Challenges to and proposals for underground gas storage (UGS business in China
Directory of Open Access Journals (Sweden)
Gangxiong Zhang
2017-05-01
Full Text Available Underground gas storage (UGS is one of the major storage and peak-shaving means in the world among numerous storage ways via gas fields, small-scale LNG, etc. With the rapid development of natural gas industry in China, the seasonal peak-shaving issues are increasingly prominent, so how to achieve sustainable development of UGS business has become a major problem at present. In view of this, we studied the present status and trend of UGS development abroad and analyzed the following challenges encountered by UGS in China. (1 UGS construction falls behind the world and peak-shaving capacity is insufficient. (2 There is lack of quality gas sources for storage and the complicated geological conditions make the cost of UGS construction high. (3 UGS construction is still at the preliminary stage, so experience is not enough in safety and scientific operation and management. (4 UGS construction, management and operation are not unified as a whole, so its maximum efficiency fails to be exerted. (5 The economic benefit of UGS is difficult to be shown without independent cost accounting. Based on the experience of other countries, some proposals were put forward on UGS development under the actual present situation: to strengthen strategic UGS layout, intensify storage site screening in key areas and steadily promote UGS construction; to establish professional UGS technical and management teams and intensify the research of key technologies; and to set up a complete and rationally-distributed UGS construction, operation and management system.
ASDEX-UG. ASDEX upgrade project proposal. Phase 2
International Nuclear Information System (INIS)
1983-05-01
The objective of ASDEX UG is to investigate the problems relating to tokamak divertor physics and the boundary layer of hot plasmas which cannot be covered otherwise by either ASDEX or other EUROPEAN tokamaks, including JET, but whose investigation is indispensable for NET and INTOR. The configuration of ASDEX UG is changed as compared with ASDEX due to the requirement that all poloidal field coils are located outside the toroidal field magnet. This leads to a highly elongated D-shaped plasma with an ''open'' divertor, which does not allow to close the divertor chamber by such simple means as in ASDEX. In section 2, the aims of ASDEX UG are repeated briefly and the essential features and parameters of the tokamak system are summarized. The summary includes an overview of the tokamak design, the time schedule of design and construction concluding with the estimated investment cost and manpower required. In section 3 the tokamak system components are treated. The circuits and energy supply for the different electrical components are described in section 4. Auxiliary heating requirements and methods are discussed in section 5. Section 6 presents a survey over the periphery of the tokamak system including preparation of the building and radiation shielding. Section 7 outlines the physical programme. Section 8 is devoted to diagnostics. Finally, the principal concepts for control, data acquisition and handling are outlined in section 9. (orig./AH)
46 CFR 54.01-35 - Corrosion (modifies UG- 25).
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Corrosion (modifies UG- 25). 54.01-35 Section 54.01-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING PRESSURE VESSELS General Requirements § 54.01-35 Corrosion (modifies UG- 25). (a) Vessels or portions of vessels subject to...
Applications of Universal Grammar (UG) in the ESL/EFL Classroom
Kirkwold, Lorne O.
2007-01-01
The article proposes Stern's (1983) framework for classifying issues related to instruction in order to ascertain the relevance of Universal Grammar (UG) in the ESL/EFL classroom. Discussed in this article, particularly as UG pertains to them, are issues related to: (a) L1 transfer; (b) teaching rules and giving error correction versus presenting…
46 CFR 54.10-10 - Standard hydrostatic test (modifies UG-99).
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Standard hydrostatic test (modifies UG-99). 54.10-10... PRESSURE VESSELS Inspection, Reports, and Stamping § 54.10-10 Standard hydrostatic test (modifies UG-99). (a) All pressure vessels shall satisfactorily pass the hydrostatic test prescribed by this section...
Creation of second order magnetic barrier inside chaos created by NTMs in the ASDEX UG
Ali, Halima; Punjabi, Alkesh
2012-10-01
Understanding and stabilization of neoclassical tearing modes (NTM) in tokamaks is an important problem. For low temperature plasmas, tearing modes are believed to be mainly driven by current density gradient. For collisionless plasmas, even when plasma is stable to classical tearing modes, helical reduction in bootstrap current in O-point of an island can destabilize NTMs when an initial island is seeded by other global MHD instabilities or when microturbulence triggers the transition from a linear to nonlinear instability. The onset of NTMs leads to the most serious beta limit in ASDEX UG tokamak [O. Gubner et al 2005 NF 39 1321]. The important NTMs in the ASDDEX UG are (m,n)=(3,2)+(4,3)+(1,1). Realistic parameterization of these NTMs and the safety factor in ASDEX UG are given in [O. Dumbrajs et al 2005 POP 12 1107004]. We use a symplectic map in magnetic coordinates for the ASDEX UG to integrate field lines in presence of the NTMs. We add a second order control term [H. Ali and A. Punjabi 2007 PPCF 49 1565] to this ASDEX UG field line Hamiltonian to create an invariant magnetic surface inside the chaos generated by the NTMs. The relative strength, robustness, and resilience of this barrier are studied to ascertain the most desirable noble barrier in the ASDEX UG with NTMs. We present preliminary results of this work, and discuss its implications with regard to magnetic transport barriers for increasing strength of magnetic perturbations. This work is supported by the grants DE-FG02-01ER54624 and DE-FG02-04ER54793.
Noble magnetic barriers in the ASDEX UG tokamak
Ali, Halima; Punjabi, Alkesh; Vazquez, Justin
2010-02-01
The second-order perturbation method of creating invariant tori inside chaos in Hamiltonian systems (Ali, H.; Punjabi, A. Plasma Phys. Contr. F. 2007, 49, 1565-1582) is applied to the axially symmetric divertor experiment upgrade (ASDEX UG) tokamak to build noble irrational magnetic barriers inside chaos created by resonant magnetic perturbations (m, n)=(3, 2)+(4, 3), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation. The radial dependence of the Fourier modes is ignored. The modes are considered to be locked and have the same amplitude δ. A symplectic mathematical mapping in magnetic coordinates is used to integrate magnetic field line trajectories in the ASDEX UG. Tori with noble irrational rotational transform are the last ones to be destroyed by perturbation in Hamiltonian systems. For this reason, noble irrational magnetic barriers are built inside chaos, and the strongest noble irrational barrier is identified. Three candidate locations for the strongest noble barrier in ASDEX UG are selected. All three candidate locations are chosen to be roughly midway between the resonant rational surfaces ψ32 and ψ43. ψ is the magnetic coordinate of the flux surface. The three candidate surfaces are the noble irrational surfaces close to the surface with q value that is a mediant of q=3/2 and 4/3, q value of the physical midpoint of the two resonant surfaces, and the q value of the surface where the islands of the two perturbing modes just overlap. These q values of the candidate surfaces are denoted by q MED, q MID, and q OVERLAP. The strongest noble barrier close to q MED has the continued fraction representation (CFR) [1;2,2,1∞] and exists for δ≤2.6599×10-4; the strongest noble barrier close to q MID has CFR [1;2,2,2,1∞] and exists for δ≤4.6311×10-4; and the strongest noble barrier close to q OVERLAP has CFR [1;2,2,6,2,1∞] and exists for δ≤1.367770×10-4. From these results, the strongest
The Development of “Eldo Ngano 1”: The World’s World’s First Ug99 Resistant Mutant Wheat Variety
International Nuclear Information System (INIS)
Forster, Brian P.
2014-01-01
The wheat black stem rust disease is a virulent race of fungus, Puccinia graminis, which affects wheat plants and is caused by a strain of fungus known as Ug99. Named for its place and year of origin, Ug99 was first discovered on wheat in Uganda in 1999. The spores of this plant disease are airborne and can be easily spread by wind. If not prevented, the disease can destroy 70 to 100 per cent of the yield of wheat crops. Annually on average 8.3 million tonnes of wheat grain is lost to this disease, costing US $1.23 billion per year. Ethiopia, Kenya and Uganda are hot spots for this disease. In 2009, growing international concern regarding the horrific impact of Ug99 on wheat led to the establishment of IAEA project INT/5/150, Responding to the Transboundary Threat of Wheat Black Stem Rust (Ug99). This project has involved over 18 countries and 5 national and international institutions, and examined possible mutation induction treatments to deal with the challenges posed by Ug99. Meetings and workshops to facilitate the project efforts have been held in Kenya and Turkey. Ug99 continues to spread globally and has now reached the Islamic Republic of Iran. There are also reports of suspected disease occurrences in Europe. It is essential that work continues on developing mutant lines for further crop protection that can be utilized worldwide to safeguard the wheat crop from this devastating disease
Analytical Review of Universal Grammar (UG) Approach on Second Language Acquisition (SLA)
Irwandy
2015-01-01
The aim of this paper is to explore the analysis of Universal Grammar (UG) approach on Second Language Acquisition (SLA). This paper is significant as the sources for teacher or researcher of the second language since this elaboration is deeply focusing on the use of UG on SLA. The method used in this academic writing is inductive method of…
Putting Ug99 on the map: An update on current and future monitoring
DEFF Research Database (Denmark)
Hodson, D P; Nazari, K; Park, R F
2011-01-01
Detection of stem rust race TTKSK (Ug99) from Uganda in 1998/99 highlighted not only the extremely high vulnerability of the global wheat crop to stem rust but also a lack of adequate global systems to monitor such a threat. Progress in the development and expansion of the Global Cereal Rust...... Monitoring System (GCRMS) is described. The current situation regarding the Ug99 lineage of races is outlined and the potential for expansion into important wheat areas is considered. The GCRMS has successfully tracked the spread and changes that are occurring within the Ug99 lineage and is now well...... capacity for race analysis is seen to be critical and integration of the Global Rust Reference Centre into the stem rust monitoring network is seen as a positive development. The current acute situation with severe epidemics of stripe rust in many countries indicates a clear need for more effective global...
Rachunek kosztów działańjako podstawa wyceny usług
Directory of Open Access Journals (Sweden)
Gertruda Krystyna Świderska
2009-03-01
Full Text Available Artykuł prezentuje wykorzystanie rachunku kosztów działań do wyceny usług na trzech rynkach podlegających centralnym regulacjom – rynku usług pocztowych, telekomunikacyjnych oraz świadczeń zdrowotnych. Doświadczenia krajów Unii Europejskiej (w tym Polski pokazują nowe obszary wykorzystania rachunku kosztów działań. Potwierdzają, że zastosowanie tego narzędzia pozwala na kontrolę kosztów ponoszonych przy świadczeniu usług oraz wycenę na podstawie rzeczywistego rachunku ekonomicznego. Takie podejście gwarantuje przejrzystość procesu wyceny na rynkach, na których odgrywa to szczególnie istotną rolę. W części pierwszej przedstawiono zarys koncepcji rachunku kosztów działań wykorzystanej w PPUP Poczta Polska. Scharakteryzowano zastosowane rozwiązanie dostosowane do specyfiki działań poczty, zawierające elementy obiektowego rachunku kosztów działań oraz rachunku kosztów działań sterowanego czasem. W części drugiej zaprezentowano zastosowanie koncepcji rachunku kosztów działań do wyceny świadczonych usług w British Telecom. Wykorzystanie właściwych nośników kosztów pozwala na prawidłowe przypisanie kosztów obiektom je generującym. W części trzeciej opisano doświadczenia krajów Unii Europejskiej w zakresie stosowania rachunku kosztów działań do wyceny świadczeń medycznych. Stanowią one przesłankę dla wdrożenia tej koncepcji do wyceny usług zdrowotnych na rynku polskim.
International Nuclear Information System (INIS)
Strudwick, R.M.; Taylor, K.
2017-01-01
Introduction: How mammography is incorporated into undergraduate (UG) radiography training may influence student perception of the speciality and its potential as a future career option. An overview is provided of the academic and clinical content of UG radiography courses relating to mammography across the UK. Methods: Using mixed methods and an iterative, inductive approach supplying quantitative and qualitative data, we identify any variations and discuss possible causes which may help influence future training strategies. A self-designed questionnaire containing open and closed questions was sent online using SurveyMonkey™ to course leaders of all Higher Education Institutions (HEIs) offering BSc (Hons) Diagnostic Radiography courses in the UK. Responses were analysed for trends which were further explored by semi structured telephone interviews. These were transcribed and evaluated using a thematic analysis, the themes being categorised and coded. Results: 19 of 24 (79%) HEIs responded to the questionnaire. Follow up telephone interviews were conducted with five course leaders to further explore themes. Academic teaching ranged from 3 to 25 h over the 3 year course. Compared to other specialities 10 (53%) HEIs spent less time on mammography with 12 (63%) citing HCPC standards as the reason. 11 (65%) HEIs sent students on mammography placements, 2 (12%) sent females only. Placement times ranged between 2 days and 2 weeks. Influences included availability of expert teaching and relationship with clinical departments. Conclusion: There is variation in undergraduate exposure to mammography. Students views should be sought to add validity to these findings - Highlights: • A summary of undergraduate (UG) breast imaging in the UK. • Themes around the delivery of UG breast imaging education in university and practice. • Opinions of UG course leaders and other stakeholders about UG breast imaging education. • There is a variation across UK universities in
Berent, Iris
2016-01-01
Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett's concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett's logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett's arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett's arguments hardly undermine the viability of this hypothesis.
Berent, Iris
2016-01-01
Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett’s concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett’s logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett’s arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett’s arguments hardly undermine the viability of this hypothesis. PMID:27471480
The Puccinia graminis f. sp. tritici (Pgt) Ug99 race group is virulent to most stem rust resistance genes currently deployed in wheat and poses a serious threat to global wheat production. The durum wheat (Triticum turgidum ssp. durum) gene Sr13 confers resistance to Ug99 in addition to virulent rac...
DEFF Research Database (Denmark)
Akbari, Mansour; Otterlei, Marit; Pena Diaz, Javier
2004-01-01
Nuclear uracil-DNA glycosylase UNG2 has an established role in repair of U/A pairs resulting from misincorporation of dUMP during replication. In antigen-stimulated B-lymphocytes UNG2 removes uracil from U/G mispairs as part of somatic hypermutation and class switch recombination processes. Using......, PCNA and DNA ligase, the latter detected as activity. Short-patch repair was the predominant mechanism both in extracts and UNG2-ARC from proliferating and less BER-proficient growth-arrested cells. Repair of U/G mispairs and U/A pairs was completely inhibited by neutralizing UNG...
Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows
International Nuclear Information System (INIS)
Osborne, P.E.
2002-01-01
The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of 233 U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF 6 and subsequent steam treatments of UO 2 F 2 . For each mole of UF 6 converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance
Directory of Open Access Journals (Sweden)
Jayaveeramuthu Nirmala
2017-10-01
Full Text Available Wheat stem rust, caused by Puccinia graminis f. sp. tritici Eriks. & E. Henn, can incur yield losses in susceptible cultivars of durum wheat, Triticum turgidum ssp. durum (Desf. Husnot. Although several durum cultivars possess the stem rust resistance gene Sr13, additional genes in durum wheat effective against emerging virulent races have not been described. Durum line 8155-B1 confers resistance against the P. graminis f. sp. tritici race TTKST, the variant race of the Ug99 race group with additional virulence to wheat stem rust resistance gene Sr24. However, 8155-B1 does not confer resistance to the first-described race in the Ug99 race group: TTKSK. We mapped a single gene conferring resistance in 8155-B1 against race TTKST, Sr8155B1, to chromosome arm 6AS by utilizing Rusty/8155-B1 and Rusty*2/8155-B1 populations and the 90K Infinium iSelect Custom bead chip supplemented by KASP assays. One marker, KASP_6AS_IWB10558, cosegregated with Sr8155B1 in both populations and correctly predicted Sr8155B1 presence or absence in 11 durum cultivars tested. We confirmed the presence of Sr8155B1 in cultivar Mountrail by mapping in the population Choteau/Mountrail. The marker developed in this study could be used to predict the presence of resistance to race TTKST in uncharacterized durum breeding lines, and also to combine Sr8155B1 with resistance genes effective to Ug99 such as Sr13. The map location of Sr8155B1 cannot rule out the possibility that this gene is an allele at the Sr8 locus. However, race specificity indicates that Sr8155B1 is different from the known alleles Sr8a and Sr8b.
Naseem, Saadia; Winter, Stephan
2016-01-01
The quantity of genomic DNA-A and DNA-B of African cassava mosaic virus (ACMV) and East African cassava mosaic virus Uganda (Uganda variant, EACMV-UG) was analysed using quantitative PCR to assess virus concentrations in plants from susceptible and tolerant cultivars. The concentrations of genome components in absolute and relative quantification experiments in single and mixed viral infections were determined. Virus concentration was much higher in symptomatic leaf tissues compared to non-symptomatic leaves and corresponded with the severity of disease symptoms. In general, higher titres were recorded for EACMV-UG Ca055 compared to ACMV DRC6. The quantitative assessment also showed that the distribution of both viruses in the moderately resistant cassava cv. TMS 30572 was not different from the highly susceptible cv. TME 117. Natural mixed infections with both viruses gave severe disease symptoms. Relative quantification of virus genomes in mixed infections showed higher concentrations of EACMV-UG DNA-A compared to ACMV DNA-A, but a marked reduction of EACMV-UG DNA-B. The higher concentrations of EACMV-UG DNA-B compared to EACMV DNA-A accumulation in single infections were consistent. Since DNA-B is implicated in virus cell-to-cell spread and systemic movement, the abundance of the EACMV-UG DNA-B may be an important factor driving cassava mosaic disease epidemic. Copyright © 2015 Elsevier B.V. All rights reserved.
Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows
Energy Technology Data Exchange (ETDEWEB)
Osborne, P.E.
2002-09-11
The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of {sup 233}U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF{sub 6} and subsequent steam treatments of UO{sub 2}F{sub 2}. For each mole of UF{sub 6} converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance.
Targeted introgression of stem rust Ug99 resistance from wheatgrasses into pasta and bread wheat
In the past 50 years, a number of stem rust resistance (Sr) genes have been transferred from several wheat-related grasses into durum (i.e. pasta) and bread wheat through chromosome translocations and additions. To utilize these genes for controlling the Ug99 races of the stem rust pathogen, we ini...
Resistance to stem rust Ug99 in six bread wheat cultivars maps to chromosome 6DS.
Lopez-Vera, Eric E; Nelson, Sarah; Singh, Ravi P; Basnet, Bhoja R; Haley, Scott D; Bhavani, Sridhar; Huerta-Espino, Julio; Xoconostle-Cazares, Beatriz G; Ruiz-Medrano, Roberto; Rouse, Matthew N; Singh, Sukhwinder
2014-01-01
Identified SSR markers ( Xcfd49 and Xbarc183 ) linked with stem rust resistance for efficient use in marker-assisted selection and stacking of resistance genes in wheat breeding programs. More than 80 % of the worldwide wheat (Triticum aestivum L.) area is currently sown with varieties susceptible to the Ug99 race group of stem rust fungus. However, wheat lines Niini, Tinkio, Coni, Pfunye, Blouk, and Ripper have demonstrated Ug99 resistance at the seedling and adult plant stages. We mapped stem rust resistance in populations derived from crosses of a susceptible parent with each of the resistant lines. The segregation of resistance in each population indicated the presence of a single gene. The resistance gene in Niini mapped to short arm of chromosome 6D and was flanked by SSR markers Xcfd49 at distances of 3.9 cM proximal and Xbarc183 8.4 cM distal, respectively. The chromosome location of this resistance was validated in three other populations: PBW343/Coni, PBW343/Tinkio, and Cacuke/Pfunye. Resistance initially postulated to be conferred by the SrTmp gene in Blouk and Ripper was also linked to Xcfd49 and Xbarc183 on 6DS, but it was mapped proximal to Xbarc183 at a similar position to previously mapped genes Sr42 and SrCad. Based on the variation in diagnostic marker alleles, it is possible that Niini and Pfunye may carry different resistance genes/alleles. Further studies are needed to determine the allelic relationships between various genes located on chromosome arm 6DS. Our results provide valuable molecular marker and genetic information for developing Ug99 resistant wheat varieties in diverse germplasm and using these markers to tag the resistance genes in wheat breeding.
Vazquez, Justin; Ali, Halima; Punjabi, Alkesh
2009-11-01
Ciraolo, Vittot and Chandre method of building invariant manifolds inside chaos in Hamiltonian systems [Ali H. and Punjabi A, Plasma Phys. Control. Fusion, 49, 1565--1582 (2007)] is used in the ASDEX UG tokamak. In this method, a second order perturbation is added to the perturbed Hamiltonian [op cit]. It creates an invariant torus inside the chaos, and reduces the plasma transport. The perturbation that is added to the equilibrium Hamiltonian is at least an order of magnitude smaller than the perturbation that causes chaos. This additional term has a finite, limited number of Fourier modes. Resonant magnetic perturbations (m,n) = (3,2)+(4,3) are added to the field line Hamiltonian for the ASDEX UG. An area-preserving map for the field line trajectories in the ASDEX UG is used. The common amplitude δ of these modes that gives complete chaos between the resonant surfaces ψ43 and ψ32 is determined. A magnetic barrier is built at a surface with noble q that is very nearly equals to the q at the physical midpoint between the two resonant surfaces. The maximum amplitude of magnetic perturbation for which this barrier can be sustained is determined. This work is supported by US Department of Energy grants DE-FG02-07ER54937, DE-FG02-01ER54624 and DE-FG02-04ER54793.
Wheat stem rust (Puccinia graminis f. sp. tritici Eriks. and E. Henn.) is one of the most destructive diseases world-wide. Races belonging to Ug99 (or TTKSK) continue to cause crop losses in East Africa and threaten global wheat production. Developing and deploying wheat varieties with multiple race...
Wheat production is threatened by the disease stem rust, which is caused by the biotrophic fungal pathogen Puccinia graminis Pers.:Pers. f. sp. tritici (Pgt). Among all known Pgt races, TTKSK (Ug99) and TRTTF are significant threats to North American wheat production due to their virulence against f...
The strongest magnetic barrier in the DIII-D tokamak and comparison with the ASDEX UG
Ali, Halima; Punjabi, Alkesh
2013-05-01
Magnetic perturbations in tokamaks lead to the formation of magnetic islands, chaotic field lines, and the destruction of flux surfaces. Controlling or reducing transport along chaotic field lines is a key challenge in magnetically confined fusion plasmas. A local control method was proposed by Chandre et al. [Nucl. Fusion 46, 33-45 (2006)] to build barriers to magnetic field line diffusion by addition of a small second-order control term localized in the phase space to the field line Hamiltonian. Formation and existence of such magnetic barriers in Ohmically heated tokamaks (OHT), ASDEX UG and piecewise analytic DIII-D [Luxon, J.L.; Davis, L.E., Fusion Technol. 8, 441 (1985)] plasma equilibria was predicted by the authors [Ali, H.; Punjabi, A., Plasma Phys. Control. Fusion 49, 1565-1582 (2007)]. Very recently, this prediction for the DIII-D has been corroborated [Volpe, F.A., et al., Nucl. Fusion 52, 054017 (2012)] by field-line tracing calculations, using experimentally constrained Equilibrium Fit (EFIT) [Lao, et al., Nucl. Fusion 25, 1611 (1985)] DIII-D equilibria perturbed to include the vacuum field from the internal coils utilized in the experiments. This second-order approach is applied to the DIII-D tokamak to build noble irrational magnetic barriers inside the chaos created by the locked resonant magnetic perturbations (RMPs) (m, n)=(3, 1)+(4, 1), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation with amplitude δ. A piecewise, analytic, accurate, axisymmetric generating function for the trajectories of magnetic field lines in the DIII-D is constructed in magnetic coordinates from the experimental EFIT Grad-Shafranov solver [Lao, L, et al., Fusion Sci. Technol. 48, 968 (2005)] for the shot 115,467 at 3000 ms in the DIII-D. A symplectic mathematical map is used to integrate field lines in the DIII-D. A numerical algorithm [Ali, H., et al., Radiat. Eff. Def. Solids Inc. Plasma Sc. Plasma Tech. 165, 83
Energy Technology Data Exchange (ETDEWEB)
Focke, H.; Brueggmann, R.; Mende, F.; Steinkraus, D.; Wauer, R. [BEB Erdgas und Erdoel GmbH, Hannover (Germany)
1998-12-31
The article describes the concepts of the plants and equipment and the specific features of the underground storage at Uelsen. The underground storage will be purpose-built as an H-gas storage in a nearly depleted sandstone deposit. At a nominal deliverability of 250.000 cubic m/h (Vn) the storage at Uelsen has more potential for expansion. This potential was taken into account by designing appropriate pressure stages, capacities, performance characteristics and space. (orig.). [Deutsch] Die nachfolgende Veroeffentlichung stellt das anlagentechnische Grundkonzept und die spezifischen Besonderheiten des UGS Uelsen dar. Der im suedwestlichen Niedersachsen als H-Gasspeicher in einer nahezu ausgefoerderten Buntsandsteinlagerstaette eingerichtete UGS Uelsen wird in mehreren Ausbaustufen bedarfsgerecht fertiggestellt. Bei einer Nennentnahmekapazitaet von 450.000 m{sup 3}/h (Vn) und einer Nenninjektionsleistung von 250.000 m{sup 3}/h (Vn) weist der UGS Uelsen noch weiteres Potential fuer Erweiterungen auf. Dieses Ausbaupotential wurde bei der Planung und dem Bau der bestehenden Anlagen durch Festlegung entsprechender Druckstufen, Kapazitaeten, Leistungsgroessen und Platzanordnungen beruecksichtigt. (orig.)
Eijk, A.; Lange, D. de; Maljaars, J.; Tenbrock-Ingenhorst, A.; Gottmer, A.
2014-01-01
Two large identical 6-cylinder Ariel JGB/6 reciprocating compressors each of 7.5 MW, are used for an underground gas storage system (UGS) plant of RWE Gasspeicher GmbH located in Epe, Germany. The system is in operation since 2005. In 2011 several internals parts (baffle plates and baffle choke
Problems of Gas Pressure Build-up in Casing String of UGS and Gas Wells
Directory of Open Access Journals (Sweden)
Peter Sovius
2006-10-01
Full Text Available This paper consists of three basic parts. The opening part is a brief description of problems associated with the secondary untightness of UGS wells (Underground Gas Storages and gas wells generally.The main part of the paper is composed of some cases that we have met in our company. Solution proposals of various cases are also supplied in this part. Separate problem situations are described in terms of finding out an untight point and also a testing result and consequential removing of untightness.The conclusion includes knowledge summary that were taken by solution of complicatedsituations connected with well non-hermeticity.
Geology of the U12n.07 UG-3 drill hole, area 12, Nevada Test Site
International Nuclear Information System (INIS)
Terry, S.S.; Cunningham, M.J.
1975-11-01
The U12n.07 UG-3 horizontal drill hole, located near the eastern edge of the center of Rainier Mesa, Nevada Test Site, was drilled to a total depth of 809 m (2,653 ft). This hole was drilled to further evaluate the tunnel-level stratigraph, and structure southwest of the U12n tunnel complex. The drill hole is collared in the middle of Tertiary tunnel bed 3A and penetrates upsection through tunnel beds 3 and 4 and terminates in subunit 4K, all of Tertiary age. Stratigraphy, structure, engineering geology, and physical properties and their relation to tunnel engineering are discussed
Mapping resistance to the Ug99 race group of the stem rust pathogen in a spring wheat landrace.
Babiker, E M; Gordon, T C; Chao, S; Newcomb, M; Rouse, M N; Jin, Y; Wanyera, R; Acevedo, M; Brown-Guedira, G; Williamson, S; Bonman, J M
2015-04-01
A new gene for Ug99 resistance from wheat landrace PI 374670 was detected on the long arm of chromosome 7A. Wheat landrace PI 374670 has seedling and field resistance to stem rust caused by Puccinia graminis f. sp tritici Eriks. & E. Henn (Pgt) race TTKSK. To elucidate the inheritance of resistance, 216 BC1F2 families, 192 double haploid (DH) lines, and 185 recombinant inbred lines (RILs) were developed by crossing PI 374670 and the susceptible line LMPG-6. The parents and progeny were evaluated for seedling resistance to Pgt races TTKSK, MCCFC, and TPMKC. The DH lines were tested in field stem rust nurseries in Kenya and Ethiopia. The DH lines were genotyped with the 90K wheat iSelect SNP genotyping platform. Goodness-of-fit tests indicated that a single dominant gene in PI 374670 conditioned seedling resistance to the three Pgt races. The seedling resistance locus mapped to the long arm of chromosome 7A and this result was verified in the RIL population screened with the flanking SNP markers using KASP assays. In the same region, a major QTL for field resistance was detected in a 7.7 cM interval and explained 34-54 and 29-36% of the variation in Kenya and Ethiopia, respectively. Results from tests with specific Pgt races and the csIH81 marker showed that the resistance was not due to Sr22. Thus, a new stem rust resistance gene or allele, either closely linked or allelic to Sr15, is responsible for the seedling and field resistance of PI 374670 to Ug99.
Directory of Open Access Journals (Sweden)
Piotr Karwasiński
2015-12-01
Full Text Available W artykule omówiono zagadnienia związane z procesami informatyzacji Biblioteki Uniwersyteckiej w Poznaniu. W celu dokładnego scharakteryzowania przemian, prócz rysu historycznego, przedstawiono obszary, które wyraźnie poprawiły jakość pracy personelu i obsługę czytelników oraz przyczyniły się do poznania, upowszechniania i wdrażania nowoczesnych rozwiązań technologicznych. Zaprezentowano proces zmian w zakresie funkcjonowania systemu biblioteczno-informacyjnego Horizon i współpracy z narodowym katalogiem centralnym NUKAT. Opisano etapy rozwoju elektronicznej przestrzeni informacyjnej, w tym budowania elektronicznych zasobów wiedzy i tworzenia narzędzi do ich obsługi i wykorzystania w procesach wyszukiwania źródeł informacji. Zaprezentowano Bibliotekę Uniwersytecką jako partnera w aranżowaniu instytucjonalnych platform cyfrowych do deponowania i udostępniania dorobku intelektualnego społeczności naukowej Uniwersytetu im. Adama Mickiewicza w Poznaniu. Wskazano także funkcjonalność zaprojektowanych i wdrożonych innowacyjnych usług wirtualnych pakietu Libsmart, optymalizujących funkcjonowanie Biblioteki Uniwersyteckiej.
New Seeds are Resistant to Wheat Stem Rust (Ug99) Multinational Programme Supported by FAO and IAEA
International Nuclear Information System (INIS)
2013-01-01
Full text: A multinational effort supported by the International Atomic Energy Agency and the U.N. Food and Agriculture Organization marked a key milestone this week when a Kenyan university debuted two new varieties of disease-resistant wheat to the nation's farmers. Over the past two days, thousands of Kenyan farmers have visited Eldoret University in western Kenya for a two-day agriculture fair highlighting the latest farming technologies. Supporting the development of the new varieties were the IAEA's Technical Cooperation Department and the Joint FAO/IAEA Programme of Nuclear Techniques in Food and Agriculture. They manage an interregional Technical Cooperation project to develop varieties of wheat that are resistant to a devastating type of fungus, causing a disease known as wheat stem rust. Wheat stem rust under control for over 30 years, but a resurgence of the disease was discovered in 1999 in Uganda that swiftly spread to neighbouring Kenya. The wheat stem rust, caused by the strain of the fungus known as Ug99, named after its place and year of origin, has since spread to Iran, Yemen and South Africa and threatens crops as far away as India as spores are carried by wind. Parasitic rusts threaten global wheat production, reducing plant growth and crop yields. The disease can destroy up to 70-100 percent of the yield of wheat crop if not prevented. 'Improving food security in developing countries through the use of nuclear techniques is an important priority of the IAEA', said IAEA Director General Yukiya Amano. 'I am pleased that we have been able to make an important contribution to fighting wheat rust'. 'Wheat rusts, particularly the Ug99 strain, are a major threat to food security because rust epidemics can result in devastating yield losses. This international project involving affected countries, plant scientists and breeders and international organizations is a major breakthrough. It clearly shows the benefits of FAO/IAEA collaboration and that
Directory of Open Access Journals (Sweden)
Yi Dai
2017-05-01
Full Text Available Fusarium head blight (FHB, leaf rust, and stem rust are the most destructive fungal diseases in current world wheat production. The diploid wheatgrass, Thinopyrum elongatum (Host Dewey (2n = 2x = 14, EE is an excellent source of disease resistance genes. Two new Triticum–Secale–Thinopyrum trigeneric hybrids were derived from a cross between a hexaploid triticale (X Triticosecale Wittmack, 2n = 6x = 42, AABBRR and a hexaploid Triticum trititrigia (2n = 6x = 42, AABBEE, were produced and analyzed using genomic in situ hybridization and molecular markers. The results indicated that line RE21 contained 14 A-chromosomes, 14 B-chromosomes, three pairs of R-chromosomes (4R, 6R, and 7R, and four pairs of E-chromosomes (1E, 2E, 3E, and 5E for a total chromosome number of 2n = 42. Line RE62 contained 14 A-chromosomes, 14 B-chromosomes, six pairs of R-chromosomes, and one pair of translocation chromosomes between chromosome 5R and 5E, for a total chromosome number of 2n = 42. At the seedling and adult growth stages under greenhouse conditions, line RE21 showed high levels of resistance to FHB, leaf rust, and stem rust race Ug99, and line RE62 was highly resistant to leaf rust and stem rust race Ug99. These two lines (RE21 and RE62 display superior disease resistance characteristics and have the potential to be utilized as valuable germplasm sources for future wheat improvement.
