full Text Available Objectives: Assessment of perception of urinary incontinence (UI among women in Poland.Materials and methods: The Centre for Public Opinion Research TNS OBOP conducted a multisubjectthematic, face-to-face interview, in the homes of respondents. Questioning about the quality of life was carriedon in two successive editions of the survey from 4 to 7 and from 11 to 14 February 2010. The study was performedon a nationwide random sample of 855 women aged 35 and older.Results: The most troublesome consequences of UI are odour (44%, leaking of urine (43%, lack of controlover own body (31%, unexpected search for toilets (24%, feeling of moisture (22% and fear of the reaction ofothers (15%. Most frequently indicated ways to improve the quality of life for women with UI are a visitto the doctor (57%, the use of anatomical inserts (33% and pelvic floor muscle exercise (21%. Sense ofattractiveness is retained for 53% of Polish women with UI, 25% do not feel attractive as a woman and 22%have no opinion on this subject.Conclusion: The problem of UI is common and is associated with reduction in quality of life. However, thosewho benefit from medical consultations, hygiene products (anatomical pads or pelvic floor muscle exercisesoften retain a sense of attractiveness.
Öz, Özge; Altay, Birsen
The purpose of this study was to examine associations among sociodemographic characteristics, urinary incontinence (UI) characteristics, UI-specific quality of life and self-esteem, and use of complementary and alternative medicine (CAM) interventions for UI. Correlational-descriptive research. This sample comprised 394 female patients 18 years or older cared for in the urology and gynecology outpatient clinics of a university hospital in Samsun, Turkey. Participants completed an investigator-developed questionnaire that included 2 validated instruments, King's Health Questionnaire (KHQ) and the Rosenberg Self-esteem Scale. Descriptive statistics were used for demographic data and use of CAM interventions. Variables associated with CAM use were assessed using χ analysis. The differences between using CAM and scales points of the KHQ and the Rosenberg Self-esteem Scale were assessed using the t test, and the relationship between the KHQ and the Rosenberg Self-esteem Scale was assessed using correlation analysis. Thirty-three percent (n = 130) of women indicated using CAM interventions to manage their UI. The most common CAM intervention, reported by 52.6% of respondents, was prayer. Women with lower UI-specific quality of life and self-esteem scores were more likely to report using CAM interventions (P self-esteem and condition-specific health-related quality of life than women who did not use these interventions.
International Nuclear Information System (INIS)
Bafarag, Saeed Mohamed Ibrahim
2001-05-01
In this study 35 breast cancer patients were followed during their treatment in Radiation and Isotope Center of Khartoum (RICK) using breast cancer antigen CA 15-3 as an indicator of tumor marker. They were classified into three categories of CA 15-3 concentration level as stated by Colomer and Genolla (1989) as follows: normal level less than 40 UI/ml, moderate level more than 40 UI/ml and less than 60 UI/ml, and high level, more than 60 UI/ml to 3000 UI/ml. A 5 ml of venous blood samples' were collected using sterile syringes from patients with different stage of breast cancer. The sample size were thirty-five cases, one of the cases is rejected because the patient discontinued the treatment. The blood samples were collected as follows: before starting the treatment course, at the mid time of treatment course, after completion the treatment course, and after one month of completion of the treatment course. The patients classified into two groups according to their treatment protocol. The first group received only external radiation therapy treatment and those were 18 patients out of 35, while the second group received combined therapy and those were 16 patients out of 35. For those whom received external radiation radiation therapy only, the results showed that the mean value of CA 15-3 concentration level decreased at the mid of the treatment as follows: 26±3 UI/ml, 24±3 UI/ml, 22±3 UI/ml respectively, while the mean value of CA 15-3 concentration level before starting the treatment was found to be 46±14 UI/ml. The number of the patients in the normal concentration level of CA 15-3 increased by 11% at the mid of external radiotherapy treatment and by 13% at the mid combined therapy, while the moderate level decreased by 6% for both external radiotherapy and combined therapy, while the number of patients within the high level decreased by 5% for external radiotherapy and 7% for combined therapy. After completion and after one month of completion of external
International Nuclear Information System (INIS)
Andrade-Tacca, Cesar Augusto; Chang, Chia-Chi; Chen, Yi-Hung; Ji, Dar-Ren; Wang, Yi-Yu; Yen, Yue-Quen; Chang, Ching-Yuan
2014-01-01
Highlights: • Ultrasonic irradiation (UI) can auto-induce temperature rise. • Esterification at higher temperature (T) by UI offers greater reduction of acid value. • Sequential UI and catalyst dosing enhance esterification conversion efficiency (η). • UR of jatropha oil at higher T results in less water content on ester as product. • A 99.35% of η is achievable via sequential UI and dosing of 5 mL per dose. - Abstract: Production of jatropha-ester (JO-ester) from jatropha oil (JO) under sequential direct-ultrasonic irradiation (UI) with auto-induced temperature rise followed by adding a mixture of methanol/sulfuric-acid catalyst (M/C) dose between high temperature intervals was studied. Comparisons with various doses of 5, 10, 16.6 and 25 mL at different temperature intervals of 108.9–120 °C, 100–120 °C, 85–120 °C and 75–120 °C respectively were performed. System parameters examined include: esterification times (t E ) for UI, settling time (t S ) after esterification and temperature (T). Properties of acid value (AV), iodine value (IV), kinematic viscosity (kV), density (ρ LO ) and water content (m w ) of JO and JO-ester product were measured. The esterification conversion efficiencies (η) were determined and assessed. An η of 99.35% was obtained at temperature interval of 108.9–120 °C with 5 mL per dose for 20 doses and t E of 167.39 min (denoted as Process U 120-5 ), which is slightly higher than η of 98.87% at temperature interval of 75–120 °C with 25 mL per dose for 4 doses and t E of 108.79 min (noted as Process U 120-25 ). The JO-ester obtained via sequential UI with adding doses of 5 mL possess AV of 0.24 mg KOH/g, IV of 124.77 g I 2 /100 g, kV of 9.89 mm 2 /s, ρ LO of 901.73 kg/m 3 and m w of 0.3 wt.% showing that sequential UI and dose at higher temperature interval can give higher reduction of AV compared with 36.56 mg KOH/g of original oil. The effects of t S and t E on AV are of minor and moderate importance
Model driven development of user interface prototypes
DEFF Research Database (Denmark)
Störrle, Harald
2010-01-01
the whole UI development life cycle, connect all stakeholders involved, and support a wide range of levels of granularity and abstraction. This is achieved by using Window/Event-Diagrams (WEDs), a UI specification notation based on UML 2 state machines. It affords closer collaboration between different user...
Penile vibratory stimulation in the treatment of post-prostatectomy incontinence
DEFF Research Database (Denmark)
Fode, Mikkel; Sønksen, Jens
2015-01-01
AIMS: To examine penile vibratory stimulation (PVS) in the treatment of post-prostatectomy urinary incontinence (UI). METHODS: Patients with post-prostatectomy UI were included in a 12-week trial. A 24-hr pad test and a 72-hr voiding diary were collected at baseline. Participants were randomized ...
Kroger, Edeltraut; Van Marum, Rob; Souverein, Patrick; Carmichael, Pierre Hugues; Egberts, Toine
2015-01-01
Treatment of Alzheimer disease (AD) with cholinesterase inhibitors (ChEIs) may increase the risk of urinary incontinence (UI). Objective: To assess whether ChEI use was associated with the risk of UI among older patients with AD. Methods: A crossover cohort study using the PHARMO Record Linkage
Kroger, Edeltraut; Van Marum, Rob; Souverein, Patrick; Carmichael, Pierre Hugues; Egberts, Toine
2015-01-01
Treatment of Alzheimer disease (AD) with cholinesterase inhibitors (ChEIs) may increase the risk of urinary incontinence (UI). Objective: To assess whether ChEI use was associated with the risk of UI among older patients with AD. Methods: A crossover cohort study using the PHARMO Record Linkage
DEFF Research Database (Denmark)
Tibaek, Sigrid; Dehlendorff, Christian
2012-01-01
‐PSS‐1 questionnaire contains more specific UI information compared to the Barthel Index. Fewer stroke patients reported UI by the Barthel Index compared to the DAN‐PSS‐1 questionnaire and moreover the DAN‐PSS‐1 questionnaire enables identification of different UI‐types. The Barthel Index...
Directory of Open Access Journals (Sweden)
Luz Velásquez
2013-06-01
Full Text Available Se ha purificado una toxina (Hm3 del veneno del escorpión Hadruroides mauryi, por cromatografía de intercambio iónico en CM-Sephadex C-25 con buffer acetato de amonio 0,05M, pH 7. La toxina produce contracción y parálisis en la extremidad inoculada de ratones albinos y se caracteriza por ser de naturaleza básica y tener un peso molecular de 4,5 kDa. Después de 45 minutos de ser inoculada en el músculo gastrocnemius de ratones albinos, Hm3 (30,4 µg aumenta los niveles plasmáticos de creatina kinasa desde 252,6 UI/L hasta 3779,3 UI/L y de lactato deshidrogenasa, desde 142,7 UI/L hasta 248,2 UI/L; igualmente incrementa los niveles de calcio intramuscular desde 34,1 nmoles hasta 69,3 nmoles. Esta toxina carece de actividad proteolítica y fosfolipásica.
A Case Study of User-Centred Design in Four Swiss RUP Projects
Directory of Open Access Journals (Sweden)
Ljiljana Vukelja
2010-01-01
Full Text Available We analysed four Rational Unified Process (RUP projects in Switzerland that identified themselves as following a user-centred approach. Grounded theory served for analysis of 12 interviews with software developers, project managers, and UI specialists. For each professional group we analysed their work context, motivations, work practices, and strategies used to overcome the obstacles to user-centred design. Results show that end users did not participate in the projects. Instead of working directly with end users, participants used data from marketing research or consulted colleagues from other departments. Prototypes played an important role. We suggest the following remedies: (1 developing methods for easy integration of existing company knowledge about products with usability features, (2 professionalising UI design by educating project stakeholders in standard UI design, (3 creating an approved pool of company's personas for UI specialists' work, and (4 educating customers on their right to get good user interfaces.
Sex Differences in Stroke Incidence, Prevalence, Mortality and Disability-Adjusted Life Years
DEFF Research Database (Denmark)
Barker-Collo, Suzanne; Bennett, Derrick A; Krishnamurthi, Rita V
2015-01-01
BACKGROUND: Accurate information on stroke burden in men and women are important for evidence-based healthcare planning and resource allocation. Previously, limited research suggested that the absolute number of deaths from stroke in women was greater than in men, but the incidence and mortality...... incidence, prevalence, mortality, disability-adjusted life years (DALYs) and healthy years lost due to disability were estimated as part of the Global Burden of Disease (GBD) 2013 Study. Data inputs included all available information on stroke incidence, prevalence and death and case fatality rates...... ischemic stroke (IS) and hemorrhagic stroke (HS) incidence (per 100,000) in men (IS 132.77 (95% UI 125.34-142.77); HS 64.89 (95% UI 59.82-68.85)) exceeded those of women (IS 98.85 (95% UI 92.11-106.62); HS 45.48 (95% UI 42.43-48.53)). IS incidence rates were lower in 2013 compared with 1990 rates for both...
Effect of isostretching on the quality of life of incontinent older women
Directory of Open Access Journals (Sweden)
Luana Weigert Kachorovski
Full Text Available Abstract Introduction : Urinary incontinence (UI can be defined as a brief involuntary loss of urine. It is a hygienic and social problem that affects mainly older women and contributes to reduced quality of life (QoL. There are currently several therapeutic strategies available for the treatment of UI, including the method of Isometric Stretching, which is based on balance exercises that lead to greater flexibility and stronger joints, tendons and muscles. Objective : To investigate the effect of Isometric Stretching on the QoL of 10 institutionalized older women with complaint of UI. Materials and methods : We used the ICIQ-SF to assess women's QoL pre- and post-treatment. The study duration was 12 weeks. Results : 80% of the women showed a significant improvement in UI (p = 0.007061 and QoL (p = 0.011. Conclusion : We concluded that Isometric Stretching contributed to a significant improvement in urinary incontinence symptoms and quality of life in incontinent older women.
Directory of Open Access Journals (Sweden)
Mercy Manyema
Full Text Available Type 2 diabetes poses an increasing public health burden in South Africa (SA with obesity as the main driver of the epidemic. Consumption of sugar sweetened beverages (SSBs is linked to weight gain and reducing SSB consumption may significantly impact the prevalence of obesity and related diseases. We estimated the effect of a 20% SSB tax on the burden of diabetes in SA.We constructed a life table-based model in Microsoft Excel (2010. Consumption data from the 2012 SA National Health and Nutrition Examination Survey, previously published own- and cross-price elasticities of SSBs and energy balance equations were used to estimate changes in daily energy intake and its projected impact on BMI arising from increased SSB prices. Diabetes relative risk and prevalent years lived with disability estimates from the Global Burden of Disease Study and modelled disease epidemiology estimates from a previous study were used to estimate the effect of the BMI changes on diabetes burden. Diabetes cost estimates were obtained from the South African Council for Medical Schemes. Over 20 years, a 20% SSB tax could reduce diabetes incident cases by 106 000 in women (95% uncertainty interval (UI 70 000-142 000 and by 54 000 in men (95% UI: 33 000-80 000; and prevalence in all adults by 4.0% (95% UI: 2.7%-5.3%. Cumulatively over twenty years, approximately 21 000 (95% UI: 14 000-29 000 adult T2DM-related deaths, 374 000 DALYs attributed to T2DM (95% UI: 299 000-463 000 and over ZAR10 billion T2DM healthcare costs (95% UI: ZAR6.8-14.0 billion equivalent to USD860 million (95% UI: USD570 million-USD1.2 billion may be averted.Fiscal policy on SSBs has the potential to mitigate the diabetes epidemic in South Africa and contribute to the National Department of Health goals stated in the National NCD strategic plan.
Manyema, Mercy; Veerman, J Lennert; Chola, Lumbwe; Tugendhaft, Aviva; Labadarios, Demetre; Hofman, Karen
2015-01-01
Type 2 diabetes poses an increasing public health burden in South Africa (SA) with obesity as the main driver of the epidemic. Consumption of sugar sweetened beverages (SSBs) is linked to weight gain and reducing SSB consumption may significantly impact the prevalence of obesity and related diseases. We estimated the effect of a 20% SSB tax on the burden of diabetes in SA. We constructed a life table-based model in Microsoft Excel (2010). Consumption data from the 2012 SA National Health and Nutrition Examination Survey, previously published own- and cross-price elasticities of SSBs and energy balance equations were used to estimate changes in daily energy intake and its projected impact on BMI arising from increased SSB prices. Diabetes relative risk and prevalent years lived with disability estimates from the Global Burden of Disease Study and modelled disease epidemiology estimates from a previous study were used to estimate the effect of the BMI changes on diabetes burden. Diabetes cost estimates were obtained from the South African Council for Medical Schemes. Over 20 years, a 20% SSB tax could reduce diabetes incident cases by 106 000 in women (95% uncertainty interval (UI) 70 000-142 000) and by 54 000 in men (95% UI: 33 000-80 000); and prevalence in all adults by 4.0% (95% UI: 2.7%-5.3%). Cumulatively over twenty years, approximately 21 000 (95% UI: 14 000-29 000) adult T2DM-related deaths, 374 000 DALYs attributed to T2DM (95% UI: 299 000-463 000) and over ZAR10 billion T2DM healthcare costs (95% UI: ZAR6.8-14.0 billion) equivalent to USD860 million (95% UI: USD570 million-USD1.2 billion) may be averted. Fiscal policy on SSBs has the potential to mitigate the diabetes epidemic in South Africa and contribute to the National Department of Health goals stated in the National NCD strategic plan.
The Communicative Ability of Universiti Teknologi MARA Sarawak's Graduates
Hassan, Sharifah Zakiah Wan; Hakim, Simon Faizal; Rahim, Mahdalela; Noyem, John Francis; Ibrahim, Sueb; Ahmad, Johnny; Jusoff, Kamaruzaman
2009-01-01
This study explores Universiti Teknologi MARA (UiTM) Sarawak graduating students' oral proficiency, focusing on grammatical accuracy. Oral proficiency in English has always been the benchmark of language proficiency, and in the context of UiTM's language teaching curriculum, efforts to enhance students' oral proficiency are implemented through…
Directory of Open Access Journals (Sweden)
Rolando Felipe Ochoa.
2006-08-01
Full Text Available Se realizó un estudio aleatorizado, controlado y a doble ciegas en 225 adolescentes cubanos entre 13 y 16 años de edad, con el objetivo de evaluar la reactogenicidad y la inmunogenicidad de una nueva vacuna de toxoide tetánico y toxoide diftérico con concentración reducida, producida en el Instituto Finlay, con respecto a su similar comercial IMOVAX dT adult de Aventis Pasteur. Se tomaron muestras de suero antes y 21 días después de la vacunación. La reactogenicidad de ambas vacunas fue similar. Los síntomas y signos, tanto locales como generales fueron moderados y aparecieron principalmente durante las primeras 72 h después de la vacunación. Todos los voluntarios vacunados alcanzaron niveles protectores (³0,1 UI/mL de antitoxina contra el tétanos y la difteria. El 99,25% de los inmunizados con la vacuna experimental y el 98,36% de los voluntarios del grupo control presentaron niveles de antitoxina tetánica correspondientes a una protección de larga duración (³1,0 UI/mL; para la antitoxina diftérica se alcanzaron estos niveles en el 81,20% y 80,33% de los voluntarios en cada grupo. Los títulos medios geométricos de antitoxina tetánica (21,73 UI/mL y antitoxina diftérica (2,55 UI/mL inducidos por la nueva vacuna fueron superiores (p<0,05 a los del grupo control: 15,55 UI/mL y 1,84 UI/Ml respectivamente(p<0.05.
Directory of Open Access Journals (Sweden)
Dias F.E.F.
2001-01-01
Full Text Available Utilizou-se a sincronização do estro com esponjas vaginais de 30mg de acetato de fluorogestona durante 12 dias para avaliar o efeito de diferentes doses de eCG sobre o desempenho reprodutivo de ovelhas. Na retirada das esponjas as ovelhas foram divididas em três grupos para receberem 0 (n=26, 200 (n=30 ou 400UI (n=30 de eCG. O estro foi detectado a cada 12h utilizando-se um rufião. As fêmeas foram inseminadas por laparoscopia 60h após a retirada das esponjas. Realizaram-se colheitas de sangue aos 5 e 18 dias pós-inseminação para dosagem de progesterona e determinação do número de ovulações e prenhezes, respectivamente. A fertilidade foi verificada por ecografia aos 60 dias e ao parto. Das 86 ovelhas 70,9% apresentaram estro. Essa porcentagem foi maior (P<0,05 nas fêmeas tratadas com eCG: 96,7% (400UI e 76,7% (200UI versus 34,6% (0 UI. O intervalo entre o final do tratamento e o início do estro foi maior (P<0,05 no grupo sem eCG, 54,7±6,3h versus 45,9±7,8h para 200UI e 40,4±10,3h para 400UI. Verificou-se menor (P<0,05 número de ovulações e prenhezes no grupo sem eCG. A não aplicação de eCG influiu negativamente no desempenho reprodutivo de ovelhas deslanadas.
Selective Media for Actinide Collection and Pre-Concentration: Results of FY 2006 Studies
Energy Technology Data Exchange (ETDEWEB)
Lumetta, Gregg J.; Addleman, Raymond S.; Hay, Benjamin P.; Hubler, Timothy L.; Levitskaia, Tatiana G.; Sinkov, Sergey I.; Snow, Lanee A.; Warner, Marvin G.; Latesky, Stanley L.
2006-11-17
In this work, we have investigated new materials for potential use in automated radiochemical separations. The work can be divided into three primary tasks: (1) synthesis of new ligands with high affinity for actinide ions, (2) evaluation of new materials for actinide ion affinity, and (3) computational design of advanced ligand architectures for highly selective binding of actinide ions. Ligand Synthesis Work was conducted on synthesizing Kl?ui ligand derivatives containing functionalized pendant groups on the cyclopentadienyl ring. The functionalized pendent groups would allow these ligands to be attached to organic and inorganic solid supports. This work focused on synthesizing the compound Na[Cp?Co(PO(OC2H5)2)3], where Cp?= C5H4C(O)OCH3. Synthesizing this compound is feasible, but the method used in FY 2006 produced an impure material. A modified synthetic scheme has been developed and will be pursued in FY 2007. Work was also initiated on synthesizing bicyclic diamides functionalized for binding to polymeric resins or other surfaces. Researchers at the University of Oregon are collaborators in this work. To date, this effort has focused on synthesizing and characterizing a symmetrically substituted bicyclic diamide ligand with the ?COOH functionality. Again, this synthetic effort will continue into FY 2007. Separations Material Evaluation Work was conducted in FY 2006 to provide a more extensive set of data on the selectivity and affinity of extraction chromatography resins prepared by sorption of Kl?ui ligand onto an inert macroreticular polymeric support. Consistent with previous observations, it was found that these materials strongly bind tetravalent actinides. These materials also adsorb trivalent actinides at low nitric acid concentrations, but the affinity for the trivalent actinides decreases with increasing nitric acid concentration. These materials have relatively low affinity for U(VI), but they do sorb U(VI) to a greater extent than Am(III) at [HNO
Directory of Open Access Journals (Sweden)
F. Sanchis-Gomar
2010-12-01
Full Text Available
Publicaciones recientes reflejan la preocupación de las autoridades antidopaje por el uso de sistemas simuladores de altitud y la posibilidad de considerarlos métodos dopantes. El objetivo de nuestro estudio fue el de comparar las modificaciones hematológicas inducidas por dos tratamientos con eritropoyetina recombinante humana (rHuEpo a diferentes dosis, frente a un protocolo de hipoxia normobárica intermitente (HNI en un modelo animal.
Veinticuatro ratas Wistar macho jóvenes fueron divididas en 3 grupos experimentales: grupo sometido a HNI (12h pO2 12% /12h pO2 21% (n=8; grupo tratado con una dosis de 300 UI de rHuEpo (n=8 y grupo tratado con 500 UI de rHuEpo (n=8. Se extrajeron dos muestras de sangre a cada uno de los grupos experimentales (antes y después de los tratamientos. Nuestros resultados muestran incrementos muy similares, y estadísticamente significativos, en los valores de hemoglobina, de hematocrito y de reticulocitos, tanto en el grupo HNI como en el grupo tratado con 300 UI de rHuEpo tras los 15 días de tratamiento. El tratamiento con 500 UI de rHuEpo produjo un incremento significativamente mayor.
La principal conclusión de nuestro estudio es que las modificaciones de los parámetros hematológicos obtenidas mediante un protocolo de HNI son similares a las obtenidas con un tratamiento con 300 UI de rHuEpo.
Palabras clave: Hemoglobina, hematocrito, reticulocitos, dopaje
Selective Media for Actinide Collection and Pre-Concentration: Results of FY 2006 Studies
International Nuclear Information System (INIS)
Lumetta, Gregg J.; Addleman, Raymond S.; Hay, Benjamin P.; Hubler, Timothy L.; Levitskaia, Tatiana G.; Sinkov, Sergey I.; Snow, Lanee A.; Warner, Marvin G.; Latesky, Stanley L.
2006-01-01
In this work, we have investigated new materials for potential use in automated radiochemical separations. The work can be divided into three primary tasks: (1) synthesis of new ligands with high affinity for actinide ions, (2) evaluation of new materials for actinide ion affinity, and (3) computational design of advanced ligand architectures for highly selective binding of actinide ions. Ligand Synthesis Work was conducted on synthesizing Kl?ui ligand derivatives containing functionalized pendant groups on the cyclopentadienyl ring. The functionalized pendent groups would allow these ligands to be attached to organic and inorganic solid supports. This work focused on synthesizing the compound Na[Cp?Co(PO(OC2H5)2)3], where Cp?C5H4C(O)OCH3. Synthesizing this compound is feasible, but the method used in FY 2006 produced an impure material. A modified synthetic scheme has been developed and will be pursued in FY 2007. Work was also initiated on synthesizing bicyclic diamides functionalized for binding to polymeric resins or other surfaces. Researchers at the University of Oregon are collaborators in this work. To date, this effort has focused on synthesizing and characterizing a symmetrically substituted bicyclic diamide ligand with the ?COOH functionality. Again, this synthetic effort will continue into FY 2007. Separations Material Evaluation Work was conducted in FY 2006 to provide a more extensive set of data on the selectivity and affinity of extraction chromatography resins prepared by sorption of Kl?ui ligand onto an inert macroreticular polymeric support. Consistent with previous observations, it was found that these materials strongly bind tetravalent actinides. These materials also adsorb trivalent actinides at low nitric acid concentrations, but the affinity for the trivalent actinides decreases with increasing nitric acid concentration. These materials have relatively low affinity for U(VI), but they do sorb U(VI) to a greater extent than Am(III) at [HNO3
Urinary Incontinence due to Overactive Detrusor Muscle: A Rare Side Effect of Venlafaxine
Directory of Open Access Journals (Sweden)
Vithyalakshmi Selvaraj
2015-01-01
Full Text Available We report a case of reemergence of urinary incontinence (UI in a patient with benign prostatic hyperplasia (BPH after starting treatment with venlafaxine who was stabilized on tamsulosin and finasteride for about 6 years. A 66-year-old Caucasian male with prior history of major depressive disorder developed UI within a week of starting venlafaxine 75 mg per day. He described symptoms in the form of involuntary leakage of urine both during the day and at night. His symptoms of UI resolved after stopping the venlafaxine. To the best of our knowledge, there are only four case reports of venlafaxine induced urinary incontinence which have been published.
Data Management Applications for the Service Preparation Subsystem
Luong, Ivy P.; Chang, George W.; Bui, Tung; Allen, Christopher; Malhotra, Shantanu; Chen, Fannie C.; Bui, Bach X.; Gutheinz, Sandy C.; Kim, Rachel Y.; Zendejas, Silvino C.;
2009-01-01
These software applications provide intuitive User Interfaces (UIs) with a consistent look and feel for interaction with, and control of, the Service Preparation Subsystem (SPS). The elements of the UIs described here are the File Manager, Mission Manager, and Log Monitor applications. All UIs provide access to add/delete/update data entities in a complex database schema without requiring technical expertise on the part of the end users. These applications allow for safe, validated, catalogued input of data. Also, the software has been designed in multiple, coherent layers to promote ease of code maintenance and reuse in addition to reducing testing and accelerating maturity.
Directory of Open Access Journals (Sweden)
Avelino Albas
1998-08-01
Full Text Available Humoral immune response using inactivated rabies vaccine was studied in 35 nelore cross-bred bovines of western region of São Paulo state. Ninety days after vaccination, 13 (92.8% animals presented titers 30.5IU/ml, through mouse neutralization test. After 180 days, 9 (64.3% sera showed titers 30.5IU/ml, after 270 days, only one (7.1% showed a titer of 0.51IU/ml, and after 360 days, all animals showed titers 0.5IU/ml. At 180 days, 17 (80.9% sera presented titers > 0.5IU/ml; at 270 days, 15 (71.4%, with titers 30.5IU/ml and at 360 days, 4 (19.0%, with titers 30.5IU/ml. Booster-dose ensured high levels of neutralizing antibodies for at least three months, and 240 days after revaccination, 71.4% of animals were found with titers 30.5IU/ml.A resposta humoral com vacina anti-rábica inativada foi estudada em 35 bovinos mestiços de raça nelore, na região oeste do estado de São Paulo. Noventa dias após a primo-vacinação, 13 (92,8% animais apresentaram títulos 30,5UI/ml, através da prova de soroneutralização em camundongos. Após 180 dias, 9 (64,3% soros evidenciaram títulos 30,5UI/ml; após 270 dias, apenas 1 (7,1% soro demonstrou título = 0,51 UI/ml. O grupo que recebeu dose de reforço 30 dias após primo-vacinação apresentou, dois meses depois, 21 animais com títulos > 0,5UI/ml. Aos 180 dias, 17 (80,9% soros apresentaram títulos > 0,5UI/ml; aos 270 dias, 15 (71,4% soros com títulos 30,5UI/ml; aos 360 dias, 4 (19,0% com títulos 30,5UI/ml. O reforço proporcionou nível elevado de anticorpos, por um período de três meses ou mais e, 240 dias após a revacinação, 71,4% dos animais apresentou títulos 30,5UI/ml.
Directory of Open Access Journals (Sweden)
Emilia Rosa Rieumont
2009-06-01
Full Text Available Uno de los pilares fundamentales para el control, eliminación de la hepatitis tipo B es la utilización de la vacunas que se aplica en Cuba, desde el año 1992. (Heberbiovac -HB. La inmunogenicidad, indicador que se obtiene mediante la cuantificación de Títulos de Anticuerpos (Anti-HBs contra el antígeno de superficie (HBsAg post vacunación permite conocer la eficacia y calidad de la vacuna. En este estudio se utilizó el método inmunoenzimático (ELISA tipo sandwich, llevado a cabo por el Departamento de Hepatitis B. del Laboratorio de Inmunología del Centro Nacional de Genética Médica, Ciudad Habana, considerándose protegidos los individuos cuyos resultados estaban entre ³10 UI/L y One of the mainstays to control and eliminate hepatitis-B is the use of the vaccines (Herberbiovac-HB applied in Cuba since 1992. The immunogenicity, an indicator obtained through the quantification of the Antibodies Titers (Anti-HBs against the surface antigens (HbsAg post-vaccination, allowing knowing the effectiveness and quality of the vaccine. The immunoenzymatic method was used in this study kind of sandwich (ELISA, carried out by the Department for the study of Hepatitis B of the Immunology Laboratory in the National Center of Medical Genetics, Havana City. The individuals which results were between =10 UI/L and < 100 UI/L, Hyperresponsers = 100 UI/L are considered protected and sero-unprotected when the titers were < 10 UI/L; in 498 children of 10 years old that were vaccinated in the early childhood having the schedule (0-16 months of negative mothers for HBsAg, belonging to Consolacion del Sur in Pinar del Rio province. Results showed that male sex, Hypersensibilities Type I and the boys and girls maintaining treatments with immunosupresor drugs were the risk factors that provided the association with the serum-unprotection; as for in the individuals having Titers of Ac < 10 UI/L; a buster of the vaccine was applied and after 15 days the 100% of
Baker, Dorothy I.; Bice, Thomas W.
1995-01-01
A retrospective cohort design is used to estimate the effect of urinary incontinence (UI) on the public costs of home care services to elderly individuals. Multivariate analyses controlling for other individual, household, and supply characteristics demonstrate that those with UI generate significantly greater public costs for home care services.…
Göral Türkcü, Sinem; Kukulu, Kamile
2017-11-01
This study was conducted to determine the effect of urinary incontinence (UI) on the quality of life of women living in nursing homes in the Mediterranean region of Turkey. The study was conducted on 95 women living in nursing homes in the Mediterranean region. Data were collected from a questionnaire on sociodemographic characteristics, the Urinary Incontinence Quality of Life Scale, the Index of Activities of Daily Living, and the International Consultation on Incontinence Questionnaire Short Form. The quality of life of women who did not consider UI a health problem was significantly higher than that of those who considered otherwise. Mixed UI was the most common UI type among the women living in nursing homes, with a rate of 31.7%. According to the overall mean scores on the Urinary Incontinence Quality of Life Scale, quality of life was the most affected among women who had nocturnal incontinence. Quality of life was affected from most to least by the mixed type, stress type, and urge type of incontinence. Early diagnosis and treatment of UI could be improved if health professionals, who have a unique role in changing the perception of society, offered training to women experiencing incontinence. Identifying this problem and determining and preventing the risk factors are important for enhancing women's quality of life. © 2017 Japanese Psychogeriatric Society.