Dai, Yi; Duan, Yamei; Liu, Huiping; Chi, Dawn; Cao, Wenguang; Xue, Allen; Gao, Yong; Fedak, George; Chen, Jianmin
2017-01-01
Fusarium head blight (FHB), leaf rust, and stem rust are the most destructive fungal diseases in current world wheat production. The diploid wheatgrass, Thinopyrum elongatum (Host) Dewey (2 n = 2 x = 14, EE) is an excellent source of disease resistance genes. Two new Triticum-Secale-Thinopyrum trigeneric hybrids were derived from a cross between a hexaploid triticale (X Triticosecale Wittmack, 2 n = 6 x = 42, AABBRR) and a hexaploid Triticum trititrigia (2 n = 6 x = 42, AABBEE), were produced and analyzed using genomic in situ hybridization and molecular markers. The results indicated that line RE21 contained 14 A-chromosomes, 14 B-chromosomes, three pairs of R-chromosomes (4R, 6R, and 7R), and four pairs of E-chromosomes (1E, 2E, 3E, and 5E) for a total chromosome number of 2 n = 42. Line RE62 contained 14 A-chromosomes, 14 B-chromosomes, six pairs of R-chromosomes, and one pair of translocation chromosomes between chromosome 5R and 5E, for a total chromosome number of 2 n = 42. At the seedling and adult growth stages under greenhouse conditions, line RE21 showed high levels of resistance to FHB, leaf rust, and stem rust race Ug99, and line RE62 was highly resistant to leaf rust and stem rust race Ug99. These two lines (RE21 and RE62) display superior disease resistance characteristics and have the potential to be utilized as valuable germplasm sources for future wheat improvement.
Perswazyjność komunikatów reklamowych w Internecie na podstawie analizy usług finansowych SKOK-ów
Idzik, Beata
2014-01-01
Praca jest wynikiem kilkuletnich obserwacji praktycznej strony funkcjonowania reklamy w zakresie usług finansowych. Autorka starała się oddać wyraz swojemu zainteresowaniu psychologią konsumenta, marketingiem w sektorze finansowym a także fascynacji możliwościom, jakie stwarzają w tym zakresie nowe technologie oparte na Internecie. Praca ma charakter teoretyczno - badawczy. W założeniach metodologicznych sformułowano problem badawczy, cele oraz cztery hipotezy badawcze, które poddano wery...
Yu, Guotai; Zhang, Qijun; Friesen, Timothy L; Rouse, Matthew N; Jin, Yue; Zhong, Shaobin; Rasmussen, Jack B; Lagudah, Evans S; Xu, Steven S
2015-03-01
Mapping studies confirm that resistance to Ug99 race of stem rust pathogen in Aegilops tauschii accession Clae 25 is conditioned by Sr46 and markers linked to the gene were developed for marker-assisted selection. The race TTKSK (Ug99) of Puccinia graminis f. sp. tritici, the causal pathogen for wheat stem rust, is considered as a major threat to global wheat production. To address this threat, researchers across the world have been devoted to identifying TTKSK-resistant genes. Here, we report the identification and mapping of a stem rust resistance gene in Aegilops tauschii accession CIae 25 that confers resistance to TTKSK and the development of molecular markers for the gene. An F2 population of 710 plants from an Ae. tauschii cross CIae 25 × AL8/78 were first evaluated against race TPMKC. A set of 14 resistant and 116 susceptible F2:3 families from the F2 plants were then evaluated for their reactions to TTKSK. Based on the tests, 179 homozygous susceptible F2 plants were selected as the mapping population to identify the simple sequence repeat (SSR) and sequence tagged site (STS) markers linked to the gene by bulk segregant analysis. A dominant stem rust resistance gene was identified and mapped with 16 SSR and five new STS markers to the deletion bin 2DS5-0.47-1.00 of chromosome arm 2DS in which Sr46 was located. Molecular marker and stem rust tests on CIae 25 and two Ae. tauschii accessions carrying Sr46 confirmed that the gene in CIae 25 is Sr46. This study also demonstrated that Sr46 is temperature-sensitive being less effective at low temperatures. The marker validation indicated that two closely linked markers Xgwm210 and Xwmc111 can be used for marker-assisted selection of Sr46 in wheat breeding programs.
Metabolomic effects in HepG2 cells exposed to CeO2, SiO2 and CuO nanomaterials.
To better assess potential hepatotoxicity of nanomaterials, human liver HepG2 cells were exposed for three days to 5 different CeO2 (either 30 or 100 ug/ml), 3 SiO2 based (30 ug/ml) or 1 CuO (3 ug/ml) nanomaterials with dry primary particle sizes ranging from 15 to 213 nm. Metab...
Qi, L L; Pumphrey, M O; Friebe, Bernd; Zhang, P; Qian, C; Bowden, R L; Rouse, M N; Jin, Y; Gill, B S
2011-06-01
Stem rust (Puccinia graminis f. sp. tritici Eriks. & E. Henn.) (the causal agent of wheat stem rust) race Ug99 (also designated TTKSK) and its derivatives have defeated several important stem rust resistance genes widely used in wheat (Triticum aestivum L.) production, rendering much of the worldwide wheat acreage susceptible. In order to identify new resistance sources, a large collection of wheat relatives and genetic stocks maintained at the Wheat Genetic and Genomic Resources Center was screened. The results revealed that most accessions of the diploid relative Dasypyrum villosum (L.) Candargy were highly resistant. The screening of a set of wheat-D. villosum chromosome addition lines revealed that the wheat-D. villosum disomic addition line DA6V#3 was moderately resistant to race Ug99. The objective of the present study was to produce and characterize compensating wheat-D. villosum whole arm Robertsonian translocations (RobTs) involving chromosomes 6D of wheat and 6V#3 of D. villosum through the mechanism of centric breakage-fusion. Seven 6V#3-specific EST-STS markers were developed for screening F(2) progeny derived from plants double-monosomic for chromosomes 6D and 6V#3. Surprisingly, although 6D was the target chromosome, all recovered RobTs involved chromosome 6A implying a novel mechanism for the origin of RobTs. Homozygous translocations (T6AS·6V#3L and T6AL·6V#3S) with good plant vigor and full fertility were selected from F(3) families. A stem rust resistance gene was mapped to the long arm 6V#3L in T6AS·6V#3L and was designated as Sr52. Sr52 is temperature-sensitive and is most effective at 16°C, partially effective at 24°C, and ineffective at 28°C. The T6AS·6V#3L stock is a new source of resistance to Ug99, is cytogenetically stable, and may be useful in wheat improvement.
The role of unattended ground sensors (UGS) in regional confidence building and arms control
Energy Technology Data Exchange (ETDEWEB)
Vannoni, M.; Duggan, R.
1997-03-01
Although the Cold War has ended, the world has not become more peaceful. Without the stability provided by an international system dominated by two super-powers, local conflicts are more likely to escalate. Agreements to counter destabilizing pressures in regional conflicts can benefit from the use of cooperative monitoring. Cooperative monitoring is the collecting, analyzing, and sharing of information among parties to an agreement. Ground sensor technologies can contribute to the collection of relevant information. If implemented with consideration for local conditions, cooperative monitoring can build confidence, strengthen existing agreements, and set the stage for continued progress. This presentation describes two examples: the Israeli-Egyptian Sinai agreements of the 1970s and a conceptual example for the contemporary Korean Peninsula. The Sinai was a precedent for the successful use of UGS within the context of cooperative monitoring. The Korean Peninsula is the world`s largest military confrontation. Future confidence building measures that address the security needs of both countries could decrease the danger of conflict and help create an environment for a peace agreement.
Directory of Open Access Journals (Sweden)
Teresa Kiziukiewicz
2009-03-01
Full Text Available Charakterystycznym dla przedsiębiorstw rolniczych składnikiem aktywów są aktywa biologiczne. Wyróżnia je fakt podlegania przemianie biologicznej, wskutek której przekształcają się one w produkty rolnicze lub inne aktywa biologiczne. W związku z tą specyfiką powstaje problem odpowiedniej prezentacji informacji o nich. W artykule są przedstawione zasady i zakres ujawnień o aktywach biologicznych w sprawozdaniu finansowym i dołączanych do niego raportach szczegółowych, ze szczególnym uwzględnieniem problemów wyceny według wartości godziwej.
Directory of Open Access Journals (Sweden)
Eon Sook Lee
2018-04-01
Full Text Available Background: Ginseng has been used as an ergogenic agent, although evidence for its effectiveness is weak. A randomized, double-blind, placebo-controlled clinical trial was conducted to evaluate the effect of a ginsenoside complex (UG0712 on changes in exercise performance. Methods: Sedentary individuals (n=117 were randomly assigned into one of three groups: low-dose ginsenoside supplementation (100 mg/d, n=39, high-dose ginsenoside supplementation (500 mg/d, n=39, or a placebo group (500 mg/d, n=39. All participants underwent a supervised 12-wk aerobic and resistance exercise training course. To assess the effects of supplementation on physical performance, maximal oxygen consumption (VO2max, anaerobic threshold (AT, lactic acid, and muscle strength of the dominant knee were measured at baseline, every visit, and after the training program. Results: Both ginsenoside groups showed significant increases in VO2max and muscular strength during exercise training. There were no definite changes in AT and lactic acid levels over time. After exercise training, there were definite differences in the VO2max (28.64.9 to 33.7±4.9 ml/kg/min in high-dose group vs. 30.4±6.7 to 32.8±6.6 ml/kg/min in placebo, p=0.029 and AT (19.3±4.2 to 20.9±3.5 ml/kg/min in high-dose group vs. 20.0±5.1 to 20.0±4.9 ml/kg/min in placebo, p=0.038 between the high-dose ginsenoside and placebo groups. However, there was no difference in VO2max between the low-dose ginsenoside and placebo groups (p=0.254. There were no differences in muscular strength during exercise training among the three groups. Conclusion: High-dose ginsenoside supplementation (UG0712 augmented the improvement of aerobic capacity by exercise training. Keywords: cardiopulmonary exercise test, ginsenoside, Panax ginseng, randomized controlled trial
Energy Technology Data Exchange (ETDEWEB)
Kim, Jin Il; Lee, Eun Sil; Kim, Jong-Young [Icheon Branch, Korea Institute of Ceramic Engineering and Technology, Gyeonggi-do (Korea, Republic of); Choi, Soon-Mok [School of Energy, Materials and Chemical Engineering, Korea University of Technology and Education, Cheonan (Korea, Republic of); Lee, Kyu Hyoung [Materials R and D Center, Samsung Advanced Institute of Technology, Yongin (Korea, Republic of); Seo, Won-Seon [Energy and Environmental Division, Korea Institute of Ceramic Engineering and Technology, Seoul (Korea, Republic of)
2014-04-15
Nanocomposites of n-type thermoelectric Bi{sub 2}Te{sub 2.7}Se{sub 0.3} (BTS) and unoxidized graphene (UG) were prepared from the exfoliated BTS and UG nanoplatelets. Polycrystalline BTS ingots were exfoliated into nanoscroll-type crystals by chemical exfoliation, and were re-assembled with UG nanoplatelets. The composites were chemically reduced by hydrazine hydrate and sintered by a spark-plasma-sintering method. The thermoelectric properties of the sintered composites were evaluated and exhibited decreased carrier concentration and increased thermal conductivity due to the embedded graphene. The peak ZT values for the UG/BTS-US and UG/BTS-EX composites were ∝0.8 at the UG concentration of 0.05 wt%. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Promotion of hepatic preneoplastic lesions in male B6C3F1 mice by unleaded gasoline.
Standeven, A M; Wolf, D C; Goldsworthy, T L
1995-01-01
In previous studies, unleaded gasoline (UG) vapor was found to be a liver tumor promoter and hepatocarcinogen in female mice, but UG was not a hepatocarcinogen in male mice. However, UG vapor had similar transient mitogenic effects in nonlesioned liver of both male and female mice under the conditions of the cancer bioassay. We used an initiation-promotion protocol to determine whether UG vapor acts as a liver tumor promoter in male mice and to examine proliferative effects that may be critical to tumor development. Twelve-day-old male B6C3F1 mice were injected with N-nitrosodiethylamine (DEN; 5 mg/kg, intraperitoneally) or vehicle. Starting at 5-7 weeks of age, mice were exposed by inhalation 6 hr/day, 5 days/week for 16 weeks to 0 or 2046 ppm of PS-6 blend UG. UG treatment caused a significant 2.3-fold increase in the number of macroscopic hepatic masses in DEN-initiated mice, whereas no macroscopic masses were observed in non-initiated mice. Altered hepatic foci (AHF), which were predominantly basophilic in phenotype, were found almost exclusively in DEN-initiated mice. UG treatment significantly increased both the mean volume (threefold) and the volume fraction (twofold) of the AHF without increasing the number of AHF per unit area. UG also induced hepatic pentoxyresorufin-O-dealkylase (PROD) activity, a marker of CYP2B, by more than 12-fold over control with or without DEN cotreatment. To study hepatocyte proliferative effects of UG, we treated mice with 5-bromo-2'-deoxyuridine (BrdU) via osmotic pump for 3 days before necropsy and measured hepatocyte BrdU labeling index (LI) in AHF and nonlesioned liver.(ABSTRACT TRUNCATED AT 250 WORDS) Images Figure 1. PMID:7588481
International Nuclear Information System (INIS)
Moon, Jong-Hwa; Kim, Sun-Ha; Chung, Yong-Sam; Lee, Ok-Hee
2013-01-01
Selenium is a key constituent of enzyme in glutathione peroxidase, which is effective in decreasing various types of oxidative stress, Thus, the adequacy of selenium intake is very important in decreasing the risks of various degenerating diseases such as cardiovascular disease, or certain cancers. Lately, the intake of animal foods is increasing among Koreans owing to a dietary transition toward a western style. This study was conducted to measure the selenium content in meat and eggs, and then assessed the selenium intake from these foods. Forty frequently eaten items among meat and eggs were analyzed using an Instrumental Neutron Activation Analysis. The selenium content in 100g of raw meat and eggs ranged from 8.1ug to 50.9ug. In particular, 100g of beef contained 12.4ug to 50.9ug of selenium; pork, 11.2ug to 22.6ug chicken, 10.2ug to 13.7ug and eggs, 28.6ug to 43.0ug. Thus, beef viscera and chicken eggs contain the highest amounts of selenium among these groups. 100g of Pork belly, the most frequently eaten meat type among Koreans, contains 14.6ug of selenium. An evaluation of dietary selenium intake shows that the total selenium supply from meats and eggs was 28.4ug/day and 27.5 ug/day in adult men and women, respectively. These are over one-half of the Korean RNI (Recommended Daily Intake) of 55ug/day. (author)
Directory of Open Access Journals (Sweden)
Chun-Yu Chen
2017-04-01
Full Text Available The NOD-like receptor pyrin domain 3 (NLRP3 inflammasome contains Nod-like receptors, a subclass of pattern recognition receptors, suggesting that this complex has a prominent role in host defenses. Various structurally diverse stimulators activate the NLRP3 inflammasome through different signaling pathways. We previously reported that ugonin U (UgU, a natural flavonoid isolated from Helminthostachys zeylanica (L Hook, directly stimulates phospholipase C (PLC and triggers superoxide release in human neutrophils. In the present study, we showed that UgU induced NLRP3 inflammasome assembly and subsequent caspase-1 and interleukin (IL-1β processing in lipopolysaccharide-primed human monocytes. Moreover, UgU elicited mitochondrial superoxide generation in a dose-dependent manner, and a specific scavenger of mitochondrial reactive oxygen species (ROS diminished UgU-induced IL-1β and caspase-1 activation. UgU induced Ca2+ mobilization, which was inhibited by treatment with inhibitors of PLC or inositol triphosphate receptor (IP3R. Blocking Ca2+ mobilization, PLC, or IP3R diminished UgU-induced IL-1β release, caspase-1 activation, and mitochondrial ROS generation. These data demonstrated that UgU activated the NLPR3 inflammasome activation through Ca2+ mobilization and the production of mitochondrial ROS. We also demonstrated that UgU-dependent NLRP3 inflammasome activation enhanced the bactericidal function of human monocytes. The ability of UgU to stimulate human neutrophils and monocytes, both of which are professional phagocytes, and its capacity to activate the NLRP3 inflammasome, which is a promising molecular target for developing anti-infective medicine, indicate that UgU treatment should be considered as a possible novel therapy for treating infectious diseases.
Bakhtavar, E.
2015-09-01
In this study, transition from open pit to block caving has been considered as a challenging problem. For this purpose, the linear integer programing code of Matlab was initially developed on the basis of the binary integer model proposed by Bakhtavar et al (2012). Then a program based on graphical user interface (GUI) was set up and named "Op-Ug TD Optimizer". It is a beneficial tool for simple application of the model in all situations where open pit is considered together with block caving method for mining an ore deposit. Finally, Op-Ug TD Optimizer has been explained step by step through solving the transition from open pit to block caving problem of a case ore deposit. W pracy tej rozważano skomplikowane zagadnienie przejścia od wybierania odkrywkowego do komorowego. W tym celu opracowano kod programowania liniowego w środowisku MATLAB w oparciu o model liczb binarnych zaproponowany przez Bakhtavara (2012). Następnie opracowano program z wykorzystujący graficzny interfejs użytkownika o nazwie Optymalizator Op-Ug TD. Jest to niezwykle cenne narzędzie umożliwiające stosowanie modelu dla wszystkich warunków w sytuacjach gdy rozważamy prowadzenie wydobycia metodą odkrywkową oraz wydobycie komorowe przy eksploatacji złóż rud żelaza. W końcowej części pracy podano szczegółową instrukcję stosowanie programu Optymalizator na przedstawionym przykładzie przejścia od wydobycia rud żelaza metodami odkrywkowymi poprzez wydobycie komorami.