Kirk, Martyn D; Pires, Sara M; Black, Robert E; Caipo, Marisa; Crump, John A; Devleesschauwer, Brecht; Döpfer, Dörte; Fazil, Aamir; Fischer-Walker, Christa L; Hald, Tine; Hall, Aron J; Keddy, Karen H; Lake, Robin J; Lanata, Claudio F; Torgerson, Paul R; Havelaar, Arie H; Angulo, Frederick J
2015-12-01
Foodborne diseases are important worldwide, resulting in considerable morbidity and mortality. To our knowledge, we present the first global and regional estimates of the disease burden of the most important foodborne bacterial, protozoal, and viral diseases. We synthesized data on the number of foodborne illnesses, sequelae, deaths, and Disability Adjusted Life Years (DALYs), for all diseases with sufficient data to support global and regional estimates, by age and region. The data sources included varied by pathogen and included systematic reviews, cohort studies, surveillance studies and other burden of disease assessments. We sought relevant data circa 2010, and included sources from 1990-2012. The number of studies per pathogen ranged from as few as 5 studies for bacterial intoxications through to 494 studies for diarrheal pathogens. To estimate mortality for Mycobacterium bovis infections and morbidity and mortality for invasive non-typhoidal Salmonella enterica infections, we excluded cases attributed to HIV infection. We excluded stillbirths in our estimates. We estimate that the 22 diseases included in our study resulted in two billion (95% uncertainty interval [UI] 1.5-2.9 billion) cases, over one million (95% UI 0.89-1.4 million) deaths, and 78.7 million (95% UI 65.0-97.7 million) DALYs in 2010. To estimate the burden due to contaminated food, we then applied proportions of infections that were estimated to be foodborne from a global expert elicitation. Waterborne transmission of disease was not included. We estimate that 29% (95% UI 23-36%) of cases caused by diseases in our study, or 582 million (95% UI 401-922 million), were transmitted by contaminated food, resulting in 25.2 million (95% UI 17.5-37.0 million) DALYs. Norovirus was the leading cause of foodborne illness causing 125 million (95% UI 70-251 million) cases, while Campylobacter spp. caused 96 million (95% UI 52-177 million) foodborne illnesses. Of all foodborne diseases, diarrheal and
Directory of Open Access Journals (Sweden)
Martyn D Kirk
2015-12-01
Full Text Available Foodborne diseases are important worldwide, resulting in considerable morbidity and mortality. To our knowledge, we present the first global and regional estimates of the disease burden of the most important foodborne bacterial, protozoal, and viral diseases.We synthesized data on the number of foodborne illnesses, sequelae, deaths, and Disability Adjusted Life Years (DALYs, for all diseases with sufficient data to support global and regional estimates, by age and region. The data sources included varied by pathogen and included systematic reviews, cohort studies, surveillance studies and other burden of disease assessments. We sought relevant data circa 2010, and included sources from 1990-2012. The number of studies per pathogen ranged from as few as 5 studies for bacterial intoxications through to 494 studies for diarrheal pathogens. To estimate mortality for Mycobacterium bovis infections and morbidity and mortality for invasive non-typhoidal Salmonella enterica infections, we excluded cases attributed to HIV infection. We excluded stillbirths in our estimates. We estimate that the 22 diseases included in our study resulted in two billion (95% uncertainty interval [UI] 1.5-2.9 billion cases, over one million (95% UI 0.89-1.4 million deaths, and 78.7 million (95% UI 65.0-97.7 million DALYs in 2010. To estimate the burden due to contaminated food, we then applied proportions of infections that were estimated to be foodborne from a global expert elicitation. Waterborne transmission of disease was not included. We estimate that 29% (95% UI 23-36% of cases caused by diseases in our study, or 582 million (95% UI 401-922 million, were transmitted by contaminated food, resulting in 25.2 million (95% UI 17.5-37.0 million DALYs. Norovirus was the leading cause of foodborne illness causing 125 million (95% UI 70-251 million cases, while Campylobacter spp. caused 96 million (95% UI 52-177 million foodborne illnesses. Of all foodborne diseases, diarrheal
School Nurse Interventions in Managing Functional Urinary Incontinence in School-Age Children
Rivers, Charisse L.
2010-01-01
Uncomplicated urinary incontinence (UI) in school-age children is a prevalent yet underrecognized problem that has remained in the shadow of other concerns commonly perceived as more prominent or urgent. There is good evidence that functional UI in children can be treated and managed effectively. When there is no structural or neurologic…
Kang, Diana; Han, Julia; Neuberger, Molly M; Moy, M Louis; Wallace, Sheila A; Alonso-Coello, Pablo; Dahm, Philipp
2015-03-18
Transurethral radiofrequency collagen denaturation is a relatively novel, minimally invasive device-based intervention used to treat individuals with urinary incontinence (UI). No systematic review of the evidence supporting its use has been published to date. To evaluate the efficacy of transurethral radiofrequency collagen denaturation, compared with other interventions, in the treatment of women with UI.Review authors sought to compare the following.• Transurethral radiofrequency collagen denaturation versus no treatment/sham treatment.• Transurethral radiofrequency collagen denaturation versus conservative physical treatment.• Transurethral radiofrequency collagen denaturation versus mechanical devices (pessaries for UI).• Transurethral radiofrequency collagen denaturation versus drug treatment.• Transurethral radiofrequency collagen denaturation versus injectable treatment for UI.• Transurethral radiofrequency collagen denaturation versus other surgery for UI. We conducted a systematic search of the Cochrane Incontinence Group Specialised Register (searched 19 December 2014), EMBASE and EMBASE Classic (January 1947 to 2014 Week 50), Google Scholar and three trials registries in December 2014, along with reference checking. We sought to identify unpublished studies by handsearching abstracts of major gynaecology and urology meetings, and by contacting experts in the field and the device manufacturer. Randomised and quasi-randomised trials of transurethral radiofrequency collagen denaturation versus no treatment/sham treatment, conservative physical treatment, mechanical devices, drug treatment, injectable treatment for UI or other surgery for UI in women were eligible. We screened search results and selected eligible studies for inclusion. We assessed risk of bias and analysed dichotomous variables as risk ratios (RRs) with 95% confidence intervals (CIs) and continuous variables as mean differences (MDs) with 95% CIs. We rated the quality of
Directory of Open Access Journals (Sweden)
Larissa Amorim Catunda Sampaio
2015-06-01
Full Text Available O objetivo da pesquisa foi mapear as competências gerenciais necessárias aos gerentes das unidades de informação (UI dos Tribunais Superiores do Poder Judiciário Brasileiro. Para o embasamento teórico, o enfoque sistêmico foi utilizado como base para a compreensão do ambiente organizacional em que as UIs atuavam, ao considerar o sistema organizacional maior (Poder Judiciário, os sistemas organizacionais intermediários (Tribunais Superiores e os sistemas organizacionais específicos (UI. A abordagem foi qualitativa e também quantitativa para complementação da análise dos dados coletados. A pesquisa de campo foi divida em duas partes. A primeira visava analisar os sistemas organizacionais para descrever o contexto ambiental, definir as características das UIs e identificar as competências organizacionais das UI e as competências gerenciais necessárias ao cumprimento de suas competências organizacionais. As técnicas utilizadas na primeira parte da pesquisa de campo foram análise documental, observação de websites e entrevistas para coletar junto aos gerentes os dados sobre as competências gerenciais que eles possuíam e julgavam necessárias. Na segunda parte foram validadas as competências gerenciais identificadas na primeira etapa da pesquisa de campo, por meio de questionários enviados a especialistas selecionados segundo critérios pré-determinados. As competências identificadas foram classificadas de acordo com os conhecimentos, habilidades e atitudes dos gerentes. Um total de 92 sentenças de competência gerencial foi validado pelos especialistas como necessárias aos gerentes das UI dos Tribunais Superiores, o que possibilitou o mapeamento final. Por fim, foram apresentadas a conclusão e as recomendações e sugestões para estudos futuros.
New Control Software of the 188cm Telescope of Okayama Astrophysical Observatory
Yoshida, Michitoshi; Shimizu, Yasuhiro; Watanabe, Etsuji; Yanagisawa, Kenshi; Uraguchi, Fumihiro
2002-12-01
We developed the telescope control software for the 188cm telescope of Okayama Astrophysical Observatory (OAO) based on Java technology. Basically, the software consists of two processes running on separate Java virtual machines; one of which is the "Command Dispatcher (CD)" and the other is the "User Interface (UI)". Among the two, CD is the main engine/server of the telescope control, whereas UI is just a client. The "standard" UI we provide is a graphical user interface written in Java/Swing. CD communicates with the local control units (LCUs) of the telescope through RS232C. CD is a Java multi-thread program, in which a number of threads run simultaneously. The threads running in CD are the follows: UNIX socket servers for external communications, socket opener for on-demand open/close of a socket port, socket client manager, auto-guider and dome watcher, internal command dispatcher, status manager, status collector, RS232C writer and reader, logger, and control units. The above "control units" are software models ("objects") of the telescope system. We introduced four control units- "Telescope", "Dome", "Weather-Monitor", and "Pointing"- for telescope control. The first three units are simple software models of the real-worlds devices. The last one, "Pointing", is a unit which abstracts pointing procedure of the telescope. CD and UI communicate with each other using UNIX socket. The command protocol of this communication is fairly simple, and observation instruments, auto guider, or additional UI for remote observation are also able to communicate with CD through socket using this protocol. CD opens and closes socket ports for communication on demand according to the request of client process (UI, instruments etc.), so that any clients can be connected to CD dynamically.
Next Gen One Portal Usability Evaluation
Cross, E. V., III; Perera, J. S.; Hanson, A. M.; English, K.; Vu, L.; Amonette, W.
2018-01-01
Each exercise device on the International Space Station (ISS) has a unique, customized software system interface with unique layouts / hierarchy, and operational principles that require significant crew training. Furthermore, the software programs are not adaptable and provide no real-time feedback or motivation to enhance the exercise experience and/or prevent injuries. Additionally, the graphical user interfaces (GUI) of these systems present information through multiple layers resulting in difficulty navigating to the desired screens and functions. These limitations of current exercise device GUI's lead to increased crew time spent on initiating, loading, performing exercises, logging data and exiting the system. To address these limitations a Next Generation One Portal (NextGen One Portal) Crew Countermeasure System (CMS) was developed, which utilizes the latest industry guidelines in GUI designs to provide an intuitive ease of use approach (i.e., 80% of the functionality gained within 5-10 minutes of initial use without/limited formal training required). This is accomplished by providing a consistent interface using common software to reduce crew training, increase efficiency & user satisfaction while also reducing development & maintenance costs. Results from the usability evaluations showed the NextGen One Portal UI having greater efficiency, learnability, memorability, usability and overall user experience than the current Advanced Resistive Exercise Device (ARED) UI used by astronauts on ISS. Specifically, the design of the One-Portal UI as an app interface similar to those found on the Apple and Google's App Store, assisted many of the participants in grasping the concepts of the interface with minimum training. Although the NextGen One-Portal UI was shown to be an overall better interface, observations by the test facilitators noted specific exercise tasks appeared to have a significant impact on the NextGen One-Portal UI efficiency. Future updates to
Use of Design Patterns According to Hand Dominance in a Mobile User Interface
Al-Samarraie, Hosam; Ahmad, Yusof
2016-01-01
User interface (UI) design patterns for mobile applications provide a solution to design problems and can improve the usage experience for users. However, there is a lack of research categorizing the uses of design patterns according to users' hand dominance in a learning-based mobile UI. We classified the main design patterns for mobile…
Selective liquid phase hydrogenation of furfural to furfuryl alcohol by Ru/Zr-MOFs
Yuan, Q.; Zhang, D.; Haandel, van L.; Ye, F.; Xue, T.; Hensen, E.J.M.; Guan, Y.
2015-01-01
Selective hydrogenation of furfural to furfuryl alcohol under mild conditions was evaluated over Ru nanoparticles supported on a series of zirconium based metal organic frameworks (UiO-66, UiO-67, Zr6-NDC, MIL-140A, MIL-140B, and MIL-140C). The particle size and oxidation state of Ru in the
Jonna, Sudheer
2014-01-01
If you are a Java developer with experience of frontend UI development, and want to take the plunge to develop stunning UI applications with the most popular JSF framework, PrimeFaces, then this book is for you. For those with entrepreneurial aspirations, this book will provide valuable insights into how to utilize successful business models.
Kirurgisk behandling af urininkontinens hos kvinder
DEFF Research Database (Denmark)
Ammendrup, Astrid Cecilie; Sørensen, Helle Christina; Sander, Pia
2010-01-01
(TVT) was the preferred sling in 2006. A total of 20 (47%) UI surgeons used only TVT, seven (17%) only transobturator slings (TOS) and 15 (36%) both TVT and TOS. Only 11 (24%) performed > 25 TVT per year and 11 (27%) performed > 25 TOS per year. In all, UI surgeons had experience with ten different...
Directory of Open Access Journals (Sweden)
Luzia Cristina Contim Ferrato
1990-12-01
Full Text Available Le test ELISA-TÉTANOS (Biosys, France a été utilisé pour le titrage des anti-corps tétaniques (sensibilité = 0,0025 UI/ml en sérums humains de donneurs de sang, 566 hommes et 108 femmes, âges de 18 à 58 ans, moyenne de 29 ans, provenant de São Paulo, SP, Brésil. L'OMS, acceptant seulement la séroneutralisation sur souris (NT, la méthode de référence, pour les études sur la protection contre le tétanos, préconise le titre de 0,01 UI/ml comme minimum protecteur. BOURLEAUD & HUET ont proposé la limite de 0,06 UI/ml quand s'emploie le test ELISA, en attendant à une certaine discordance inévitable entre les méthodes. Parmi les 674 sérums étudiés, 178 (26,41% n'ont pas présenté d'anticorps ( 0,06 UI/ml.
Tian, Ye; Yang, Zhuo; Xu, Zhiyuan; Liu, Siyang; Sun, Weifeng; Shi, Longxing; Zhu, Yuanzheng; Ye, Peng; Zhou, Jincheng
2018-04-01
In this paper, a novel failure mechanism under unclamped inductive switch (UIS) for Split-Gate Trench Metal Oxide Semiconductor Field Effect Transistor (MOSFET) with large current is investigated. The device sample is tested and analyzed in detail. The simulation results demonstrate that the nonuniform potential distribution of the source poly should be responsible for the failure. Three structures are proposed and verified available to improve the device UIS ruggedness by TCAD simulation. The best one of the structures the device with source metal inserting into source poly through contacts in the field oxide is carried out and measured. The results demonstrate that the optimized structure can balance the trade-off between the UIS ruggedness and the static characteristics.
A colloidal water-stable MOF as a broad-range fluorescent pH sensor via post-synthetic modification.
Aguilera-Sigalat, Jordi; Bradshaw, Darren
2014-05-11
We report for the first time the pH-dependent fluorescence of UiO-66-NH2 across the wide range from 1 to 9. By application of a post-synthetic modification (PSM) diazotisation strategy, we synthesized a new material, UiO-66-N=N-ind, which shows increased chemical stability and enhanced sensing up to pH 12.
Designing interfaces patterns for effective interaction design
Tidwell, Jenifer
2005-01-01
This convenient resource offers advice on creating user-friendly interface designs--whether they're delivered on the Web, a CD, or a smart" devices like a cell phone. Solutions to common UI design problems are expressed as a collection of patterns--each one containing concrete examples, recommendations, and warnings. Intended for designers with basic UI design knowledge
Directory of Open Access Journals (Sweden)
Fahmida Zabin
2016-07-01
Full Text Available Background: Urinary incontinence (UI is a highly prevalent and burdensome condition among women.However,fewer than half of women with symptoms consult with a physician about incontinence, and determinant of treatment seeking are not well understood.Objectives: The aim of this study was to determine the prevalence, awareness and determinants of urinary incontinence (UI among women attending GOPD in BSMMU and the sociodemographic factors involved in their health care-seeking behaviour.Methods: Cross-sectional study was carried out in Gynaeout patient department of Bangabandhu Sheikh Mujib Medical University with a sample of 800 women aged 45 yrs and above.Results: A total of 1000 women were recruited for the study by purposive sampling,among them 800 agreed to participate and completed the questionnaire. Of these, 165 (20.6% were found to have UL Overall, the reason for not seeking medical attention was mainly embarrassment (40.6% at having to speak with doctor. Of the total study sample, 566 subjects (70.6% believed that UI was abnormal and worth reporting to a doctor. Coping mechanisms among incontinent women included frequent washing (58.3% and wearing a protective perineal pad (42.4%, changing underwear frequently (41.3%, decreasing fluid intake (19.8% and stopping all work (4.9%. Sufferers were most troubled by their inability to pray (64% maintain marital relationship (47%, limitation of their social activities (20%, difficulty in doing housework (14% and inconvenience during shopping (13%. Most (56% found it most embarrassing to discuss UI with their husbands. The majority of women (51.9% believed child birth to be the major cause ofUI, followed by ageing (49.5%, menopause (34.2% and paralysis (25.3%. Most of the subjects (62.3% believe that UI can cause infection, some (20.5% believe that it can cause skin allergy and very few think that it can cause cancer or other disorders.Conclusions: Our findings indicate that although UI is
Chen, Kai; Zhang, Lingyi; Zhang, Weibing
2018-03-30
In this work, an open-tubular capillary liquid-phase column was prepared by modifying chain polymer on the inner surface of capillary and chemical bonding of metal organic frameworks, NH 2 -UiO-66, to the brushes of chain polymer (poly(glycidyl methacrylate)). Besides advantages of facial preparation and good permeability, the chain polymer effectively increases the modification amount of NH 2 -UiO-66 nanoparticles to increase the phase ratio of open-tubular capillary column and enhance the interactions with analytes. The results of scanning electron microscope energy-dispersive X-ray spectra indicated that NH 2 -UiO-66 nanoparticles were successfully bonded to the chain polymer. Because of the hydrophobic interaction and hydrogen bonding interaction between the analytes and the ligand of NH 2 -UiO-66, different analytes were well separated on the NH 2 -UiO-66-modified poly(glycidyl methacrylate) capillary (1.12 m × 25 μm id × 365 μm od) with the high absolute column efficiency reaching 121 477 plates, benefiting from an open-tubular column and low mass transfer resistance provided by polymer brush and metal-organic framework crystal. The relative standard deviations of the retention time for run-to-run, day-to-day, and column-to-column (n = 3) runs are below 4.28%, exhibiting good repeatability. Finally, the column was successfully applied to separation of flavonoids in licorice. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
The bottom-supported fast reactor - system simplifications and enhanced safety
International Nuclear Information System (INIS)
Petrozelli, J.; Golan, S.; Kawamura, Yutaka; Kumaoka, Yoshio; Nakagawa, Hiroshi
1992-01-01
The 600-MW(electric) bottom-supported fast reactor (BSFR) incorporates the following key features: (1) modular upper internal structure (UIS); (2) electromagnetic pumps (EMPs); (3) low-sodium-void-worth metal-fuel core; and (4) bottom supported reactor vessel (BSRV), which is entirely supported by the basement, except for the control rods, control rod drives (CRDs), UIS, and the stationary plug; by comparison, a top-supported reactor vessel (TSRV) is completely supported by the operating floor. The diameter of the reactor vessel (RV) is 12.8 m (42 ft), and the height (distance from the basemat to the operating floor) is 19.8 m (65 ft). The RV is supported by a single support cylinder anchored to the basemat. The core has 210 driver assemblies and 192 radial blanket assemblies in an annular configuration. The primary heat transport system components consist of four intermediate heat exchangers (IHXs), four EMPs, and four primary reactor auxillary cooling systems. All these components are supported by the BSRV and hang from their tops. Six modular, vertically movable UIS mechanisms clear the UIS from the space over the core during refueling. The top closure is designed to operate at the reactor outlet temperature and is free to expand and contract. Small bellows between the top closure and each UIS model accommodate differential movements and comprise a portion of the cover gas boundary. A 1200-MW(electric) plant with two 600-MW(electric) (twin) nuclear steam supply systems is being studied
Pelvic Floor Morphometric Differences in Elderly Women with or without Urinary Incontinence.
Fradet, Sarah; Morin, Mélanie; Kruger, Jennifer; Dumoulin, Chantale
2018-01-01
Purpose: Urinary incontinence (UI) affects as many as 50% of women aged 60 years and older, but UI pathophysiology, specifically in elderly women, remains unclear. A better understanding of morphometric differences between continent and urinary incontinent elderly women is needed to improve the effectiveness of conservative treatment approaches. We hypothesized that morphometric differences in the pelvic floor muscles (PFM) among elderly women with and without UI could be observed using three- and four-dimensional (3D/4D) transperineal ultrasound (TPU) imaging. Method: A total of 40 elderly women (20 women with and 20 women without UI), with a mean age of 67.10 (SD 4.94) years, participated in the study. This was a case-control study in which TPU images were taken under three conditions: rest, maximal voluntary contraction (MVC), and Valsalva. Independent t -tests were conducted to compare measurements between the groups. Results: The study revealed statistically significant differences between the groups. At rest, the levator hiatal area and transverse diameter were bigger, and the PFM position was lower in the incontinent group. During MVC, all axial plane parameters were bigger in the incontinent group. In the sagittal plane, PFM position was again lower in the incontinent group. During Valsalva, the anorectal angle was wider in the women with incontinence. Conclusion: PFM morphometric differences were present and were observed using 3D/4D TPU imaging in elderly women with and without UI.
Petrangeli, F; Capitanucci, M L; Marciano, A; Mosiello, G; Alvaro, R; Zaccara, A; Finazzi-Agro, E; De Gennaro, M
2014-06-01
To determine whether urinary incontinence (UI) and lower urinary tract symptoms (LUTS) persist over years, patients treated for UI and LUTS in childhood were re-evaluated in adulthood. Forty-seven women (cases) treated in childhood for daytime UI/LUTS (group A) and nocturnal enuresis (group B) self-completed (average age: 24.89 ± 3.5 years) the International Consultation on Incontinence Questionnaire for Female with LUTS (ICIQ-FLUTS). ICIQ-FLUTS was self-administered to 111 healthy women (average age: 23 ± 5.1 years) from a nursing school as a control group. Data obtained from ICIQ-FLUTS and quality of life (QoL) score (0-10) were compared (Fisher's exact test) between patients and controls, and between group A (n = 28) and group B (n = 19). Prevalence of LUTS was higher in patients than in controls. The difference between patients and controls was statistically significant (p = 0.0001) for UI (34% vs. 7%) and feeling of incomplete bladder emptying (49% vs. 28%). QoL score was >5 in 59% of patients and 1% of controls (p = 0.0001). No significant differences were found between groups A and B. UI and LUTS are confirmed in young women who suffered for the same condition in childhood. Longitudinal studies are needed to assess if these symptoms persist or are newly onset. Copyright © 2014 Journal of Pediatric Urology Company. Published by Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Eduardo Malvino
2005-03-01
Full Text Available Se analizaron en forma retrospectiva las características clínicas, complicaciones, gravedad, y sobrevivencia materna y fetal, en un grupo de gestantes con síndrome HELLP ( Hemolysis , Elevated Liver enzyme levels, Low Platelet count que requirieron admisión en cuatro unidades de cuidados intensivos del área metropolitana Buenos Aires, Argentina. Durante el período comprendido entre marzo de 1997 y marzo de 2003 se evaluaron 62 pacientes en la segunda mitad del embarazo o el puerperio inmediato que cumplían criterios diagnósticos de hipertensión inducida por el embarazo, asociado a plaquetopenia 70 UI/l, láctico deshidrogenasa >600 UI/l, bilirrubina total >1.2 mg / dl , y/o frotis de sangre periférica con signos de hemólisis. La edad promedio fue 28 ± 8 años; número de gestas promedio 2.7 ± 2.3; edad gestacional media 33 ± 4 semanas. Según el grado de plaquetopenia, 23 casos pertenecieron a la clase 1, 29 a la clase 2 y el resto a la clase 3 de la clasificación de Martin . Hubo 16 formas eclámpticas. El recuento plaquetario promedio fue 67 604 ± 31 535/ mm3 ; TGO 271 ± 297 UI/l; TGP 209 ± 178 UI/l; LDH 1 444 ± 1 295 UI/l; creatininemia 1.1 ± 0.8 mg / dl. Cuarenta y una pacientes cursaron con diverso grado de deterioro del filtrado glomerular, con requerimiento de tratamiento hemodialítico y plasmaféresis en un caso. Se presentó insuficiencia respiratoria vinculada a síndrome de distrés respiratorio del adulto en cuatro enfermas. Todas las puérperas sobrevivieron y se comprobaron cuatro muertes perinatales. En la población estudiada, se observó baja prevalencia de complicaciones graves, óptima sobrevivencia materna y baja mortalidad perinatal.We analized the clinical characteristics, complications, severity, and maternal and fetal survival of patients suffering from HELLP syndrome ( Hemolysis , Elevated Liver enzymes level, Low Platelet count requiring admission to the intensive care unit in four hospitals from
Directory of Open Access Journals (Sweden)
Helmgton José Brito de Souza
2008-03-01
Full Text Available OBJETIVO: O objetivo deste estudo é avaliar as estratégias adotadas por nossa equipe para reduzir o uso de hemoderivados em pacientes submetidos a cirurgia cardiovascular. MÉTODOS: Entre outubro de 2005 e janeiro de 2007, foram operados 101 pacientes. Destes, 51 (50,5% eram do sexo masculino e 50 (49,5% do feminino. A idade variou de 13 a 80 anos (média de 50,76 anos. A estratégia utilizada consiste em uso de antifibrinolíticos, hemodiluição normovolêmica e reposição total do perfusato. RESULTADOS: A média de utilização de hemoderivados por paciente foi de 1,45 UI de CH; 0,75 UI de PF; 0,89 UI de crioprecipitados e 1,43 UI de plaquetas. Em 59 (58,4% pacientes, não foram usados hemoderivados e somente 12 (11,9% pacientes necessitaram mais de quatro UI de CH. Dentre os 27 (26,7% pacientes cujo tempo de circulação extracorpórea (CEC excedeu os 120 minutos, 17 (63% necessitaram de hemotransfusão. Apenas três (2,97% pacientes desenvolveram coagulopatia, sendo dois (1,98% reoperados por sangramento. Dos três pacientes que desenvolveram coagulopatia, dois pertenciam ao subgrupo de idosos. CONCLUSÃO: Na série apresentada, as medidas adotadas conseguiram reduzir a necessidade de hemotransfusão no pós-operatório de cirurgia cardíaca. Pacientes com tempo de CEC maior que 120 minutos tenderam a necessitar de hemotransfusão. A associação de cirurgia em pacientes idosos e tempo de CEC superior a 120 minutos resultou em maior utilização de sangue e hemoderivados no período pós-operatório.OBJECTIVE: The aim of this study is to evaluate the strategies adopted by our team to reduce the use of bloods components in patients undergoing cardiovascular surgical procedures. METHODS: Between October 2005 and January 2007, 101 patients were operated. Fifty-one (50.5% were male and 50 (49.5% female. Patients' age ranged from 13 to 80 years (mean of 50.76 years. The strategy consisted in using antifibrinolytics and normovolemic
On the deployment of agents by binary information
De Persis, Claudio; Cao, Ming; Ceragioli, Francesca
2011-01-01
We study the problem of deploying on a line a group of N agents with kinematic continuous-time model x˙i = ui , i = 1,...,N , (1) with xi ,ui ∈ R. The agents are connected through an undirected chain graph G = (V ,E ), with V = {1,2,...,N} and E = {(1,2),...,(i,i + 1),...,(N − 1,N)}. Moreover, we
Liao, Po-Yung; Chang, Ting-Chang; Su, Wan-Ching; Chen, Bo-Wei; Chen, Li-Hui; Hsieh, Tien-Yu; Yang, Chung-Yi; Chang, Kuan-Chang; Zhang, Sheng-Dong; Huang, Yen-Yu; Chang, Hsi-Ming; Chiang, Shin-Chuan
2017-06-01
This letter investigates repeated uniaxial mechanical stress-induced degradation behavior in flexible amorphous In-Ga-Zn-O thin-film transistors (TFTs) of different geometric structures. Two types of via-contact structure TFTs are investigated: symmetrical and UI structure (TFTs with I- and U-shaped asymmetric electrodes). After repeated mechanical stress, I-V curves for the symmetrical structure show a significant negative threshold voltage (VT) shift, due to mechanical stress-induced oxygen vacancy generation. However, degradation in the UI structure TFTs after stress is a negative VT shift along with the parasitic transistor characteristic in the forward-operation mode, with this hump not evident in the reverse-operation mode. This asymmetrical degradation is clarified by the mechanical strain simulation of the UI TFTs.
Teaching Arturo Ui: Triumph of Whose Will?
Rhiel, Mary
1993-01-01
Describes a unit on teaching Brecht in an introductory literature course, and suggests that students are better able to read and discuss Brecht's Hitler play if they first view and discuss Leni Riefenstahl's film Triumph of the Will. Guidelines are provided on how best to present and explore the two works with students. (LET)
Jerez-Roig, J; Souza, D L B; Espelt, A; Costa-Marín, M; Belda-Molina, A M
2013-01-01
Electrostimulation (ES) is one of the techniques employed in conservative treatment of urinary incontinence (UI) and/or overactive bladder syndrome (OAB). Nevertheless, there is controversy in the scientific literature regarding its effectiveness as monotherapy. To evaluate the scientific evidence on ES of the pelvic floor in women with UI and with/without OAB. A systematic review of clinical trials was carried out in the following databases: PubMed, Cochrane, PEDro, Elsevier (Doyma) and EnFisPo (1980-2011). Quality of study registries was evaluated and information was obtained from those that presented the inclusion criteria established in the review. The 27 clinical trials were included in the review: 13 randomized controlled trials, 11 randomized non-controlled trials and 3 non-randomized trials. Most of the clinical trials conclude that ES is effective in the treatment of UI and OAB in women. However, better methodological quality studies are needed to obtain a higher level of scientific evidence and to know the optimal current modality, type and parameters for each type of UI and OAB. Copyright © 2012 AEU. Published by Elsevier Espana. All rights reserved.
Radzimińska, Agnieszka; Strączyńska, Agnieszka; Weber-Rajek, Magdalena; Styczyńska, Hanna; Strojek, Katarzyna; Piekorz, Zuzanna
2018-01-01
Purpose The purpose of this review was to assess the effectiveness of pelvic floor muscle training (PFMT) in the treatment of urinary incontinence (UI) in women, with a particular focus on the impact of this form of therapy on the patients’ quality of life (QoL). Methods The following electronic databases were searched: PubMed, Embase, and Cochrane Library (articles only in English, 1990–2017). Search terms were as follows: urinary incontinence, pelvic floor muscle training, pelvic floor exercises, quality of life. Systematic review methods were based on the PRISMA (Preferred Reporting Items for Systematic Reviews and Meta-Analyses) statement. Results The assessment of the impact of PFMT on the QoL of women with UI was conducted among 2,394 women in 24 selected studies. After the end of treatment, the majority of patients in the experimental groups noted a statistically significant improvement in QoL. Conclusion The results of this literature review demonstrate that PFMT is an effective treatment for UI in women. PFMT significantly improves the QoL of women with UI, which is an important determinant of their physical, mental, and social functioning.
Ultrasensitive TSH: a new approach to hyperthyroidism diagnosis
International Nuclear Information System (INIS)
Gibold, G.; Liehn, J.C.; Deltour, G.; Delisle, M.J.
1986-01-01
The value of new ultrasensible and rapid immunoradiometric assay of thyroid stimulating hormone (TSH) for the diagnosis of hyperthyroidism was assessed in 130 patients with suspected hyperthyroidism and in 330 controls. The diagnosis was established by the clinical evaluation, thyroid scintigraphy and serum concentrations of thyroid hormones. Using the ROC (Receiver Operating Characteristic) curve methodology which allows the optimization of sensitivity and specificity, the physician can choose the Cut-off value between hyperthyroidism and euthyroidism. Two points of the curve seem to be interesting: using the cut-off value of 0.1 mUI/1, sensitivity is 0.98 and specificity is 0.98; using the cut-off value of 0.3 mUI/1, sensitivity is 1.00 and specificity is 0.92. Using the association TSH and FT4 (Free Thyroxin), sensitivity is 0.94 and specificity is 0.99. Sixty four per cent of euthyroid patients with TSH under 0.3 mUI/1 have one or several hot nodules and only two have no thyroid disease. A TRH (Thyrotrophin Releasing Hormone) test was carried out in 63 patients with suspected thyrotoxicosis: basal and TRH stimulated TSH levels were under 0.1 mUI/1. This immunoradiometric assay for TSH may simplify the approach to thyroid function testing in patients with suspected thyrotoxicosis: a basal TSH under 0.3 mUI/1 is sufficient to confirm a clinical suspicion of thyrotoxicosis without TRH test within four hours. In a department devoted to testing thyroid function, this new method provides a great benefit in cost and work [fr
Gezginci, Elif; Iyigun, Emine; Yilmaz, Sercan
The purpose of this study was to compare the effect of 3 instructional methods for behavioral therapy on lower urinary tract symptom (LUTS) severity and health-related quality of life (HRQOL) in women with overactive bladder. Single-center, parallel-group, randomized, clinical trial. The sample comprised 60 women diagnosed with overactive bladder. The study setting was a university-based female urology clinic in Ankara, Turkey; data were collected from November 2012 to May 2013. Eligible participants were ambulatory women 18 years or older with predominant overactive bladder and urge urinary incontinence (UI) symptoms, with or without stress UI symptoms. Subjects were randomized into 4 groups based on educational intervention; group 1 received structured verbal instruction plus a leaflet, group 2 received structured verbal instruction, group 3 received a leaflet alone, and group 4 received usual care that included unstructured verbal counseling about continence care. The primary outcome measures were Incontinence Impact Questionnaire-7 (IIQ-7) and Urinary Distress Inventory-6 (UDI-6) scores. We also measured changes in UI-specific HRQOL scores via the Urinary Incontinence Quality of Life Instrument (I-QOL). All outcomes were measured before and 6 to 8 weeks after the interventions. The Wilcoxon test was used to identify differences in LUTS severity and HRQOL before and after the educational intervention. The Kruskall-Wallis test was used to compare differences among the groups. The severity of LUTS and UI-specific quality of life assessed by the IIQ-7, UDI-6, and I-QOL scores significantly improved after training in all 4 groups (P women with overactive bladder and urge UI.
BMI and Healthcare Cost Impact of Eliminating Tax Subsidy for Advertising Unhealthy Food to Youth.
Sonneville, Kendrin R; Long, Michael W; Ward, Zachary J; Resch, Stephen C; Wang, Y Claire; Pomeranz, Jennifer L; Moodie, Marj L; Carter, Rob; Sacks, Gary; Swinburn, Boyd A; Gortmaker, Steven L
2015-07-01
Food and beverage TV advertising contributes to childhood obesity. The current tax treatment of advertising as an ordinary business expense in the U.S. subsidizes marketing of nutritionally poor foods and beverages to children. This study models the effect of a national intervention that eliminates the tax subsidy of advertising nutritionally poor foods and beverages on TV to children aged 2-19 years. We adapted and modified the Assessing Cost Effectiveness framework and methods to create the Childhood Obesity Intervention Cost Effectiveness Study model to simulate the impact of the intervention over the 2015-2025 period for the U.S. population, including short-term effects on BMI and 10-year healthcare expenditures. We simulated uncertainty intervals (UIs) using probabilistic sensitivity analysis and discounted outcomes at 3% annually. Data were analyzed in 2014. We estimated the intervention would reduce an aggregate 2.13 million (95% UI=0.83 million, 3.52 million) BMI units in the population and would cost $1.16 per BMI unit reduced (95% UI=$0.51, $2.63). From 2015 to 2025, the intervention would result in $352 million (95% UI=$138 million, $581 million) in healthcare cost savings and gain 4,538 (95% UI=1,752, 7,489) quality-adjusted life-years. Eliminating the tax subsidy of TV advertising costs for nutritionally poor foods and beverages advertised to children and adolescents would likely be a cost-saving strategy to reduce childhood obesity and related healthcare expenditures. Copyright © 2015 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.
Efficacy And Non Invasive Treatment Of Sialorrhea In The Goldenhar Syndrome.
Marvulli, R; Gallo, G A; Mastromauro, L; Fiore, P; Ianieri, G; Megna, M
2018-03-28
Goldenhar syndrome (ocular-auricular-vertebral syndrome), a rare congenital condition arising from defects in the first and second brachial arches, consists in clinical variety of features ranging from facial abnormalities, ear-eye abnormalities, vertebral defects and congenital heart problems and severe obstructive sleep apnea. Due to craniofacial abnormalities, patients presents mechanical obstructive phenomena and sialorrhea that cause prone position, language's fastening, use of nasopharyngeal cannulas and tracheal intubation. In this article, we report a case of a 16 years old child affected by Goldenhar syndrome and sialorrhea to demonstrate improvement of the daily patient management, through inoculations of botulinum toxin type A. Due to severe sialorrhea which caused tracheobronchial daily aspirations, caregivers used an external aspirators. In the first infiltration (August 2016) the parotid and submandibular glands bilaterally were inoculated with incobotulinum toxin type A (Xeomin®, Merz Pharma) with dosages of 5 UI for each of them, for a total of 20 UI without clinical efficacy (no quantitative and qualitative saliva reducing during 3 months). In the second (November 2016) and third (February 2017) infiltrations each parotid and each submandibular glands were injected with a (dosage of 7 UI and 5 UI respectively (total of 24 UI of incobotulinumtoxin A) with important clinical results (saliva production and tracheo-bronchial aspirations reduced). So, botulinum toxin type A could be a good and non invasive treatment of sialorrhea in Goldenhar syndrome to improve oral hygiene and daily patient management. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
Visualizing common operating picture of critical infrastructure
Rummukainen, Lauri; Oksama, Lauri; Timonen, Jussi; Vankka, Jouko
2014-05-01
This paper presents a solution for visualizing the common operating picture (COP) of the critical infrastructure (CI). The purpose is to improve the situational awareness (SA) of the strategic-level actor and the source system operator in order to support decision making. The information is obtained through the Situational Awareness of Critical Infrastructure and Networks (SACIN) framework. The system consists of an agent-based solution for gathering, storing, and analyzing the information, and a user interface (UI) is presented in this paper. The UI consists of multiple views visualizing information from the CI in different ways. Different CI actors are categorized in 11 separate sectors, and events are used to present meaningful incidents. Past and current states, together with geographical distribution and logical dependencies, are presented to the user. The current states are visualized as segmented circles to represent event categories. Geographical distribution of assets is displayed with a well-known map tool. Logical dependencies are presented in a simple directed graph, and users also have a timeline to review past events. The objective of the UI is to provide an easily understandable overview of the CI status. Therefore, testing methods, such as a walkthrough, an informal walkthrough, and the Situation Awareness Global Assessment Technique (SAGAT), were used in the evaluation of the UI. Results showed that users were able to obtain an understanding of the current state of CI, and the usability of the UI was rated as good. In particular, the designated display for the CI overview and the timeline were found to be efficient.
Directory of Open Access Journals (Sweden)
Silva Fernanda Alvares da
2001-01-01
Full Text Available Um experimento foi conduzido para estudar os efeitos de níveis de ácido L-Glutâmico (L-Glu e vitamina D3 (VD da dieta em pintos de corte de um dia, machos, Hubbard, recebendo dieta básica purificada, contendo todos os L-aminoácidos essenciais, minerais e vitaminas (exceto vitamina D3, suplementada com 5, 10 e 15% de L-Glu, combinados com 0, 5.000, 10.000 e 15.000 UI de vitamina D3. O experimento foi realizado utilizando-se esquema fatorial, em delineamento inteiramente casualizado 3 x 4, com quatro repetições de sete aves cada. O ganho de peso aumentou até o nível máximo estimado, de 8,56% de L-Glu e 15.000 UI de vitamina D3. A melhor taxa de conversão alimentar foi verificada com nível estimado de 8,40% de L-Glu. O maior consumo de ração estimado foi obtido com 8,48% de L-Glu e 15.000 UI de vitamina D3. Houve redução na incidência de problemas de pernas com 10% de L-Glu e 15.000 UI de vitamina D3. L-Glu estimado em 8,56% e 15.000 UI de vitamina D3 permitiu um melhor desempenho das aves, confirmando que esse aminoácido é boa fonte de nitrogênio não-específico para maximizar o desempenho e reduzir a incidência de problemas de pernas.
Directory of Open Access Journals (Sweden)
Igor But
2013-04-01
Conclusions: Both, UI and OAB represent a significant problem among patients attending the family practice physician office. It seems that the knowledge of both dysfunctions is satisfactory among physicians. The majority of patients would tell their doctors about UI and OAB and would also receive appropriate instructions regarding the bladder training and PFMT, both methods being very important for the prevention and treatment of these dysfunctions.
Zaidan,Patrícia; Silva,Elirez Bezerra da
2016-01-01
Abstract Introduction: Urinary incontinence (UI) after prostatectomy is difficult to treat and causes profound adverse impacts on the individual's quality of life. The main clinical treatments available for post-prostatectomy UI consist of behavioral techniques and physical therapy techniques, such as exercises, electrical stimulation and biofeedback for pelvic floor muscles (PFMs). Objective: To investigate the effectiveness of PFM exercises with or without electrical stimulation for reduc...
Thyroglobulin recovery test of sera containing elevated levels of anti-thyroglobulin antibodies
International Nuclear Information System (INIS)
Hervas, I.; Gonzalez-Cabezas, P.; Flores, D.; Perez-Pastor, J.L.; Bello, P.; Rivas, A.; Alonso, J.; Olivas, C.; Mateo, A.
2002-01-01
Aim: Thyroglobulin (Tg) is a macro-molecule synthesized exclusively in the thyroid gland for the synthesis of thyroid hormones. In differentiated thyroid carcinoma, after radical thyroidectomy, the discovering of measurable quantities of Tg can be indicator of relapse y/or spread of disease but Thyroglobulin antibodies can alter the determination of Tg. The aim of this study is to assess and measure the interference of Tg antibodies on the Tg determination. Methods: We have selected 50 consecutive serum whose Tg-antibodies levels were higher than the normality values (0-100 UI/mL). Tg-antibodies were measured using a 'sandwich' radioimmunometric assay on solid phase. We have performed a recovery test on these sera. This test consists on adding a known quantity (50 UI) of Tg on that sera and then measure the Tg values to find out the percentage of Tg that is recuperated. Tg was measured using a radioimmunometric assay on solid phase. Results: Sera were divided in two groups: A.- 15 sera with Tg-antibodies levels between 100-250 UI/mL: 85% of them presented a Tg recovery percentage higher than 90% (Tg-antibodies did not interfere on Tg values due to Tg was recovered almost in its totality). B.- 53 sera with Tg-antibodies levels higher than 250 UI/mL: Only 10% of them presented a Tg recovery percentage higher than >90% . (90% of sera interfered on Tg values). 70% of that sera presented percentages under 50%. The Pearson's correlation coefficient between Tg-antibodies and Tg recovery percentage was -0.34. Conclusions: The majority (90%)of sera with Tg-antibodies higher than 250 UI/mL presented an high interference on Tg determination. However the majority of sera with Tg-antibodies between 100-250 did not show any interference on Tg determination. There are not linear correlation between highest values and lowest percentages of Tg recovered. We recommend the realization of Tg recovery test on sera with elevated Tg antibodies specially when are higher than 250 UI/mL
Directory of Open Access Journals (Sweden)
Kaori Kinouchi
2018-02-01
Full Text Available Background The purpose of this study was to evaluate the efficacy of a smartphone-based reminder system in promoting pelvic floor muscle training (PFMT to help postpartum women manage urinary incontinence (UI. Methods Forty-nine and 212 postpartum women in the intervention and control groups, respectively, received PFMT guidance using a leaflet and verbal instruction as the standard care at an obstetrics clinic in Japan. Women in the intervention group also received PFMT support using the smartphone-based reminder system between January and August 2014. For analysis, they were compared with historical controls between February 2011 and January 2012, who did not receive such support and were chosen by propensity score matching. The outcomes examined were PFMT adherence and UI prevalence. The former consisted of implementation rate (i.e., the percentage of women who reported performing PFMT during the intervention period, training intensity (i.e., the number of pelvic floor muscle contractions (PFMCs per day, and training frequency (i.e., the number of days PFMT was performed per week; the latter consisted of self-reported UI prevalence at baseline and at the end of the eight-week intervention period. Result Propensity score matching resulted in 58 postpartum women (n = 29 per group. The intervention group exhibited better PFMT adherence than the control group, in terms of PFMT implementation rate (69 vs. 31%, p = 0.008, median training intensity (15 vs. 1 PFMC reps/day, p = 0.006, and training frequency (7 vs. 3 days/week, p < 0.001. UI prevalence was not different between the groups at baseline, but was significantly reduced in the intervention group at eight weeks (0 vs. 24%, p = 0.004. Conclusion Our smartphone-based reminder system appears promising in enhancing PFMT adherence and managing postpartum UI in postpartum women. By enhancing PFMT adherence and improving women’s ability to manage the condition, the reminder system could
Sacks, G; Veerman, J L; Moodie, M; Swinburn, B
2011-07-01
Cost-effectiveness analyses are important tools in efforts to prioritise interventions for obesity prevention. Modelling facilitates evaluation of multiple scenarios with varying assumptions. This study compares the cost-effectiveness of conservative scenarios for two commonly proposed policy-based interventions: front-of-pack 'traffic-light' nutrition labelling (traffic-light labelling) and a tax on unhealthy foods ('junk-food' tax). For traffic-light labelling, estimates of changes in energy intake were based on an assumed 10% shift in consumption towards healthier options in four food categories (breakfast cereals, pastries, sausages and preprepared meals) in 10% of adults. For the 'junk-food' tax, price elasticities were used to estimate a change in energy intake in response to a 10% price increase in seven food categories (including soft drinks, confectionery and snack foods). Changes in population weight and body mass index by sex were then estimated based on these changes in population energy intake, along with subsequent impacts on disability-adjusted life years (DALYs). Associated resource use was measured and costed using pathway analysis, based on a health sector perspective (with some industry costs included). Costs and health outcomes were discounted at 3%. The cost-effectiveness of each intervention was modelled for the 2003 Australian adult population. Both interventions resulted in reduced mean weight (traffic-light labelling: 1.3 kg (95% uncertainty interval (UI): 1.2; 1.4); 'junk-food' tax: 1.6 kg (95% UI: 1.5; 1.7)); and DALYs averted (traffic-light labelling: 45,100 (95% UI: 37,700; 60,100); 'junk-food' tax: 559,000 (95% UI: 459,500; 676,000)). Cost outlays were AUD81 million (95% UI: 44.7; 108.0) for traffic-light labelling and AUD18 million (95% UI: 14.4; 21.6) for 'junk-food' tax. Cost-effectiveness analysis showed both interventions were 'dominant' (effective and cost-saving). Policy-based population-wide interventions such as traffic
Directory of Open Access Journals (Sweden)
Arief Goeritno
2016-03-01
Full Text Available Telah dilakukan implementasi Automatic Packet Reporting System (APRS untuk paket data pemantauan dan pengukuran melalui tujuan penelitian, berupa: a penyetelan program aplikasi pada jaringan APRS dan b pengukuran terhadap penerimaan data berdasarkan kinerja sensor-sensor. Penyetelan program aplikasi APRS merupakan konfigurasi perangkat lunak untuk APRS yang akan digunakan pada stasiun penerimaan data APRS dengan program aplikasi yang biasa digunakan, yaitu hyperterminal dan UI-View 32. Pengukuran penerimaan data berdasarkan kinerja sensor yang dilakukan melalui proses perekaman pada stasiun penerimaan data APRS. Kinerja sensor-sensor akan diamati pada stasiun pengiriman dan data hasil pengamatan akan dapat diterima pada stasiun penerimaan secara real time. Program aplikasi berbasis hyperterminal dan UI View 32 telah berhasil melakukan proses handshaking antara Terminal Node Controller (TNC dan komputer, sehingga data telemetri dari stasiun pengiriman paket data dapat diterima di stasiun penerimaan. Data telemetri dapat diamati pada stasiun penerimaan dan dapat diperoleh secara real time dengan format: YB0LRB-11>BEACON,WIDE2-1 [05/18/2014 04:03:49]: <UI>: T#010,008,093,004,122,075. Notifikasi YB0LRB-11 merupakan stasiun pengiriman paket data telemetri, kemudian data tersebut akan diterima pada stasiun penerima YD1PRY dengan format: YD1PRY-2>APLPN,ARISS [05/18/2014 04:03:07]: <UI>: !06.30.37S/106.48.26E#. Notifikasi tersebut merupakan pengiriman informasi data posisi oleh stasiun YD1PRY untuk inisialisasi pada jaringan APRS. Stasiun YB0LRB-11 ketika mengirim paket data telemetri dengan format: YB0LRB-11>BEACON,WIDE2-1 [05/18/2014 04:00:49]: <UI>: T#001,004,035,005,122,075. Paket data dari stasiun YB0LRB yang dipancar ulang atau digipeater dengan format: YB0LRB-11>BEACON,YD1PRY-2,WIDE2* [05/18/2014 04:00:50]: <UI>: T#001,004,035,005,122,075. Sensor pengukuran berkinerja relatif stabil, walaupun terdapat nilai simpangan pengukuran sebesar 1 cm atau
Bourne, Rupert R. A.; Taylor, Hugh R.; Flaxman, Seth R.; Keeffe, Jill; Leasher, Janet; Naidoo, Kovin; Pesudovs, Konrad; White, Richard A.; Wong, Tien Y.; Resnikoff, Serge; Jonas, Jost B.
2016-01-01
Objective To assess the number of individuals visually impaired or blind due to glaucoma and to examine regional differences and temporal changes in this parameter for the period from 1990 to 2012. Methods As part of the Global Burden of Diseases (GBD) Study 2010, we performed a systematic literature review for the period from 1980 to 2012. We primarily identified 14,908 relevant manuscripts, out of which 243 high-quality, population-based studies remained after review by an expert panel that involved application of selection criteria that dwelt on population representativeness and clarity of visual acuity methods used. Sixty-six specified the proportion attributable to glaucoma. The software tool DisMod-MR (Disease Modeling–Metaregression) of the GBD was used to calculate fraction of vision impairment due to glaucoma. Results In 2010, 2.1 million (95% Uncertainty Interval (UI):1.9,2.6) people were blind, and 4.2 (95% UI:3.7,5.8) million were visually impaired due to glaucoma. Glaucoma caused worldwide 6.6% (95% UI:5.9,7.9) of all blindness in 2010 and 2.2% (95% UI:2.0,2.8) of all moderate and severe visual impairment (MSVI). These figures were lower in regions with younger populations (10%). From 1990 to 2010, the number of blind or visually impaired due to glaucoma increased by 0.8 million (95%UI:0.7, 1.1) or 62% and by 2.3 million (95%UI:2.1,3.5) or 83%, respectively. Percentage of global blindness caused by glaucoma increased between 1990 and 2010 from 4.4% (4.0,5.1) to 6.6%. Age-standardized prevalence of glaucoma related blindness and MSVI did not differ markedly between world regions nor between women. Significance By 2010, one out of 15 blind people was blind due to glaucoma, and one of 45 visually impaired people was visually impaired, highlighting the increasing global burden of glaucoma. PMID:27764086
Universities-industry collaboration strategies: a micro-level perspective
DEFF Research Database (Denmark)
Bjerregaard, Toke
2009-01-01
Purpose - The purpose of this paper is to examine the collaboration strategies employed by collaborating small- and medium-sized enterprises (SMEs) and university researchers for initiating and optimizing the process and outcome of R&D collaboration. Design/methodology/approach - The paper is based...... upon a long-term strategy aiming at developing UI relations beyond the immediate project and practical learning. A variety of shifting strategies shape researchers' decisions during UI collaborations, which thus convey different notions of success. Research limitations/implications - The findings...... partners choose to pursue difference short- or long-term strategies to optimize the process and outcome of university-industry (UI) collaboration. Some collaborations were thus informed by a short-term strategy aimed at achieving immediate R&D results. However, to a high extent, many SME partners relied...
Directory of Open Access Journals (Sweden)
Paula Cabrini Scheibel
2014-10-01
Full Text Available OBJECTIVE: The aim of the present study was to investigate the correlation between initial alveolar bone density of upper central incisors (ABD-UI and external apical root resorption (EARR after 12 months of orthodontic movement in cases without extraction. METHODS: A total of 47 orthodontic patients 11 years old or older were submitted to periapical radiography of upper incisors prior to treatment (T1 and after 12 months of treatment (T2. ABD-UI and EARR were measured by means of densitometry. RESULTS: No statistically significant correlation was found between initial ABD-UI and EARR at T2 (r = 0.149; p = 0.157. CONCLUSION: Based on the present findings, alveolar density assessed through periapical radiography is not predictive of root resorption after 12 months of orthodontic treatment in cases without extraction.
Scheibel, Paula Cabrini; Ramos, Adilson Luiz; Iwaki, Lilian Cristina Vessoni; Micheletti, Kelly Regina
2014-01-01
OBJECTIVE: The aim of the present study was to investigate the correlation between initial alveolar bone density of upper central incisors (ABD-UI) and external apical root resorption (EARR) after 12 months of orthodontic movement in cases without extraction. METHODS: A total of 47 orthodontic patients 11 years old or older were submitted to periapical radiography of upper incisors prior to treatment (T1) and after 12 months of treatment (T2). ABD-UI and EARR were measured by means of densitometry. RESULTS: No statistically significant correlation was found between initial ABD-UI and EARR at T2 (r = 0.149; p = 0.157). CONCLUSION: Based on the present findings, alveolar density assessed through periapical radiography is not predictive of root resorption after 12 months of orthodontic treatment in cases without extraction. PMID:25715722
Directory of Open Access Journals (Sweden)
Fragoulakis V
2013-04-01
Full Text Available V Fragoulakis,1 E Kastritis,2 T Psaltopoulou,3 N Maniadakis1 1National School of Public Health, Athens, Greece; 2Department of Clinical Therapeutics, Alexandra Hospital, University of Athens, School of Medicine, Athens, Greece; 3Department of Hygiene, Epidemiology and Medical Statistics, University of Athens, School of Medicine, Athens, Greece Background: Multiple myeloma is a hematologic malignancy that incurs a substantial economic burden in care management. Since most patients with multiple myeloma eventually relapse or become refractory to current therapies (rrMM, the aim of this study was to assess the cost-effectiveness of the combination of lenalidomide–dexamethasone, relative to bortezomib alone, in patients suffering from rrMM in Greece. Methods: An international discrete event simulation model was locally adapted to estimate differences in overall survival and treatment costs associated with the two alternative treatment options. The efficacy data utilized came from three international trials (MM-009, MM-010, APEX. Quality of life data were extracted from the published literature. Data on resource use and prices came from relevant local sources and referred to 2012. The perspective of the analysis was that of public providers. Total costs for monitoring and administration of therapy to patients, management of adverse events, and cost of medication were captured. A 3.5% discount rate was used for costs and health outcomes. A Monte Carlo simulation was used to estimate probabilistic results with 95% uncertainty intervals (UI and a cost-effectiveness acceptability curve. Results: The mean number of quality-adjusted life years (QALYs was 3.01 (95% UI 2.81–3.20 and 2.22 (95% UI 2.02–2.41 for lenalidomide–dexamethasone and bortezomib, respectively, giving an incremental gain of 0.79 (95% UI 0.49–1.06 QALYs in favor of lenalidomide–dexamethasone. The mean cost of therapy per patient was estimated at €77,670 (95% UI €76,509
Misganaw, Awoke; Melaku, Yohannes Adama; Tessema, Gizachew Assefa; Deribew, Amare; Deribe, Kebede; Abera, Semaw Ferede; Dessalegn, Muluken; Lakew, Yihunie; Bekele, Tolesa; Haregu, Tilahun N; Amare, Azmeraw T; Gedefaw, Molla; Mohammed, Mesoud; Yirsaw, Biruck Desalegn; Damtew, Solomon Abrha; Achoki, Tom; Blore, Jed; Krohn, Kristopher J; Assefa, Yibeltal; Kifle, Mahlet; Naghavi, Mohsen
2017-01-01
Disability-adjusted life years (DALYs) provide a summary measure of health and can be a critical input to guide health systems, investments, and priority-setting in Ethiopia. We aimed to determine the leading causes of premature mortality and disability using DALYs and describe the relative burden of disease and injuries in Ethiopia. We used results from the Global Burden of Diseases, Injuries, and Risk Factors Study 2015 (GBD 2015) for non-fatal disease burden, cause-specific mortality, and all-cause mortality to derive age-standardized DALYs by sex for Ethiopia for each year. We calculated DALYs by summing years of life lost due to premature mortality (YLLs) and years lived with disability (YLDs) for each age group and sex. Causes of death by age, sex, and year were measured mainly using Causes of Death Ensemble modeling. To estimate YLDs, a Bayesian meta-regression method was used. We reported DALY rates per 100,000 for communicable, maternal, neonatal, and nutritional (CMNN) disorders, non-communicable diseases, and injuries, with 95% uncertainty intervals (UI) for Ethiopia. Non-communicable diseases caused 23,118.1 (95% UI, 17,124.4-30,579.6), CMNN disorders resulted in 20,200.7 (95% UI, 16,532.2-24,917.9), and injuries caused 3781 (95% UI, 2642.9-5500.6) age-standardized DALYs per 100,000 in Ethiopia in 2015. Lower respiratory infections, diarrheal diseases, and tuberculosis were the top three leading causes of DALYs in 2015, accounting for 2998 (95% UI, 2173.7-4029), 2592.5 (95% UI, 1850.7-3495.1), and 2562.9 (95% UI, 1466.1-4220.7) DALYs per 100,000, respectively. Ischemic heart disease and cerebrovascular disease were the fourth and fifth leading causes of age-standardized DALYs, with rates of 2535.7 (95% UI, 1603.7-3843.2) and 2159.9 (95% UI, 1369.7-3216.3) per 100,000, respectively. The following causes showed a reduction of 60% or more over the last 25 years: lower respiratory infections, diarrheal diseases, tuberculosis, neonatal encephalopathy
African Journals Online (AJOL)
ebutamanya
15 mars 2016 ... Selon les marqueurs évolutifs, 112 patients (78,3%) avaient un AgHBe négatif. Quant à la charge virale, 106 patients (74,2%) avaient une virémie inférieure à 2000UI/ml et une fibrose minime inférieure à 7kpa selon le FibroScan. Parmi eux, 13 malades avaient un ADN du VHB indétectable (<20UI/ml).
International Nuclear Information System (INIS)
Hassan, A.; Shafi, M.; Khattak, M.
2016-01-01
This paper addresses UI (User Interface) designing based on multi-touch collaborative gesture recognition meant for ASD (Autism Spectrum Disorder) - affected children. The present user interfaces (in the context of behavioral interventions for Autism Spectrum disorder) are investigated in detail. Thorough comparison has been made among various groups of these UIs. Advantages and limitations of these interfaces are discussed and future directions for the design of such interfaces are suggested. (author)
Fu, Qiuli; Qin, Zhenwei; Jin, Xiuming; Zhang, Lifang; Chen, Zhijian; He, Jiliang; Ji, Junfeng; Yao, Ke
2017-01-01
The pathological mechanisms underlying cataract formation remain largely unknown on account of the lack of appropriate in vitro cellular models. The aim of this study is to develop a stable in vitro system for human lens regeneration using pluripotent stem cells. Isolated human urinary cells were infected with four Yamanaka factors to generate urinary human induced pluripotent stem cells (UiPSCs), which were induced to differentiate into lens progenitor cells and lentoid bodies (LBs). The expression of lens-specific markers was examined by real-time PCR, immunostaining, and Western blotting. The structure and magnifying ability of LBs were investigated using transmission electron microscopy and observing the magnification of the letter "X," respectively. We developed a "fried egg" differentiation method to generate functional LBs from UiPSCs. The UiPSC-derived LBs exhibited crystalline lens-like morphology and a transparent structure and expressed lens-specific markers αA-, αB-, β-, and γ-crystallin and MIP. During LB differentiation, the placodal markers SIX1, EYA1, DLX3, PAX6, and the specific early lens markers SOX1, PROX1, FOXE3, αA-, and αB-crystallin were observed at certain time points. Microscopic examination revealed the presence of lens epithelial cells adjacent to the lens capsule as well as both immature and mature fiber-like cells. Optical analysis further demonstrated the magnifying ability (1.7×) of the LBs generated from UiPSCs. Our study provides the first evidence toward generating functional LBs from UiPSCs, thereby establishing an in vitro system that can be used to study human lens development and cataractogenesis and perhaps even be useful for drug screening.
Dumoulin, Chantale; Hunter, Kathleen F; Moore, Katherine; Bradley, Catherine S; Burgio, Kathryn L; Hagen, S; Imamura, M; Thakar, R; Williams, K; Chambers, T
2016-01-01
The objective of the 5th International Consultation on Incontinence (ICI) chapter on Adult Conservative Management was to review and summarize the new evidence on conservative management of urinary incontinence (UI) and pelvic organ prolapse (POP) in order to compile a current reference source for clinicians, health researchers, and service planners. In this paper, we present the review highlights and new evidence on female conservative management. Revision and updates of the 4th ICI Report using systematic review covering years 2008-2012. Each section begins with a brief definition and description of the intervention followed by a summary, where possible, of both the state and level of evidence for prevention and treatment, and ends with a "grade of recommendation." The paper concludes with areas identified as requiring further research. For UI, there are no prevention trials on lifestyle interventions. There are, however, few new intervention trials of lifestyle interventions involving weight loss and fluid intake with improved levels of evidence and grade of recommendation. Outside of pre- and post-natal pelvic floor muscle training (PFMT) trials for the prevention of female UI, there is a dearth of PFMT prevention trials for women with UI. PFMT remains the first-line treatment for female UI with high levels of evidence and grades of recommendation. Bladder training levels of evidence and grades of recommendation are maintained. For POP, new evidence supports the effectiveness of physiotherapy in the treatment of POP and there are now improved levels of evidence and grades of recommendation. Neurourol. Urodynam. 35:15-20, 2016. © 2014 Wiley Periodicals, Inc. © 2014 Wiley Periodicals, Inc.
Plant-Derived Urease Inhibitors as Alternative Chemotherapeutic Agents.
Hassan, Sherif T S; Žemlička, Milan
2016-07-01
Inhibition of the metalloenzyme urease has important pharmacologic applications in the field of antiulcer and antigastric cancer agents. Urease is involved in many serious infections caused by Helicobacter pylori in the gastric tract as well as by Proteus and related species in the urinary tract. Although numerous studies have described several novel urease inhibitors (UIs) used for the treatment of gastric and urinary infections, all these compounds have exhibited severe side effects, toxicity, and instability. Therefore, to overcome such problems, it is necessary to search for new sources of UIs, such as natural products, that provide reduced side effects, low toxicity, greater stability, and bioavailability. As limited studies have been conducted on plant-derived UIs, this paper aims to highlight and summarize the most promising compounds isolated and identified from plants, such as terpenoids, phenolic compounds, alkaloids, and other substances with inhibitory activities against plant and bacterial ureases; these are in vitro and in vivo studies with an emphasis on structure-activity relationship studies and types of inhibition that show high and promising levels of anti-urease activity. This will aid medicinal chemists in the design and synthesis of novel and pharmacologically potent UIs useful for the development of antiulcer drugs. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Adaptive UIX Layer for University Information SOA-BUS
Directory of Open Access Journals (Sweden)
Octavian DOSPINESCU
2017-01-01
Full Text Available The user interface (UI layer is considered one of the key components of software applications since it connects their end-users to functionalities. Well-engineered and robust software applications could eventually fail to be adopted due to a weak UI layer. In the current market, when creating sites, UI designers have to determine how to plan the best interface according to the devices of the users, namely desktops, laptops, tablets or smartphones. Having this in mind, the current paper aims to present the adaptive UIX Layer for a University Information SOA-Bus (UISB – a topic discussed in previous works [1], [2]. In this respect, we reviewed the literature on responsive and adaptive web design in order to identify the best front-end approach to the UISB. According to our findings, there is a strong debate in the academic field as well in the IT business in what concerns UI design. Recent interests have shown that the new trend in drafting the front-end layer is choosing between a responsive and an adaptive design. While arguments provided by both sides have failed to ease the decision makers’ choices on what type of design to choose, we aim to bring some light on the subject by proposing different layers for the UISB.