Kwaansa-Ansah, E E; Basu, N; Nriagu, J O
2010-11-01
Total mercury concentrations in human hair and urine samples were determined to ascertain the extent of environmental and occupational mercury exposure in Dunkwa-On-Offin, a small scale gold mining area of the central-west region of Ghana. In all ninety-four (94) hair and urine samples comprising of forty (40) small scale miners and fifty-four (54) farmers were collected and analyzed for their total mercury levels using the cold vapour atomic absorption spectrometry. The hair total mercury concentrations ranged from 0.63 to 7.19 ug/g with a mean of 2.35 ± 1.58 ug/g for the farmers and 0.57-6.07 ug/g with a mean of 2.14 ± 1.53 ug/g for the small scale gold miners. There was no significant correlation between the total mercury concentration and the average weekly fish diet. The total mercury concentrations in urine of the miners were higher than those of the farmers and ranged from 0.32 to 3.62 ug/L with a mean of 1.23 ± 0.86 ug/L. The urine concentrations of farmers ranged from 0.075 to 2.31 ug/L with a mean of 0.69 ± 0.39 ug/L. Although the results indicate elevated internal dose of mercury the current levels of exposures do not appear to pose a significant health threat to the people.
International Nuclear Information System (INIS)
Ko, Kinarm; Moore, Robert W.; Peterson, Richard E.
2004-01-01
In utero exposure of male C57BL/6 mice to 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) prevents prostatic epithelial buds from forming in the ventral region of the urogenital sinus (UGS) and reduces the number of buds that form in the dorsolateral region. This inhibition of budding is aryl hydrocarbon receptor (AHR) dependent and appears to be the primary cause of lobe-specific prostate abnormalities in TCDD-exposed mice. TCDD can inhibit prostatic epithelial bud formation by acting directly on the UGS in vitro, but whether it does so via AHR in UGS mesenchyme, epithelium, or both was unknown. To address this issue, UGS mesenchyme and epithelium from gestation day (GD) 15 wild-type C57BL/6J male mice were isolated, recombined, and cultured in vitro for 5 days with 10 -8 M 5α-dihydrotestosterone (DHT) and either 10 -9 M TCDD or vehicle. Prostatic epithelial buds were viewed by light microscopy after removal of mesenchyme. Effects depended greatly on which portions of the mesenchyme were used: TCDD had little if any effect when whole UGS epithelium (UGE) was recombined with ventral plus dorsolateral mesenchyme, tended to reduce bud numbers in recombinants made with UGE and dorsolateral mesenchyme, and severely reduced bud numbers in recombinants made with UGE and ventral mesenchyme (VM). [VM + UGE] recombinants prepared from wild-type and AHR knockout (Ahr -/- ) mice were then cultured with DHT to determine the site of action of TCDD. AHR null mutation alone had no effect on budding. TCDD severely inhibited prostatic epithelial bud formation in recombinants that contained mesenchymal AHR, whereas bud formation was not inhibited by TCDD in recombinants lacking mesenchymal AHR, regardless of epithelial AHR status. These results demonstrate that UGS mesenchyme and not UGS epithelium is the site of action of TCDD. Therefore, the initial events responsible for abnormal UGS (and ultimately prostate) development occur within the UGS mesenchyme, and changes in gene expression
Directory of Open Access Journals (Sweden)
Palit Soumen
2001-01-01
Full Text Available The extraction of alpha-amylase in the solid state fermentation of wheat bran by Bacillus circulans GRS313 was optimized. Among various solvents tested, maximum extraction was achieved when 2.5% (v/v glycerol was added. The optimum conditions for extraction were 2.5 hrs soaking time at 30° C under recirculation and agitated condition, which yielded 590 U/g bran of enzyme activity. Whereas under stationary soaking condition the activity of the enzyme was 439.58U/g bran. With repeated wash under the above optimum conditions showed that 600 U/g and 184.2 U/g of enzyme extracted in the 1st and 2nd washes respectively and only 36.84 U/g was recovered in the 3rd wash
Directory of Open Access Journals (Sweden)
Maria Marcela Bailez
2014-07-01
Full Text Available Aim :Evaluate postoperative urinary continence in patients withcongenital adrenal hyperplasia(CAHwith intermediate (ITand high urogenital sinus (UGS who underwent a UGS mobilization maneuver .Methods: We called IT to those that although needing an aggressive dissection to get to the vagina, still have enough urethra proximal to the vaginal confluence. Very low variants are excluded from this analysis. Dissection always started in the posterior wall of the UGS with an aggressive separation from the anterior rectal wall. If the wide portion of the vagina was reached dissection stopped and the UGS opened ventrally widening to the introitus. Nineteen patients were treated using this maneuver (Group1. When more dissection was required the anterior wall of the UGS was dissected and carefully freed from the low retropubic space. Then the UGS was opened either ventrally or dorsally. Thirty three patients required this approach (Group 2 .Combined procedures were used in 3 patients with high UGS (Group 3. Results : Mean age at the time of the repair and length of the UGS were 12.2 years (4 months to 18 years and 3.75 cm (3 -8 cmfor G 1; 8 years (5 months to 17 years and 6.34 cm ( 4-12 cm in G2 and 8,3 years (2 -14 y and 11.5cm (11-12cm in G3. All patients had been regularly followed. Mean age at last follow up of 14.3y, 17y and 9.9y for groups 1, 2 and 3 respectively. All patients continue to void normally and are continent. All patients have 2 separate visible orifices in the vulva. Only 3 are sexually active.Conclusion: UGS mobilization for vaginoplasty in girls with CAH does not compromise voiding function or urinary continence,
Directory of Open Access Journals (Sweden)
Marianna Rakszegi
2017-09-01
Full Text Available Cereal grain fiber is an important health-promoting component in the human diet. One option to improve dietary fiber content and composition in wheat is to introduce genes from its wild relatives Aegilops biuncialis and Aegilops geniculata. This study showed that the addition of chromosomes 2Ug, 4Ug, 5Ug, 7Ug, 2Mg, 5Mg, and 7Mg of Ae. geniculata and 3Ub, 2Mb, 3Mb, and 7Mb of Ae. biuncialis into bread wheat increased the seed protein content. Chromosomes 1Ug and 1Mg increased the proportion of polymeric glutenin proteins, while the addition of chromosomes 1Ub and 6Ub led to its decrease. Both Aegilops species had higher proportions of β-glucan compared to arabinoxylan (AX than wheat lines, and elevated β-glucan content was also observed in wheat chromosome addition lines 5U, 7U, and 7M. The AX content in wheat was increased by the addition of chromosomes 5Ug, 7Ug, and 1Ub while water-soluble AX was increased by the addition of chromosomes 5U, 5M, and 7M, and to a lesser extent by chromosomes 3, 4, 6Ug, and 2Mb. Chromosomes 5Ug and 7Mb also affected the structure of wheat AX, as shown by the pattern of oligosaccharides released by digestion with endoxylanase. These results will help to map genomic regions responsible for edible fiber content in Aegilops and will contribute to the efficient transfer of wild alleles in introgression breeding programs to obtain wheat varieties with improved health benefits.Key Message: Addition of Aegilops U- and M-genome chromosomes 5 and 7 improves seed protein and fiber content and composition in wheat.
Radiation sensitivity of two Ginger varieties (Zingiber officinale Rosc.) to gamma irradiation
International Nuclear Information System (INIS)
Nwachukwu, E.C.; Ene, L.S.O.; Mbanaso, E.N.A.
1994-01-01
The mutability and radiosensitivity of two local ginger varieties in Nigeria ''Tafin Giwa'' (UG 1) and ''Yatsun Biri'' (UG 2) were studied using gamma rays from a 60Co gamma source. There was a high frequency of chlorophyll mutations indicating a high mutability in ginger. GR 50 was obtained at 5.0 and 6.0 Gy in UG1, and UG2, respectively, while LD50 was obtained at 8.75 Gy in both varieties. The dose limitation range for ginger was estimated to be 5.0-9.0 Gy [es
International Nuclear Information System (INIS)
El-Sattar, Osama Abd
2002-01-01
Two simple and reliable methods are described for the determination of sulphaquinoxaline (SQX) and amprolium (AMP) combined in veterinary powder. The first method depends on high performance liquid chromatography on a reversed phase column (Bondapak-C18) using mobile phase consisting of acetonitrile-methanol-water-phosphoric acid (30: 5: 55: 0.7, by volumes) at a flow rate of 1 ml min with UV detection at 254 nm. The detection limits were 0.2 ug ml and 0.35 ug ml and linearity ranges were 2-20 ug ml and 4-40ug ml for SQX and AMP, respectively. The second one deals with the first derivative (D) spectrophotometry with zero-crossing measurement at 253 nm and 226 nm for SQX and AMP respectively. The detection limits were 0.3 ug ml and linearity ranges were 1-18 ug ml and 4-32 ug-ml for SQX and AMP respectively. The proposed procedures were successfully applied to the determination of these drugs in laboratory prepared mixtures with mean percentage recovery ranged from 98.50 to 99.75 and in commercial preparation ranged from 103.85 to 104.85. (author)
Textural properties of low-fat set-type yoghurt depending on mTG addition
Directory of Open Access Journals (Sweden)
Lívia Darnay
2016-07-01
Full Text Available Our aim was to determine how 0.5-2 U/g non-inactivated mTG affects the pH development and apparent viscosity during fermentation. Furthermore we wished to examine how the enzyme addition could change protein structure, gel strength and sensory characteristics by healthy low-fat set-type yoghurt product. Therefore commercial mTG enzyme preparation was added in different concentrations (0.5-2.0 U/g, in 0.5 U/g steps to 1.5 % bovine milk simultaneously with DVS starter culture. Our study revealed that enzyme dosage (0.5-2 U/g protein had no impact on pH development and apparent viscosity during fermentation when manufacturing low-fat (1.5 % set-type yoghurt. The addition of mTG contributed to 38 % more whey retention with incorporation of β-casein, and caused 44 % higher gel strength up to a level of 1 U/g protein.
Enhancement Nisin Activity By Some Natural Additives
International Nuclear Information System (INIS)
Hussien, H.A.; El-Fouly, M.E.; Zayed, M.N.; Harroun, M.B.
2010-01-01
Nisin showed great inhibition of gram positive bacteria while it had no effect on gram negative bacteria or yeast.It is clear from the present study that 250ug/ml of nisin was lethal for S .aureus but this dose decreased to 25 ug/ml when combined with 0.05% of citric acid or 0.1% of lactic acid or 0.4% of cinnamon. Although nisin had no effect on P. aeruginosa but when 200ug/ml of nisin combined with 0.2% of citric acid or 0.1% of lactic acid or 2% of cinnamon P. aeruginosa completely inhibited.In the same manner 200ug/ml of nisin was sufficient to inhibit Debaryomyces sp. growth when combined by 3% of citric or 3.5% of lactic or 2% of cinnamon. On the other hand, 25 μg/ml of nisin reduced the following lethal concentrations of S .aureus from0.2% to 0.05%, 0.15% to 0.1% and from 1.2% to 0.4% for citric acid, lactic acid and cinnamon, respectively. While. 200 ug/ml of nisin decreased the following lethal concentrations of P. aeruginosa from 0.3% to 0.2%, 0.3% to 0.1% and from 4% to 2% for citric acid, lactic acid and cinnamon, respectively. Two hundred ug/ml of nisin decreased lethal concentrations of Debaryomyces sp. from4% to 3%, 4.5% to 3.5% for citric acid and lactic acid, respectively. Two hundred ug/ml of nisin did not reduce cinnamon lethal dose.
International Nuclear Information System (INIS)
Aziz, N.H.; Attia, E.-S.A.; Farag, S.A.
1997-01-01
A survey was carried out to obtain data on the occurence of Fusarium mycotoxin in wheat and flour samples collected from local markets in Egypt and to study the influence of gamma-irradiation on controlling the occurrence of thesemycotoxins in wheat, flour and bread. Deoxynivalenol (DON) was detected in five samples of wheat at levels ranging from 103 to 287 ug/kg and one sample each of flour and bread concentrations 188 and 170 ug/kg. Zearaleone (ZEN) was detected in ten samples of wheat at levels from 28 to 42 ug/kg and four samples each of flour and bread at concentrations of 95 and 34 ug/kg, respectively. T-2 toxin was detected only in one sample each of wheat, flour and bread at concentrations of 2.9, 2.2, and 2.3 ug/kg, respectively. Gamma-irradiation at dose level of 6 kGy completely eliminated fungal flora in flour and wheat. DON, ZEN and T-2 toxin concentrations are reduced to 85, 20 and 2.0 ug/kg for wheat and to 125, 45, and 1.0 ug/kg for flour after 4 kGy exposure and a sharp drop in Fusarium toxin levels occured at 6 kGy and was eliminated at 8 kGy. Bread prepared from 6 kGy was contaminate4d with Fusarium toxin at levels below 5 ug/kg. It was noticed that gamme-irradiation reduce greatly the natural occurrence of Fusarium mycotoxins in bread
In Situ Bioremediation of Chlorinated Solvent Source Areas with Enhanced Mass Transfer
2008-09-01
three-dimensional view with iso -surface of LIF counts • GMS support files needed to operate GMS (for example, bor, .map, .mat, .img, .mat, and .sol...DCE (ug/L) trans-DCE (ug/L) VC (ug/L) Ethane (ug/L) Ethene (ug/L) Chloride (ug/L) 5C2C43 11/9/2005 440 J,B,D 27000 D 0 540 D 4.0 J 8.6 J...0.43 J 0.64 J 2C2D21 7/18/2005 29000 D 2C2D22 7/19/2005 530 J, D 30000 B, D, E 0 0 0 0 2C2D22 7/19/2005 27000 D 2C2D23 7/20/2005 180 J
Energy Technology Data Exchange (ETDEWEB)
Souza, Jose Francisco de; Nascimento, Jose Maria do; Silva, Luiz Antonio da; Salazar, Marcos Vinicios; Baptista, Reinaldo Lopes; Barros, Sueli Aguiar [Companhia Siderurgica Nacional (CSN), Volta Redonda, RJ (Brazil)
2009-11-01
The areas of finishing products of CSN Steel Plant generate contaminated effluents with oil and grease , that are treated in ETEO (Effluent Station of Oil Treatment). In this plant, the oil is processed to be sold for the consuming market. However, some seasons of the year, the market does not absorb the oil, and CSN is obliged to defray the burning of this oil, to not interrupt the productive process and cause an environmental impact. Because of this situation, we search alternatives for the viable use of this oil inside CSN steel plant, taking care for the security of the processes and the impact to the environment. This paper describes the details of the work and the implantation of the burning of this oil of the ETEO with BPF oil (type of petrochemical oil) as combustible in the boiler 7 of the power plant UG 50 Hz. For the implantation of this project, operational contingencies of security for equipment was prepared . Moreover, the work included chemical analyses of the oil and the conditions of the boiler using this mixing of oils. The reached results demonstrate the total viability of this project and it was proved another alternative of the use of this residue, with reduction of the fuel costs , steam costs and the electric energy generated in the power plant of CSN. (author)
Directory of Open Access Journals (Sweden)
Yagang Zhang
2012-04-01
Full Text Available The facile coupling of azobenzene dyes to the quadruply hydrogen-bonding modules 2,7-diamido-1,8-naphthyridine (DAN and 7-deazaguanine urea (DeUG is described. The coupling of azobenzene dye 2 to mono-amido DAN units 4, 7, and 9 was effected by classic 4-(dimethylaminopyridine (DMAP-catalyzed peptide synthesis with N-(3-dimethylaminopropyl-N’-ethyl carbodiimide hydrochloride (EDC as activating agent, affording the respective amide products 5, 8, and 10 in 60–71% yield. The amide linkage was formed through either the aliphatic or aromatic ester group of 2, allowing both the flexibility and absorption maximum to be tuned. Azobenzene dye 1 was coupled to the DeUG unit 11 by Steglich esterification to afford the product amide 12 in 35% yield. Alternatively, azobenzene dye 16 underwent a room-temperature copper-catalyzed azide–alkyne Huisgen cycloaddition with DeUG alkyne 17 to give triazole 18 in 71% yield. Azobenzene coupled DAN modules 5, 8, and 10 are bright orange–red in color, and azobenzene coupled DeUG modules 12 and 18 are orange–yellow in color. Azobenzene coupled DAN and DeUG modules were successfully used as colorimetric indicators for specific DAN–DeUG and DAN–UPy (2-ureido-4(1H-pyrimidone quadruply hydrogen-bonding interactions.
Heim, E. W.; Dibb, J. E.; Scheuer, E. M.