Directory of Open Access Journals (Sweden)
Kazuo Isoda
2017-03-01
Full Text Available The intuitiveness of tangible user interface (TUI is not only for its operator. It is quite possible that this type of user interface (UI can also have an effect on the experience and learning of observers who are just watching the operator using it. To understand the possible effect of TUI, the present study focused on the mu rhythm suppression in the sensorimotor area reflecting execution and observation of action, and investigated the brain activity both in its operator and observer. In the observer experiment, the effect of TUI on its observers was demonstrated through the brain activity. Although the effect of the grasping action itself was uncertain, the unpredictability of the result of the action seemed to have some effect on the mirror neuron system (MNS-related brain activity. In the operator experiment, in spite of the same grasping action, the brain activity was activated in the sensorimotor area when UI functions were included (TUI. Such activation of the brain activity was not found with a graphical user interface (GUI that has UI functions without grasping action. These results suggest that the MNS-related brain activity is involved in the effect of TUI, indicating the possibility of UI evaluation based on brain activity.
Renewable Electric Plant Information System user interface manual: Paradox 7 Runtime for Windows
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-11-01
The Renewable Electric Plant Information System (REPiS) is a comprehensive database with detailed information on grid-connected renewable electric plants in the US. The current version, REPiS3 beta, was developed in Paradox for Windows. The user interface (UI) was developed to facilitate easy access to information in the database, without the need to have, or know how to use, Paradox for Windows. The UI is designed to provide quick responses to commonly requested sorts of the database. A quick perusal of this manual will familiarize one with the functions of the UI and will make use of the system easier. There are six parts to this manual: (1) Quick Start: Instructions for Users Familiar with Database Applications; (2) Getting Started: The Installation Process; (3) Choosing the Appropriate Report; (4) Using the User Interface; (5) Troubleshooting; (6) Appendices A and B.
AdaM: Adapting Multi-User Interfaces for Collaborative Environments in Real-Time
DEFF Research Database (Denmark)
Park, Seonwook; Gebhardt, Christoph; Rädle, Roman
2018-01-01
and rule-based solutions are tedious to create and do not scale to larger problems nor do they adapt to dynamic changes, such as users leaving or joining an activity. In this paper, we cast the problem of UI distribution as an assignment problem and propose to solve it using combinatorial optimization. We...... present a mixed integer programming formulation which allows real-time applications in dynamically changing collaborative settings. It optimizes the allocation of UI elements based on device capabilities, user roles, preferences, and access rights. We present a proof-of-concept designer-in-the-loop tool......Developing cross-device multi-user interfaces (UIs) is a challenging problem. There are numerous ways in which content and interactivity can be distributed. However, good solutions must consider multiple users, their roles, their preferences and access rights, as well as device capabilities. Manual...
DEFF Research Database (Denmark)
Svare, Jens A; Hansen, Bent B; Lose, Gunnar
2014-01-01
second questionnaire was filled out 1 year later. Additional data were obtained from the medical records. The first questionnaire was completed by 1,018 women (63 %) and the second by 859 women (84 %). The study group comprised the 575 women without any UI before the pregnancy and who had a vaginal...... delivery. The primary analysis comprised 117 women with either SUI or MUI 1 year after the vaginal delivery and 403 women without any UI. RESULTS: In univariate analyses, the following factors were associated with SUI or MUI: prepregnancy body mass index (BMI) ≥ 30 (p ...INTRODUCTION AND HYPOTHESIS: The objective was to examine the relationship between maternal and perinatal factors and the occurrence of stress (SUI) or mixed (MUI) urinary incontinence (UI) 1 year after the first vaginal delivery in primiparous women. METHODS: Participants in this prospective...
Effect of Inhomogeneity on s-wave Superconductivity in the Attractive Hubbard Model
Energy Technology Data Exchange (ETDEWEB)
Aryanpour, K. A. [University of California, Davis; Dagotto, Elbio R [ORNL; Mayr, Matthias [Max-Planck-Institut fur Feskorperforschung, Stuttgart, Germany; Paiva, T. [Universidade Federal do Rio de Janeiro, Brazil; Pickett, W. E. [University of California, Davis; Scalettar, Richard T [ORNL
2006-01-01
Inhomogeneous s-wave superconductivity is studied in the two-dimensional, square lattice attractive Hubbard Hamiltonian using the Bogoliubov-de Gennes BdG mean field approximation. We find that at weak coupling, and for densities mainly below half-filling, an inhomogeneous interaction in which the on-site interaction Ui takes on two values, Ui=0, 2U results in a larger zero temperature pairing amplitude, and that the superconducting Tc can also be significantly increased, relative to a uniform system with Ui=U on all sites. These effects are observed for stripe, checkerboard, and even random patterns of the attractive centers, suggesting that the pattern of inhomogeneity is unimportant. Monte Carlo calculations which reintroduce some of the fluctuations neglected within the BdG approach see the same effect, both for the attractive Hubbard model and a Hamiltonian with d-wave pairing symmetry.
Kardanpour, Reihaneh; Tangestaninejad, Shahram; Mirkhani, Valiollah; Moghadam, Majid; Mohammadpoor-Baltork, Iraj; Zadehahmadi, Farnaz
2016-03-01
Efficient synthesis of various benzimidazoles and benzothiazoles under mild conditions catalyzed by Cu(II) anchored onto UiO-66-NH2 metal organic framework is reported. In this manner, first, the aminated UiO-66 was modified with thiophene-2-carbaldehyde and then the prepared Schiff base was reacted with CuCl2. The prepared catalyst was characterized by FT-IR, UV-vis, X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), N2 adsorption, inductively coupled plasma atomic emission spectroscopy (ICP-AES) and field emission scanning electron microscopy (FE-SEM). The UiO-66-NH2-TC-Cu was applied as a highly efficient catalyst for synthesis of benzimidazole and benzothiazole derivatives by the reaction of aldehydes with 1,2-diaminobenzene or 2-aminothiophenol. The Cu(II)-containing MOF was reused several times without any appreciable loss of its efficiency.
M. T. Teruel; R. C. Catalano; S. S. Callejas; J. A. Cabodevila; S. Gómez
2006-01-01
El objetivo del trabajo fue evaluar el efecto de diferentes dosis de gonadotrofina coriónica equina (eCG) (5, 7,5 o 10 UI) sobre parámetros ováricos y desarrollo in vitro de embriones de hembras ratón Balb C. El peso y diámetro ovárico fueron superiores en animales tratados con 7,5 y 10 UI de eCG que en animales controles (P
Enhancements for a Dynamic Data Warehousing and Mining System for Large-scale HSCB Data
2016-06-20
seamlessly. A representative UI is shown in Figure 1. The UI has the same look and feel with other social media searches, Page | 4...released it part of Scraawl. In particular, we have developed two APIs for continuous (Streaming) and recent YouTube data searches, and designed a...allows searching on recent YouTube videos, and the resulting data will be saved in the configured database . Both APIs make use of the (i
The Near Wake of Bluff Bodies in Stratified Fluids and the Emergence of Late Wake Characteristics
2010-10-29
The Physics of Fluids, 20:187-191, 1977. [39] L. Prandtl. Uber ttiissigkeitsbewegimg bei sehr kleiuer reibung. Int. Math. Kongr. Heidelberg, pages...Tij = UiUj — Ui Uj. (3) The form of equations (1) and (2) requires that the filtering and differentiation com- mute (Ghosal and Moin (1995...introduced an exponential filter which has an inverse in a form of a differential operator. The inverse allows to compute the SGS stress tensor from the
Directory of Open Access Journals (Sweden)
AHMED HASSAN
2016-10-01
Full Text Available This paper addresses UI (User Interface designing based on multi-touch collaborative gesture recognition meant for ASD (Autism Spectrum Disorder - affected children. The present user interfaces (in the context of behavioral interventions for Autism Spectrum disorder are investigated in detail. Thorough comparison has been made among various groups of these UIs. Advantages and limitations of these interfaces are discussed and future directions for the design of such interfaces are suggested.
Leading Healthcare Change Across the Care Continuum: An Interview With Dr Kenneth Rempher.
Murphy, Lyn Stankiewicz; Joseph, M Lindell
2016-01-01
Kenneth Rempher, PhD, MBA, CENP, RN, is the chief nursing officer for the University of Iowa (UI) Hospitals and Clinics. In his 20-year career, he has distinguished himself as a visionary healthcare leader. Colleagues describe Dr Rempher as a strong, transformational leader, guiding the UI enterprise through a time of uncertainty and change. This interview by the CGEAN provides insight to his leadership style, successes, and ideas on the future of care delivery.
PROCESS FOR PREPARING URANIUM METAL
Prescott, C.H. Jr.; Reynolds, F.L.
1959-01-13
A process is presented for producing oxygen-free uranium metal comprising contacting iodine vapor with crude uranium in a reaction zone maintained at 400 to 800 C to produce a vaporous mixture of UI/sub 4/ and iodine. Also disposed within the maction zone is a tungsten filament which is heated to about 1600 C. The UI/sub 4/, upon contacting the hot filament, is decomposed to molten uranium substantially free of oxygen.
Notes on Finite Cooperative Games,
1981-02-01
solution concepts: .-%. P Th. 1: (VIN) M (r) + o (Peleg) 11 r STh. II: (VI) K(r) + 0 (Maschler & Peleg) Donald Brown and Peter Loeb, "The Values of...C. If ZeJ and ySZ ipso facto ZeC C. Since K K 0jC- for any j, CcC, OJC. Then C is a filter and C 3. By Zorn’s Lemma there exists UI such that UI is
The societal cost of Taenia solium cysticercosis in Tanzania.
Trevisan, Chiara; Devleesschauwer, Brecht; Schmidt, Veronika; Winkler, Andrea Sylvia; Harrison, Wendy; Johansen, Maria Vang
2017-01-01
Taenia solium is a zoonotic parasite prevalent in many low income countries throughout Latin America, Asia and sub-Saharan Africa, including Tanzania. The parasite is recognized as a public health threat; however the burden it poses on populations of Tanzania is unknown. The aim of this study was to estimate the societal cost of T. solium cysticercosis in Tanzania, by assessing both the health and economic burden. The societal cost of T. solium cysticercosis was assessed in humans and pigs based on data obtained by a systematic review. Experts' opinion was sought in cases where data were not retrievable. The health burden was assessed in terms of annual number of neurocysticercosis (NCC) associated epilepsy incident cases, deaths and disability-adjusted life years (DALYs), while the economic burden was assessed in terms of direct and indirect costs imposed by NCC-associated epilepsy and potential losses due to porcine cysticercosis. Based on data retrieved from the systematic review and burden assessments, T. solium cysticercosis contributed to a significant societal cost for the population. The annual number of NCC-associated epilepsy incident cases and deaths were 17,853 (95% Uncertainty Interval (UI), 5666-36,227) and 212 (95% UI, 37-612), respectively. More than 11% (95% UI, 6.3-17) of the pig population was infected with the parasite when using tongue examination as diagnostic method. For the year 2012 the number of DALYs per thousand person-years for NCC-associated epilepsy was 0.7 (95% UI, 0.2-1.6). Around 5 million USD (95% UI, 797,535-16,933,477) were spent due to NCC-associated epilepsy and nearly 3 million USD (95% UI, 1,095,960-5,366,038) were potentially lost due to porcine cysticercosis. Our results show that T. solium imposes a serious public health, agricultural and economic threat for Tanzania. We urge that a One Health approach, which involves the joint collaboration and effort of veterinarians, medical doctors, agricultural extension officers
Using STOQS to Understand Molecular Biology and Oceanographic Data
McCann, M. P.; Ryan, J. P.; Messié, M.; Harvey, J.; Cline, D.; Michisaki, R.
2014-12-01
Advances in technology enable us to collect massive amounts of diverse data. With the ability to collect more data, the problem of comparative analysis becomes increasing difficult. The Monterey Bay Aquarium Research Institute (MBARI) designed the Spatial Temporal Oceanographic Query System (STOQS) to create new capabilities for scientists to gain insight from data collected by oceanographic platforms. STOQS uses a geospatial database and a web-based user interface (UI) to allow scientists to explore large collections of data. The UI is optimized to provide a quick overview of data in spatial and temporal dimensions, as well as in parameter and platform space. A user may zoom into a feature of interest and select it, initiating a filter operation updating the UI with an overview of all the data in the new filtered selection. When details are desired, radio buttons and check boxes can be selected to generate a number of different types of visualizations. These include color-filled temporal section plots, parameter-parameter plots, and both 2D and 3D spatial visualizations. The ISO/IEC 19775-1, Extensible 3D (X3D) standard provides the technology for presenting 3D data in a web browser. STOQS has been in use at MBARI for four years and is helping us manage and visualize data from month-long multi-platform observational campaigns. These campaigns produce tens of millions of diverse measurements. These volumes are too great to really understand - even with an effective data exploration UI. Effective management of these diverse data in STOQS is achieved through a two-step harmonization process: 1) conversion of all data to OGC CF-NetCDF Discrete Sampling Geometry feature types and 2) loading all data into the STOQS data model. Having all of the data easily accessible via this data model made development of the UI possible. This same method of access is also being used for development of visualization and analysis programs for tasks that cannot be executed within the UI
Directory of Open Access Journals (Sweden)
Tak Erwin CPM
2012-09-01
Full Text Available Abstract Background Urinary incontinence (UI is a major problem in older women. Management is usually restricted to dealing with the consequences instead of treating underlying causes such as bladder dysfunction or reduced mobility. The aim of this multicenter randomized controlled trial was to compare a group-based behavioral exercise program to prevent or reduce UI, with usual care. The exercise program aimed to improve functional performance of pelvic floor muscle (PFM, bladder and physical performance of women living in homes for the elderly. Methods Twenty participating Dutch homes were matched and randomized into intervention or control homes using a random number generator. Homes recruited 6–10 older women, with or without UI, with sufficient cognitive and physical function to participate in the program comprising behavioral aspects of continence and physical exercises to improve PFM, bladder and physical performance. The program consisted of a weekly group training session and homework exercises and ran for 6 months during which time the control group participants received care as usual. Primary outcome measures after 6 months were presence or absence of UI, frequency of episodes (measured by participants and caregivers (not blinded using a 3-day bladder diary and the Physical Performance Test (blinded. Linear and logistic regression analysis based on the Intention to Treat (ITT principle using an imputed data set and per protocol analysis including all participants who completed the study and intervention (minimal attendance of 14 sessions. Results 102 participants were allocated to the program and 90 to care as usual. ITT analysis (n = 85 intervention, n = 70 control showed improvement of physical performance (intervention +8%; control −7% and no differences on other primary and secondary outcome measures. Per protocol analysis (n = 51 intervention, n = 60 control showed a reduction of participants with UI
Starke, Sandra D; Baber, Chris
2018-07-01
User interface (UI) design can affect the quality of decision making, where decisions based on digitally presented content are commonly informed by visually sampling information through eye movements. Analysis of the resulting scan patterns - the order in which people visually attend to different regions of interest (ROIs) - gives an insight into information foraging strategies. In this study, we quantified scan pattern characteristics for participants engaging with conceptually different user interface designs. Four interfaces were modified along two dimensions relating to effort in accessing information: data presentation (either alpha-numerical data or colour blocks), and information access time (all information sources readily available or sequential revealing of information required). The aim of the study was to investigate whether a) people develop repeatable scan patterns and b) different UI concepts affect information foraging and task performance. Thirty-two participants (eight for each UI concept) were given the task to correctly classify 100 credit card transactions as normal or fraudulent based on nine transaction attributes. Attributes varied in their usefulness of predicting the correct outcome. Conventional and more recent (network analysis- and bioinformatics-based) eye tracking metrics were used to quantify visual search. Empirical findings were evaluated in context of random data and possible accuracy for theoretical decision making strategies. Results showed short repeating sequence fragments within longer scan patterns across participants and conditions, comprising a systematic and a random search component. The UI design concept showing alpha-numerical data in full view resulted in most complete data foraging, while the design concept showing colour blocks in full view resulted in the fastest task completion time. Decision accuracy was not significantly affected by UI design. Theoretical calculations showed that the difference in achievable
Lausen, Adi; Marsland, Louise; Head, Samantha; Jackson, Joanna; Lausen, Berthold
2018-01-12
Urinary incontinence (UI) is a distressing condition affecting at least 5 million women in England and Wales. Traditionally, physiotherapy for UI comprises pelvic floor muscle training, but although evidence suggests this can be effective it is also recognised that benefits are often compromised by patient motivation and commitment. In addition, there is increasing recognition that physical symptoms alone are poor indicators of the impact of incontinence on individuals' lives. Consequently, more holistic approaches to the treatment of UI, such as Modified Pilates (MP) have been recommended. This study aimed to provide preliminary findings about the effectiveness of a 6-week course of MP classes as an adjunct to standard physiotherapy care for UI, and to test the feasibility of a randomised controlled trial (RCT) design. The study design was a single centre pilot RCT, plus qualitative interviews. 73 women referred to Women's Health Physiotherapy Services for UI at Colchester Hospital University NHS Foundation Trust were randomly assigned to two groups: a 6-week course of MP classes in addition to standard physiotherapy care (intervention) or standard physiotherapy care only (control). Main outcome measures were self-reported UI, quality of life and self-esteem at baseline (T1), completion of treatment (T2), and 5 months after randomisation (T3). Qualitative interviews were conducted with a subgroup at T2 and T3. Due to the nature of the intervention blinding of participants, physiotherapists and researchers was not feasible. Post-intervention data revealed a range of benefits for women who attended MP classes and who had lower symptom severity at baseline: improved self-esteem (p = 0.032), decreased social embarrassment (p = 0.026) and lower impact on normal daily activities (p = 0.025). In contrast, women with higher symptom severity showed improvement in their personal relationships (p = 0.017). Qualitative analysis supported these findings and
USO DA eCG PARA FORMAÇÃO DO CORPO LÚTEO EQÜINO E PRODUÇÃO DE PROGESTERONA
Directory of Open Access Journals (Sweden)
Tiago Gomes RODRIGUES
2015-12-01
Full Text Available Este estudo foi conduzido com a finalidade de avaliar o uso da gonadotrofina coriônica eqüina (eCG logo após a ovulação de éguas com o objetivo avaliar a formação do corpo lúteo e produção de progesterona. Utilizou-se 50 éguas durante 2 estações de monta 2011/2012 e 2012/2013. Com auxílio da ultrassonografia as éguas foram monitoradas as características dos órgãos genitais durante o estro até o dia da ovulação (D0 e no diestro em D2, D4 e D8. O experimento foi dividido em 2 tratamentos: Tratamento I (n=25 – éguas com ovulação natural e tratamento II (n=25 – éguas com ovulação induzida. Verificada a ovulação, os tratamentos foram sub divididas em 5 grupos de 5 animais, obedecendo a administração do fármaco estudado (eCG, sendo GI: controle; GII: 250 UI eCG no DO; GIII: 250 UI eCG no DO + 250 UI eCG no D2; GIV: 500 UI no Do; e GV: 500 UI eCG no D0 + 500 UI no D2. Para a avaliação do efeito dose resposta do fármaco e influência do eCG sob a glândula luteínica, foram coletados os dados: tônus uterino, ecogenicidade e tamanho do corpo lúteo (CL e concentração de progesterona. Na análise estatística somente quando comparando o GV entre os dois tratamentos há diferença estatística para o D8 na concentração de progesterona. Portanto o uso da eCG no momento da ovulação, não produziu efeito significativo esperado, mas este trabalho inicial abre portas para novas investigações a respeito desta biomolécula, e que venha contribuir na biotecnologia reprodutiva equina.
Hameed, Shaista
2009-01-01
Cyanobacteria produce a number of bioactive compounds, most of them are oligopeptides. Almost all are known from freshwater species. The aim of this study was to search for marine and brackish water species producing bioactive compounds. To reach this goal, new strains were isolated from Norwegian and Pakistani coastal waters. These and additional strains from NIVA, UiO and UiB culture collections (24 in total), belonging to Chroococcales and Oscillatoriales, were identified based on morpholo...
Prevalence and risk factors for urinary incontinence in healthy pregnant Brazilian women.
Martins, Gisele; Soler, Zaida A S G; Cordeiro, José Antônio; Amaro, João Luiz; Moore, Katherine N
2010-10-01
Physiological and anatomical changes of pregnancy are risk factors for lower urinary tract symptoms (LUTS). This study aimed to evaluate the prevalence and risk factors for urinary incontinence (UI) in healthy pregnant women. A cross-sectional study was conducted in pregnant Brazilian women who enrolled in the primary health-care system in Sao Jose do Rio Preto, Brazil. Face-to-face interview and completion of two-part questionnaire were administered and done which evaluated the presence of LUTS pre- and during pregnancy. The data were analyzed by logistic regression. Five hundred pregnant women were enrolled ranging from first to third trimester. LUTS present in 63.8% in these women; the main associated risk factors were multiparity and prepregnancy LUTS as well as smoking, constipation, and daily coffee intake. The prevalence of UI during pregnancy is high, highlighting the presence of the risk factors associated with UI during pregnancy.
Global Epidemiology and Burden of Schizophrenia
DEFF Research Database (Denmark)
Charlson, Fiona J; Ferrari, Alize J; Santomauro, Damian F
2018-01-01
countries. Method: We conducted a systematic review to identify studies reporting the prevalence, incidence, remission, and/or excess mortality associated with schizophrenia. Reported estimates which met our inclusion criteria were entered into a Bayesian meta-regression tool used in GBD 2016 to derive...... prevalence for 20 age groups, 7 super-regions, 21 regions, and 195 countries and territories. Burden of disease estimates were derived for acute and residual states of schizophrenia by multiplying the age-, sex-, year-, and location-specific prevalence by 2 disability weights representative of the disability......-standardized point prevalence rates did not vary widely across countries or regions. Globally, prevalent cases rose from 13.1 (95% UI: 11.6-14.8) million in 1990 to 20.9 (95% UI: 18.5-23.4) million cases in 2016. Schizophrenia contributes 13.4 (95% UI: 9.9-16.7) million years of life lived with disability to burden...
Figueiredo, Vânia F; Amorim, Juleimar S C; Pereira, Aline M; Ferreira, Paulo H; Pereira, Leani S M
2015-01-01
Low back pain (LBP) and urinary incontinence (UI) are highly prevalent among elderly individuals. In young adults, changes in trunk muscle recruitment, as assessed via ultrasound imaging, may be associated with lumbar spine stability. To assess the associations between LBP, UI, and the pattern of transversus abdominis (TrA), internal (IO), and external oblique (EO) muscle recruitment in the elderly as evaluated by ultrasound imaging. Fifty-four elderly individuals (mean age: 72±5.2 years) who complained of LBP and/or UI as assessed by the McGill Pain Questionnaire, Incontinence Questionnaire-Short Form, and ultrasound imaging were included in the study. The statistical analysis comprised a multiple linear regression model, and a p-value recruitment. These results suggest that age-related factors may have interfered with the findings of the study, thus emphasizing the need to perform ultrasound imaging-based studies to measure abdominal muscle recruitment in the elderly.
DEFF Research Database (Denmark)
Sørensen, Rikke Guldberg; Kesmodel, Ulrik Schiøler; Brostrøm, Søren
2014-01-01
OBJECTIVE: To describe the use of antibiotics for urinary tract infection (UTI) before and after surgery for urinary incontinence (UI); and for those with use of antibiotics before surgery, to estimate the risk of treatment for a postoperative UTI, relative to those without use of antibiotics...... from the date of surgery were extracted from a prescription database. MAIN OUTCOME MEASURES: Use of antibiotics for UTI in relation to UI surgery, and the risk of being a postoperative user of antibiotics for UTI among preoperative users. RESULTS: A total of 2151 women had a primary surgical procedure...... for UI; of these 496 (23.1%) were preoperative users of antibiotics for UTI. Among preoperative users, 129 (26%) and 215 (43.3%) also redeemed prescriptions of antibiotics for UTI within 0-60 and 61-365 days after surgery, respectively. Among preoperative non-users, 182 (11.0%) and 235 (14.2%) redeemed...
Daly, Deirdre; Clarke, Mike; Begley, Cecily
2018-03-01
While many women report urinary incontinence (UI) during pregnancy, associations with pre-pregnancy urinary leakage remain under-explained. We performed a multi-strand prospective cohort study with 860 nulliparous women recruited during pregnancy. Prevalence of any urinary leakage was 34.8% before and 38.7% during pregnancy. Prevalence of UI, leaking urine at least once per month, was 7.2% and 17.7% respectively. Mixed urinary incontinence (MUI) was reported by 59.7% of women before and 58.8% during pregnancy, stress urinary incontinence (SUI) by 22.6% and 37.2%, and urge urinary incontinence (UUI) by 17.7% and 4.0%, respectively. SUI accounted for half (50.0%), MUI for less than half (44.2%), and UUI for 5.8% of new-onset UI in pregnancy. Pre-pregnancy UI was significantly associated with childhood enuresis [adjusted odds ratio (AOR) 2.9, 95% confidence interval (CI) 1.5-5.6, p = 0.001) and a body mass index (BMI) ≥30 kg/m 2 (AOR 4.2, 95% CI 1.9-9.4, p pregnancy BMI was 25-29.99 kg/m 2 (AOR 2.0, 95% CI 1.2-3.5, p = 0.01), and women who leaked urine less than once per month (AOR 2.6, 95% CI 1.6-4.1, p pregnancy. Considerable proportions of nulliparous women leak urine before and during pregnancy, and most ignore symptoms. Healthcare professionals have several opportunities for promoting continence in all pregnant women, particularly in women with identifiable risk factors. If enquiry about UI, and offering advice on effective preventative and curative treatments, became routine in clinical practice, it is likely that some of these women could become or stay continent.
Montenegro-Bethancourt, Gabriela; Johner, Simone A; Stehle, Peter; Remer, Thomas
2015-07-14
Adequate dietary iodine intake in children is essential for optimal physical and neurological development. Whether lower dietary animal food and salt intake may adversely affect iodine status is under discussion. We examined the association between dietary animal:plant protein ratio with 24-h urinary iodine excretion (24-h UI, μg/d), and whether this is modified by salt intake. A 24-h UI was measured in 1959 24-h urine samples from 516 6- to 12-year-old participants of the Dortmund Nutritional and Anthropometric Longitudinally Designed Study. Parallel 3 d weighed food records were used to estimate dietary intakes. Protein sources were classified as dairy, animal and plant. A repeated-measures regression model (PROC MIXED) was used to analyse the effect of animal:plant protein ratios on 24-h UI. plant protein ratios ranged from 0.5 (95 % CI 0.4, 0.6) to 1.6 (95 % CI 1.4, 1.9) (lowest and highest quartile). After adjustment for total energy intake, main dietary iodine sources (dairy and salt intake), and further covariates, the inter-individual variation in animal:plant protein ratio was significantly associated with variation in 24-h UI. One unit higher animal:plant protein ratio predicted 6 μg/d higher 24-h UI (P= 0.002) in boys and 5 μg/d (P= 0.03) in girls. This relationship was partially mediated by a higher salt intake at higher animal:plant protein ratios. These results suggest that lower consumption of animal protein is associated with a small decline in iodine excretion, partially mediated by decreased salt intake. Because limited salt and increased intake of plant-based foods are part of a preferable healthy food pattern, effective nutrition political strategies will be required in the future to ensure appropriate iodine nutrition in adherent populations.
Pontbriand-Drolet, Stéphanie; Tang, An; Madill, Stephanie J; Tannenbaum, Cara; Lemieux, Marie-Claude; Corcos, Jacques; Dumoulin, Chantale
2016-04-01
To compare magnetic resonance imaging (MRI) of the pelvic floor musculature (PFM), bladder neck and urethral sphincter morphology under three conditions (rest, PFM maximal voluntary contraction (MVC), and straining) in older women with symptoms of stress (SUI) or mixed urinary incontinence (MUI) or without incontinence. This 2008-2012 exploratory observational cohort study was conducted with community-dwelling women aged 60 and over. Sixty six women (22 per group), mean age of 67.7 ± 5.2 years, participated in the study. A 3 T MRI examination was conducted under three conditions: rest, PFM MVC, and straining. ANOVA or Kruskal-Wallis tests (data not normally distributed) were conducted, with Bonferroni correction, to compare anatomical measurements between groups. Women with MUI symptoms had a lower PFM resting position (M-Line P = 0.010 and PC/H-line angle P = 0.026) and lower pelvic organ support (urethrovesical junction height P = 0.013) than both continent and SUI women. Women with SUI symptoms were more likely to exhibit bladder neck funneling and a larger posterior urethrovesical angle at rest than both continent and MUI women (P = 0.026 and P = 0.008, respectively). There were no significant differences between groups on PFM MVC or straining. Women with SUI and MUI symptoms present different morphological defects at rest. These observations emphasize the need to tailor UI interventions to specific pelvic floor defects and UI type in older women. Older women with UI demonstrate different problems with their pelvic organ support structures depending on the type of UI. These new findings should be taken into consideration for future research into developing new treatment strategies for UI in older women. Neurourol. Urodynam. 35:515-521, 2016. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.
Impact of overactive bladder symptoms on work activity: The ACTIVHA study.
Rapariz, M; Mora, A M; Roset, M
2018-04-01
To analyse the impact of overactive bladder (OAB) symptoms on the work activity of patients in Spain. An observational, multicentre cross-sectional study was conducted with 149 urologists and 131 gynaecologists of Spain and included patients diagnosed with OAB, according to clinical judgment, who were of working age (18-65 years). We collected sociodemographic, clinical and work activity data. The patients filled out the Bladder Control Self-Assessment Questionnaire (B-SAQ) and the Work Productivity and Activity Impairment Questionnaire-General Health (WPAI-GH). The effect of each symptom on the daily and occupational activity was assessed. The results were stratified according to sex and the presence of emergency and urinary incontinence (UI) according to the B-SAQ. We assessed 768 patients (89% women), with a mean (SD) age of 52.5 (9.3) years and 2.6 (2.6) years of OAB progression. The most common symptoms according to the patients were urgent urination (89.8%), nocturia (75.7%), urge incontinence (68.5%) and frequent urination (68.2%). Ninety-six percent of the patients adopted adaptive measures for their OAB. According to the B-SAQ, 543 patients (71%) presented urgent urination; of these, 294 (54%) showed UI. The symptom that most affected work activity was frequent urination (59.8%). According to the WPAI-GH, the patients reported an impact of 32% during the workday (41% in patients with urgent urination and UI) and a loss of work time of 6.5% (9.9% in patients with urgent urination and UI). The symptoms of OAB negatively affect work activity, especially in patients who have urgent urination and UI. Copyright © 2017 AEU. Publicado por Elsevier España, S.L.U. All rights reserved.
Performance I interferon in solid tumors, melanoma. Literature review and overhaul of the subject
International Nuclear Information System (INIS)
Vázquez, A.; Terzieff, V.
2004-01-01
To determine the best dose and treatment outcome in melanoma Interferon basis. Methods: We reviewed the published literature of international the last twenty years and bibliographic communications based on the use Interferon in different dosage forms. Results: We evaluated the INF a, b, g pegylated in different doses and different results. Est in adjuvant melanoma. II and III: a low dose 3M 3v ui per week. 3 to have no impact or SV or SVLE; 20m high dose 5 ui v by sem. for 4 wk. and then 10 M ui 3 v per week. for 48 wk. no impact on long-SV term but if SVLE (Kirkwood plan). At intermediate doses: 10 5 M ui v by sem. for 4 wk. 10m then ui v 3 per week. for 48 or 96 wk. no impact on SV while in the outcome assessment in SVLE. In disseminated disease 15% of metastatic RG with better results for the high dose is postulated. It needs further testing in clinical trial results. Discussion: The use of INF in different dosage forms has not demonstrated impact on SV or adjuvant or disseminated disease. It discusses what the best plan based on the given palliative treatments SVLE the important side effects of this medication is generally not has allowed for the complete treatment plans with high dose to 48% of patients enrolled in clinical trials. The decision involves determining that plan has a greater impact, the sharp peak of high doses or long-term treatment intermediate dose over time. The addition of INF treatment of metastatic melanoma to QT no plans increase results and if the toxic effects of the treatment
Brown, Vicki; Ananthapavan, Jaithri; Veerman, Lennert; Sacks, Gary; Lal, Anita; Peeters, Anna; Backholer, Kathryn; Moodie, Marjory
2018-05-15
Television (TV) advertising of food and beverages high in fat, sugar and salt (HFSS) influences food preferences and consumption. Children from lower socioeconomic position (SEP) have higher exposure to TV advertising due to more time spent watching TV. This paper sought to estimate the cost-effectiveness of legislation to restrict HFSS TV advertising until 9:30 pm, and to examine how health benefits and healthcare cost-savings differ by SEP. Cost-effectiveness modelling was undertaken (i) at the population level, and (ii) by area-level SEP. A multi-state multiple-cohort lifetable model was used to estimate obesity-related health outcomes and healthcare cost-savings over the lifetime of the 2010 Australian population. Incremental cost-effectiveness ratios (ICERs) were reported, with assumptions tested through sensitivity analyses. An intervention restricting HFSS TV advertising would cost AUD5.9M (95% UI AUD5.8M⁻AUD7M), resulting in modelled reductions in energy intake (mean 115 kJ/day) and body mass index (BMI) (mean 0.352 kg/m²). The intervention is likely to be cost-saving, with 1.4 times higher total cost-savings and 1.5 times higher health benefits in the most disadvantaged socioeconomic group (17,512 HALYs saved (95% UI 10,372⁻25,155); total cost-savings AUD126.3M (95% UI AUD58.7M⁻196.9M) over the lifetime) compared to the least disadvantaged socioeconomic group (11,321 HALYs saved (95% UI 6812⁻15,679); total cost-savings AUD90.9M (95% UI AUD44.3M⁻136.3M)). Legislation to restrict HFSS TV advertising is likely to be cost-effective, with greater health benefits and healthcare cost-savings for children with low SEP.
Veerman, Lennert; Lal, Anita; Peeters, Anna; Backholer, Kathryn; Moodie, Marjory
2018-01-01
Television (TV) advertising of food and beverages high in fat, sugar and salt (HFSS) influences food preferences and consumption. Children from lower socioeconomic position (SEP) have higher exposure to TV advertising due to more time spent watching TV. This paper sought to estimate the cost-effectiveness of legislation to restrict HFSS TV advertising until 9:30 pm, and to examine how health benefits and healthcare cost-savings differ by SEP. Cost-effectiveness modelling was undertaken (i) at the population level, and (ii) by area-level SEP. A multi-state multiple-cohort lifetable model was used to estimate obesity-related health outcomes and healthcare cost-savings over the lifetime of the 2010 Australian population. Incremental cost-effectiveness ratios (ICERs) were reported, with assumptions tested through sensitivity analyses. An intervention restricting HFSS TV advertising would cost AUD5.9M (95% UI AUD5.8M–AUD7M), resulting in modelled reductions in energy intake (mean 115 kJ/day) and body mass index (BMI) (mean 0.352 kg/m2). The intervention is likely to be cost-saving, with 1.4 times higher total cost-savings and 1.5 times higher health benefits in the most disadvantaged socioeconomic group (17,512 HALYs saved (95% UI 10,372–25,155); total cost-savings AUD126.3M (95% UI AUD58.7M–196.9M) over the lifetime) compared to the least disadvantaged socioeconomic group (11,321 HALYs saved (95% UI 6812–15,679); total cost-savings AUD90.9M (95% UI AUD44.3M–136.3M)). Legislation to restrict HFSS TV advertising is likely to be cost-effective, with greater health benefits and healthcare cost-savings for children with low SEP. PMID:29762517
Guldberg, Rikke; Kesmodel, Ulrik Schiøler; Brostrøm, Søren; Kærlev, Linda; Hansen, Jesper Kjær; Hallas, Jesper; Nørgård, Bente Mertz
2014-02-04
To describe the use of antibiotics for urinary tract infection (UTI) before and after surgery for urinary incontinence (UI); and for those with use of antibiotics before surgery, to estimate the risk of treatment for a postoperative UTI, relative to those without use of antibiotics before surgery. A historical population-based cohort study. Denmark. Women (age ≥18 years) with a primary surgical procedure for UI from the county of Funen and the Region of Southern Denmark from 1996 throughout 2010. Data on redeemed prescriptions of antibiotics ±365 days from the date of surgery were extracted from a prescription database. Use of antibiotics for UTI in relation to UI surgery, and the risk of being a postoperative user of antibiotics for UTI among preoperative users. A total of 2151 women had a primary surgical procedure for UI; of these 496 (23.1%) were preoperative users of antibiotics for UTI. Among preoperative users, 129 (26%) and 215 (43.3%) also redeemed prescriptions of antibiotics for UTI within 0-60 and 61-365 days after surgery, respectively. Among preoperative non-users, 182 (11.0%) and 235 (14.2%) redeemed prescriptions within 0-60 and 61-365 days after surgery, respectively. Presurgery exposure to antibiotics for UTI was a strong risk factor for postoperative treatment for UTI, both within 0-60 days (adjusted OR, aOR=2.6 (95% CI 2.0 to 3.5)) and within 61-365 days (aOR=4.5 (95% CI 3.5 to 5.7)). 1 in 4 women undergoing surgery for UI was treated for UTI before surgery, and half of them had a continuing tendency to UTIs after surgery. Use of antibiotics for UTI before surgery was a strong risk factor for antibiotic use after surgery. In women not using antibiotics for UTI before surgery only a minor proportion initiated use after surgery.
Wehrberger, Clemens; Madersbacher, Stephan; Jungwirth, Susanne; Fischer, Peter; Tragl, Karl-Heinz
2012-11-01
To assess prevalence and severity of lower urinary tract function in 85-year-old men and women. Little is known on the prevalence of lower urinary tract dysfunction in this geriatric age group, which is now the fastest growing sector of the population worldwide. The Vienna Trans-Danube Aging study (VITA) is a longitudinal, population-based study initiated in 2000 that included men/women aged 75 years living in a well-defined area in Vienna. The main purpose of the VITA study was to identify risk factors for incident Alzheimer's disease. All study participants alive in 2010 were contacted by mail to complete a detailed questionnaire on various aspects of lower urinary tract symptoms (LUTS) and urinary incontinence (UI). The response rate was 68%, resulting in a total of 262 questionnaires available for analysis (men n= 96; women n= 166). All study participants were 85 years of age. Urinary incontinence defined as any involuntary loss during the past 4 weeks was reported by 24% of men and 35% of women (P= 0.04). Stress UI was more frequent in women (39%) than in men (14%, P 0.05). Nocturia more often than twice was more prevalent in men (69%) than in women (49%) (P= 0.02). Overactive bladder, according to International Continence Society criteria, was present in 55% of women and 50% of men. No difference regarding quality of life impairment as the result of LUTS and UI was noticed between sexes. A few co-morbidities were identified to correlate with UI and storage symptoms. These data provide insights into the prevalence and severity of LUTS and UI in individuals in their eighties, to our knowledge the largest population-based study in this age group. Demographic changes in upcoming decades underline the importance of a thorough understanding of lower urinary tract dysfunction in a geriatric population. © 2012 BJU INTERNATIONAL.
Journy, Neige; Ancelet, Sophie; Rehel, Jean-Luc; Mezzarobba, Myriam; Aubert, Bernard; Laurier, Dominique; Bernier, Marie-Odile
2014-03-01
The potential adverse effects associated with exposure to ionizing radiation from computed tomography (CT) in pediatrics must be characterized in relation to their expected clinical benefits. Additional epidemiological data are, however, still awaited for providing a lifelong overview of potential cancer risks. This paper gives predictions of potential lifetime risks of cancer incidence that would be induced by CT examinations during childhood in French routine practices in pediatrics. Organ doses were estimated from standard radiological protocols in 15 hospitals. Excess risks of leukemia, brain/central nervous system, breast and thyroid cancers were predicted from dose-response models estimated in the Japanese atomic bomb survivors' dataset and studies of medical exposures. Uncertainty in predictions was quantified using Monte Carlo simulations. This approach predicts that 100,000 skull/brain scans in 5-year-old children would result in eight (90 % uncertainty interval (UI) 1-55) brain/CNS cancers and four (90 % UI 1-14) cases of leukemia and that 100,000 chest scans would lead to 31 (90 % UI 9-101) thyroid cancers, 55 (90 % UI 20-158) breast cancers, and one (90 % UI risks without exposure). Compared to background risks, radiation-induced risks would be low for individuals throughout life, but relative risks would be highest in the first decades of life. Heterogeneity in the radiological protocols across the hospitals implies that 5-10 % of CT examinations would be related to risks 1.4-3.6 times higher than those for the median doses. Overall excess relative risks in exposed populations would be 1-10 % depending on the site of cancer and the duration of follow-up. The results emphasize the potential risks of cancer specifically from standard CT examinations in pediatrics and underline the necessity of optimization of radiological protocols.
Kosilov, Kirill V; Loparev, Sergey A; Kuzina, Irina G; Shakirova, Olga V; Zhuravskaya, Natalya S; Lobodenko, Alexandra
2017-01-01
To investigate the heterogeneous factors affecting the stability of patients older than 60 years in the UI treatment with Antimuscarinics. The prevalence of Urge Incontinence (UI) in older persons reaches 29.3%. The symptoms of urinary incontinence in older people reduce the health related life quality. In 1257 patients over 60 years (857 (68.2%) women - average age 67.8, 400 (31.8%) men - 71.4), who received AM for one year, demographic, socio-economic and health parameters were studied. OABq-SF questionnaires, MOS SF-36, urination diaries, uroflowmetry, income information from the tax offices and outpatient records were used. The compliance to AM treatment within 6 months was retained in 44.2%, and within the year - 26.8% of older patients. At least 40% of the total number of patients refused to continue the treatment for medical reasons. The persons taking Solifenacin (p≤ 0.01), Trospium (p≤ 0.05), or Darifenacin (p≤ 0.05), suffering from severe UI symptoms (p≤ 0.01), and experiencing minor side effects (p≤ 0.01), well-informed about UI treatment methods (p≤ 0.01) prevailed among the treatment compliant patients. At least 20.4% of the patients discontinued their treatment due to economic reasons. The persons with significantly larger annual income (p≤ 0.05) and annual medical cost (p≤ 0.01) prevailed among the treatment compliant patients. About 12.2% of the patients stopped their treatment for reasons related to the social background and psychological status. In this experiment, we found that AM treatment compliance in older patients, in addition to medical parameters and health conditions, is largely affected by the economic as well as social, demographic and psychological factors. The study results can be claimed by practitioners involved in correcting UI symptoms in older people. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
Subramaniam, Jayakumar; Eswara, Shilpalakshmiprasad; Yesudhason, Bineshlal
2016-03-01
Urinary incontinence (UI) is increasingly recognized as a significant health problem, which remains a hygienic as well as social problem. Women have higher risk of developing incontinence in their lifetime compared with men. Urinary tract infection can increase the incidence of incontinence. Present study was undertaken to assess the association of UTI in married women who presented with UI. The present study was aimed to identify the patients (married women) with complaints of UI and determining its association with UTI; and to identify the causative organism for the UTI along with its antimicrobial susceptibility pattern. This is a cross-sectional, non-randomized study of 107 married women with UI, who attended outpatient department in our hospital. Mid-stream urine (MSU) samples were collected from these patients with positive history of incontinence. Screening of urine for significant bacteriuria and culture to identify the etiological agents were performed followed by evaluation of their antimicrobial susceptibility profiles using Kirby Bauer disc diffusion method. Overall 25.2% of patients with incontinence had a positive urine culture. History of UTI was elicited in around 38.3% of patients, among which 15% had positive urine culture and 10.3% of the patients who did not have a history had positive culture. Escherichia coli was the commonest causative organism (66.6) causing UTI, followed by Enterococcus spp. (22.3%), Klebsiella pneumoniae (7.4%) and Proteus mirabilis (3.7%). The antimicrobial susceptibility pattern for Escherichia coli showed high sensitivity to Nitrofurantoin (94.4%) and high resistance to Ampicillin (94.4%). Our study revealed one in every four incontinent patients had UTI and almost half of them suffered from previous episodes of UTI. Thus appropriate correction of the existing UTI can help in the treatment of UI.
Moodie, Marj; Haby, Michelle M; Swinburn, Boyd; Carter, Robert
2011-05-01
To assess from a societal perspective the cost-effectiveness of a school program to increase active transport in 10- to 11-year-old Australian children as an obesity prevention measure. The TravelSMART Schools Curriculum program was modeled nationally for 2001 in terms of its impact on Body Mass Index (BMI) and Disability-Adjusted Life Years (DALYs) measured against current practice. Cost offsets and DALY benefits were modeled until the eligible cohort reached age 100 or died. The intervention was qualitatively assessed against second stage filter criteria ('equity,' 'strength of evidence,' 'acceptability to stakeholders,' 'feasibility of implementation,' 'sustainability,' and 'side-effects') given their potential impact on funding decisions. The modeled intervention reached 267,700 children and cost $AUD13.3M (95% uncertainty interval [UI] $6.9M; $22.8M) per year. It resulted in an incremental saving of 890 (95%UI -540; 2,900) BMI units, which translated to 95 (95% UI -40; 230) DALYs and a net cost per DALY saved of $AUD117,000 (95% UI dominated; $1.06M). The intervention was not cost-effective as an obesity prevention measure under base-run modeling assumptions. The attribution of some costs to nonobesity objectives would be justified given the program's multiple benefits. Cost-effectiveness would be further improved by considering the wider school community impacts.
Comparison of the functional profile of elderly women with urinary continence and incontinence
Directory of Open Access Journals (Sweden)
Gabriele Regiane Winter
2014-10-01
Full Text Available Urinary incontinence (UI, more prevalent in women and influencing their functional decline, increases with age. Current longitudinal study with two data collection in 2005-2006 and 2011 compares the functional profile of urinary continence and incontinence in elderly women. Sixty-eight women were divided into females with urinary continence (CG; n = 62 and females with urinary incontinence (IG; n = 6. Dependent variables measured were obesity and body adiposity indexes and functional fitness. Data were given in means with standard deviation (± and analyzed by the independent t-test (p < 0.05. There were six cases of UI. In the first evaluation group differences occurred for waist circumference (CG: 85.3±9.7 cm; IG: 91.2 ± 12.4cm; t=-2.267; p < 0.05 and cardiorespiratory fitness (CG: 517.9 ± 67.3 m; IG: 463.0±85.9 m; t = 2.571; p < 0.05. CG had a better functional profile, excepting flexibility and lower limbs strength, in the second evaluation. Women with UI had higher waist circumference and lower cardiorespiratory fitness. This may be due to the relationship between the variables and greater abdominal compression and functional decline. Results show that future public health strategies should focus on these factors to decrease the risk of people developing UI and to improve physical-functional and psycho-social benefits to elderly women.
Cracking ShadowCrypt: Exploring the Limitations of Secure I/O Systems in Internet Browsers
Directory of Open Access Journals (Sweden)
Freyberger Michael
2018-04-01
Full Text Available An important line of privacy research is investigating the design of systems for secure input and output (I/O within Internet browsers. These systems would allow for users’ information to be encrypted and decrypted by the browser, and the specific web applications will only have access to the users’ information in encrypted form. The state-of-the-art approach for a secure I/O system within Internet browsers is a system called ShadowCrypt created by UC Berkeley researchers [23]. This paper will explore the limitations of ShadowCrypt in order to provide a foundation for the general principles that must be followed when designing a secure I/O system within Internet browsers. First, we developed a comprehensive UI attack that cannot be mitigated with popular UI defenses, and tested the efficacy of the attack through a user study administered on Amazon Mechanical Turk. Only 1 of the 59 participants who were under attack successfully noticed the UI attack, which validates the stealthiness of the attack. Second, we present multiple attack vectors against Shadow-Crypt that do not rely upon UI deception. These attack vectors expose the privacy weaknesses of Shadow DOM—the key browser primitive leveraged by ShadowCrypt. Finally, we present a sketch of potential countermeasures that can enable the design of future secure I/O systems within Internet browsers.
Capacity Analysis Of Parking Lot And Volume Of Vehicle Toward Sustainable Parking Convenience
Herdiansyah, Herdis; Sugiyanto; Guntur Octavianto, Andrew; Guntur Aritonang, Edison; Nova Imaduddin, Malya; Dedi; Rilaningrum, Magfira
2017-10-01
The development of human's population is having effect on the increase of facilities and transportation needs. One of the primary problems is the availability of parking area. This has occurred in Universitas Indonesia (UI), mainly in Salemba Campus. The availability of land is not as equal as the number of vehicles, which are to be parked, that is why the convenience of students, lecturers and employees at UI is unsatisfactory. The purpose of this paper is to know the level of parking convenience that is affected by the capacity of parking lots and the volume of vehicles in UI Salemba Campus. The results of this research indicate Salemba campus's parking index. The motor index is still in the category of medium (index 0.945) and the car parking index has less category with a parking index 0.485. While with the location of research object being behind the UI Salemba campus, the results obtained were both the motor and the car are still in the category of “enough” with the parking index of, that is 0.657 for the motor and 0.777 for the car. So theoretically, the parking management at Salemba Campus is in an unsustainable parking degree because, if there is no long-term solution, it will increase congestion in the surrounding area and intensify the dissatisfaction of existing parking users.
Hamid, Tengku Aizan; Pakgohar, Minoo; Ibrahim, Rahimah; Dastjerdi, Marzieh Vahid
2015-01-01
UI is a worldwide chronic condition among postmenopausal women. Little is known about the meaning of lived experiences of urinary incontinence of these women's viewpoints in their context. The aim of this study was to illuminate the experience of Muslim community-dwelling postmenopausal women who were living with urinary incontinence (UI). Seventeen women with UI (range: 52-68 years) who had experienced it for more than ten years were interviewed. A phenomenological hermeneutic method was used to analyze and interpret the interview texts. The women's experiences of living with urinary incontinence have been presented in terms of three main themes: disruption of normal functioning, self-imposed restriction, and feelings of despair. Disruption of normal functioning meant emotional, spiritual, physical, and daily life disruption. Self-imposed restriction meant suppression of delights and needs and avoidance of social interactions. Feelings of despair referred to predictions of a bad and dark future of living with urinary incontinence, ambiguity, and hopelessness. The meaning of living with UI has been considered a 'stain in life'. Health care providers should be familiar with the different manifestations of urinary incontinence for early diagnosis and prevention of the negative effects of this condition to improve quality of life. In addition, symbolic interactionism theory can help health care providers to understand the meaning of urinary incontinence for women. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Pizzoferrato, Anne-Cécile; Fauconnier, Arnaud; Quiboeuf, Emeline; Morel, Karine; Schaal, Jean-Patrick; Fritel, Xavier
2013-01-01
International audience; AIMS: Our aim was to study risk factors associated with prevalence, incidence, and remission of UI 4 and 12 years after first delivery. METHODS: Seven hundred seventy-four nulliparous women who gave birth in 1996 in two French maternity units at term received a questionnaire about their urinary symptoms in 2000 and again in 2008. Two hundred thirty-six women returned a questionnaire about UI 4 and 12 years after first delivery. Four groups of women were built: (A) wome...
WeCurate: Designing for synchronised browsing and social negotiation
Hazelden, Katina; Yee-King, Matthew; d'Inverno, Mark; Confalonieri, Roberto; De Jonge, Dave; Amgoud, Leila; Osman, Nardine; Prade, Henri; Sierra, Carles
2012-01-01
WeCurate is a shared image browser for collaboratively curating a virtual exhibition from a cultural image archive. This paper is concerned with the evaluation and iteration of a prototype UI (User Interface) design to enable this community image browsing. In WeCurate, several remote users work together with autonomic agents to browse the archive and to select, through negotiation and voting, a set of images which are of the greatest interest to the group. The UI allows users to synchronize v...
Benitez Molina, Alimar; Caballero Badillo, María Claudia
2017-01-01
Abstract The aim of this research is to study the psychometric properties of Zung's and Apgar's Questionnaires for Depression and Anxiety, applied by the División de Bienestar Universitario de la UIS (DBU, for its Spanish acronym), a division in charge of students' welfare at UIS. The questionnaires were applied as part of a comprehensive assessment of admitted students, oriented to an early diagnosis of risk factors that may influence their academic performance. The sample consisted of a gro...
Indian Academy of Sciences (India)
with (al,b},cd = (15,1,24) and (a2,b2,c2) = (56,4,90). We have accomplished the task we set out to do. It is interesting to ask whether there are any solutions other than the ones given above. A Geometric Dissection Problem. Find a way of cutting up a regular octagon into twelve congruent isosceles triangles and one square.
STUDIES ON THYSANURA. UI. SOME FACTORS AFFECTING THE ...
African Journals Online (AJOL)
Fipre ) shoW& tile distribution of known spccia of Thysanura in southmt Africa .... have invaded the more arid regions of South America (Wygodzinsky 1955). ... Kuhnelt (1961) describes the Machilida as " ... found regularly in dry forests ...
Urinary incontinence, mental health and loneliness among community-dwelling older adults in Ireland
DEFF Research Database (Denmark)
Stickley, Andrew; Santini, Ziggi Ivan; Koyanagi, Ai
2017-01-01
Background Urinary incontinence (UI) is associated with worse health among older adults. Little is known however, about its relation with loneliness or the role of mental health in this association. This study examined these factors among older adults in Ireland. Methods Data were analyzed from 6...... community-dwelling adults but this association is largely explained by comorbid mental health problems, in particular, depression.......Background Urinary incontinence (UI) is associated with worse health among older adults. Little is known however, about its relation with loneliness or the role of mental health in this association. This study examined these factors among older adults in Ireland. Methods Data were analyzed from...... 6903 community-dwelling adults aged ≥ 50 collected in the first wave of The Irish Longitudinal Study on Ageing (TILDA) in 2009–11. Information was obtained on the self-reported occurrence (yes/no) and severity (frequency/activity limitations) of UI in the past 12 months. Loneliness was measured using...
Directory of Open Access Journals (Sweden)
Fuad Alkhoury
2015-01-01
PRESENTATION OF CASE: A 15-year-old female who came to the JDCH ER complaining of 3 days history of mild diffuse abdominal pain associated with two episodes of emesis. She also reports headache as well as a mild cough and low grade subjective fever. Blood test results showed mild leukocytosis with significant elevation in the lymphocytes (59%, High alkaline phosphatase (221 U/I, AST (191 U/I, ALT(221 U/I and bilirubin (Total 1.8 and direct 1.5. Abdominal US showed a contracted gallbladder with wall thickness and pericholecystic fluid. During hospital stay number 2–3 laboratory work up show a trending up in the bilirubin levels. MRCP was ordered and no abdnormalities were found. At this point Hospital stay number 3 EBV acute infection was suspected. Serum serological studies were subsequently diagnostic for this viral disease. Management was conservative and the patient was discharged asymptomatic on hospital day number six.
Varela, Gervasio; Paz-Lopez, Alejandro; Becerra, Jose A.; Duro, Richard
2016-01-01
This paper addresses the problem of developing user interfaces for Ubiquitous Computing (UC) and Ambient Intelligence (AmI) systems. These kind of systems are expected to provide a natural user experience, considering interaction modalities adapted to the user abilities and preferences and using whatever interaction devices are present in the environment. These interaction devices are not necessarily known at design time. The task is quite complicated due to the variety of devices and technologies, and the diversity of scenarios, and it usually burdens the developer with the need to create many different UIs in order to consider the foreseeable user-environment combinations. Here, we propose an UI abstraction framework for UC and AmI systems that effectively improves the portability of those systems between different environments and for different users. It allows developers to design and implement a single UI capable of being deployed with different devices and modalities regardless the physical location. PMID:27399711
Directory of Open Access Journals (Sweden)
Gervasio Varela
2016-07-01
Full Text Available This paper addresses the problem of developing user interfaces for Ubiquitous Computing (UC and Ambient Intelligence (AmI systems. These kind of systems are expected to provide a natural user experience, considering interaction modalities adapted to the user abilities and preferences and using whatever interaction devices are present in the environment. These interaction devices are not necessarily known at design time. The task is quite complicated due to the variety of devices and technologies, and the diversity of scenarios, and it usually burdens the developer with the need to create many different UIs in order to consider the foreseeable user-environment combinations. Here, we propose an UI abstraction framework for UC and AmI systems that effectively improves the portability of those systems between different environments and for different users. It allows developers to design and implement a single UI capable of being deployed with different devices and modalities regardless the physical location.
Varela, Gervasio; Paz-Lopez, Alejandro; Becerra, Jose A; Duro, Richard
2016-07-07
This paper addresses the problem of developing user interfaces for Ubiquitous Computing (UC) and Ambient Intelligence (AmI) systems. These kind of systems are expected to provide a natural user experience, considering interaction modalities adapted to the user abilities and preferences and using whatever interaction devices are present in the environment. These interaction devices are not necessarily known at design time. The task is quite complicated due to the variety of devices and technologies, and the diversity of scenarios, and it usually burdens the developer with the need to create many different UIs in order to consider the foreseeable user-environment combinations. Here, we propose an UI abstraction framework for UC and AmI systems that effectively improves the portability of those systems between different environments and for different users. It allows developers to design and implement a single UI capable of being deployed with different devices and modalities regardless the physical location.
Global burden of stroke and risk factors in 188 countries, during 1990-2013
DEFF Research Database (Denmark)
Feigin, Valery L; Roth, Gregory A; Naghavi, Mohsen
2016-01-01
the population-attributable fraction (PAF) of stroke-related disability-adjusted life-years (DALYs) associated with potentially modifiable environmental, occupational, behavioural, physiological, and metabolic risk factors in different age and sex groups worldwide and in high-income countries and low......·2-73·5) and environmental factors (air pollution and lead exposure; 33·4%, 95% UI 32·4-34·3) were the second and third largest contributors to DALYs. Globally, 29·2% (95% UI 28·2-29·6) of the burden of stroke was attributed to air pollution. Although globally there were no significant differences between sexes......-income and middle-income countries, from 1990 to 2013. METHODS: We used data on stroke-related DALYs, risk factors, and PAF from the GBD 2013 Study to estimate the burden of stroke by age and sex (with corresponding 95% uncertainty intervals [UI]) in 188 countries, as measured with stroke-related DALYs in 1990...
Directory of Open Access Journals (Sweden)
Mara R. Knorst
2011-04-01
Full Text Available OBJECTIVES: To describe the characteristics of urinary incontinence (UI and to evaluate its impact on health-related quality of life (QOL and depressive symptoms in women referred for physical therapy at a university hospital. METHODS: A descriptive cross-sectional study with demographic data collection related to UI. All women were evaluated through examination and also through depression and QOL questionnaires. RESULTS: Forty-eight women were evaluated (53.8±10.9 years, 47.9% with mixed UI (MUI, 39.6% with stress UI (SUI and 12.5% with urge UI (UUI. In 50% of the cases the urinary loss lasted between 3.3 and 10 years. There was no significant difference in the pelvic floor muscle strength among the different types of UI (P>0.05. Depressive symptoms were detected in 37% of the women. Changes in the QOL were observed in all three groups of women with UI. According to the King's Health Questionnaire (KHQ, women with MUI presented more compromised health perception and greater physical, social, daily activity and personal relationship limitations (POBJETIVOS: Descrever as características da incontinência urinária (IU e avaliar seu impacto na qualidade de vida (QV relacionada à saúde e aos sintomas depressivos de mulheres encaminhadas para atendimento fisioterapêutico em hospital universitário. MÉTODOS: Estudo descritivo transversal com coleta de dados demográficos e dos relacionados à IU. Todas as mulheres foram avaliadas por meio de exame físico e por escalas de depressão e QV. RESULTADOS: Foram avaliadas 48 mulheres (53,8±10,9 anos; 47,9% com incontinência urinária mista (IUM, 39,6% com incontinência urinária de esforço (IUE e 12,5% com incontinência urinária de urgência (IUU. Em 50% dos casos, a perda urinária durou entre 3,3 e 10 anos. Não houve diferença na força da musculatura perineal nos diferentes tipos de IU (P>0,05. Sintomas depressivos foram detectados em 37% das mulheres. Observou-se alteração da QV nos tr
Trends and Patterns of Differences in Infectious Disease Mortality Among US Counties, 1980-2014.
El Bcheraoui, Charbel; Mokdad, Ali H; Dwyer-Lindgren, Laura; Bertozzi-Villa, Amelia; Stubbs, Rebecca W; Morozoff, Chloe; Shirude, Shreya; Naghavi, Mohsen; Murray, Christopher J L
2018-03-27
Infectious diseases are mostly preventable but still pose a public health threat in the United States, where estimates of infectious diseases mortality are not available at the county level. To estimate age-standardized mortality rates and trends by county from 1980 to 2014 from lower respiratory infections, diarrheal diseases, HIV/AIDS, meningitis, hepatitis, and tuberculosis. This study used deidentified death records from the National Center for Health Statistics (NCHS) and population counts from the US Census Bureau, NCHS, and the Human Mortality Database. Validated small-area estimation models were applied to these data to estimate county-level infectious disease mortality rates. County of residence. Age-standardized mortality rates of lower respiratory infections, diarrheal diseases, HIV/AIDS, meningitis, hepatitis, and tuberculosis by county, year, and sex. Between 1980 and 2014, there were 4 081 546 deaths due to infectious diseases recorded in the United States. In 2014, a total of 113 650 (95% uncertainty interval [UI], 108 764-117 942) deaths or a rate of 34.10 (95% UI, 32.63-35.38) deaths per 100 000 persons were due to infectious diseases in the United States compared to a total of 72 220 (95% UI, 69 887-74 712) deaths or a rate of 41.95 (95% UI, 40.52-43.42) deaths per 100 000 persons in 1980, an overall decrease of 18.73% (95% UI, 14.95%-23.33%). Lower respiratory infections were the leading cause of infectious diseases mortality in 2014 accounting for 26.87 (95% UI, 25.79-28.05) deaths per 100 000 persons (78.80% of total infectious diseases deaths). There were substantial differences among counties in death rates from all infectious diseases. Lower respiratory infection had the largest absolute mortality inequality among counties (difference between the 10th and 90th percentile of the distribution, 24.5 deaths per 100 000 persons). However, HIV/AIDS had the highest relative mortality inequality between counties (10.0 as the
Which nonsurgical options are effective for the treatment of female urinary incontinence?