2017-12-01
The KORUS mission was a collaborative effort between the Korean Institute of Environmental Research and NASA. KORUS provided a comprehensive assessment of air quality in Korea during early 2016. The intensive sampling campaign was timed to assess local photochemistry during increasing solar insolation and biogenic emissions; after the April peak in outflow of pollution and dust from central China. Chinese outflow is well characterized by Silica-Calcium rich dust. Despite the effort to avoid the period with strongest dust outflow, Ca2+ was well represented in all bulk (particle diameters up to 4.5 micron) aerosol filter samples filter measurements and submicron measurements of NH4+, SO42, and NO3- made by AMS indicates substantial super-micron fractions of these anthropogenic ions at times during KORUS-AQ. During the dustiest samples (Ca2+ > 1.5ug/m3) we see marked increases in super-micron concentration of NH4+, SO42-, and NO3-, m = 1.113 ug/m3 , 2.621 ug/m3 , 4.413 ug/m3, with the super-micron contribution to total concentration averaging 47%, 45%, and 81% respectively. In contrast, low dust days (Ca2+ < 0.2ug/m3) the super-micron concentrations averaged 0.262 ug/m3, 0.510 ug/m3, -0.029 ug/m3, respectively and accounted for just 20%, 14%, and 8% of total mass. During the dust events, samples that have trajectories passing over industrial centers in eastern China approached equivalence balance between Ca2++ NH4+ and SO42-+NO3-. In contrast dusty samples that did not pass over these industrial centers during transport to the West Sea and Korea maintained excess cations, dominantly Ca2+. This suggests that dust can act as an important carrier of Chinese pollution to Korea when this saturated dust reaches the peninsula.
African Journals Online (AJOL)
Abstract A request for elective surgery for aUgInentation mammoplasty (AM) is .... item explored on a given topic; total percentages are thus greater or less than ..... This lends further credence to the thesis that those patients who can benefit ...
Persistence of 14C maneb in lettuce plants an soil
International Nuclear Information System (INIS)
Bennaceur, M.; Sennaoui, Z.; Meguenni, H.
1992-10-01
Maneb residue is studied on lettuce plant and soil after spraying on greenhouse with 14C maneb. The residues declined with time. After 37 days from the application, 14C maneb residues in water extracts declined to 1,5. 10-2ug/g from 5,8. 10-1ug/g of the zero day sample in lettuce plants and 4,6. 10-3ug/g from 1,73. 10-1ug/g in soil. The 14C internals residues in lettuce and soil increase respectively till 16 days and 24 days, then decrease to 88% and 4,05% after 37 days. ETU was present in lettuce plant after 8 days then decreases with time. Two metabolites were identified by TLC (EU,ETU)
Effect of anti-inflamentation extracts from Korean traditional medicinal herb
Directory of Open Access Journals (Sweden)
Zhang Xiaowan
2014-09-01
Full Text Available Five Mix Plant Extracts according to different extraction solvents were assessed for its cell viability and anti-inflammatory activity by in vitro methods. The single plant extract was extracted with 70% ethanol(EtOH and the mix plants(C.kousa, R.multiflora, T.nucifera, M.basjoo and S.glabra were extracted with EtOH 30%, 70%; Butylene Glycol(BG 30%, 70%; Propylene Glycol(PG 30%, 70%; Distilled Water(D.W. Cell viability was measured using the Micro culture tetrazolium (MTT assay method and Human fibroblast cells, CCD 1102 KERTr were used. The plant extracts with the maximum concentration that none toxic to the cells were evaluated for anti-inflammatory activity. Anti-inflammatory activity was evaluated using lipoxygenase inhibition assay method. A dose response curve was plotted to determine the IC50 values. Results showed that, at the 5 kinds of single plant extracts by 70% EtOH extraction solvent, it showed the IC50 was 280ug/ml of S1, 370ug/ml of S2, 380ug/ml of S3, 170ug/ml of S4 and 190ug/ml of S5. At the mix plant extracts by 7 kinds of extraction solvents (70%, 30% EtOH; 70%, 30% BG; 70%, 30% PG; D.W, it showed the IC50 was 140ug/ml of M E70, 140ug/ml of M E30, 120ug/ml of M BG70, 110ug/ml of M BG30, 120ug/ml of M PG70, 136ug/ml of M PG30 and 120ug/ml of M D.W. From the results, it is concluded that when these five plants mixed before extraction, it will extract more active ingredients with anti-inflammatory effects. Further study we will analyzing plants effective single compound using high performance liquid chromatography (HPLC profiling and progressing the experiments in vivo.
Establishment of Uropygial Gland Growth Curves for White, Three-Way Crossed Mule Ducklings
Directory of Open Access Journals (Sweden)
YH Chen
2015-06-01
Full Text Available Growth curves for the uropygial gland (UG of white, 3-way crossed mule ducklings were established using the Gompertz function. In total, 144 ducklings were fed in 12 floor pens with 12 birds in each pen. Each pen contained an equal number of animals of each sex. Feed and water were supplied ad libitumthroughout the entire experimental period. The weekly change in UG weight was recorded in males and females from hatch to 8 weeks of age. The weight and length of the UG, the width of the lobus glandulae uropygialis, the length and width of the pluma of the circulus uropygialis, and the index of the papilla uropygialis were measured once a week in individual ducklings in one pen. The average UG weight gain observed in white, 3-way crossed drakes was significantly higher than that of ducks of 21-56 days of age (P< 0.05. The UG length was 1.64-2.23 times the width of the left or right lobe, and the development of the UG was delayed from 3-4 weeks of age. The morphology of the UG changed from elliptical to elongated-elliptical with age. The right and left lobus glandulae uropygialis were symmetrical. The Gompertz growth functions of the UG in drakes and ducks were W=5.49e-e-0.675(t-1.955 and W=4.76e-e-0.685(t-1.936, respectively, where t represents age in weeks. These equations indicated that the maximum growth rate for drakes occurred at 14.1 days of age and for ducks at 13.6 days of age.
Studies on the preparation of radioactive labelled compounds
International Nuclear Information System (INIS)
Kim, Jae-Rok; Park, Kyung-Bae; Awh, Ok-Doo
1985-04-01
To deveolp 99 mTc instant labelling kits of dimercaptosuccinic acid (DMSA), glucoheptonic acid (GH), and tin colloid, molar ratios of the host compound to the stannous chloride, amount of the stannous chloride and pH were, respectively, controlled. The labelling yields and radiochemical purities were checked by means of a paper chromatography. Animal studies and clinical applications were also carried out. The results indicated that DMSA/SnCl 2 2H 2 O 3/1(mole/mole), SnCl 2 2H 2 O 410ug/ml/vial, pH 2.5, Ca GH/SnCl 2 2H 2 O 53/1(mole/mole), SnCl 2 2H 2 O 350 ug/ml/vial, pH 6.5, NaF 100ug/vial, SnCl 2 2H 2 O 150 ug/ml/vial, pH. 5.6 etc, were optimal conditions for the preparation of DMSA-, GH-, and tin colloid-kits, respectively. (Author)
report general | 1-Overview | 5-Publications | Indian Academy of ...
Indian Academy of Sciences (India)
In this process, the advantages offered by distance education methods should also be exploited. ... The U.G. course should be solid and broad based, providing a good ... Thus all U.G. students should take some common courses in physics, ...
Seasonal Scale Convective-Stratiform Pricipitation Variabilities at Tropics
S, Sreekanth T.
begin{center} Large Seasonal Scale Convective-Stratiform Pricipitation Variabilities at Tropics Sreekanth T S*, Suby Symon*, G. Mohan Kumar (1) and V Sasi Kumar (2) *Centre for Earth Science Studies, Akkulam, Thiruvananthapuram (1) D-330, Swathi Nagar, West Fort, Thiruvananthapuram 695023 (2) 32. NCC Nagar Peroorkada, Thiruvananthapuram ABSTRACT This study investigates the variabilities of convective and stratiform rainfall from 2011 to 2013 at a tropical coastal station in three seasons viz Pre-Monsoon (March-May), Monsoon (June-September) and Post-Monsoon (October-December). Understanding the climatological variability of these two dominant forms of precipitation and their implications in the total rainfall were the main objectives of this investigation. Variabilities in the frequency & duration of events, rain rate & total number of rain drops distribution in different events and the accumulated amount of rain water were analysed. Based on the ground & radar observations from optical & impact disdrometers, Micro Rain Radar and Atmospheric Electric Field Mill, precipitation events were classified into convective and stratiform in three seasons. Classification was done by the method followed by Testud et al (2001) and as an additional information electrical behaviour of clouds from Atmospheric Electric Field Mill is also used. Events which could not be included in both types were termed as 'mixed precipitation' and were included separately. Diurnal variability of the total rainfall in each seasons were also examined. For both convective and stratiform rainfall there exist distinct day-night differences. During nocturnal hours convective rain draged more attention. In all seasons almost 70% of rain duration and 60% of rain events of convective origin were confined to nocturnal hours. But stratiform rain was not affected by diurnal variations greatly because night time occurrences of stratiform duration and events were less than 50%. Also in Monsoon above 35% of
ANTIBACTERIAL PROPERTIES OF PHARMACEUTICAL COMPOSITION OF HEPATOPROTECTORS
Directory of Open Access Journals (Sweden)
Aslanian MA
2016-12-01
/ml. Compared to the tablets No. 2 and No. 3, where minimal inhibitory concentration was higher and amounted to 350-550 ug/ml. Results and discussion. Minimal inhibitory concentration for S. aureus amounted to 250-300 ug/ml, for S. epidermidis 150-250 ug/ml, for S. agalactiae and E. faecalis 300-400 ug/ml, for E. coli, K. pneumonia, E. cloaceae – 400-750 ug/ml. Minimal inhibitory concentration for anaerobic bacteriae (P. niger, P. anaerobius, Fusobacterium spp, B. fragilis -300-550 ug/ml , minimal inhibitory concentration to the tablets № 2 та № 3 amounted to 450-650ug/ml. Minimal inhibitory concentration for C. albicans 300-400 ug/ml. Compared to the tablets No. 2 and No. 3, where minimal inhibitory concentration was higher and amounted to 450-600 ug/ml. To sum up the results of the conducted experimental studies of combined capsules with flamin and lavender oil we can make a conclusion that the most effective against the different clinical microorganism andfungi strains is a combination of flamin 0.05 g, 0.02 g lavender oil (tablets No. 1, which makes it possible to preparecombined medicine for pathologies of hepatobiliary system (HBS. Conclusions. To sum up the results of experimental studies of combined capsules which consist of flamin and lavender oil we can make a conclusion that the most effective remedy for different clinical microorganism and fungi strains is a combination of flamin 0.05 g, 0.02 g lavender oil (tablets No. 1, which gives the opportunity to prepare combined medicine for pathologies of hepatobiliary system (HBS.
Unigene BLAST: CBRC-DMEL-01-0065 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-01-0065 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 2e-11 29% ...
Unigene BLAST: CBRC-DMEL-01-0067 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-01-0067 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 2e-10 31% ...
The Clinical Spectrum of Plumbism; an Experience from a Tertiary Care Hospital in Karachi, Pakistan
Directory of Open Access Journals (Sweden)
Lena Jafri
2017-12-01
Full Text Available Background:Lead toxicity continues to remain a concerning health problem for developing nations like Pakistan. Due to the lack of studies, we aim to highlight the clinical spectrum of lead poisoning in patients presenting to an urban-based tertiary care hospital in Pakistan. Method:This is a retrospective review of patients admitted form January 2011 to December 2014 using a structured questionnaire for recording demographics, comorbidities, clinical findings, biochemical abnormalities, clinical findings and treatment provided. Patients were categorized as children (≤18yrs and adults (>18yrs, further divided into three groups; desired blood lead levels (BLLs [lead levels 70ug/dl]. Result: A total of 86 patients were included in the final analysis, majority (69.6% of whom were adult males with median age of 35 yrs. Median (IQR BLL was 6.3 ug/dl (12.8-2.7 in all age groups with BLL in children and adults of 4.2 ug/dl (3.1-5.7 and 6.5 ug/dl (2.6-14.7, respectively. 72% of the children had complaints related to the central nervous system with majority complaining of irritability. The gastrointestinal system was most commonly implicated in adults (93% with most common complaint of abdominal pain. The commonest risk factor showing a positive correlation with BLLs was battery handling in adults [median (IQR BLL 18.4ug/dl (8.35-36.1] and pica eating in children with BLLs in high but non-toxic range [median (IQR BLL 5.2ug/dl (2.7-5.7]. The highest BLLs were observed to lie within the high but non-toxic range group in one adult herbal medicine user (54.4 ug/dl and in children observed in the toxic range group (>10ug/dl due to occupational battery work exposure and residence in a congested zone. Conclusion:Lead toxicity continues to be hazardous due to unchecked environmental and occupational exposure. Increasing awareness is tantamount in order to find a solution.
Unigene BLAST: CBRC-DMEL-02-0074 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0074 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 4e-09 28% ...
Unigene BLAST: CBRC-DMEL-01-0066 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-01-0066 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 3e-14 34% ...
Unigene BLAST: CBRC-DMEL-02-0075 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0075 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 4e-66 93% ...
Unigene BLAST: CBRC-DMEL-01-0040 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-01-0040 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 2e-05 30% ...
Unigene BLAST: CBRC-HSAP-04-0044 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-04-0044 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 2e-34 27% ...
Factors Associated with Redundant Sigmoid Colon at Mulago ...
African Journals Online (AJOL)
jen
economic factors between 68 patients .... 50,000 Uganda shillings (Ug. Shs) compared to only 19.9% of the controls (1 US $ = Ug shs 1500). ... the majority of the affected patients in this study had a family income of below 50,000 Ug. shs per month.
Unigene BLAST: CBRC-DMEL-06-0041 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-06-0041 gnl|UG|Dm#S40592667 DMG1A.1_1.E02.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.6.106.a, mRNA sequence /clone=DMG1-chr2L.6.106.a /gb=EW712706 /gi=156141512 /ug=Dm.26303 /len=1270 0.17 28% ...
Unigene BLAST: CBRC-MMUS-03-0073 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-03-0073 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-27 27% ...
Unigene BLAST: CBRC-GGAL-06-0012 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 2e-85 49% ... ...CBRC-GGAL-06-0012 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-MMUS-17-0171 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-17-0171 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-22 22% ...
Unigene BLAST: CBRC-DMEL-01-0039 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-01-0039 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 4e-11 25% ...
Unigene BLAST: CBRC-DMEL-01-0038 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-01-0038 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 4e-84 95% ...
Unigene BLAST: CBRC-DMEL-08-0057 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-08-0057 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 2e-06 22% ...
Validity and Reliability of 2 Goniometric Mobile Apps: Device, Application, and Examiner Factors.
Wellmon, Robert H; Gulick, Dawn T; Paterson, Mark L; Gulick, Colleen N
2016-12-01
Smartphones are being used in a variety of practice settings to measure joint range of motion (ROM). A number of factors can affect the validity of the measurements generated. However, there are no studies examining smartphone-based goniometer applications focusing on measurement variability and error arising from the electromechanical properties of the device being used. To examine the concurrent validity and interrater reliability of 2 goniometric mobile applications (Goniometer Records, Goniometer Pro), an inclinometer, and a universal goniometer (UG). Nonexperimental, descriptive validation study. University laboratory. 3 physical therapists having an average of 25 y of experience. Three standardized angles (acute, right, obtuse) were constructed to replicate the movement of a hinge joint in the human body. Angular changes were measured and compared across 3 raters who used 3 different devices (UG, inclinometer, and 2 goniometric apps installed on 3 different smartphones: Apple iPhone 5, LG Android, and Samsung SIII Android). Intraclass correlation coefficients (ICCs) and Bland-Altman plots were used to examine interrater reliability and concurrent validity. Interrater reliability for each of the smartphone apps, inclinometer and UG were excellent (ICC = .995-1.000). Concurrent validity was also good (ICC = .998-.999). Based on the Bland-Altman plots, the means of the differences between the devices were low (range = -0.4° to 1.2°). This study identifies the error inherent in measurement that is independent of patient factors and due to the smartphone, the installed apps, and examiner skill. Less than 2° of measurement variability was attributable to those factors alone. The data suggest that 3 smartphones with the 2 installed apps are a viable substitute for using a UG or an inclinometer when measuring angular changes that typically occur when examining ROM and demonstrate the capacity of multiple examiners to accurately use smartphone-based goniometers.
Directory of Open Access Journals (Sweden)
Yongjun Zheng
2014-01-01
Full Text Available Objective. To compare ultrasound-guided miniscalpel-needle (UG-MSN release versus ultrasound-guided dry needling (UG-DN for chronic neck pain. Methods. A total of 169 patients with chronic neck pain were randomized to receive either UG-MSN release or UG-DN. Before treatment and at 3 and 6 months posttreatment, pain was measured using a 10-point visual analogue scale (VAS. Neck function was examined using the neck disability index. Health-related quality of life was examined using the physical component score (PCS and mental component score (MCS of the SF-36 health status scale. Results. Patients in the UG-MSN release had greater improvement on the VAS (by 2 points at 3 months and 0.9 points at 6 months versus in the UG-DN arm; (both P<0.0001. Patients receiving UG-MSN release also showed significantly lower scores on the adjusted neck disability index, as well as significantly lower PCS. No severe complications were observed. Conclusion. UG-MSN release was superior to UG-DN in reducing pain intensity and neck disability in patients with chronic neck pain and was not associated with severe complications. The procedural aspects in the two arms were identical; however, we did not verify the blinding success. As such, the results need to be interpreted with caution.