DEFF Research Database (Denmark)
Brostrøm, Søren
2008-01-01
In this study sponsored by the US federal government, Shamliyan et al. extracted data from 96 randomized controlled trials and 3 meta-analyses, and reviewed the evidence of nonsurgical treatment for female urinary incontinence (UI). Pelvic-floor muscle training alone, or in combination with bladder...... training, was found to be effective in improving UI compared with standard care. Generalizing the clinical relevance of these studies, however, was difficult because of heterogeneity between the trials. Anticholinergic agents were also moderately effective, but adverse effects were frequent. Additionally...
Barbosa, Michelle C; Messmer, Nigel R; Brazil, Tayra R; Marciano, Fernanda R; Lobo, Anderson O
2013-07-01
Nanohydroxyapatite (nHAp) powders were produced via aqueous precipitation by adopting four different experimental conditions, assisted or non-assisted by ultrasound irradiation (UI). The nHAp powders were characterized by X-ray diffraction, energy-dispersive X-ray fluorescence, Raman and attenuated total reflection Fourier transform infrared spectroscopies, which showed typical surface chemical compositions of nHAp. Analysis found strong connections between UI and the crystallization process, crystal growth properties, as well as correlations between calcination and substitution reactions. Copyright © 2013 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Fragoulakis V
2013-06-01
Full Text Available Vassilis Fragoulakis, Nikolaos ManiadakisNational School of Public Health, Department of Health Services Management, Athens, GreeceObjective: To quantify the economic effects of a child conceived by in vitro fertilization (IVF in terms of net tax revenue from the state's perspective in Greece.Methods: Based on previous international experience, a mathematical model was developed to assess the lifetime productivity of a single individual and his/her lifetime transactions with governmental agencies. The model distinguished among three periods in the economic life cycle of an individual: (1 early life, when the government primarily contributes resources through child tax credits, health care, and educational expenses; (2 employment, when individuals begin returning resources through taxes; and (3 retirement, when the government expends additional resources on pensions and health care. The cost of a live birth with IVF was based on the modification of a previously published model developed by the authors. All outcomes were discounted at a 3% discount rate. The data inputs – namely, the economic or demographic variables – were derived from the National Statistical Secretariat of Greece and other relevant sources. To deal with uncertainty, bias-corrected uncertainty intervals (UIs were calculated based on 5000 Monte Carlo simulations. In addition, to examine the robustness of our results, other one-way sensitivity analyses were also employed.Results: The cost of IVF per birth was estimated at €17,015 (95% UI: €13,932–€20,200. The average projected income generated by an individual throughout his/her productive life was €258,070 (95% UI: €185,376–€339,831. In addition, his/her life tax contribution was estimated at €133,947 (95% UI: €100,126–€177,375, while the discounted governmental expenses for elderly and underage individuals were €67,624 (95% UI: €55,211–€83,930. Hence, the net present value of IVF was €60
Svare, Jens A; Hansen, Bent B; Lose, Gunnar
2014-01-01
The objective was to examine the relationship between maternal and perinatal factors and the occurrence of stress (SUI) or mixed (MUI) urinary incontinence (UI) 1 year after the first vaginal delivery in primiparous women. Participants in this prospective cohort were recruited consecutively from June 2003 to July 2005 from all eligible women who delivered in the department. A validated questionnaire, the International Consultation of Incontinence Questionnaire Short Form (ICIQ-SF) was completed by all participants 2-3 days after delivery, and a similar second questionnaire was filled out 1 year later. Additional data were obtained from the medical records. The first questionnaire was completed by 1,018 women (63 %) and the second by 859 women (84 %). The study group comprised the 575 women without any UI before the pregnancy and who had a vaginal delivery. The primary analysis comprised 117 women with either SUI or MUI 1 year after the vaginal delivery and 403 women without any UI. In univariate analyses, the following factors were associated with SUI or MUI: prepregnancy body mass index (BMI) ≥ 30 (p pregnancy (p pregnancy [adjusted odds ratio (OR) 4.7, 95 % confidence interval (CI) 2.9-7.7) and inversely associated with oxytocin augmentation (adjusted OR 0.5, 95 % CI 0.3-0.9). SUI or MUI 1 year after the first vaginal delivery was strongly associated with UI during the pregnancy and inversely associated with oxytocin augmentation.
[Urine incontinence referral criteria for primary care].
Brenes Bermúdez, F J; Cozar Olmo, J M; Esteban Fuertes, M; Fernández-Pro Ledesma, A; Molero García, J M
2013-05-01
Despite the high incidence of urinary incontinence (UI), health professional awareness of this disease is low, which in itself is not serious but significantly limits the lives of the patients. The Primary Care associations, Sociedad Española de Médicos de Atención Primaria [SEMERGEN], Sociedad Española de Médicos Generales y de Familia [SEMG], Sociedad Española de Medicina de Familia y Comunitaria [semFYC]) along with the Asociación Española de Urología (EAU) have developed this consensus with the proposal of making GPs aware, and to help them in the diagnosis, treatment and referral to Urologists. The first goal in primary care must be the detection of UI, thus an opportunistic screening at least once in the lifetime of asymptomatic women > 40 years old and asymptomatic men > 55 years old. The diagnosis, based on medical history and physical examination, must determine the type and severity of the UI in order to refer severe cases to the Urologist. Except for overactive bladder (OAB), non-pharmacological conservative treatment is the first approach to uncomplicated UI in females and males. Antimuscarinics are the only drugs that have demonstrated efficacy and safety in urge urinary incontinence (UUI) and OAB. In men with mixed symptoms, excluding severe obstruction cases, a combination therapy of alpha-blockers and antimuscarinics should be chosen. Copyright © 2013 Elsevier España, S.L. All rights reserved.
Directory of Open Access Journals (Sweden)
Radzimińska A
2018-05-01
Full Text Available Agnieszka Radzimińska, Agnieszka Strączyńska, Magdalena Weber-Rajek, Hanna Styczyńska, Katarzyna Strojek, Zuzanna Piekorz Department of Physiotherapy, Nicolaus Copernicus University Collegium Medicum in Bydgoszcz, Bydgoszcz, Poland Purpose: The purpose of this review was to assess the effectiveness of pelvic floor muscle training (PFMT in the treatment of urinary incontinence (UI in women, with a particular focus on the impact of this form of therapy on the patients’ quality of life (QoL. Methods: The following electronic databases were searched: PubMed, Embase, and Cochrane Library (articles only in English, 1990–2017. Search terms were as follows: urinary incontinence, pelvic floor muscle training, pelvic floor exercises, quality of life. Systematic review methods were based on the PRISMA (Preferred Reporting Items for Systematic Reviews and Meta-Analyses statement. Results: The assessment of the impact of PFMT on the QoL of women with UI was conducted among 2,394 women in 24 selected studies. After the end of treatment, the majority of patients in the experimental groups noted a statistically significant improvement in QoL. Conclusion: The results of this literature review demonstrate that PFMT is an effective treatment for UI in women. PFMT significantly improves the QoL of women with UI, which is an important determinant of their physical, mental, and social functioning. Keywords: urinary incontinence, pelvic floor muscle training, quality of life
Directory of Open Access Journals (Sweden)
Grasiéla Nascimento Correia
Full Text Available INTRODUCTION: The pelvic floor muscle (PFM training is the most common treatment for urinary incontinence (UI, however many women performed the contraction of PFM with associated contraction of abdominal, gluteus and hip adductors muscles. OBJECTIVE: To assess the effects of pelvic floor muscle (PFM training on isometric and isokinetic hip adductors peak torque (PT among women suffering from urinary incontinence (UI. MATERIALS AND METHODS: It is a longitudinal and prospective exploratory study. This study included 15 physically active women aged 45 years old and over, who presented complaints of UI. The PFM function (digital evaluation and perineometry, isometric and isokinetic hip adductors PT and one hour pad test were performed before and after treatment. The PFM training was performed in group, one hour once a week for 12 sessions. RESULTS: Significant improvement of PFM function and pressure level (p = 0.003, and significant decrease of hip adductors isometric PT and one-hour pad test, were found post-treatment. Moderate negative correlations between PFM contraction pressure and hip adductors isokinetic PT for dominant side (DS (r = -0.62; p = 0.03 and non-dominant side (NDS (r = -0.64; p = 0.02; and between PFM fast fibers contraction and hip adductors isometric PT for DS (r = -0.60; p = 0.03 and NDS (r = -0.59; p = 0.04 were also found. CONCLUSIONS: The PFM training decreased hip adductors PT and improved PFM functions and UI.
Directory of Open Access Journals (Sweden)
Barbara Torlinska
2018-03-01
Full Text Available Severe iodine deficiency during pregnancy has been associated with pregnancy/neonatal loss, and adverse pregnancy outcomes; however, the impact of mild–to–moderate iodine insufficiency, though prevalent in pregnancy, is not well-documented. We assessed whether mild iodine deficiency during pregnancy was associated with pregnancy/infant loss, or with other adverse pregnancy outcomes. We used samples and data from the Avon Longitudinal Study of Parents and Children (ALSPAC, from 3140 singleton pregnancies and from a further 42 women with pregnancy/infant loss. The group was classified as mildly-to-moderately iodine deficient with a median urinary iodine concentration of 95.3 µg/L (IQR 57.0–153.0; median urinary iodine-to-creatinine ratio (UI/Creat 124 µg/g, IQR 82–198. The likelihood of pregnancy/infant loss was not different across four UI/Creat groups (<50, 50–149, 150–250, >250 µg/g. The incidence of pre-eclampsia, non-proteinuric gestational hypertension, gestational diabetes, glycosuria, anaemia, post-partum haemorrhage, preterm delivery, mode of delivery, being small for gestational age, and large for gestational age did not differ significantly among UI/Creat groups, nor were there any significant differences in the median UI/Creat. We conclude that maternal iodine status was not associated with adverse pregnancy outcomes in a mildly-to-moderately iodine-deficient pregnant population. However, in view of the low number of women with pregnancy/infant loss in our study, further research is required.
Treatment of subclinical hypothyroidism in pregnancy using fixed thyroxine daily doses of 75 μg.
Penin, Manuel; Trigo, Cristina; López, Yolanda; Barragáns, María
2014-01-01
Treatment of hypothyroid pregnant women is usually calculated based on weight (1 μg/kg/day) and TSH levels. This study assessed the usefulness of treating these women with a fixed dose of 75 μg/day. All women with pregnancy diagnosed from January to August 2012 in the Vigo Health Area (Spain) without previous diagnosis of thyroid disease or thyroxine treatment and with TSH levels over 4,5 mUI/ml were enrolled by consecutive sampling. All 116 women in the sample were treated with a fixed daily dose of thyroxine 75 μg-thyroxine levels were measured at two, four, and six months, and thyroxine dose was modified if TSH level was lower than 0.3 or higher than 4.5 mUI/ml. A woman had a TSH level less than 0.3 mUI/ml in a test; reduction of thyroxine dose to 50 μg/day allowed for maintaining TSH level within the desired range until delivery. Six women had TSH levels over 4.5 mUI/ml in one test; in all of them, increase in thyroxine dose to 100 μg/day allowed for maintaining the level within the desired range until delivery. Fixed daily doses of thyroxine 75 μg allowed for achieving goal TSH levels in most of our pregnant women with subclinical hypothyroidism, irrespective of their weight and baseline TSH level. Copyright © 2013 SEEN. Published by Elsevier Espana. All rights reserved.
Venegas, Mónica; Carrasco, Bernardita; Casas-Cordero, Romina
2018-03-01
To ensure the effectiveness of Physical Therapy for urinary incontinence (UI), it is crucial that patients adhere to treatment in both the long and the short term. Treatment adherence may prevent symptom progression and the need for surgery, which is associated with higher costs and potential complications. Adherence is defined as carrying out a recommended behavioral modification or change. The World Health Organization (WHO) has established that adherence is a multifactorial phenomenon determined by the interaction of five dimensions, which include diverse factors that affect long-term adherence on many levels. To identify the factors that influence long-term adherence to pelvic floor exercises in women with UI. Observational, descriptive, cross-sectional study. The sample was recruited from the "Centro Integral de Reeducación de Piso Pélvico" (CIREP), and included 61 women treated for UI at the center in 2014 and 2015. Participants completed a self-administered, 28-item questionnaire developed for this study based on the WHO five dimensions. Data analysis was performed using STATA 13.0 software. Having performed pelvic floor home exercises after discharge from Physical Therapy was significantly associated with self-rated treatment adherence (P pelvic floor exercise program (P pelvic floor exercises in women with UI; forgetting to do the exercises and boredom with the exercises were the factors most strongly related to low treatment adherence, while motivation and commitment were associated with high adherence in this population. © 2017 Wiley Periodicals, Inc.
Qiu, Yan-Ling; Hanada, Satoshi; Ohashi, Akiyoshi; Harada, Hideki; Kamagata, Yoichi; Sekiguchi, Yuji
2008-04-01
Phenol degradation under methanogenic conditions has long been studied, but the anaerobes responsible for the degradation reaction are still largely unknown. An anaerobe, designated strain UI(T), was isolated in a pure syntrophic culture. This isolate is the first tangible, obligately anaerobic, syntrophic substrate-degrading organism capable of oxidizing phenol in association with an H(2)-scavenging methanogen partner. Besides phenol, it could metabolize p-cresol, 4-hydroxybenzoate, isophthalate, and benzoate. During the degradation of phenol, a small amount of 4-hydroxybenzoate (a maximum of 4 microM) and benzoate (a maximum of 11 microM) were formed as transient intermediates. When 4-hydroxybenzoate was used as the substrate, phenol (maximum, 20 microM) and benzoate (maximum, 92 microM) were detected as intermediates, which were then further degraded to acetate and methane by the coculture. No substrates were found to support the fermentative growth of strain UI(T) in pure culture, although 88 different substrates were tested for growth. 16S rRNA gene sequence analysis indicated that strain UI(T) belongs to an uncultured clone cluster (group TA) at the family (or order) level in the class Deltaproteobacteria. Syntrophorhabdus aromaticivorans gen. nov., sp. nov., is proposed for strain UI(T), and the novel family Syntrophorhabdaceae fam. nov. is described. Peripheral 16S rRNA gene sequences in the databases indicated that the proposed new family Syntrophorhabdaceae is largely represented by abundant bacteria within anaerobic ecosystems mainly decomposing aromatic compounds.
Energy Technology Data Exchange (ETDEWEB)
Chan-Min Liu; Zhi-Min Zong; Ji-Xian Jia; Yao-Guo Huang; Hong Zhang; Bin Huang; Xian-Yong Wei [China University of Mining and Technology, Xuzhou (China). School of Chemical Engineering
2007-07-01
Five Chinese coals were subject to water treatment (WT) at 75{sup o}C under ultrasonic irradiation (UI). The resulting water-extractable fraction (WEF) in the aqueous solution was extracted with benzene. The treated and untreated coals were extracted with a CS{sub 2}/NMP mixed solvent (1:1 by vol) under UI at room temperature. The results show that only small amount of WEF is extractable with benzene and that WT increases coal solubility in the CS{sub 2}/NMP mixed solvent only to small extent. 6 refs., 2 figs., 1 tab.
Tidwell, Jenifer
2010-01-01
Despite all of the UI toolkits available today, it's still not easy to design good application interfaces. This bestselling book is one of the few reliable sources to help you navigate through the maze of design options. By capturing UI best practices and reusable ideas as design patterns, Designing Interfaces provides solutions to common design problems that you can tailor to the situation at hand. This updated edition includes patterns for mobile apps and social media, as well as web applications and desktop software. Each pattern contains full-color examples and practical design advice th
Unemployment duration and unemployment insurance
DEFF Research Database (Denmark)
Røed, Knut; Jensen, Peter; Thoursie, Anna
2008-01-01
Based on pooled register data from Norway and Sweden, we find that differences in unemployment duration patterns reflect dissimilarities in unemployment insurance (UI) systems in a way that convincingly establishes the link between economic incentives and job search behaviour. Specifically, UI...... benefits are relatively more generous for low-income workers in Sweden than in Norway, leading to relatively longer unemployment spells for low-income workers in Sweden. Based on the between-countries variation in replacement ratios, we find that the elasticity of the outflow rate from insured unemployment...
US NDC Modernization Iteration E2 Prototyping Report: User Interface Framework
Energy Technology Data Exchange (ETDEWEB)
Lewis, Jennifer E. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Palmer, Melanie A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Vickers, James Wallace [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Voegtli, Ellen M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2014-12-01
During the second iteration of the US NDC Modernization Elaboration phase (E2), the SNL US NDC Modernization project team completed follow-on Rich Client Platform (RCP) exploratory prototyping related to the User Interface Framework (UIF). The team also developed a survey of browser-based User Interface solutions and completed exploratory prototyping for selected solutions. This report presents the results of the browser-based UI survey, summarizes the E2 browser-based UI and RCP prototyping work, and outlines a path forward for the third iteration of the Elaboration phase (E3).
Seffah, Ahmed
2015-01-01
As interactive systems are quickly becoming integral to our everyday lives, this book investigates how we can make these systems, from desktop and mobile apps to more wearable and immersive applications, more usable and maintainable by using HCI design patterns. It also examines how we can facilitate the reuse of design practices in the development lifecycle of multi-devices, multi-platforms and multi-contexts user interfaces. Effective design tools are provided for combining HCI design patterns and User Interface (UI) driven engineering to enhance design whilst differentiating between UI
Assessment of the societal cost of Taenia solium in Angónia district, Mozambique
DEFF Research Database (Denmark)
Trevisan, Chiara; Devleesschauwer, Brecht; Praet, Nicolas
2018-01-01
: Approximately 0.7% (95% Uncertainty Interval (UI), 0.4-0.9) and 0.4% (95% UI, 0.2-0.6) of the total population in the district was estimated to suffer from neurocysticercosis (NCC)-associated epilepsy and headache. The estimated average number of disability-adjusted life years (DALYs) due to NCC...... with disabilities. Infected pork poses a serious risk to the community and affects the economy of smallholder farmers. Cost for treatment and hospitalization of patients with NCC-associated epilepsy, and lack of productivity and inability of suffering patients to work, further hinder socioeconomic development...
Structural analysis of the Upper Internals Structure for the Clinch River Breeder Reactor Plant
International Nuclear Information System (INIS)
Houtman, J.L.
1979-01-01
The Upper Internals Structure (UIS) of the Clinch River Breeder Reactor Plant (CRBRP) provides control of core outlet flow to prevent severe thermal transients from occuring at the reactor vessel and primary heat transport outlet piping, provides instrumentation to monitor core performance, provides support for the control rod drivelines, and provides secondary holddown of the core. All of the structural analysis aspects of assuring the UIS is structurally adequate are presented including simplified and rigorous inelastic analysis methods, elevated temperature criteria, environmental effects on material properties, design techniques, and manufacturing constraints
de Oliveira Otto, Marcia C.; Afshin, Ashkan; Micha, Renata; Khatibzadeh, Shahab; Fahimi, Saman; Singh, Gitanjali; Danaei, Goodarz; Sichieri, Rosely; Monteiro, Carlos A; Louzada, Maria L. C.; Ezzati, Majid; Mozaffarian, Dariush
2016-01-01
Background Trends in food availability and metabolic risk factors in Brazil suggest a shift toward unhealthy dietary patterns and increased cardiometabolic disease risk, yet little is known about the impact of dietary and metabolic risk factors on cardiometabolic mortality in Brazil. Methods Based on data from Global Burden of Disease (GBD) Study, we used comparative risk assessment to estimate the burden of 11 dietary and 4 metabolic risk factors on mortality due to cardiovascular diseases and diabetes in Brazil in 2010. Information on national diets and metabolic risks were obtained from the Brazilian Household Budget Survey, the Food and Agriculture Organization database, and large observational studies including Brazilian adults. Relative risks for each risk factor were obtained from meta-analyses of randomized trials or prospective cohort studies; and disease-specific mortality from the GBD 2010 database. We quantified uncertainty using probabilistic simulation analyses, incorporating uncertainty in dietary and metabolic data and relative risks by age and sex. Robustness of findings was evaluated by sensitivity to varying feasible optimal levels of each risk factor. Results In 2010, high systolic blood pressure (SBP) and suboptimal diet were the largest contributors to cardiometabolic deaths in Brazil, responsible for 214,263 deaths (95% uncertainty interval [UI]: 195,073 to 233,936) and 202,949 deaths (95% UI: 194,322 to 211,747), respectively. Among individual dietary factors, low intakes of fruits and whole grains and high intakes of sodium were the largest contributors to cardiometabolic deaths. For premature cardiometabolic deaths (before age 70 years, representing 40% of cardiometabolic deaths), the leading risk factors were suboptimal diet (104,169 deaths; 95% UI: 99,964 to 108,002), high SBP (98,923 deaths; 95%UI: 92,912 to 104,609) and high body-mass index (BMI) (42,643 deaths; 95%UI: 40,161 to 45,111). Conclusion suboptimal diet, high SBP, and high
Burden of epilepsy in rural Kenya measured in disability-adjusted life years
Ibinda, Fredrick; Wagner, Ryan G; Bertram, Melanie Y; Ngugi, Anthony K; Bauni, Evasius; Vos, Theo; Sander, Josemir W; Newton, Charles R
2014-01-01
Objectives The burden of epilepsy, in terms of both morbidity and mortality, is likely to vary depending on the etiology (primary [genetic/unknown] vs. secondary [structural/metabolic]) and with the use of antiepileptic drugs (AEDs). We estimated the disability-adjusted life years (DALYs) and modeled the remission rates of active convulsive epilepsy (ACE) using epidemiologic data collected over the last decade in rural Kilifi, Kenya. Methods We used measures of prevalence, incidence, and mortality to model the remission of epilepsy using disease-modeling software (DisMod II). DALYs were calculated as the sum of Years Lost to Disability (YLD) and Years of Life Lost (YLL) due to premature death using the prevalence approach, with disability weights (DWs) from the 2010 Global Burden of Disease (GBD) study. DALYs were calculated with R statistical software with the associated uncertainty intervals (UIs) computed by bootstrapping. Results A total of 1,005 (95% UI 797–1,213) DALYs were lost to ACE, which is 433 (95% UI 393–469) DALYs lost per 100,000 people. Twenty-six percent (113/100,000/year, 95% UI 106–117) of the DALYs were due to YLD and 74% (320/100,000/year, 95% UI 248–416) to YLL. Primary epilepsy accounted for fewer DALYs than secondary epilepsy (98 vs. 334 DALYs per 100,000 people). Those taking AEDs contributed fewer DALYs than those not taking AEDs (167 vs. 266 DALYs per 100,000 people). The proportion of people with ACE in remission per year was estimated at 11.0% in males and 12.0% in females, with highest rates in the 0–5 year age group. Significance The DALYs for ACE are high in rural Kenya, but less than the estimates of 2010 GBD study. Three-fourths of DALYs resulted from secondary epilepsy. Use of AEDs was associated with 40% reduction of DALYs. Improving adherence to AEDs may reduce the burden of epilepsy in this area. PMID:25131901
Indução da ovulação com gonadotrofina coriônica humana em éguas Crioulas
Directory of Open Access Journals (Sweden)
Jordana Beal
2011-08-01
Full Text Available O efeito da idade, diâmetro folicular e mês da estação de monta (setembro a janeiro na indução da ovulação com hCG foi avaliado em 123 éguas Crioulas. A idade das éguas variou entre dois e 24 anos e os animais foram examinados diariamente por palpação retal e ultrassonografia com transdutor linear de 5 MHz. Quando os folículos ovarianos atingiram diâmetro de 30 a 35 milímetros aplicou-se uma injeção intravenosa com 1000 UI (n = 39; 1500 UI (n = 41 ou 2000 UI (n = 43 de hCG. As éguas foram cobertas no dia seguinte e examinadas diariamente até a detecção da ovulação. O percentual de éguas que ovularam antes de 24 h da injeção de hCG foi de 10,3%, 7,3% e 4,7%, até 48h após a injeção foi de 92,3%, 85,3% e 86,0%, nos grupos com 1000, 1500 e 2000 UI de hCG, respectivamente. O mês da estação de monta, a idade das éguas ou o diâmetro folicular não influenciaram a resposta ovulatória. As três doses de hCG utilizadas em éguas Crioulas (P >; 0,05 resultaram na indução da ovulação dentro de 48h após a aplicação, quando foi identificado um folículo pré-ovulatório de 30 a 35 mm de diâmetro. Uma única dose de 1000 UI de hCG é eficiente para induzir a ovulação em éguas Crioulas.
Liedberg, Fredrik; Ahlgren, Göran; Baseckas, Gediminas; Gudjonsson, Sigurdur; Håkansson, Ulf; Lindquist, Sara; Löfgren, Annica; Patschan, Oliver; Siller, Carina; Sjödahl, Gottfrid
2017-02-01
Functional outcomes after ileal bladder substitution reflect the expectations of future patients at a particular centre. The aim of this study was to use validated questionnaires and a pad-weighing test to investigate functional outcomes after neobladder reconstruction at long-term follow-up in patients at a single centre. During 2005 - 2015, 75 patients received a Studer ileal bladder substitute at the Department of Urology, Malmö. Forty-six of these patients were alive for follow-up and were evaluated using the pad-weighing test and the International Consultation on Incontinence Questionnaire-Urinary Incontinence Short Form (ICIQ-UI-SF), the Female Sexual Function Index (FSFI) and the International Index of Erectile Function (IIEF). Five of 37 evaluable patients (14%) were considered fully continent, reporting a pad-weighing test result of 0 g and an ICIQ-UI-SF score of 0. The median ICIQ-UI-SF score was 8 [interquartile range (IQR) 3-11], and seven patients (17%) were continent according to the ICIQ-UI-SF score only. In the pad-weighing test, 28 out of 37 patients (76%) reported 0 g day-time leakage whereas only 12 out of 37 patients (32%) reported 0 g night-time leakage. At follow-up, nine out of 39 (23%) of evaluable male patients were potent. The median ICIQ-UI-SF score was significantly lower during the second half of the study period [4 (IQR 0-8) vs 10 (IQR 6-14); p = .003]. The inverse applied to the median IIEF score [5 (IQR 3-12) vs 2 (IQR 1-4); p = .02]. Functional outcomes at long-term follow-up after radical cystectomy and Studer ileal bladder substitute were at best modest in this series. Better outcomes during the second half of the study period might be explained by improved patient selection and a refined surgical technique, but possibly also by longer follow-up of patients during the first half of the period resulting in a more pronounced time-dependent decline in functional outcomes.
Brisson, Marc; Laprise, Jean-François; Chesson, Harrell W; Drolet, Mélanie; Malagón, Talía; Boily, Marie-Claude; Markowitz, Lauri E
2016-01-01
Randomized clinical trials have shown the 9-valent human papillomavirus (HPV) vaccine to be highly effective against types 31/33/45/52/58 compared with the 4-valent. Evidence on the added health and economic benefit of the 9-valent is required for policy decisions. We compare population-level effectiveness and cost-effectiveness of 9- and 4-valent HPV vaccination in the United States. We used a multitype individual-based transmission-dynamic model of HPV infection and disease (anogenital warts and cervical, anogenital, and oropharyngeal cancers), 3% discount rate, and societal perspective. The model was calibrated to sexual behavior and epidemiologic data from the United States. In our base-case, we assumed 95% vaccine-type efficacy, lifelong protection, and a cost/dose of $145 and $158 for the 4- and 9-valent vaccine, respectively. Predictions are presented using the mean (80% uncertainty interval [UI] = 10(th)-90(th) percentiles) of simulations. Under base-case assumptions, the 4-valent gender-neutral vaccination program is estimated to cost $5500 (80% UI = 2400-9400) and $7300 (80% UI = 4300-11 000)/quality-adjusted life-year (QALY) gained with and without cross-protection, respectively. Switching to a 9-valent gender-neutral program is estimated to be cost-saving irrespective of cross-protection assumptions. Finally, the incremental cost/QALY gained of switching to a 9-valent gender-neutral program (vs 9-valent girls/4-valent boys) is estimated to be $140 200 (80% UI = 4200->1 million) and $31 100 (80% UI = 2100->1 million) with and without cross-protection, respectively. Results are robust to assumptions about HPV natural history, screening methods, duration of protection, and healthcare costs. Switching to a 9-valent gender-neutral HPV vaccination program is likely to be cost-saving if the additional cost/dose of the 9-valent is less than $13. Giving females the 9-valent vaccine provides the majority of benefits of a gender-neutral strategy. © The Author
EVALUACIÓN DE ENZIMAS PARA LA HIDRÓLISIS DE RESIDUOS (HOJAS Y COGOLLOS DE LA COSECHA CAÑA DE AZÚCAR
Directory of Open Access Journals (Sweden)
JAIRO G. SALCEDO M.
2011-01-01
Full Text Available El presente trabajo tuvo como objetivo la evaluación de la hidrólisis enzimática de residuos de la cosecha de la caña de azúcar (hojas y cogollos a partir de la preparación de cuatro sustratos con diferentes pretratamientos, entre los que se encuentran: delignificación organosolvente, delignificación enzimática, delignificación con hidróxido de sodio y clorito de sodio y un sustrato base obtenido directamente de la cosecha. Además, se elaboraron cinco enzimas a partir de mezclas de actividades de enzimas comerciales, que fueron evaluadas en los diferentes sustratos. Se introduce un criterio para evaluar la eficiencia de las enzimas a partir de curvas de progreso, porcentaje de sacarificación e índice de sacarificación, a este índice se le denomino "índice global de hidrólisis". Los resultados muestran, que para la hidrólisis con el preparado enzimático E5, que contiene las siguientes actividades enzimáticas: hemicelulusas de 52.75 unidades globales/ml, celulasas total de 27.53 FPU/ml, endoglucanasas de 1782,1 CMC/ml, exoglucanasa de 0.377 UI/ml, betaglucosidasa de 550 pNPG U/ml, xilanasa de 28.23 UI/ml, galactosidasa de 7.1 UI/ml, manasa de 2.76 UI/ml y ranmanasa de 14.63 UI/ml y el sustrato S3, con un contenido de celulosa de 80.53%, hemicelulosa de 13.35, lignina 1.36 y un número de Kappa de 5.85 presenta el mayor índice global de Nhidrólisis que corresponde a un valor de 117.16. El estudio permite concluir que el preparado enzimático E5 presenta un gran potencial para la hidrólisis de los residuos de la caña de azúcar tratados en este proyecto.
Directory of Open Access Journals (Sweden)
Luis Fernando Uribe-Velásquez
2010-06-01
Full Text Available Objetivou-se comparar os efeitos de diferentes doses de gonadotrofina coriônica equina (eCG na dinâmica folicular e nas concentrações hormonais em cabras alpinas. Durante a estação reprodutiva, as cabras foram submetidas à sincronização do estro e da ovulação com um dispositivo de progesterona por 14 dias. As cabras (n=24 foram divididas aleatoriamente, em quatro grupos de seis e, no dia da remoção do dispositivo, receberam 0 (controle, 200, 300 e 400 UI de eCG. O desenvolvimento folicular foi observado via ultrassonografia um dia antes da administração da eCG até a ovulação seguinte. Determinaram-se diariamente as concentrações plasmáticas de estradiol e progesterona por radioimunoensaio. Todos os animais tratados manifestaram estro. Observaram-se ciclos estrais com três e quatro ondas de crescimento folicular. O tamanho do maior folículo nos animais controle na terceira onda (5,5 ± 0,50 mm foi menor que naqueles tratados com 300 UI de eCG (7,17 ± 0,35 mm. A aplicação de gonadotrofina aumentou o número de folículos pequenos e médios em relação ao grupo controle, uma vez que o número médio de corpos lúteos foi maior nas fêmeas tratadas com 400 UI (4,27 ± 0,23 em comparação àquelas tratadas com 200 UI (1,95 ± 0,19. A concentração plasmática de progesterona e estradiol diferiu entre os grupos experimentais. A combinação de progestágenos e eCG é uma alternativa adequada para a sincronização do estro e suporta o desenvolvimento de novos protocolos de técnicas reprodutivas, como a superovulação e a transferência de embriões em cabras.The objective of the present study was to compare the effect of different dosages of equine chorionic gonadotrophin (eCG on the follicular dynamics and hormonal concentrations in Alpine goats. During the breeding season, the goats were submitted to estrous and ovulation synchronization with a device containing progesterone for 14 days. Female goats (n=24 were divided
Selamat, Rusidah; Mohamud, Wan Nazaimoon Wan; Zainuddin, Ahmad Ali; Rahim, Nor Syamlina Che Abdul; Ghaffar, Suhaila Abdul; Aris, Tahir
2010-01-01
A nationwide cross-sectional school-based survey was undertaken among children aged 8-10 years old to determine the current iodine deficiency status in the country. Determination of urinary iodine (UI) and palpation of the thyroid gland were carried out among 18,012 and 18,078 children respectively while iodine test of the salt samples was done using Rapid Test Kits and the iodometric method. The results showed that based on WHO/ ICCIDD/UNICEF criteria, the national median UI was 109 μg/L [25th, 75th percentile (67, 166)] showing borderline adequacy. The overall national prevalence of iodine deficiency disorders (IDD) with UIMalaysia using adequately iodised salt as recommended by Malaysian Food Act 1983 of 20-30 ppm was only 6.8% (95% CI: 5.1, 9.0). In conclusion, although a goitre endemic was not present in Malaysia, almost half of the states in Peninsular Malaysia still have large proportion of UI level review on the current approach of the national IDD prevention and control programme.
Kiefel, Karin; Donsa, Klaus; Tiefenbacher, Peter; Mischak, Robert; Brunner, Gernot; Sendlhofer, Gerald; Pieber, Thomas
2018-01-01
The Surgical Safety Checklist (SSC) is routinely used in operating rooms (OR) but its acceptance is low. One promising way to improve acceptance of the SSC and thus quality of patient care is digitalization. To investigate how a digitalization of the SSC could be implemented in a teaching hospital. Based on the identified user requirements we designed a first user interface (UI). We performed a literature review, identified user perceptions and requirements during 12 interviews including a standardized questionnaire in surgical departments at the University Hospital Graz (Austria). Subsequently a first prototype of a UI was designed. Seven different approaches for digital SSC were identified in literature. Our interviews showed that 90% of the participants had a positive attitude towards a digitalization of SSC. The most favoured version of a digitalized SSC was a tablet-based client-server system with integration in the EHR and projection on an OR monitor. Digitalization of the SSC is requested by medical and nursing personnel. Based on the identified user requirements we designed a process oriented UI of a digital SSC.
Li, Yanping; Zhang, Xin; Zhang, Ling; Jiang, Ke; Cui, Yuanjing; Yang, Yu; Qian, Guodong
2017-11-01
Hydrogen sulfide (H2S) has been commonly viewed as a gas signaling molecule in various physiological and pathological processes. However, the highly efficient H2S detection still remains challenging. Herein, we designed a new robust nano metal-organic framework (MOF) UiO-66-CH=CH2 as a fluorescent probe for rapid, sensitive and selective detection of biological H2S. UiO-66-CH=CH2 was prepared by heating ZrCl4 and 2-vinylterephthalic acid via a simple method. UiO-66-CH=CH2 displayed fluorescence quenching to H2S and kept excellent selectivity in the presence of biological relevant analytes especially the cysteine and glutathione. This MOF-based probe also exhibited fast response (10 s) and high sensitivity with a detection limit of 6.46 μM which was within the concentration range of biological H2S in living system. Moreover, this constructed MOF featured water-stability, nanoscale (20-30 nm) and low toxicity, which made it a promising candidate for biological H2S sensing.
Tiyarattanachai, Ronnachai; Hollmann, Nicholas M
2016-01-01
In 2010, Universitas Indonesia (UI) developed the UI GreenMetric World University Ranking for universities to share information about their sustainability practices. This ranking system was well aligned with the basis of Sustainability for Higher Education. The scoring system can also be used as a guideline for universities to achieve sustainability in their campuses. Since its first launch, more universities around the world have increasingly participated in the ranking system including many universities in Thailand. This study compared perception of stakeholders in Green Campus and Non-Green Campus universities in Thailand regarding stakeholders' satisfaction on sustainability practices and perceived quality of life at their campuses. The results showed that stakeholders at the studied Green Campus University were more satisfied and had significantly better perceived quality of life compared to stakeholders from the studied Non-Green Campus university. The results suggested that universities should adopt the criteria set in the UI GreenMetric World University Ranking to achieve better sustainability in their campuses and improve quality of life of their stakeholders.
Pelvic Floor Muscle Training: Underutilization in the USA.
Lamin, Eliza; Parrillo, Lisa M; Newman, Diane K; Smith, Ariana L
2016-02-01
Pelvic floor disorders are highly prevalent in women of all ages and can greatly impair quality of life. Pelvic floor muscle training (PFMT) is a viable treatment option for several pelvic floor conditions including urinary incontinence and pelvic organ prolapse. PFMT is a program of therapy initiated by an experienced clinician (e.g., women's health or urology nurse practitioner (NP), physical therapist (PT)) that involves exercises for women with stress urinary incontinence (UI) and exercises combined with behavioral or conservative treatments (lifestyle changes, bladder training with urge suppression) for women with urgency or mixed UI. These exercise programs are more comprehensive than simple Kegel exercises. Despite evidence-based research indicating the efficacy and cost-effectiveness for treatment of urinary incontinence, PFMT is not commonly used as a first-line treatment in clinical practice in the USA (Abrams et al., 2012). This article will review PFMT for the treatment of UI and pelvic organ prolapse (POP) and theorize how this conservative therapy can be utilized more effectively in the USA.
Liang, Huixin; Yao, Aonan; Jiao, Xiuling; Li, Cheng; Chen, Dairong
2018-06-20
Self-detoxification filters against lethal chemical warfare agents (CWAs) are highly desirable for the protection of human beings and the environment. In this report, flexible self-supported filters of a series of Zr(IV)-based metal-organic frameworks (MOFs) including UiO-66, UiO-67, and UiO-66-NH 2 were successfully prepared and exhibited fast and sustained degradation of CWA simulants. A half-life as short as 2.4 min was obtained for the catalytic hydrolysis of dimethyl 4-nitrophenyl phosphate, and the percent conversion remained above 90% over a long-term exposure of 120 min, well exceeding those of the previously reported composite MOF filters and the corresponding MOF powders. The outstanding detoxification performance of the self-supported fibrous filter comes from the exceptionally high surface area, excellent pore accessibility, and hierarchical structure from the nano- to macroscale. This work demonstrates, for the first time, MOF-only filters as efficient self-detoxification media, which will offer new opportunities for the design and fabrication of functional materials for toxic chemical protection.
Li, Bin; Liu, Jian; Nie, Zimin; Wang, Wei; Reed, David; Liu, Jun; McGrail, Pete; Sprenkle, Vincent
2016-07-13
The new aqueous zinc-polyiodide redox flow battery (RFB) system with highly soluble active materials as well as ambipolar and bifunctional designs demonstrated significantly enhanced energy density, which shows great potential to reduce RFB cost. However, the poor kinetic reversibility and electrochemical activity of the redox reaction of I3(-)/I(-) couples on graphite felts (GFs) electrode can result in low energy efficiency. Two nanoporous metal-organic frameworks (MOFs), MIL-125-NH2 and UiO-66-CH3, that have high surface areas when introduced to GF surfaces accelerated the I3(-)/I(-) redox reaction. The flow cell with MOF-modified GFs serving as a positive electrode showed higher energy efficiency than the pristine GFs; increases of about 6.4% and 2.7% occurred at the current density of 30 mA/cm(2) for MIL-125-NH2 and UiO-66-CH3, respectively. Moreover, UiO-66-CH3 is more promising due to its excellent chemical stability in the weakly acidic electrolyte. This letter highlights a way for MOFs to be used in the field of RFBs.
International Nuclear Information System (INIS)
Erbagci, I.; Okumus, S.; Bekir, Necdet A.; Karaca, M.; Ugur, Mete G.
2008-01-01
Objective was to present various ophthalmologic disorders in a clinical series of hemolysis, elevated liver enzymes and low platelet count (HELLP) syndrome cases. This is a prospective clinical study performed between 2002 and 2005. One hundred seven HELLP attended in either Departments of Ophthalmology or Obstetrics and Gynecology, Medical School, Gaziantep University, Gaziantep, Turkey were evaluated. Mean age was 25.5 (22-36 years). Mean levels were 2.5 gravidity, 1.3 parity, 55,200/mm3 platelet counts, 308.7 U/I aspartate transaminase, 255.4 U/I alanine transminase and 1711.6U/I lactate dehydrogenase. Four patients died (3.7%) despite the proper treatments. Cortical blindness was observed in 3 cases (2.7%), serous retinal detachments in 4 (3.7%) and mild hypertension changes in 18 (16%). Ophthalmic complications are possible during and after this syndrome. Almost all ophthalmologic changes recover after delivery by cesarean section, nevertheless, it is essential that ophthalmologists should be aware of retinal disorders when this fatal complication of pregnancy is encountered. (author)
Fragoulakis, Vassilis; Pescott, Chris P; Smeenk, Jesper M J; van Santbrink, Evert J P; Oosterhuis, G Jur E; Broekmans, Frank J M; Maniadakis, Nikos
2016-12-01
Subfertility represents a multidimensional problem associated with significant distress and impaired social well-being. In the Netherlands, an estimated 50,000 couples visit their general practitioner and 30,000 couples seek medical specialist care for subfertility. We conducted an economic evaluation comparing recombinant human follicle-stimulating hormone (follitropin alfa, r-hFSH, Gonal-F ® ) with two classes of urinary gonadotrophins-highly purified human menopausal gonadotrophin (hp-HMG, Menopur ® ) and urinary follicle-stimulating hormone (uFSH, Fostimon ® )-for ovarian stimulation in women undergoing in vitro fertilization (IVF) treatment in the Netherlands. A pharmacoeconomic model was developed, simulating each step in the IVF protocol from the start of therapy until either a live birth, a new IVF treatment cycle or cessation of IVF, following a long down-regulation protocol. A decision tree combined with a Markov model details progress through each health state, including ovum pickup, fresh embryo transfer, up to two subsequent cryo-preserved embryo transfers, and (ongoing) pregnancy or miscarriage. A health insurer perspective was chosen, and the time horizon was set at a maximum of three consecutive treatment cycles, in accordance with Dutch reimbursement policy. Transition probabilities and costing data were derived from a real-world observational outcomes database (from Germany) and official tariff lists (from the Netherlands). Adverse events were considered equal among the comparators and were therefore excluded from the economic analysis. A Monte Carlo simulation of 5000 iterations was undertaken for each strategy to explore uncertainty and to construct uncertainty intervals (UIs). All cost data were valued in 2013 Euros. The model's structure, parameters and assumptions were assessed and confirmed by an external clinician with experience in health economics modelling, to inform on the appropriateness of the outcomes and the applicability of the
Directory of Open Access Journals (Sweden)
Linda J Cobiac
2017-02-01
Full Text Available An increasing number of countries are implementing taxes on unhealthy foods and drinks to address the growing burden of dietary-related disease, but the cost-effectiveness of combining taxes on unhealthy foods and subsidies on healthy foods is not well understood.Using a population model of dietary-related diseases and health care costs and food price elasticities, we simulated the effect of taxes on saturated fat, salt, sugar, and sugar-sweetened beverages and a subsidy on fruits and vegetables, over the lifetime of the Australian population. The sizes of the taxes and subsidy were set such that, when combined as a package, there would be a negligible effect on average weekly expenditure on food (<1% change. We evaluated the cost-effectiveness of the interventions individually, then determined the optimal combination based on maximising net monetary benefit at a threshold of AU$50,000 per disability-adjusted life year (DALY. The simulations suggested that the combination of taxes and subsidy might avert as many as 470,000 DALYs (95% uncertainty interval [UI]: 420,000 to 510,000 in the Australian population of 22 million, with a net cost-saving of AU$3.4 billion (95% UI: AU$2.4 billion to AU$4.6 billion; US$2.3 billion to the health sector. Of the taxes evaluated, the sugar tax produced the biggest estimates of health gain (270,000 [95% UI: 250,000 to 290,000] DALYs averted, followed by the salt tax (130,000 [95% UI: 120,000 to 140,000] DALYs, the saturated fat tax (97,000 [95% UI: 77,000 to 120,000] DALYs, and the sugar-sweetened beverage tax (12,000 [95% UI: 2,100 to 21,000] DALYs. The fruit and vegetable subsidy (-13,000 [95% UI: -44,000 to 18,000] DALYs was a cost-effective addition to the package of taxes. However, it did not necessarily lead to a net health benefit for the population when modelled as an intervention on its own, because of the possible adverse cross-price elasticity effects on consumption of other foods (e.g., foods high in
Directory of Open Access Journals (Sweden)
Stępień-Słodkowska Marta
2015-03-01
Full Text Available The purpose of this study was to examine the association of the BstUI RFLP C/T (rs 12722 and DpnII RFLP C/T (rs 13946 COL5A1 polymorphisms, individually and as haplotypes, with anterior cruciate ligament ruptures in recreational skiers. Subjects were 138 male recreational skiers with surgically diagnosed primary anterior cruciate ligament ruptures. The control group consisted of 183 apparently healthy male recreational skiers, who were without any self-reported history of ligament or tendon injury. DNA was extracted from buccal cells donated by the subjects and genotyping was carried out using real-time PCR. The genotype distributions for both polymorphisms met Hardy- Weinberg expectations in both groups. There were no significant differences in genotype distribution of allele frequencies of COL5A1 BstUI RFLP C/T and COL5A1 DpnII RFLP C/T polymorphisms between the ACL rupture and control groups. The T-T (BstUI RFLP T, DpnII RFLP T haplotype was the most common (55.6%. The haplotype T-C was not present in any of the subjects. There was an underrepresentation tendency of the C-T haplotype in the study group compared to controls under recessive mode of inheritance. Higher frequency of the COL5A1 BstUI RFLP C/T and COL5A1DpnII RFLP C/T polymorphisms haplotype is associated with reduced risk of anterior cruciate ligament injury in a group of apparently healthy male recreational skiers.
Cost-effectiveness of tiotropium versus salmeterol: the POET-COPD trial.
Hoogendoorn, Martine; Al, Maiwenn J; Beeh, Kai-Michael; Bowles, David; Graf von der Schulenburg, J Matthias; Lungershausen, Juliane; Monz, Brigitta U; Schmidt, Hendrik; Vogelmeier, Claus; Rutten-van Mölken, Maureen P M H
2013-03-01
The aim of this study was to perform a 1-yr trial-based cost-effectiveness analysis (CEA) of tiotropium versus salmeterol followed by a 5-yr model-based CEA. The within-trial CEA, including 7,250 patients with moderate to very severe chronic obstructive pulmonary disease (COPD), was performed alongside the 1-yr international randomised controlled Prevention of Exacerbations with Tiotropium (POET)-COPD trial comparing tiotropium with salmeterol regarding the effect on exacerbations. Main end-points of the trial-based analysis were costs, number of exacerbations and exacerbation days. The model-based analysis was conducted to extrapolate results to 5 yrs and to calculate quality-adjusted life years (QALYs). 1-yr costs per patient from the German statutory health insurance (SHI) perspective and the societal perspective were €126 (95% uncertainty interval (UI) €55-195) and €170 (95% UI €77-260) higher for tiotropium, respectively. The annual number of exacerbations was 0.064 (95% UI 0.010-0.118) lower for tiotropium, leading to a reduction in exacerbation-related costs of €87 (95% UI €19-157). The incremental cost-effectiveness ratio was €1,961 per exacerbation avoided from the SHI perspective and €2,647 from the societal perspective. In the model-based analyses, the 5-yr costs per QALY were €3,488 from the SHI perspective and €8,141 from the societal perspective. Tiotropium reduced exacerbations and exacerbation-related costs, but increased total costs. Tiotropium can be considered cost-effective as the resulting cost-effectiveness ratios were below commonly accepted willingness-to-pay thresholds.
International Nuclear Information System (INIS)
Iozzo, P.; Osman, S.; Glaser, M.; Knickmeier, M.; Ferrannini, E.; Pike, V.W.; Camici, P.G.; Law, M.P.
2002-01-01
[A 14 -*I]iodoinsulin was prepared for studies to assess the suitability of labeled iodoinsulin for positron emission tomography (PET). Iodine-125 was used to establish the methods and for preliminary studies in rats. Further studies and PET scanning in rats were carried out using iodine-124. Tissue and plasma radioactivity was measured as the uptake index (UI={cpm·(g tissue) -1 }/{cpm injected·(g body weight) -1 }) at 1 to 40 min after intravenous injection of either [A 14 - 125 I]iodoinsulin or [A 14 - 124 I]iodoinsulin. For both radiotracers, initial clearance of radioactivity from plasma was rapid (T 1/2 ∼ 1 min), reaching a plateau (UI = 2.8) at ∼ 5 min which was maintained for 35 min. Tissue biodistributions of the two radiotracers were comparable; at 10 min after injection, UI for myocardium was 2.4, liver, 4.0, pancreas, 5.4, brain, 0.17, kidney, 22, lung, 2.3, muscle, 0.54 and fat, 0.28. Predosing rats with unlabelled insulin reduced the UI for myocardium (0.95), liver (1.8), pancreas (1.2) and brain (0.08), increased that for kidney (61) but had no effect on that for lung (2.5), muscle (0.50) or fat (0.34). Analysis of radioactivity in plasma demonstrated a decrease of [ 125 I]iodoinsulin associated with the appearance of labeled metabolites; the percentage of plasma radioactivity due to [ 125 I]iodoinsulin was 40% at 5 min and 10% at 10 min. The heart, liver and kidneys were visualized using [ 124 I]iodoinsulin with PET
Directory of Open Access Journals (Sweden)
Vânia F. Figueiredo
2015-02-01
Full Text Available Background: Low back pain (LBP and urinary incontinence (UI are highly prevalent among elderly individuals. In young adults, changes in trunk muscle recruitment, as assessed via ultrasound imaging, may be associated with lumbar spine stability. Objective: To assess the associations between LBP, UI, and the pattern of transversus abdominis (TrA, internal (IO, and external oblique (EO muscle recruitment in the elderly as evaluated by ultrasound imaging. Method: Fifty-four elderly individuals (mean age: 72±5.2 years who complained of LBP and/or UI as assessed by the McGill Pain Questionnaire, Incontinence Questionnaire-Short Form, and ultrasound imaging were included in the study. The statistical analysis comprised a multiple linear regression model, and a p-value <0.05 was considered significant. Results: The regression models for the TrA, IO, and EO muscle thickness levels explained 2.0% (R2=0.02; F=0.47; p=0.628, 10.6% (R2=0.106; F=3.03; p=0.057, and 10.1% (R2=0.101; F=2.70; p=0.077 of the variability, respectively. None of the regression models developed for the abdominal muscles exhibited statistical significance. A significant and negative association (p=0.018; β=-0.0343 was observed only between UI and IO recruitment. Conclusion: These results suggest that age-related factors may have interfered with the findings of the study, thus emphasizing the need to perform ultrasound imaging-based studies to measure abdominal muscle recruitment in the elderly.
Wang, Zonghua; Yan, Zhiyong; Wang, Feng; Cai, Jibao; Guo, Lei; Su, Jiakun; Liu, Yang
2017-11-15
A turn-on photoelectrochemical (PEC) biosensor based on the surface defect recognition and multiple signal amplification of metal-organic frameworks (MOFs) was proposed for highly sensitive protein kinase activity analysis and inhibitor evaluation. In this strategy, based on the phosphorylation reaction in the presence of protein kinase A (PKA), the Zr-based metal-organic frameworks (UiO-66) accommodated with [Ru(bpy) 3 ] 2+ photoactive dyes in the pores were linked to the phosphorylated kemptide modified TiO 2 /ITO electrode through the chelation between the Zr 4+ defects on the surface of UiO-66 and the phosphate groups in kemptide. Under visible light irradiation, the excited electrons from [Ru(bpy) 3 ] 2+ adsorbed in the pores of UiO-66 injected into the TiO 2 conduction band to generate photocurrent, which could be utilized for protein kinase activities detection. The large surface area and high porosities of UiO-66 facilitated a large number of [Ru(bpy) 3 ] 2+ that increased the photocurrent significantly, and afforded a highly sensitive PEC analysis of kinase activity. The detection limit of the as-proposed PEC biosensor was 0.0049UmL -1 (S/N!=!3). The biosensor was also applied for quantitative kinase inhibitor evaluation and PKA activities detection in MCF-7 cell lysates. The developed visible-light PEC biosensor provides a simple detection procedure and a cost-effective manner for PKA activity assays, and shows great potential in clinical diagnosis and drug discoveries. Copyright © 2017 Elsevier B.V. All rights reserved.
Khalil, Ibrahim; Colombara, Danny V.; Forouzanfar, Mohammad Hossein; Troeger, Christopher; Daoud, Farah; Moradi-Lakeh, Maziar; El Bcheraoui, Charbel; Rao, Puja C.; Afshin, Ashkan; Charara, Raghid; Abate, Kalkidan Hassen; El Razek, Mohammed Magdy Abd; Abd-Allah, Foad; Abu-Elyazeed, Remon; Kiadaliri, Aliasghar Ahmad; Akanda, Ali Shafqat; Akseer, Nadia; Alam, Khurshid; Alasfoor, Deena; Ali, Raghib; AlMazroa, Mohammad A.; Alomari, Mahmoud A.; Al-Raddadi, Rajaa Mohammad Salem; Alsharif, Ubai; Alsowaidi, Shirina; Altirkawi, Khalid A.; Alvis-Guzman, Nelson; Ammar, Walid; Antonio, Carl Abelardo T.; Asayesh, Hamid; Asghar, Rana Jawad; Atique, Suleman; Awasthi, Ashish; Bacha, Umar; Badawi, Alaa; Barac, Aleksandra; Bedi, Neeraj; Bekele, Tolesa; Bensenor, Isabela M.; Betsu, Balem Demtsu; Bhutta, Zulfiqar; Bin Abdulhak, Aref A.; Butt, Zahid A.; Danawi, Hadi; Dubey, Manisha; Endries, Aman Yesuf; Faghmous, Imad D. A.; Farid, Talha; Farvid, Maryam S.; Farzadfar, Farshad; Fereshtehnejad, Seyed-Mohammad; Fischer, Florian; Fitchett, Joseph Robert Anderson; Gibney, Katherine B.; Ginawi, Ibrahim Abdelmageem Mohamed; Gishu, Melkamu Dedefo; Gugnani, Harish Chander; Gupta, Rahul; Hailu, Gessessew Bugssa; Hamadeh, Randah Ribhi; Hamidi, Samer; Harb, Hilda L.; Hedayati, Mohammad T.; Hsairi, Mohamed; Husseini, Abdullatif; Jahanmehr, Nader; Javanbakht, Mehdi; Jibat, Tariku; Jonas, Jost B.; Kasaeian, Amir; Khader, Yousef Saleh; Khan, Abdur Rahman; Khan, Ejaz Ahmad; Khan, Gulfaraz; Khoja, Tawfik Ahmed Muthafer; Kinfu, Yohannes; Kissoon, Niranjan; Koyanagi, Ai; Lal, Aparna; Latif, Asma Abdul Abdul; Lunevicius, Raimundas; El Razek, Hassan Magdy Abd; Majeed, Azeem; Malekzadeh, Reza; Mehari, Alem; Mekonnen, Alemayehu B.; Melaku, Yohannes Adama; Memish, Ziad A.; Mendoza, Walter; Misganaw, Awoke; Mohamed, Layla Abdalla Ibrahim; Nachega, Jean B.; Le Nguyen, Quyen; Nisar, Muhammad Imran; Peprah, Emmanuel Kwame; Platts-Mills, James A.; Pourmalek, Farshad; Qorbani, Mostafa; Rafay, Anwar; Rahimi-Movaghar, Vafa; Ur Rahman, Sajjad; Rai, Rajesh Kumar; Rana, Saleem M.; Ranabhat, Chhabi L.; Rao, Sowmya R.; Refaat, Amany H.; Riddle, Mark; Roshandel, Gholamreza; Ruhago, George Mugambage; Saleh, Muhammad Muhammad; Sanabria, Juan R.; Sawhney, Monika; Sepanlou, Sadaf G.; Setegn, Tesfaye; Sliwa, Karen; Sreeramareddy, Chandrashekhar T.; Sykes, Bryan L.; Tavakkoli, Mohammad; Tedla, Bemnet Amare; Terkawi, Abdullah S.; Ukwaja, Kingsley; Uthman, Olalekan A.; Westerman, Ronny; Wubshet, Mamo; Yenesew, Muluken A.; Yonemoto, Naohiro; Younis, Mustafa Z.; Zaidi, Zoubida; Zaki, Maysaa El Sayed; Al Rabeeah, Abdullah A.; Wang, Haidong; Naghavi, Mohsen; Vos, Theo; Lopez, Alan D.; Murray, Christopher J. L.; Mokdad, Ali H.
2016-01-01
Diarrheal diseases (DD) are leading causes of disease burden, death, and disability, especially in children in low-income settings. DD can also impact a child's potential livelihood through stunted physical growth, cognitive impairment, and other sequelae. As part of the Global Burden of Disease Study, we estimated DD burden, and the burden attributable to specific risk factors and particular etiologies, in the Eastern Mediterranean Region (EMR) between 1990 and 2013. For both sexes and all ages, we calculated disability-adjusted life years (DALYs), which are the sum of years of life lost and years lived with disability. We estimate that over 125,000 deaths (3.6% of total deaths) were due to DD in the EMR in 2013, with a greater burden of DD in low- and middle-income countries. Diarrhea deaths per 100,000 children under 5 years of age ranged from one (95% uncertainty interval [UI] = 0–1) in Bahrain and Oman to 471 (95% UI = 245–763) in Somalia. The pattern for diarrhea DALYs among those under 5 years of age closely followed that for diarrheal deaths. DALYs per 100,000 ranged from 739 (95% UI = 520–989) in Syria to 40,869 (95% UI = 21,540–65,823) in Somalia. Our results highlighted a highly inequitable burden of DD in EMR, mainly driven by the lack of access to proper resources such as water and sanitation. Our findings will guide preventive and treatment interventions which are based on evidence and which follow the ultimate goal of reducing the DD burden. PMID:27928080
Figueiró-Filho, Ernesto Antonio; Aydos, Ricardo Dutra; Senefonte, Flávio Renato de Almeida; Ferreira, Cristiane Munaretto; Pereira, Erica Freire de Vasconcelos; Oliveira, Vanessa Marcon de; Menezes, Giovanna Pádoa de; Bósio, Marco Antonio Costa
2014-07-01
To evaluate the effects of exposure of enoxaparin and unfractionated heparin (UFH) in prophylactic and therapeutic doses on the fertility rates of pregnant healthy Wistar rats. Enoxaparin and UFH were administered in prophylactic doses 1 mg/Kg/day 72 UI/Kg/day, and in therapeutic doses at 2 mg/kg/day 400UI/Kg/day. The rats were divided into five groups. The number of live and dead foetuses was quantified. The uterine horns were dissected and the presence of early and late reabsorptions (abortions) was determined. A peffect on fertility with the use of anticoagulant drugs in pregnant healthy Wistar rats.
Economic evaluation of home blood pressure telemonitoring
DEFF Research Database (Denmark)
Madsen, Line Bille; Christiansen, Terkel; Kirkegaard, Peder
2011-01-01
-time ambulatory BP (ABP) were reduced in both groups. The uncertainty around the incremental cost effectiveness ratio point estimates was considerable for both systolic and diastolic ABP. For systolic ABP, the difference in cost effectiveness ratio between the two groups was 256 Danish kroner (DKK)/mmHg [95......% uncertainty interval, UI -860 to 4544]. For diastolic ABP, the difference in cost effectiveness ratio between the two groups was 655 DKK/mmHg [95% UI -674 to 69315]. Medication and consultation costs were lowest in the intervention group, but were offset by the cost of the telemonitoring equipment...
Digital Systems Validation Handbook. Volume 2
1989-02-01
0 ui ac v :ECL. Z 00 ui Cie LU < L-,, 0of n ᝰ U. :E 0 = cc C6 Vb Z:* 3-33 U3 - x bI- t;U us L4) .3 .3a o6 - ka. 3-:3 D3 z a~ad .3 0404 =-44 oil OM F...manufacturers’ mses appear herein solely because they are considered essentil to the objective of this report. 0 TABLE OF CONTENTS Section Page 1...for safety. Selected circuits on each engine are separated from each other. Oil pressure transducers, engine temperature thermocouples, exhaust gas
Santoro, Nanette; Eisenberg, Esther; Trussell, J C; Craig, LaTasha B; Gracia, Clarisa; Huang, Hao; Alvero, Ruben; Casson, Peter; Christman, Gregory; Coutifaris, Christos; Diamond, Michael; Jin, Susan; Legro, Richard S; Robinson, Randal D; Schlaff, William D; Zhang, Heping
2016-10-01
Does fertility-related quality of life (FertiQOL) differ by infertility diagnosis between women with polycystic ovary syndrome (PCOS) and their partners, compared with couples with unexplained infertility (UI)? Women with PCOS report lower QOL than those with UI, whereas males with UI report lower QOL than males with PCOS partners. The fertility-specific QOL survey, FertiQOL, has been used to examine fertility-related QOL in a number of worldwide cohorts. Few data have addressed fertility-related QOL as a function of infertility diagnosis. Overall, men report better QOL than women with infertility, and there is variation in FertiQOL scores across different samples from different countries. This was a prospective, cohort study derived from two concurrent, randomized clinical trials, and designed to examine QOL in infertile females with PCOS and UI at the time of enrollment compared with each other and their male partners; to compare concordance FertiQOL scores in this study across other worldwide cohorts; and to determine if baseline FertiQOL was associated with pregnancy outcome. Women with PCOS and their partners (n = 733 and n = 641, respectively), and couples with UI (n = 865 women and 849 men) completed a validated fertility-specific QOL survey (FertiQOL) at the time of the study screening visit. PCOS women were randomized to either clomiphene citrate or letrozole treatment; couples with UI were randomized to clomiphene citrate, letrozole or gonadotrophin plus IUI. FertiQOL results were compiled by diagnosis (PCOS or UI) and compared by diagnosis and sex using Wilcoxon Rank-Sum testing. Relationships between baseline FertiQOL and pregnancy outcomes were examined using logistic regression. Multivariable models were performed to assess the association between FertiQOL scores and key participant characteristics. Women with PCOS had lower total FertiQOL scores (72.3 ± 14.8) than those with UI (77.1 ± 12.8; P male partners. Males with PCOS partners had higher
Mobile Design Pattern Gallery UI Patterns for Mobile Applications
Neil, Theresa
2012-01-01
When you're under pressure to produce a well designed, easy-to-navigate mobile app, there's no time to reinvent the wheel. This concise book provides a handy reference to 70 mobile app design patterns, illustrated by more than 400 screenshots from current iOS, Android, BlackBerry, WebOS, Windows Mobile, and Symbian apps. User experience professional Theresa Neil (Designing Web Interfaces) walks you through design patterns in 10 separate categories, including anti-patterns. Whether you're designing a simple iPhone application or one that's meant to work for every popular mobile OS on the mark
Verkorting van de kweekcyclus bij ui (Allium cepa L.)
Kampen, van J.