Concentraciones de yodo en orina y en sal de consumo en mujeres entre 12 a 49 años del Perú
Directory of Open Access Journals (Sweden)
Carolina Tarqui-Mamani
Full Text Available Objetivos. Determinar las concentraciones de yodo en orina y sal de consumo en mujeres entre 12 a 49 años en Perú. Materiales y métodos. Se realizó un estudio observacional y transversal. Durante el 2012 y 2013, se incluyó mujeres entre 12 a 49 años residentes en los hogares peruanos seleccionadas mediante un muestreo probabilístico, estratificado y multietápico. La determinación de yodo en orina se realizó por espectrofotometría basada en la reacción de Sandell-Kolthoff. La evaluación cualitativa de yodo en sal se realizó por yoditest y la cuantitativa por volumetría. El procesamiento se realizó mediante muestras complejas con ponderaciones. Se obtuvo medianas, rango intercuartílico y percentiles. Resultados. La mediana de yoduria en las participantes fue 250,4 ug/L; los departamentos con medianas de yoduria elevadas fueron: Moquegua (389,3 ug/L; Tacna (320,5 ug/L; Madre de Dios (319,8 ug/L, y Ucayali (306,0 ug/L; mientras que Puno (192,9 ug/L; Piura (188,1 ug/L y Tumbes (180,5 ug/L tuvieron medianas dentro de lo recomendado por la OMS. La mediana de yoduria en gestantes fue 274,6 ug/L (RIQ: 283 ug/L. El 82,5% de las muestras de sal tuvieron yodo ≥30 ppm y 1,9% tuvo valores de 0 ppm. Conclusiones. La mediana de yoduria en las mujeres peruanas está por encima de lo recomendado por la OMS y la mayoría de las muestras de sal tuvieron concentraciones adecuadas de yodo según la OMS
2011-08-01
GonzalezBUAP, FCFM Lorenzo Díaz CruzBUAP Facultad de Ciencias Físico Matemáticas Luis Rey Díaz BarrónDivisión de Ciencias e Ingenierías Luis UrenaUniversidad de Guanajuato Magda LolaDept. of Physics, University of Patras, Greece Mahmoud WahbaEgyptian Center for Theoretical Physics, MTI Marcus S CohenNew Mexico State University Mario A Acero OrtegaICN - UNAM Mario E GomezUniversidad de Huelva Mark PipeUniversity of Sheffield Mauro NapsucialeDCI-UG Mirco CannoniUniversidad de Huelva Mónica Felipa Ramírez PalaciosUniversidad de Guadalajara Murli Manohar VermaLucknow university, India Nassim BozorgniaUCLA Octavio Obregón Octavio ValenzuelaIA-UNAM Oleg KamaevUniversity of Minnesota Osamu SetoHokkai-Gakuen University Pedro F González DíazIFF, CSIC, Serrano 121, 28006 Madrid, Spain Qaisar ShafiBartol Research Inst. and Delaware U. Raul Hennings-YeomansLos Alamos National Laboratory René Ángeles MartínezDepartamento de Fisica, del DCI de la Universidad de Guanajuato Reyna XoxocotziBUAP, FCFM Rishi Kumar TiwariGovt. Model Science College, Rewa (MP) INDIA Roberto A SussmanICN-UNAM Selim Gómez ÁvilaDCI-UG Sugai KenichiSaitama University Susana Valdez AlvaradoDCI-UG TVladimir - 2K CollaborationColorado State University Tonatiuh MatosCINVESTAV Valeriy DvoeglazovUniversidad de Zacatecas Vannia Gonzalez MaciasDCI-UG Vladimir Avila-ReeseInstituto de Astronomia, UNAM Wolfgang BietenholzINC, UNAM (Mexico) Yamanaka MasatoKyoto Sangyo University Yann MambriniLPT Orsay Yu-Feng ZhouInstitute of Theotretical Physics, Chinese Academy of Sciences, PR China Aaron HigueraDCI-UG Azarael Yebra PérezDCI-UG César Hernández AguayoDCI-UG Jaime Chagoya AlvarezDCI-UG Jonathan Rashid Rosique CampuzanoDCI-UG José Alfredo Soto ÁlvarezDCI-UG Juan Carlos De Haro SantosDCI-UG Luis Eduardo Medina MedranoDCI-UG Maria Fatima Rubio EspinozaDCI-UG Paulo Alberto Rodriguez HerreraDCI-UG Roberto Oziel Gutierrez CotaDCI-UG Rocha Moran Maria PaulinaDCI-UG Xareni Sanchez MonroyDCI-UG
On star-critical and upper size Ramsey numbers
Zhang, Yanbo; Broersma, Haitze J.; Chen, Yaojun
2016-01-01
In this paper, we study the upper size Ramsey number u(G1,G2)u(G1,G2), defined by Erdős and Faudree, as well as the star-critical Ramsey number r∗(G1,G2)r∗(G1,G2), defined by Hook and Isaak. We define Ramsey-full graphs and size Ramsey good graphs, and perform a detailed study on these graphs. We
Unigene BLAST: CBRC-DMEL-04-0010 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0010 gnl|UG|Dm#S40593089 DMG1C.2_1.B05.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3L.17.035.a, mRNA sequence /clone=DMG1-chr3L.17.035.a /gb=EW713128 /gi=156142082 /ug=Dm.15247 /len=1404 1.8 29% ...
The concentration of cadmium in hepatoma among Filipinos
International Nuclear Information System (INIS)
Alejandrino, A.L.; Goze, C.B.; Paradero, R.R.
1977-08-01
The concentration of cadmium in liver hepatoma and in normal liver in Filipinos was determined by atomic absorption spectrophotometry. Using NBS Bovine Liver (SRM1577) as reference material, a value of 0.28+-0.025 ug/g dry weight was obtained for cadmium which is close to the certified NBS value of 0.27+-0.04 ug/g. The mean percentage recovery for cadmium determination by AAS was 98.38%. A mean value of 2.14+-1.58 ug Cd/g liver hepatoma was observed for the 12 cases investigated, showing decreased cadmium levels in the cancerous liver compared to the mean value of 12.62 ug Cd/g observed for normal liver obtained from 10 cases of accidental deaths. The values are expressed on a dry weight basis
Unigene BLAST: CBRC-DMEL-03-0012 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-03-0012 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 0.64 34% ...
Unigene BLAST: CBRC-DMEL-02-0056 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0056 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-11 26% ...
Unigene BLAST: CBRC-DMEL-08-0015 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-08-0015 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 4e-07 35% ...
Unigene BLAST: CBRC-DMEL-08-0038 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-08-0038 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 6e-10 32% ...
Unigene BLAST: CBRC-DMEL-08-0039 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-08-0039 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 4e-07 39% ...
Unigene BLAST: CBRC-DMEL-04-0037 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0037 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-04 26% ...
Unigene BLAST: CBRC-DMEL-04-0005 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0005 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-06 20% ...
Unigene BLAST: CBRC-DMEL-03-0071 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-03-0071 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 3e-07 47% ...
Unigene BLAST: CBRC-DMEL-02-0037 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0037 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-12 26% ...
Unigene BLAST: CBRC-DMEL-04-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0021 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-16 32% ...
Acosta-MontesdeOca, Adriana; Zariñán, Teresa; Macías, Héctor; Pérez-Solís, Marco A; Ulloa-Aguirre, Alfredo; Gutiérrez-Sagal, Rubén
2012-05-01
To gain further insight on the estrogen-dependent transcriptional regulation of the uteroglobin (UG) gene, we cloned the 5'-flanking region of the UG gene from the phylogenetically ancient volcano rabbit (Romerolagus diazi; Rd). The cloned region spans 812 base pairs (bp; -812/-1) and contains a noncanonical TATA box (TACA). The translation start site is 48 bp downstream from the putative transcription initiation site (AGA), and is preceded by a consensus Kozak box. Comparison of the Rd-UG gene with that previously isolated from rabbits (Oryctolagus cuniculus) showed 93% in sequence identity as well as a number of conserved cis-acting elements, including the estrogen-response element (ERE; -265/-251), which differs from the consensus by two nucleotides. In MCF-7 cells, 17β-estradiol (E(2)) induced transcription of a luciferase reporter driven by the Rd-UG promoter in a similar manner as in an equivalent rabbit UG reporter; the Rd-UG promoter was 30% more responsive to E(2) than the rabbit promoter. Mutagenesis studies on the Rd-ERE confirmed this cis-element as a target of E(2) as two luciferase mutant reporters of the Rd-promoter, one with the rabbit and the other with the consensus ERE, were more responsive to the hormone than the wild-type reporter. Gel shift and super-shift assays showed that estrogen receptor-α indeed binds to the imperfect palindromic sequence of the Rd-ERE. Copyright © 2012 Wiley Periodicals, Inc.
Unigene BLAST: CBRC-TGUT-37-0238 [SEVENS
Lifescience Database Archive (English)
Full Text Available egment Chr 11 Brigham & Women's Genetics 0434 expressed variant 2-like mRNA, complete sequence /gb=DQ215253 /gi=76158658 /ug=Tgu.7189 /len=654 1.4 27% ... ...CBRC-TGUT-37-0238 gnl|UG|Tgu#S33942003 Taeniopygia guttata clone 0058P0013A02 DNA s
Next-generation Surface Enhanced Raman Scattering (SERS) Substrates for Hazard Detection
2012-09-01
substrates at differing concentrations ranging from 0.05 ug/cm2 to 50 ug/cm2. These concentrations were independently validated by UV -Vis...standard Klarite substrates at a concentration of 5.0 ug/cm2. The concentration jetted was validated using a secondary UV -Vis technique.(20, 81) After... Spectros ., 994 (1997). [58] Alexander, T.A., Le, D.M., "Characterization of a commercialized SERS-active substrate and its application to the
Directory of Open Access Journals (Sweden)
Roberto Muller
2003-06-01
Full Text Available Objective: To evaluate the applicability of a simplified method forquantitative determination of glucose-6-phosphate dehydrogenaseactivity in normal children; to determine the mean, standarddeviation and threshold value under which the enzyme activity isconsidered deficient. Methods: Blood samples were collected from201 children from two day-care centers in the city of São Paulo.The subjects were considered normal based on physicalexamination and laboratory tests. The enzyme activity wasdetermined in red blood cells of normal children using the “TestCombination G-6-PDH®” kit. The following statistical analyses werecarried out: the results were submitted to Student’s t test,Kolmogorov-Smirnov test, lower confidence interval (one-tailedtest and Spearman’s correlation coefficient. Results: The meanhemoglobin value for girls was slightly higher than the mean valuefor boys, but this difference was not statistically significant. Therewas no statistical difference in mean enzyme activities for Caucasianand non-Caucasian children. There was no significant correlation amongenzyme activity levels, red blood cells, hemoglobin levels,hematocrit, reticulocytes, white blood cells and age of patients.The mean enzyme activity for boys was 4.448 U/g Hb, standarddeviation = 1.380 U/g Hb. For girls, the mean enzyme activity was4.531 U/g Hb, standard deviation = 1.386 U/g Hb, and the differencewas not statistically significant. Therefore, the two populationgroups were considered as one single population, presenting amean enzyme activity of 4.490 U/g Hb, standard deviation = 1.380 U/g Hb.Since the distribution curve of enzyme activity values was normal,a lower confidence interval was determined (one-tailed test, witha cutoff point of 2.227 U/g Hb. Conclusion: The method used bySolem proved to be simple, fast, very accurate and useful to detectglucose-6-phosphate dehydrogenase activity and to identifychildren with enzyme deficiency.
A preliminary study on the physiological effects of aflatoxin B-1 lactating water buffaloes
International Nuclear Information System (INIS)
Abdelaal, A.E.; Naguib, K.M.; Naguib, M.M.
1986-01-01
Aflatoxin B-1 is one of the biologically active mycotoxins, produced as contaminants in human and animal food by a variety of spoilage molds. The effects of administering aflatoxin B-1 on plasma proteins, total thyroxine, cholesterol, zinc and iron were studied in eight lactating buffaloes (3rd and 8th season of lactation). The toxin was first tested in one animal which received single doses of 400, 1000 and 1500 ug each, mixed with 1 Kg ration, given one week apart. Blood, milk and urine samples were collected over the next 120 hrs. The toxin was not detected in either milk or urine. One week later, the latter dose was offered daily, but the animal lost its appetite and did not consume any of the ration offered on the second day. On the third day through the sixth, the toxin (1500 ug in 5 ml chloroform) was injected into the rumen through the flank region using a long needle and a syringe. However, the toxin could not be detected in either milk or urine. After another week, the dose was increased to 5000 ug intraruminally given for 2 days. The toxin appeared in milk and urine. The other seven animals were then included in the experiment and blood samples were collected 10 and 34 hours after dosing. The results obtained (from the pilot test) showed a transient decrease in serum albumin which lasted for 10-24 hours after oral administration of 400, 1000 and 1500 ug in food. This phenomenon was also confirmed in all animals at 34 hrs. after the intraruminal administration of 5000 ug (p>0.01). On the other hand, serum cholesterol was increased (P>0.01). Serum zinc was also increased though insignificantly. However, no appreciable changes were noted in either serum iron or total thyroxine. This experiment has shown that physiological responses may occur before the detection of the toxin in body fluids. It is suggested that measurement of plasma proteins and cholesterol can be used as a test for the toxic effect of aflatoxin, especially at low doses; a case similar to
Directory of Open Access Journals (Sweden)
Paula M. Bermúdez D
2014-01-01
Full Text Available Objetivo: el estudio buscó establecer patrones de resistencia antimicrobiana de 155 cepas de Salmonella spp., aisladas de la superficie de canales de cerdo, procedentes de plantas de beneficio en Colombia. Metodología: mediante el método de difusión en disco (Bauer et. Kirby, 1966 se evaluaron nueve antimicrobianos: Amoxicilina y ácido clavulánico (30 ug, Ampicilina (10 ug, Ceftiofur (30 ug, Ciprofloxacina (5 ug, Cloranfenicol (30 ug, Florfenicol (30 ug, Gentamicina (10 ug, Sulfadiazina y Trimetoprim (25 ug y Tetraciclina (30 ug. Resultados: los resultados confirmaron la presencia de cepas multiresistentes de Salmonella spp. de origen porcino, mostrando 30 patrones diferentes de multiresistencia; el más común fue Ampicilina, Amoxicilina, Cloranfenicol, Florfenicol y Tetraciclina en el 16,77% (n=26 de las cepas. Tetraciclina y Florfenicol fueron los antimicrobianos menos efectivos en el 94,84% (n=147 y 47,74% (n=74 de cepas resistentes, respectivamente. Discusión: se deben consolidar los sistemas de monitoreo, y de vigilancia y control de las resistencias antimicrobianas para prevenir, con un enfoque de cadena productiva, la diseminación de cepas multiresistentes en alimentos de origen animal, como parte integral del sistema de gestión de inocuidad de los alimentos en Colombia. - Objetivo: el estudio buscó establecer patrones de resistencia antimicrobiana de 155 cepas de Salmonella spp., aisladas de la superficie de canales de cerdo, procedentes de plantas de beneficio en Colombia. Metodología: mediante el método de difusión en disco (Bauer et. Kirby, 1966 se evaluaron nueve antimicrobianos: Amoxicilina y ácido clavulánico (30 ug, Ampicilina (10 ug, Ceftiofur (30 ug, Ciprofloxacina (5 ug, Cloranfenicol (30 ug, Florfenicol (30 ug, Gentamicina (10 ug, Sulfadiazina y Trimetoprim (25 ug y Tetraciclina (30 ug. Resultados: los resultados confirmaron la presencia de cepas multiresistentes de Salmonella spp. de origen porcino, mostrando
Wang, Guo-zhong; Liu, Jing-hua; Lü, Shu-zheng; Lü, Yun; Guo, Cheng-jun; Zhao, Dong-hui; Fang, Dong-ping; He, Dong-fang; Zhou, Yuan; Ge, Chang-jiang
2011-05-01
It has been proven that ultrasonic destruction of microbubbles can enhance gene transfection efficiency into the noncardiac cells, but there are few reports about cardiac myocytes. Moreover, the exact mechanisms are not yet clear; whether the characteristic of microbubbles can affect the gene transfection efficiency or not is still controversial. This study was designed to investigate whether the ultrasound destruction of gene-loaded microbubbles could enhance the plasmids carried reporter gene transfection in primary cultured myocardial cell, and evaluate the effects of microbubbles characteristics on the transgene expression in cardiac myocytes. The β-galactosidase plasmids attached to the two types of microbubbles, air-contained sonicated dextrose albumin (ASDA) and perfluoropropane-exposed sonicated dextrose albumin (PESDA) were prepared. The gene transfection into cardiac myocytes was performed in vitro by naked plasmids, ultrasound exposure, ultrasonic destruction of gene-loaded microbubbles and calcium phosphate precipitation, and then the gene expression and cell viability were analyzed. The ultrasonic destruction of gene-loaded microbubbles enhanced gene expression in cardiac myocytes compared with naked plasmid transfection ((51.95 ± 2.41) U/g or (29.28 ± 3.65) U/g vs. (0.84 ± 0.21) U/g, P ASDA ((51.95 ± 2.41) U/g vs. (29.28 ± 3.65) U/g, P < 0.05). Ultrasonic destruction of microbubbles during calcium phosphate precipitation gene transfection enhanced β-galactosidase activity nearly 8-fold compared with calcium phosphate precipitation gene transfection alone ((111.35 ± 11.21) U/g protein vs. (14.13 ± 2.58) U/g protein, P < 0.01). Even 6 hours after calcium phosphate precipitation gene transfection, ultrasound-mediated microbubbles destruction resulted in more intense gene expression ((35.63 ± 7.65) U/g vs. (14.13 ± 2.58) U/g, P < 0.05). Ultrasonic destruction of microbubbles might be a promising method for the delivery of non-viral DNA into
High-temperature vaporization of thorium-uranium mixed monocarbide (Th1-y, Uy)C
International Nuclear Information System (INIS)
Koyama, Tadafumi; Yamawaki, Michio
1989-01-01
Vaporization thermodynamics of thorium-uranium mixed monocarbide phase (Th 1-y , U y )C was studied by mass spectrometric Knudsen effusion method for the compositions of (Th 0.9 , U 0.1 )C 0.855 , (Th 0.8 , U 0.2 )C 0.973 and (Th 0.6 , U 0.4 )C 0.973 . The partial vapor pressures of Th(g) and U(g) and activities of Th and U of these mixed monocarbides were determined at temperatures ranging from about 2000 to 2200 K. Further, the partial pressures of Th(g) and U(g) and activities of Th and U of the stoichiometric mixed monocarbides (Th 1-y , U y )C 1.00 were evaluated by compensating for the effect of carbon content. The Gibbs energies of formation of stoichiometric (Th 1-y , U y )C 1.00 were also evaluated. (orig.)
Directory of Open Access Journals (Sweden)
Halina Waniak-Michalak
2017-06-01
Full Text Available Porównywalność w czasie informacji o wynikach działalności społecznie odpowiedzialnej firm raportujących według zasad GRI The involvement of corporations in corporate social responsibility (CSR activities with respect for work- ers' rights and ethical principles brings tangible benefits to the enterprise. CSR activities can therefore be considered as an investment, the effects of which should be measured. CSR benefits derive from im- proved assessment of the corporation by the stakeholders and increased social trust. However, in order to achieve the desired results of CSR activities, it is necessary to provide adequate information to customers, employees and owners. Moreover, the measurement of CSR results is necessary to determine the effec- tiveness of the actions taken. The aim of the article was to answer the question if companies present the same measures in successive CSR reports and whether it is possible to compare the CSR activity results for successive years. Examination of 31 CSR reports for two consecutive editions of the reporting showed that companies change the number and type of disclosed measures.
DEFF Research Database (Denmark)
Rutt, Rebecca Leigh; Gulsrud, Natalie Marie
2016-01-01
tIn this short communication, we discuss European urban green space (UGS) research from an environ-mental justice perspective. We show that European UGS scholarship primarily focuses on functionalvalues and managerial aspects of UGS, while paying less attention to equity in the enjoyment of andde...... of anddecision-making around UGS. On this basis we discuss potentials for European urban green space researchto take up a more explicit environmental justice framing to shed much-needed light on injustices inEuropean cities and inspire change in policy and practice.......tIn this short communication, we discuss European urban green space (UGS) research from an environ-mental justice perspective. We show that European UGS scholarship primarily focuses on functionalvalues and managerial aspects of UGS, while paying less attention to equity in the enjoyment...
Micro-Physical characterisation of Convective & Stratiform Rainfall at Tropics
Sreekanth, T. S.
Large Micro-Physical characterisation of Convective & Stratiform Rainfall at Tropics begin{center} begin{center} Sreekanth T S*, Suby Symon*, G. Mohan Kumar (1) , and V Sasi Kumar (2) *Centre for Earth Science Studies, Akkulam, Thiruvananthapuram (1) D-330, Swathi Nagar, West Fort, Thiruvananthapuram 695023 (2) 32. NCC Nagar, Peroorkada, Thiruvananthapuram ABSTRACT Micro-physical parameters of rainfall such as rain drop size & fall speed distribution, mass weighted mean diameter, Total no. of rain drops, Normalisation parameters for rain intensity, maximum & minimum drop diameter from different rain intensity ranges, from both stratiform and convective rain events were analysed. Convective -Stratiform classification was done by the method followed by Testud et al (2001) and as an additional information electrical behaviour of clouds from Atmospheric Electric Field Mill was also used. Events which cannot be included in both types are termed as 'mixed precipitation' and identified separately. For the three years 2011, 2012 & 2013, rain events from both convective & stratiform origin are identified from three seasons viz Pre-Monsoon (March-May), Monsoon (June-September) and Post-Monsoon (October-December). Micro-physical characterisation was done for each rain events and analysed. Ground based and radar observations were made and classification of stratiform and convective rainfall was done by the method followed by Testud et al (2001). Radar bright band and non bright band analysis was done for confimation of stratifom and convective rain respectievely. Atmospheric electric field data from electric field mill is also used for confirmation of convection during convective events. Statistical analyses revealed that the standard deviation of rain drop size in higher rain rates are higher than in lower rain rates. Normalised drop size distribution is ploted for selected events from both forms. Inter relations between various precipitation parameters were analysed in three
Unigene BLAST: CBRC-CFAM-33-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CFAM-33-0021 gnl|UG|Cfa#S19197038 ip37b10.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip37b10, mRNA sequence /clone=ip37b10 /gb=CK998901 /gi=45762581 /ug=Cfa.4074 /len=820 2e-18 79% ...
A novel preconcentration technique for the PIXE analysis of water
International Nuclear Information System (INIS)
Savage, J.M.; Robertson, J.D.; Majidi, V.
1994-01-01
The potential of using dried algae as a novel preconcentration technique for the analysis of water samples by PIXE was examined. 5 mg of dried algae powder were mixed with 5 mL of single- and multi-metal solutions. The algae cells were then collected by filtration on 0.6 um polycarbonate membranes and analyzed by PIXE using a dual energy irradiation. When C. vulgatis was used on mixed metal solutions, linear responses were observed for Ag + , Ba 2+ , and Cd 2+ in the concentration range from 10 ng/g to 1 ug/g; for Cu 2+ and Pb 2+ from 10 ng/g to 5 ug/g; and for Hg 2+ from 10 ng/g to 10 ug/g. When S. bacillaris was used, linear responses were observed from 10 ng/g up to 10 ug/g for all of the metal cations investigated. The PIXE results demonstrated that metal binding at low concentrations involves replacement of sodium on the cell wall and that at high concentrations magnesium is also replaced
Dicty_cDB: Contig-U15201-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2e-04 2 ( EX698640 ) GF_AW109651c08 AW1 Schistosoma mansoni cDNA clone... 44 2e-04 2 ( CD147...-0107T-L395-E12-U.B MG1-0107 Schistosoma manso... 44 2e-04 2 ( CD147233 ) ML1-0002T-M131-E11-U.G ML1-0002 Sc
Directory of Open Access Journals (Sweden)
Yufei Tan
2016-11-01
Full Text Available The techniques of pressurized mining and hydraulic fracturing are often used to improve gas well productivity at the later development stage of low-permeability carbonate gas reservoirs, but reservoirs are watered out and a great number of micro fractures are produced. Therefore, one of the key factors for underground gas storages (UGS rebuilt from low-permeability fractured gas reservoirs with CO2 as the cushion gas is how to expand storage capacity effectively by injecting CO2 to displace water and to develop control strategies for the stable migration of gas–water interface. In this paper, a mathematical model was established to simulate the gas–water flow when CO2 was injected into dual porosity reservoirs to displace water. Then, the gas–water interface migration rules while CO2 was injected in the peripheral gas wells for water displacement were analyzed with one domestic UGS rebuilt from fractured gas reservoirs as the research object. And finally, discussion was made on how CO2 dissolution, bottom hole flowing pressure (BHFP, CO2 injection rate and micro fracture parameters affect the stability of gas–water interface in the process of storage capacity expansion. It is shown that the speed of capacity expansion reaches the maximum value at the fifth cycle and then decreases gradually when UGS capacity is expanded in the pattern of more injection and less withdrawal. Gas–water interface during UGS capacity expansion is made stable due to that the solubility of CO2 in water varies with the reservoir pressure. When the UGS capacity is expanded at constant BHFP and the flow rate, the expansion speed can be increased effectively by increasing the BHFP and the injection flow rate of gas wells in the central areas appropriately. In the reservoir areas with high permeability and fracture-matrix permeability ratio, the injection flow rate should be reduced properly to prevent gas–water interface fingering caused by a high-speed flow
1991-12-01
support the NPDES permit renewal appl ication. the studies should collect sufficient data to characterize waste streams, including wastewater and WINTP...26Apr 1 30Apr I 1May I 2May Arsenic I uiI i ! Barium I ug l I i . 4001 SWot 1000 " 2600 Beryllium J ug 1 <o 0 <o
Heavy Metals Contamination in Coastal Sediments of Karachi, Pakistan
Siddique, A.; Mumtaz, M.; Zaigham, N. A.; Mallick, K. A.; Saied, S.; Khwaja, H. A.
2008-12-01
Toxic compounds such as heavy metals exert chronic and lethal effects in animals, plants, and human health. With the rapid industrialization, urbanization, and economic development in Karachi, heavy metals are continuing to be introduced to estuarine and coastal environment through rivers, runoff and land-based point sources. Pollution in the Karachi coastal region (167 km long) is mainly attributed to Lyari and Malir Rivers flowing through the city of Karachi. Both rivers are served by various channels of domestic and industrial wastes carrying more than 300 million gallons per day untreated effluent of 6000 industries and ultimately drain into the beaches of Arabian Sea. Concentrations of selected heavy metals (Cd, Co, Cr, Cu, Fe, Mn, Ni, Pb, and Zn) in surface sediments from eighty-eight sites in Karachi coastal region were studied in order to understand metal contamination due to industrialization, urbanization, and economic development in Karachi. Sediment samples were collected in 2005 and 2006. We have found that heavy metal concentrations in surface sediments varied from 0.006 to 24.3 ug/g for Cd, 5.1 to 95 ug/g for Co, 2.9 to 571 ug/g for Cr, 6.9 to 272 ug/g for Cu, 0.55 to 6.5% for Fe, 1.2 to 318 ug/g for Mn, 7.5 to 75 ug/g for Ni, 6.3 to 121 ug/g for Pb, and 3.3 to 389 ug/g for Zn. Enrichment factors (EFs) were calculated to assess whether the concentrations observed represent background or contaminated levels. The highest levels of metals were found to be at the confluence of the Lyari and Malir River streams at the Arabian Sea, indicating the impact of the effluents of the highly urbanized and industrialized city of Karachi. Furthermore, this study assessed heavy metal toxicity risk with the application of Sediment Quality Guideline (SQG) indices (effect range low/effect range median values, ERL/ERM). Results indicated that the potential toxicity of marine environment can cause adverse biological effects to the biota directly and the human health
Unigene BLAST: CBRC-DRER-15-0113 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0113 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-51 73% ...
Unigene BLAST: CBRC-DRER-15-0106 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0106 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-51 75% ...
Unigene BLAST: CBRC-DRER-15-0110 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0110 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-71 99% ...
The anger-infused Ultimatum Game: A reliable and valid paradigm to induce and assess anger.
Gilam, Gadi; Abend, Rany; Shani, Hagai; Ben-Zion, Ziv; Hendler, Talma
2018-03-22
The Ultimatum Game (UG) is a canonical social decision-making task whereby a proposer divides a sum of money between himself and a responder who accepts or rejects the offer. Studies consistently demonstrate that unfair offers induce anger, and that rejecting such offers relates to aggression. Nevertheless, the UG is limited in interpersonal provocations common to real-life experiences of anger. Moreover, the psychometric properties of the UG as an anger-induction paradigm have yet to be evaluated. Here, to induce a more intense and genuine anger experience, we implemented a modified UG whereby short written provocations congruent with unfairness levels accompanied each offer. We aimed to test whether this anger-infused UG led to more anger and aggressive responses relative to the standard UG and to establish the reliability and validity of both versions. Participants performed either the anger-infused UG or a standard version, repeated twice, a week apart. They also performed the Taylor Aggression Paradigm, a reactive aggression paradigm, and completed emotion ratings and a trait anger inventory. Results indicate similar decreases in acceptance rates with increase in offer unfairness, and increases in reported anger, across both UG versions. Both versions demonstrated strong test-retest reliability. However, the anger-infused UG led to significantly stronger relations with reactive aggression and trait anger compared to the standard UG, providing evidence for better validity. The development of the anger-infused UG as a reliable and valid paradigm is pivotal for the induction and assessment of interpersonal anger and its aggressive expression in basic and clinical research settings. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
Directory of Open Access Journals (Sweden)
S.S. BABA
1998-11-01
Full Text Available The antigenic relationship of 9 flaviviruses, Yellow fever (YF , Wesselsbron (WSL , Uganda S (UGS , Potiskum (POT, West Nile (WN , Banzi (BAN , Zika (ZK , Dengue type 1 (DEN-1 and Dengue type 2 (DEN-2, was assessed by cross-haemagglutination-inhibition (Cross-HI and cross-complement fixation (Cross-CF reactions between each of the viruses and their homologous immune mouse ascitic fluids. Titre ratios were calculated using the heterologous and homologous titres. Cross-CF reactions revealed wider antigenic variations among viruses than Cross-HI reactions. There was no significant antigenic variation between WSL, POT and YF viruses using either of those methods. However, definite differences in antigenicity were observed between them and UGS, BAN and ZK viruses. There were no significant differences between UGS, BAN and ZK or between DEN-1 and DEN-2. The serological relationship among flaviviruses is important in establishing diagnosis and epidemiology of these infections in Africa.A relação antigênica de 9 Flavivirus, Febre amarela (YF, Wesselsbron (WSL, Uganda S (UGS, Potiskum (POT, West Nile (WN, Banzi (BAN, Zika (ZK, Dengue tipo 1 (DEN-1 e Dengue tipo2 (DEN-2, foi avaliada por reação de inibição da hemaglutinação cruzada (cross-HI e reação de fixação do complemento cruzada (Cross-CF entre cada um dos virus e seu fluido ascítico homólogo em camundongos. Médias de títulos foram calculadas usando os títulos heterólogos e homólogos. Reações cruzadas CF revelaram maiores variações antigênicas entre virus do que reações cruzadas HI. Não houve variação antigênica significativa entre virus WSL, POT e YF usando cada um dos métodos. Todavia, diferenças definidas da antigenicidade foram observadas entre eles e os vírus UGS, BAN e ZK. Não existiram diferenças significativas entre UGS, BAN e ZK ou entre DEN-1 e DEN-2. A relação sorológica entre Flavivirus é importante para se estabelecer o diagnóstico e a
Gelatin methacrylamide as coating material in cell culture.
Egger, Michael; Tovar, Günter E M; Hoch, Eva; Southan, Alexander
2016-06-13
Unmodified gelatin (uG) is widely used as a coating material in cell culture for improving surface properties. In this study, the authors investigated if gelatin methacrylamide (GM) with a medium degree of methacrylamide modification (GM1.5) and a high degree of methacrylamide modification (GM4) are equally suitable for this purpose. Therefore, gold surfaces were coated with uG, GM1.5, and GM4 by adsorption of the polymers on the surfaces. Coating success was confirmed by spectroscopic ellipsometry, contact angle measurements, surface plasmon resonance spectroscopy (SPRS), and atomic force microscopy (AFM). The authors found that upon adsorption of uG, GM1.5, a nd GM4 on gold, thin films with thicknesses of 2.95 nm, 2.50 nm, and 2.26 nm were formed. The coated surfaces showed advancing contact angles of 46° (uG and GM1.5) and 52° (GM4) without alteration of the surface roughness determined by AFM. Protein adsorption taking place on the coated surfaces was measured during contact of the surfaces with fetal calf serum by SPRS. Protein adsorption on the coated surfaces was reduced by the factor of 6.4 (uG), 5.4 (GM1.5), and 4.6 (GM4) compared to gold surfaces. Human fibroblasts cultured on the surfaces showed excellent viability shown by water soluble tetrazolium salt assay as well as live/dead staining with propidium iodide and fluorescein diacetate. No cytotoxic effects of the GM coated surfaces were observed, giving rise to the conclusion that GMs are suitable materials as coatings in cell culture.
Lu, Congxiang; Liu, Wen-wen; Pan, Hui; Tay, Beng Kang; Wang, Xingli; Liang, Kun; Wei, Xuezhe
2018-05-01
In this work, a three dimensional (3D) interconnected carbon network consisting of ultrathin graphite (UG) and carbon nanotubes (CNTs) on Ni foam is fabricated and employed as a novel type of substrate for mesoporous NiCo2O4 nano-needles. The successfully synthesized NiCo2O4 nano-needles/CNTs/UG on Ni foam has many advantages including facile electrolyte access and direct conducting pathways towards current collectors, which enable it to be a promising electrode material in battery-like electrochemical energy storage. Encouragingly, a high capacity of 135.1 mAh/g at the current density of 1 A/g, superior rate performance and also stable cycling for 1200 cycles at the current density of 5 A/g have been demonstrated in this novel material.