1970-01-01
With an annual production of about 250 000 to 300 000 tons, onion (Allium cepa L.) is the most important outdoor vegetable crop in the Netherlands. The greater part, namely 70 to 80 %, has to be exported, and is meeting increasing competition. For this reason and in connection with changed growing
re-sonanceij-ui-y--20-0-2-------------~----------------------------8-9
Indian Academy of Sciences (India)
equation'. Such equations (or more generally, the equa- tion 1 + Nx2 = y2 where N is a given positive inte- ger) were studied long back by the Indian mathemati- cians Aryabhatta and Bhaskaracharya, Later they were studied by Fermat, and still later by Euler and La- grange, and somewhere along the way the equation got.
Simulation of Growth Trajectories of Childhood Obesity into Adulthood.
Ward, Zachary J; Long, Michael W; Resch, Stephen C; Giles, Catherine M; Cradock, Angie L; Gortmaker, Steven L
2017-11-30
Although the current obesity epidemic has been well documented in children and adults, less is known about long-term risks of adult obesity for a given child at his or her present age and weight. We developed a simulation model to estimate the risk of adult obesity at the age of 35 years for the current population of children in the United States. We pooled height and weight data from five nationally representative longitudinal studies totaling 176,720 observations from 41,567 children and adults. We simulated growth trajectories across the life course and adjusted for secular trends. We created 1000 virtual populations of 1 million children through the age of 19 years that were representative of the 2016 population of the United States and projected their trajectories in height and weight up to the age of 35 years. Severe obesity was defined as a body-mass index (BMI, the weight in kilograms divided by the square of the height in meters) of 35 or higher in adults and 120% or more of the 95th percentile in children. Given the current level of childhood obesity, the models predicted that a majority of today's children (57.3%; 95% uncertainly interval [UI], 55.2 to 60.0) will be obese at the age of 35 years, and roughly half of the projected prevalence will occur during childhood. Our simulations indicated that the relative risk of adult obesity increased with age and BMI, from 1.17 (95% UI, 1.09 to 1.29) for overweight 2-year-olds to 3.10 (95% UI, 2.43 to 3.65) for 19-year-olds with severe obesity. For children with severe obesity, the chance they will no longer be obese at the age of 35 years fell from 21.0% (95% UI, 7.3 to 47.3) at the age of 2 years to 6.1% (95% UI, 2.1 to 9.9) at the age of 19 years. On the basis of our simulation models, childhood obesity and overweight will continue to be a major health problem in the United States. Early development of obesity predicted obesity in adulthood, especially for children who were severely obese. (Funded by the JPB
Automatic figure ranking and user interfacing for intelligent figure search.
Directory of Open Access Journals (Sweden)
Hong Yu
2010-10-01
Full Text Available Figures are important experimental results that are typically reported in full-text bioscience articles. Bioscience researchers need to access figures to validate research facts and to formulate or to test novel research hypotheses. On the other hand, the sheer volume of bioscience literature has made it difficult to access figures. Therefore, we are developing an intelligent figure search engine (http://figuresearch.askhermes.org. Existing research in figure search treats each figure equally, but we introduce a novel concept of "figure ranking": figures appearing in a full-text biomedical article can be ranked by their contribution to the knowledge discovery.We empirically validated the hypothesis of figure ranking with over 100 bioscience researchers, and then developed unsupervised natural language processing (NLP approaches to automatically rank figures. Evaluating on a collection of 202 full-text articles in which authors have ranked the figures based on importance, our best system achieved a weighted error rate of 0.2, which is significantly better than several other baseline systems we explored. We further explored a user interfacing application in which we built novel user interfaces (UIs incorporating figure ranking, allowing bioscience researchers to efficiently access important figures. Our evaluation results show that 92% of the bioscience researchers prefer as the top two choices the user interfaces in which the most important figures are enlarged. With our automatic figure ranking NLP system, bioscience researchers preferred the UIs in which the most important figures were predicted by our NLP system than the UIs in which the most important figures were randomly assigned. In addition, our results show that there was no statistical difference in bioscience researchers' preference in the UIs generated by automatic figure ranking and UIs by human ranking annotation.The evaluation results conclude that automatic figure ranking and user
Hoffmann, Friederike; Meyer, Stefanie; de Vareilles, Mahaut
2017-04-01
In the past years there has been a strong push in Norway for increasing participation in the EU Framework Programmes for Research and Innovation. EU projects coordinated by the University of Bergen (UiB) usually receive management support from the central administration (mostly financial) in collaboration with a full- or part-time scientific project manager working on a fixed-term contract at the same institute as the project's principal scientist. With an increasing amount of granted EU projects, the number of scientific project managers employed across the whole university has also increased, and a need for coordination and professionalization of this service became obvious. Until recently, UiB had no unified structures and routines for training of newly recruited project managers, or for archiving and transferring routines and skills after the end of the project and the manager's employment contract. To overcome this administrative knowledge gap, the "Forum for scientific EU project managers at UiB" was founded in spring 2016 as an informal communication platform. Its purpose is to bring together current and previous scientific EU project managers from different disciplines to share their experiences. The main aim of the forum is to transfer and improve knowledge, skills and routines on effective management of EU funded projects, but also to function as a discussion forum where issues arising from handling international consortia can be reviewed. The group meets monthly and discusses current challenges from on-going EU projects as well as routines for specific project operation tasks. These routines are archived in an online best-practise guide which the group currently develops. The regular personal meetings are supplemented with an intense communication via a group mailing list and several individual mail- and phone-meetings. Since lessons learned during project implementation may improve future proposals, UiB research advisors for proposal support frequently
International Nuclear Information System (INIS)
Anusha, L. S.; Nagendra, K. N.
2011-01-01
In two previous papers, we solved the polarized radiative transfer (RT) equation in multi-dimensional (multi-D) geometries with partial frequency redistribution as the scattering mechanism. We assumed Rayleigh scattering as the only source of linear polarization (Q/I, U/I) in both these papers. In this paper, we extend these previous works to include the effect of weak oriented magnetic fields (Hanle effect) on line scattering. We generalize the technique of Stokes vector decomposition in terms of the irreducible spherical tensors T K Q , developed by Anusha and Nagendra, to the case of RT with Hanle effect. A fast iterative method of solution (based on the Stabilized Preconditioned Bi-Conjugate-Gradient technique), developed by Anusha et al., is now generalized to the case of RT in magnetized three-dimensional media. We use the efficient short-characteristics formal solution method for multi-D media, generalized appropriately to the present context. The main results of this paper are the following: (1) a comparison of emergent (I, Q/I, U/I) profiles formed in one-dimensional (1D) media, with the corresponding emergent, spatially averaged profiles formed in multi-D media, shows that in the spatially resolved structures, the assumption of 1D may lead to large errors in linear polarization, especially in the line wings. (2) The multi-D RT in semi-infinite non-magnetic media causes a strong spatial variation of the emergent (Q/I, U/I) profiles, which is more pronounced in the line wings. (3) The presence of a weak magnetic field modifies the spatial variation of the emergent (Q/I, U/I) profiles in the line core, by producing significant changes in their magnitudes.
¿Es equivalente la suplementación diaria con vitamina D2 o vitamina D3 en adultos mayores?
Directory of Open Access Journals (Sweden)
Mariana Seijo
2012-06-01
Full Text Available Tanto la equivalencia entre colecalciferol (D3 y ergocalciferol (D2, como las dosis y forma de administración de ambos, son actualmente un tema controvertido. El objetivo de este estudio fue comparar la efectividad de 800 UI/día de D2 (gotas y D3 (comprimidos para alcanzar niveles adecuados de 25 hidroxivitamina D (25OHD (= 30 ng/ml. Veintiún mujeres posmenopáusicas que vivían en la Ciudad de Buenos Aires, edad promedio ( ± DS 77.1 ± 6.8 años fueron incluidas y asignadas en forma aleatoria a uno de los siguientes grupos: GD2 (n = 13: 800 UI (gotas y GD3 (n = 8: 800 UI (comprimidos. Se midió 25OHD sérica (RIA-DIASORIN basal y a los 7, 28 y 45 días del estudio. Basalmente, 19 de las 21 mujeres presentaron niveles de deficiencia de 25(OHD (< 20 ng/ml: GD2: 14.0 ± 4.8 y GD3: 13.2 ± 4.9 (NS. Se observó en el día 7 un incremento del ~25% solo en GD3 y un aumento significativo al final del estudio en ambos grupos, sin alcanzar los valores adecuados de 25OHD (GD2: 17.4 ± 5.5 vs. GD3:22.9 ± 4.6 ng/ml p < 0.001. La administración por 45 días de 800 UI de vitamina D3 fue más efectiva que D2 para incrementar los niveles de 25OHD, aunque ambas fueron insuficientes para alcanzar niveles adecuados de 25OHD (= 30 ng/ml.
Improving the efficiency of phytoremediation using electrically charged plant and chelating agents.
Tahmasbian, Iman; Safari Sinegani, Ali Akbar
2016-02-01
The low efficiency of phytoremediation is a considerable problem that limits the application of this environmentally friendly method on heavy metal-polluted soils. The combination of chelate-assisted phytoextraction and electrokinetic remediation could offer new opportunities to improve the effectiveness of phytoextraction. The current experiment aims to investigate the effects of electrical fields and chelating agents on phytoremediation efficiency. In a pot experiment using mine soil, poultry manure extract (PME), cow manure extract (CME), and ethylenediaminetetraacetic acid (EDTA) were applied to soil as chelating agents (2 g kg(-1)) at the beginning of the flowering stage. A week later, Helianthus annuus (sunflower) was negatively charged by inserting a stainless steel needle with 10 and 30 V DC electricity in the lowest part of the stems for 1 h each day for a 14-day period. At the end of the experiment, the shoot and root dry weight, lead (Pb) concentration in plant organs, translocation factor (TF), metal uptake index (UI), and soil available Pb (diethylene triamine pentaacetic acid (DTPA) extractable) were detected. Results indicated that the application of electrical fields had no significant impact on the shoot and root dry weights, while Pb concentration and UI increased in the 10-V EDTA treatment by 500 % compared to control. There was no significant difference between UI in 30- and 10-V EDTA treatments. Soil available Pb significantly increased in the 30-V treated soil. A positive correlation was observed between the available Pb in soil near the root and Pb concentration in shoot, its TF, and UI. In conclusion, a negatively charged plant along with the application of EDTA significantly increased the phytoremediation efficiency.
Directory of Open Access Journals (Sweden)
L. F. B. Venancio
2017-12-01
Full Text Available Urinary infections (UI in nuts are highly prevalent in modern intensive farming systems and cause significant economic losses, especially for reproductive failure and shortening the life of the array. The most frequently isolated agent is the bacterium Escherichia coli (E. coli. Variables such as environmental contamination pressure, management, nutrition, physiological and anatomical facilities and conditions of the animal itself are directly linked to illness. The objective of this work was to monitor microbiological urine nuts with suspected UI on commercial farms in the municipality of Sinop-MT, by counting of aerobic mesophilic total of Escherichia coli research and antimicrobial susceptibility profile. Urine samples with aerobic mesophilic total counts above 105UFC / mL were considered positive, confirming IU in 12 samples (28.57% of the 42 females subjected to collections. Of the 42 urine samples, 305 were isolated colonies of Gram negative bacteria and through biochemical tests it was confirmed E.coli in 165 (54.09% of these. In 37 (88.09% of the 42 samples collected had involvement of E. coli, with or without other pathogens and all positive samples for UI by total aerobic mesophilic bacteria count showed. Through the antimicrobial susceptibility profile test, E. coli strains showed sensitivity to the following percentages: Gentamicin (100%, Streptomycin (98.70%, Neomycin (92.85% Doxycycline (91.55% , Enrofloxacin (80.51%, Sulfazotrim (64.28%, Ampicillin (62.97%, tetracycline (61.68% and Amoxicillin (24.04%. The diagnosis of UI should be carried out thoroughly, assessing clinical and microbiological aspects, for the identification of the microorganism involved and the realization of antimicrobial susceptibility testing prevents the appearance of multi-resistant bacterial strains.
Design of the upper internals structure for the Clinch River Breeder Reactor Plant
International Nuclear Information System (INIS)
Thompson, D.C.; Novendstern, E.H.
1977-01-01
The Upper Internals Structure (UIS) is located above the core and is supported from the head at four locations. It is designed to perform the following primary functions: provide secondary core holddown in the event of a malfunction of the core hydraulic holddown system; provide support for routing all in-vessel instrumentation to core assemblies; maintain alignment between the core assemblies, the UIS and the closure head; provide guidance and crossflow protection for the control rod drivelines; and mix/duct flow to the upper region of the vessel outlet plenum to minimize rapid temperature changes to components during a reactor trip transient. In accomplishing these functions, the UIS will experience a sodium environment with temperatures up to 1200 0 F (649 0 C), and as many as 7 x 10 8 cycles of fluid temperature fluctuations up to 250 0 F (121 0 C) at full power operation. It must be designed to survive these conditions in combination with seismic and flow-induced vibration loadings for its 30 year design life. The design program of designing to controlled functional requirements and design conditions is discussed. Included is a description of the significant parts of the design and the approach used to balance the requirement of tight joints. The thermal and hydraulic environment including the results of a comprehensive test program are discussed. The test program results establish the basis of the thermal boundary used in the structural evaluation, and the UIS vibration characteristics. A summary of the areas which have required design changes is included with a summary of the structural evaluation of these changes
A Zinc Porphyrin Sensitizer Modified with Donor and Acceptor Groups for Dye-ensitized Solar Cells
Energy Technology Data Exchange (ETDEWEB)
Lee, See Woo; Sarker, K. Ashis; Hong, Jong Dal [Incheon National University, Incheon (Korea, Republic of)
2014-09-15
In this article, we have designed and synthesized a novel donor-π-acceptor (D-π-A) type porphyrin-based sensitizer (denoted UI-5), in which a carboxyl anchoring group and a 9,9-dimethyl fluorene were introduced at the meso-positions of porphyrin ring via phenylethynyl and ethynyl bridging units, respectively. Long alkoxy chains in ortho-positions of the phenyls were supposed to reduce the degree of dye aggregation, which tends to affect electron injection yield in a photovoltaic cell. The cyclic voltammetry was employed to determine the band gap of UI-5 to be 1.41 eV based on the HOMO and LUMO energy levels, which were estimated by the onset oxidation and reduction potentials. The incident monochromatic photon-to-current conversion efficiency of the UI-5 DSSC assembled with double-layer (20 nm-sized TiO{sub 2}/400 nm-sized TiO{sub 2}) film electrodes appeared lower upon overall ranges of the excitation wavelengths, but exhibited a higher value over the NIR ranges (λ = 650-700 nm) compared to the common reference sensitizer N719. The UI-5-sensitized cell yielded a relatively poor device performance with an overall conversion efficiency of 0.74% with a short circuit photocurrent density of 3.05 mA/cm2, an open circuit voltage of 0.54 mV and a fill factor of 0.44 under the standard global air mass (AM 1.5) solar conditions. However, our report about the synthesis and the photovoltaic characteristics of a porphyrin-based sensitizer in a D-π-A structure demonstrated a significant complex relationship between the sensitizer structure and the cell performance.
The ugliness-in-averageness effect: Tempering the warm glow of familiarity.
Carr, Evan W; Huber, David E; Pecher, Diane; Zeelenberg, Rene; Halberstadt, Jamin; Winkielman, Piotr
2017-06-01
Mere exposure (i.e., stimulus repetition) and blending (i.e., stimulus averaging) are classic ways to increase social preferences, including facial attractiveness. In both effects, increases in preference involve enhanced familiarity. Prominent memory theories assume that familiarity depends on a match between the target and similar items in memory. These theories predict that when individual items are weakly learned, their blends (morphs) should be relatively familiar, and thus liked-a beauty-in-averageness effect ( BiA ). However, when individual items are strongly learned, they are also more distinguishable. This "differentiation" hypothesis predicts that with strongly encoded items, familiarity (and thus, preference) for the blend will be relatively lower than individual items-an ugliness-in-averageness effect ( UiA ). We tested this novel theoretical prediction in 5 experiments. Experiment 1 showed that with weak learning, facial morphs were more attractive than contributing individuals (BiA effect). Experiments 2A and 2B demonstrated that when participants first strongly learned a subset of individual faces (either in a face-name memory task or perceptual-tracking task), morphs of trained individuals were less attractive than the trained individuals (UiA effect). Experiment 3 showed that changes in familiarity for the trained morph (rather than interstimulus conflict) drove the UiA effect. Using a within-subjects design, Experiment 4 mapped out the transition from BiA to UiA solely as a function of memory training. Finally, computational modeling using a well-known memory framework (REM) illustrated the familiarity transition observed in Experiment 4. Overall, these results highlight how memory processes illuminate classic and modern social preference phenomena. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Position in the second stage of labour and de novo onset of post-partum urinary incontinence.
Serati, Maurizio; Di Dedda, Maria Carmela; Bogani, Giorgio; Sorice, Paola; Cromi, Antonella; Uccella, Stefano; Lapenna, Martina; Soligo, Marco; Ghezzi, Fabio
2016-02-01
The aim of this study was to evaluate the role of the maternal position at the time of delivery on the onset of de novo symptoms of urinary incontinence (UI) in the post-partum period. This prospective study evaluated the data of consecutive women undergoing labour and delivery, between January 2014 and July 2014. We included only women with a singleton pregnancy undergoing vaginal delivery. During the study period, patients chose to deliver in the position that they considered the most comfortable. The onset of UI was evaluated according to the International Consultation on Incontinence Questionnaire-Short Form (ICIQ-sf). Overall, 716 primiparous women were included in the study. Sixty women refused the 12-week post-partum interview (8.4%). Women were divided in two groups: 296 women (45.1%) who chose an upright position during delivery (group 1) and 360 women (54.9%) who chose a supine position (group 2). Group 1 had a significantly lower episiotomy rate, but a higher rate of greater than second degree perineal tears. In group 1 we found a significantly lower rate of de novo UI (40.5% vs 48.9%, p = 0.03) and in particular of stress urinary incontinence. Via multivariate analysis, birth position was the only factor correlating with the occurrence of urinary incontinence in the post-partum period (OR: 1.52; 95%CI: 1.06, 2.18; p = 0.02). Upright positions at delivery are related to a lower episiotomy rate and a higher rate of greater than second degree perineal tears. Supine positions are an independent risk factor for the onset of de novo UI.
Directory of Open Access Journals (Sweden)
Patrícia Zaidan
Full Text Available Abstract Introduction: Urinary incontinence (UI after prostatectomy is difficult to treat and causes profound adverse impacts on the individual's quality of life. The main clinical treatments available for post-prostatectomy UI consist of behavioral techniques and physical therapy techniques, such as exercises, electrical stimulation and biofeedback for pelvic floor muscles (PFMs. Objective: To investigate the effectiveness of PFM exercises with or without electrical stimulation for reducing post-prostatectomy UI. Methods: We included only randomized controlled trials (RCTs which used PFM exercises with or without electrical stimulation. The search was conducted in August of 2013 in the databases of the U.S. National Library of Medicine (MEDLINE, Scientific Electronic Library Online (SciELO, Physiotherapy Evidence Database (PEDro and Virtual Health Library (VHL. We searched for RCTs published between 1999 and 2013. As keywords for our search, we used the following descriptors from the Health Sciences Descriptors (DeCS: urinary incontinence, pelvic diaphragm, prostatectomy, pelvic floor exercises, electrostimulation and electrical stimulation. We also used the following descriptors from the Medical Subject Headings (MeSH: electrical stimulation, pelvic floor, urinary incontinence, prostatectomy, physiotherapy and exercise therapy. Results: Of the 59 RCTs found, 26 were excluded as duplicates, and 28 were excluded for not displaying a minimum score of 5.0 on the PEDro Scale, which left us with five RCTs. Conclusion: PFM exercises can be effective for treating UI after radical prostatectomy, especially if begun soon after surgery. Associating electrical stimulation with PFM exercises did not show additional benefit for treating urinary incontinence. However, the selected studies presented some methodological weaknesses that may have compromised their internal validity.
Kiadaliri, A A; Uhlig, T; Englund, M
2018-01-29
To explore the burden of gout in the Nordic region, with a population around 27 million in 2015 distributed across six countries. We used the findings of the 2015 Global Burden of Diseases study to report prevalence and disability associated with gout in the Nordic region. From 1990 to 2015, the number of prevalent gout cases rose by 30% to 252 967 [95% uncertainty interval (UI) 223 478‒287 288] in the Nordic region. In 2015, gout contributed to 7982 (95% UI 5431‒10 800) years lived with disability (YLDs) in the region, an increase of 29% (95% UI 24‒35%) from 1990. While the crude YLD rate of gout increased by 12.9% (95% UI 7.8‒18.1%) between 1990 and 2015, the age-standardized YLD rate remained stable. Gout was ranked as the 63rd leading cause of total YLDs in the region in 2015, with the highest rank in men aged 55-59 years (38th leading cause of YLDs). The corresponding rank at the global level was 94. Of 195 countries studied, four Nordic countries [Greenland (2nd), Iceland (12th), Finland (14th), and Sweden (15th)] were among the top 15 countries with the highest age-standardized YLD rate of gout. The burden of gout is rising in the Nordic region. Gout's contribution to the total burden of diseases in the region is more significant than the global average. Expected increases in gout burden owing to population growth and ageing call for stronger preventive and therapeutic strategies for gout management in Nordic countries.
Application and Limitations of Nanocasting in Metal–Organic Frameworks
Energy Technology Data Exchange (ETDEWEB)
Malonzo, Camille D. [Department of Chemistry, University of Minnesota, Minneapolis, Minnesota 55455, United States; Wang, Zhao [Department of Chemistry, University of Minnesota, Minneapolis, Minnesota 55455, United States; Duan, Jiaxin [Department of Chemistry, University of Minnesota, Minneapolis, Minnesota 55455, United States; Zhao, Wenyang [Department of Chemistry, University of Minnesota, Minneapolis, Minnesota 55455, United States; Webber, Thomas E. [Department of Chemistry, University of Minnesota, Minneapolis, Minnesota 55455, United States; Li, Zhanyong [Department of Chemistry, Northwestern University, Evanston, Illinois 60208, United States; Kim, In Soo [Materials Science Division, Argonne National Laboratory, Argonne, Illinois 60439, United States; Kumar, Anurag [Department of Chemical Engineering and Materials Science, University of Minnesota, Minneapolis, Minnesota 55455, United States; Bhan, Aditya [Department of Chemical Engineering and Materials Science, University of Minnesota, Minneapolis, Minnesota 55455, United States; Platero-Prats, Ana E. [X-ray Science Division, Advanced Photon Source, Argonne National Laboratory, Argonne, Illinois 60439, United States; Chapman, Karena W. [X-ray Science Division, Advanced Photon Source, Argonne National Laboratory, Argonne, Illinois 60439, United States; Farha, Omar K. [Department of Chemistry, Northwestern University, Evanston, Illinois 60208, United States; Department of Chemistry, Faculty of Science, King Abdulaziz University, Jeddah, Saudi Arabia; Hupp, Joseph T. [Department of Chemistry, Northwestern University, Evanston, Illinois 60208, United States; Martinson, Alex B. F. [Materials Science Division, Argonne National Laboratory, Argonne, Illinois 60439, United States; Penn, R. Lee [Department of Chemistry, University of Minnesota, Minneapolis, Minnesota 55455, United States; Stein, Andreas [Department of Chemistry, University of Minnesota, Minneapolis, Minnesota 55455, United States
2018-02-12
Nanocasting can be a useful strategy to transfer the catalytic metal clusters in metal-organic frameworks (MOFs) to an all-inorganic support such as silica. The incorporation of silica in the MOF pores as a secondary support has the potential to extend the application of the highly tunable metal-based active sites in MOFs to high temperature catalysis. Here, we demonstrate the applicability of the nanocasting method to a range of MOFs that incorporate catalytically attractive hexazirconium, hexacerium, or pentanickel oxide-based clusters (UiO-66, (Ce)UiO-66, (Ce)UiO-67, (Ce)MOF-808, DUT-9, and In- and Ni-post-metalated NU-1000). We describe, in tutorial form, the challenges associated with nanocasting of MOFs that are related to their small pore size and to considerations of chemical and mechanical stability, and we provide approaches to overcome some of these challenges. Some of these nanocast materials feature the site-isolated clusters in a porous, thermally stable silica matrix, suitable for catalysis at high temperatures; in others, structural rearrangement of clusters or partial cluster aggregation occurs, but extensive aggregation can be mitigated by the silica skeleton introduced during nanocasting.
Designing algorithm visualization on mobile platform: The proposed guidelines
Supli, A. A.; Shiratuddin, N.
2017-09-01
This paper entails an ongoing study about the design guidelines of algorithm visualization (AV) on mobile platform, helping students learning data structures and algorithm (DSA) subject effectively. Our previous review indicated that design guidelines of AV on mobile platform are still few. Mostly, previous guidelines of AV are developed for AV on desktop and website platform. In fact, mobile learning has been proved to enhance engagement in learning circumstances, and thus effect student's performance. In addition, the researchers highly recommend including UI design and Interactivity in designing effective AV system. However, the discussions of these two aspects in previous AV design guidelines are not comprehensive. The UI design in this paper describes the arrangement of AV features in mobile environment, whereas interactivity is about the active learning strategy features based on learning experiences (how to engage learners). Thus, this study main objective is to propose design guidelines of AV on mobile platform (AVOMP) that entails comprehensively UI design and interactivity aspects. These guidelines are developed through content analysis and comparative analysis from various related studies. These guidelines are useful for AV designers to help them constructing AVOMP for various topics on DSA.
International Nuclear Information System (INIS)
Li Huanbin; Zhang Qi; Wang Ling; Wu Shixiu; Xie Congying
2006-01-01
Objective: To study the uptake and excretion function of parotid by radionuclide imaging after simultaneous modulated accelerated radiation therapy (SMART) in nasopharyngeal cancer. Methods: Forty-eight nasopharyngeal cancer cases, 38 of them were treated by SMART with 2.5 Gy/fraction at tumor and enlarged lymph node to a total dose of 70 Gy, and 2.0 Gy/fraction at subclinical foci and prophy laxtic area volume to a total dose of 56 Gy in 38 d. The other 10 cases were treated by traditional radiation therapy (RT). After treatment, all patients performed parotid imaging and both uptake index (UI) and excretion index (EI) after acid stimulation were calculated. Clinical manifestation such as grade of mouth dryness was also analyzed. Results: Average UI and EI in SMART group decreased 21.9% and 37.3% respectively, with 12 cases moderate and severe mouth dryness, whereas in traditional RT group, mean UI and El decreased 56.1% and 96.1% respectively, with 9 cases moderate and severe mouth dryness. There was significant difference between them (P<0.05). Conclusion: Parotid imaging is sensitive for monitoring parotid function, and it is also reliable to evaluate the safety of SMART to parotid.. (authors)
Augmented reality user interface for mobile ground robots with manipulator arms
Vozar, Steven; Tilbury, Dawn M.
2011-01-01
Augmented Reality (AR) is a technology in which real-world visual data is combined with an overlay of computer graphics, enhancing the original feed. AR is an attractive tool for teleoperated UGV UIs as it can improve communication between robots and users via an intuitive spatial and visual dialogue, thereby increasing operator situational awareness. The successful operation of UGVs often relies upon both chassis navigation and manipulator arm control, and since existing literature usually focuses on one task or the other, there is a gap in mobile robot UIs that take advantage of AR for both applications. This work describes the development and analysis of an AR UI system for a UGV with an attached manipulator arm. The system supplements a video feed shown to an operator with information about geometric relationships within the robot task space to improve the operator's situational awareness. Previous studies on AR systems and preliminary analyses indicate that such an implementation of AR for a mobile robot with a manipulator arm is anticipated to improve operator performance. A full user-study can determine if this hypothesis is supported by performing an analysis of variance on common test metrics associated with UGV teleoperation.
Burkin, M A; Gal'vidis, I A; Iakovleva, I V; Sviridov, V V
2007-01-01
Immunization of BALB/c mice by horse antiserum against diphtheria made it possible to obtain IgG1 monoclonal antibodies (MoAbs) 2B7E4 specific for light chains of horse immunoglobulin (Ig). Unlike commercial preparations of anti-horse immunoglobulin antibodies, which are specific for the whole Ig molecule or its Fc-fragment, the peroxidase (HRP) conjugate of the MoAb, 2B7E4-HRP did not interact with human, mouse, rabbit, and sheep Igs, or horse albumin. The conjugate obtained was used with MoAbs against bacterial toxins and commercial horse anatoxins, as a universal reagent in sandwich enzyme immunoassay (ELISA) for bacterial toxins and anatoxins. The detection sensitivity of diphtheria toxin/anatoxin equaled 0.0005 Lf/ml; tetanus toxin and anatoxin were detected with sensitivities of 20 LD50/ml and 0.005 UI/ml, respectively. A similar sandwich ELISA for botulinum anatoxins (group measurement) allowed types A, B, and E to be detected at 0.02, 0.002, and 0.001 UI/ml, respectively; selective measurement was only possible in the case of type E anatoxin (0.001 UI/ml).
Ultra-Fast Degradation of Chemical Warfare Agents Using MOF-Nanofiber Kebabs.
Zhao, Junjie; Lee, Dennis T; Yaga, Robert W; Hall, Morgan G; Barton, Heather F; Woodward, Ian R; Oldham, Christopher J; Walls, Howard J; Peterson, Gregory W; Parsons, Gregory N
2016-10-10
The threat associated with chemical warfare agents (CWAs) motivates the development of new materials to provide enhanced protection with a reduced burden. Metal-organic frame-works (MOFs) have recently been shown as highly effective catalysts for detoxifying CWAs, but challenges still remain for integrating MOFs into functional filter media and/or protective garments. Herein, we report a series of MOF-nanofiber kebab structures for fast degradation of CWAs. We found TiO 2 coatings deposited via atomic layer deposition (ALD) onto polyamide-6 nanofibers enable the formation of conformal Zr-based MOF thin films including UiO-66, UiO-66-NH 2 , and UiO-67. Cross-sectional TEM images show that these MOF crystals nucleate and grow directly on and around the nanofibers, with strong attachment to the substrates. These MOF-functionalized nanofibers exhibit excellent reactivity for detoxifying CWAs. The half-lives of a CWA simulant compound and nerve agent soman (GD) are as short as 7.3 min and 2.3 min, respectively. These results therefore provide the earliest report of MOF-nanofiber textile composites capable of ultra-fast degradation of CWAs. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Missile Liquid Propellant Systems Maintenance. AFS 445X1.
1981-06-01
4 bf~~ II It - S .. Ui0 j lt 1 1 I I . ,. 1111 ,w I,,,Q , . S0 111 S01111 1 1 60 1 I ’m 041 w0 UI I It I 45w IV taZ& 4140 A, : :wt xi Z Z 1 ww .1...0 6 0 a 0- Jewe ~ l .8 2~ I- sca4 a - 0 I,01 04 ~ ~ ~ P .A0 3~ W 40 * 2 U £ WIa -00 1 t - 0 a* d . 0 ~ 4 A- aiSI so a-- r.a 0W 01 P - At0 i4 Im a-I
A note on subtrees rooted along the primary path of a binary tree
Troutman, B.M.; Karlinger, M.R.
1993-01-01
Let Fn denote the set of rooted binary plane trees with n external nodes, for given T???Fn let ui(T) be the altitude i node along the primary path of T, and let ??i(T) denote the number of external nodes in the induced subtree rooted at ui(T). We set ??i(T) = 0 if i is greater than the length of the primary path of T. We prove limn?????? ???i???x/n En{??i}/???i?? En{??i} = G(x), where En denotes the average over trees T???Fn and where the distribution function G is determined by its moments, for which we present an explicit expression. ?? 1993.
ORF Alignment: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available uis str. SC-B67] ... Length = 155 ... Query: 3 ... KILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMP...PEIFAKAGGKTQNAPVAT 62 ... KILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGKTQNAPVAT ...Sbjct: 1 ... KILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGKTQNAPVAT 60 ... Query: 123 ATTIAGGDGSRQPSQEELSIA