Energy Technology Data Exchange (ETDEWEB)
Vogel, M., E-mail: M.Vogel@fzd.de; Guenther, A.; Rossberg, A.; Li, B.; Bernhard, G.; Raff, J.
2010-12-15
Biosorption of uranium(VI) by the green alga Chlorella vulgaris was studied at varying uranium concentrations from 5 {mu}M to 1 mM, and in the environmentally relevant pH range of 4.4 to 7.0. Living cells bind in a 0.1 mM uranium solution at pH 4.4 within 5 min 14.3 {+-} 5.5 mg U/g dry biomass and dead cells 28.3 {+-} 0.6 mg U/g dry biomass which corresponds to 45% and 90% of total uranium in solution, respectively. During 96 h of incubation with uranium initially living cells died off and with 26.6 {+-} 2.1 mg U/g dry biomass bound similar amounts of uranium compared to dead cells, binding 27.0 {+-} 0.7 mg U/g dry biomass. In both cases, these amounts correspond to around 85% of the initially applied uranium. Interestingly, at a lower and more environmentally relevant uranium concentration of 5 {mu}M, living cells firstly bind with 1.3 {+-} 0.2 mg U/g dry biomass to 1.4 {+-} 0.1 mg U/g dry biomass almost all uranium within the first 5 min of incubation. But then algal cells again mobilize up to 80% of the bound uranium during ongoing incubation in the time from 48 h to 96 h. The release of metabolism related substances is suggested to cause this mobilization of uranium. As potential leachates for algal-bound uranium oxalate, citrate and ATP were tested and found to be able to mobilize more than 50% of the algal-bound uranium within 24 h. Differences in complexation of uranium by active and inactive algae cells were investigated with a combination of time-resolved laser-induced fluorescence spectroscopy (TRLFS), extended X-ray absorption fine structure (EXAFS) spectroscopy and attenuated total reflection Fourier transform infrared (ATR-FTIR) spectroscopy. Obtained results demonstrated an involvement of carboxylic and organic/inorganic phosphate groups in the uranium complexation with varying contributions dependent on cell status, uranium concentration and pH.
International Nuclear Information System (INIS)
Vogel, M.; Guenther, A.; Rossberg, A.; Li, B.; Bernhard, G.; Raff, J.
2010-01-01
Biosorption of uranium(VI) by the green alga Chlorella vulgaris was studied at varying uranium concentrations from 5 μM to 1 mM, and in the environmentally relevant pH range of 4.4 to 7.0. Living cells bind in a 0.1 mM uranium solution at pH 4.4 within 5 min 14.3 ± 5.5 mg U/g dry biomass and dead cells 28.3 ± 0.6 mg U/g dry biomass which corresponds to 45% and 90% of total uranium in solution, respectively. During 96 h of incubation with uranium initially living cells died off and with 26.6 ± 2.1 mg U/g dry biomass bound similar amounts of uranium compared to dead cells, binding 27.0 ± 0.7 mg U/g dry biomass. In both cases, these amounts correspond to around 85% of the initially applied uranium. Interestingly, at a lower and more environmentally relevant uranium concentration of 5 μM, living cells firstly bind with 1.3 ± 0.2 mg U/g dry biomass to 1.4 ± 0.1 mg U/g dry biomass almost all uranium within the first 5 min of incubation. But then algal cells again mobilize up to 80% of the bound uranium during ongoing incubation in the time from 48 h to 96 h. The release of metabolism related substances is suggested to cause this mobilization of uranium. As potential leachates for algal-bound uranium oxalate, citrate and ATP were tested and found to be able to mobilize more than 50% of the algal-bound uranium within 24 h. Differences in complexation of uranium by active and inactive algae cells were investigated with a combination of time-resolved laser-induced fluorescence spectroscopy (TRLFS), extended X-ray absorption fine structure (EXAFS) spectroscopy and attenuated total reflection Fourier transform infrared (ATR-FTIR) spectroscopy. Obtained results demonstrated an involvement of carboxylic and organic/inorganic phosphate groups in the uranium complexation with varying contributions dependent on cell status, uranium concentration and pH.
Immobilization of Aspergillus niger. beta. -D-glucosidase on aminated chitin and alumina/alginate
Energy Technology Data Exchange (ETDEWEB)
Bon, E.; Freire, D.; Mendes, M.F.; Soares. V.F.
1986-01-01
The immobilization of ..beta..-glucosidase was studied by (a) covalent coupling to aminated chitin (IME-C) and (b) adsorption onto alumina followed by gel entrapment of the suspension with calcium alginate (IME-A). The levels of catalytic activity determined against salicin at 50 C were 23.0 U/g and 0.2 U/g for the IME-C and IMA-A respectively. The first system was shown to be quite stable with a loss of only 2% of the initial activity over 14 days. The IME-A system had a half life of 14 days. The activity of IME-C was studied using cellobiose and enzymatic hydrolysates of sugar cane bagasse at several cellobiose concentrations. The activities obtained with cellobiose were 104.0 U/g and 72.0 U/g respectively. 13 references.
2016-04-01
ES2 OVCAR8 LnCap PC-3 C4-2 Cell Count 1.8X108 1x108 1.1X108 1.24X108 1.1X108 Episomal DNA (ug) 21.3 23.7 26 15.6 20.4 Starting DNA (ug) 21.3 23.7...kidney, liver, lung, skeletal muscle, spleen, sperm , testis and thymus) (5). EccDNA sequences were then enriched by multiple displacement amplification...including sperm . MicroDNAs arise preferentially from areas with high gene density, GC content, and exon density from promoters with activating chro
Gene : CBRC-HSAP-06-0003 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-06-0003 Novel 6 D UNKNOWN CN165_HUMAN 2e-21 63% dbj|BAC85887.1| unnamed protein product [Homo sapi...ens] 7e-35 68% gnl|UG|Hs#S28297950 DA109160 BRACE3 Homo sapiens cDNA clone BRACE302...5623 5', mRNA sequence /clone=BRACE3025623 /clone_end=5' /gb=DA109160 /gi=80475782 /ug=Hs.690917 /len=598 1e-39 69% MAPI...YRHMPPYPTNFCIFSRDRLSLCWPGWSPFLISGDPAALVSQSAGITGVSHGTWPFDCFSSFELGLFLPPHSPIAILEILGYQILPGQVSAPIDAYSNAVPFSHGF ...
Recombinant bovine uteroglobin at 1.6 Å resolution: a preliminary X-ray crystallographic analysis
International Nuclear Information System (INIS)
Decken, Victoria von der; Delbrück, Heinrich; Herrler, Andreas; Beier, Henning M.; Fischer, Rainer; Hoffmann, Kurt M. V.
2005-01-01
The crystallization of recombinant bovine uteroglobin. Uteroglobin (UG) is a conserved protein which is induced by progesterone and secreted by the epithelia of various mammalian reproductive and respiratory organs. Recombinant bovine uteroglobin (recbUG), consisting of 80 amino acids with a C-terminal His 6 tag, was overexpressed in Escherichia coli and purified. The protein was crystallized in two geometric forms, rhomboid and cuneate (wedge-shaped), by the hanging-drop vapour-diffusion method at 295 K. The rhomboid crystals diffracted to a maximum resolution of 1.6 Å using synchrotron radiation. These crystals belong to space group P2 1 2 1 2, with unit-cell parameters a = 81.42, b = 82.82, c = 45.26 Å, and contain four monomers per asymmetric unit. The cuneate crystals diffracted to 2.35 Å resolution using a rotating-anode generator. These crystals belong to space group C222 1 , with unit-cell parameters a = 43.39, b = 93.94, c = 77.30 Å, and contain two molecules per asymmetric unit
Niedbalski, Zbigniew; Nguyen, Phu Minh Vuong; Widzyk-Capehart, Eleonora
2018-03-01
Nowadays, for a number of reasons, many open pit mines are considering a transition from Open Pit (OP) to Underground (UG) to remain competitive. In OP-UG transition, UG operation is operated simultaneously with the OP operation for a certain period of time. Guidelines for the simultaneous operation of OP and UG are very difficult to establish, as there are very few case studies available. Yet, because of the OP-UG interactions; the operation has a higher safety, technical and management requirements than the OP or UG methods when considered separately. In Vietnam, Cao Son is one of many OP mines, which decided to change the operational system from OP to UG. Simultaneous operation started in 2015 and will be conducted until 2030 when the OP mine Cao Son ends its mining activities. In this paper, selected geomechanical considerations of the simultaneous operation are presented. A number of numerical modelling calculations using finitedifference software with code FLAC were carried out for calibration process, slope stability analysis and the OP-UG interaction analysis for the Cao Son - Khe Cham II-IV mine. Based on the results obtained from numerical modelling, the geomechanical assessments of simultaneous operation Cao Son - Khe Cham II-IV are discussed in this paper.
Directory of Open Access Journals (Sweden)
Hsueh-Sheng Chang
2015-09-01
Full Text Available The compact city is becoming a prevailing paradigm in the world to control urban sprawl and achieve a pattern of sustainable urban development. However, discussions of the area's overcrowded neighborhoods, its health problems, and the destruction of its green areas have inspired self-examination with respect to the compact city paradigm. High population density attracts even more residents and frequently renders the existing urban green space (UGS insufficient for use as part of a living environment. Due to the unique benefits that these qualities confer, UGS allocation is now considered a significant contributing factor to urban livability. In addition, the UGS allocation may be different due to the presence of many spatial non-stationarity processes. Therefore, this study employs geographically-weighted regression (GWR to explore the unique and spatially-explicit relationships between the degree of urban compaction and UGS within the Taipei metropolitan area. Maps summarizing the GWR results demonstrate that there is significantly insufficient UGS allocation in the central area, which consists mainly of Taipei City. Townships with higher parameters contain UGS levels that better meet the needs of their residents. Overall, the exploration of conceptualizing spatial heterogeneity of relationships between the degree of urban compaction and UGS can provide insightful analyses for decision-making on allocating UGS.
Characterization of oils from Duranta repens leaf and seed
Directory of Open Access Journals (Sweden)
Agomuo Emmanuel
2017-11-01
Full Text Available The knowledge of the chemical composition of unpopular sources of edible oils has become paramount to supplement the usage of widely known vegetable oils. In this study, the gas chromatographic quantification of fatty acids and phytochemicals was carried out, and the physicochemical and micronutrient composition of Duranta repens leaf and seed oil were evaluated using standard methods. The leaf oils contained significantly higher (p oleic > myristic > stearic > capric > linoleic > lauric > palmitoleic for the seed oil, while for the leaf oil linoleic > palmitoleic > oleic > stearic > palmitic > myristic > capric > lauric > myristoleic. The major phytochemical constituents of the seed oils were catechin (68.12 ug/ml, saponin (44.03 ug/ml, rutin (32.89 ug/ml, linamarin (22.66 ug/ml and tannins (19.62 ug/ml, while kaempherol (84.05 ug/ml, rutin (62.26 ug/ml and saponins (45.63 ug/ml were mostly predominant in the leaf oil. Spartein, anthocyanins and phytates were among the least phytochemicals in composition, for both samples. These chemical properties evaluated, suggest that Duranta repens seed oil is more suitable for industrial and therapeutic purposes.
Unigene BLAST: CBRC-HSAP-23-0072 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-23-0072 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 100% ...
Unigene BLAST: CBRC-HSAP-23-0073 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-23-0073 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 100% ...
Unigene BLAST: CBRC-HSAP-23-0071 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-23-0071 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 95% ...
International Nuclear Information System (INIS)
Santos, Flora L.; Pabroa, Preciosa Corazon B.; Morco, Ryan P.; Racho, Joseph Michael D.
2007-01-01
In the Philippines, it has been a yearly tradition to welcome the coming of the New Year with the loudest noise as can be achieved. Firecrackers and fireworks have been a necessity for Filipinos during this time despite bans on the use of most of these and despite the Department of Health (DOH) campaign to use alternative safe practices to welcome the New Year. Data for PM 10 samples (fractionated as PM 10-2.2 or the course fraction and PM2.2 or the fine fraction) collected in four PNRI sampling sites in Metro Manila show the air pollution impacts of fireworks on New Year's Eve. Samples were collected from 1998 to 2006 using a Gent dichotomous sampler in connection with the PNRI project P articulate Matter Source Apportionment Using Nuclear and Related Analytical Techniques . Particulate mass was determined by gravimetry. Elemental analysis of the air filters was done using X-ray Fluorescence Spectrometry (X RF) or Particle induced X-ray Emission (PIXE), multielemental non-destructive nuclear analytical techniques. Black carbon was analyzed using reflectometry. PM 10 values increased by two to four times the usual averages (36.4 to 55.4 ug/cum) and in 2002 even exceeded the PNAAQ short-term guideline value of 150 ug/cum at the ADMU sampling station. PM2.2 values increased by two to six times the usual averages (15 to 28 ug/cum), even many times exceeding US EPA short-term guideline value of 65 ug/cum. The increase in the particulate mass of New Year's Day samples can be attributed more to an increase in the metal pollutants rather than the black carbon, with higher contribution to the fine fraction. Increase in the elemental concentrations of Al, S, Cl, K, Ba, Sr, Ti, V, Mn, Cu and Pb were observed with the highest contribution from K. Results show that the usual practices of burning firecrackers and fireworks during New Year's day celebration is a very strong source of air pollution which contributes significantly high amount of metal pollutants in the air
Steadman, Bob; Finklea, John; Kershaw, James; Loughman, Cathy; Shaffner, Patti; Frost, Dean; Deller, Sean
2014-06-01
Textron's Advanced MicroObserver(R) is a next generation remote unattended ground sensor system (UGS) for border security, infrastructure protection, and small combat unit security. The original MicroObserver(R) is a sophisticated seismic sensor system with multi-node fusion that supports target tracking. This system has been deployed in combat theaters. The system's seismic sensor nodes are uniquely able to be completely buried (including antennas) for optimal covertness. The advanced version adds a wireless day/night Electro-Optic Infrared (EOIR) system, cued by seismic tracking, with sophisticated target discrimination and automatic frame capture features. Also new is a field deployable Gateway configurable with a variety of radio systems and flexible networking, an important upgrade that enabled the research described herein. BattleHawkTM is a small tube launched Unmanned Air Vehicle (UAV) with a warhead. Using transmitted video from its EOIR subsystem an operator can search for and acquire a target day or night, select a target for attack, and execute terminal dive to destroy the target. It is designed as a lightweight squad level asset carried by an individual infantryman. Although BattleHawk has the best loiter time in its class, it's still relatively short compared to large UAVs. Also it's a one-shot asset in its munition configuration. Therefore Textron Defense Systems conducted research, funded internally, to determine if there was military utility in having the highly persistent MicroObserver(R) system cue BattleHawk's launch and vector it to beyond visual range targets for engagement. This paper describes that research; the system configuration implemented, and the results of field testing that was performed on a government range early in 2013. On the integrated system that was implemented, MicroObserver(R) seismic detections activated that system's camera which then automatically captured images of the target. The geo-referenced and time-tagged Micro
Unigene BLAST: CBRC-HSAP-07-0070 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-07-0070 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 1e-80 43% ...
Directory of Open Access Journals (Sweden)
Niewiadowska Alicja
2014-10-01
Full Text Available The occurrence and concentrations of organochlorine pesticides and polychlorinated biphenyls (PCBs were determined in 158 muscle samples of bream (Abramis brama and roach (Rutilus rutilus, and 84 samples of sediments collected from 10 river and lake sampling sites in 2011 and 2012. The concentrations of DDTs (p,p’-DDT, o,p’-DDT, p,p’-DDE, and p,p’-DDD, HCH isomers (a-, ß-, and y-HCH, HCB, and PCBs (six indicator PCB congeners 28, 52, 101, 138, 153 and 180 were determined using the capillary gas chromatography. The mean concentrations of DDTs in bream and roach were in the range of 11.2-654 and 4.5-121 ug/kg wet weight respectively, and PCBs were in the range of 1.3-75.9 and 1.1-112 ug/kg wet weight, respectively. Mean concentrations of DDTs and PCBs in sediments were 0.5-270 ug/kg dry weight and ⋋0.1-2.2 ug/kg dry weight respectively. The study showed clear spatial differences in the levels of organochlorine pesticides and PCBs in fish and sediments from different aquatic ecosystems. The highest levels of contaminants were detected in fish and sediments from the Vistula River in vicinity of Cracow. The possible risk to the fish meat consumers and ecological risk were evaluated.
Unigene BLAST: CBRC-TGUT-29-0000 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TGUT-29-0000 gnl|UG|Tgu#S36163076 Taeniopygia guttata clone 0057P0006B02 megalencephalic leukoencephalo...pathy with subcortical cysts 1-like mRNA, complete sequence /gb=EF191703 /gi=120431699 /ug=Tgu.3485 /len=1532 1.8 21% ...
Composition and color stability of anthocyanin-based extract from purple sweet potato
Directory of Open Access Journals (Sweden)
Xiu-li He
2015-09-01
Full Text Available AbstractPurple sweet potato (PSP can provide products with attractive color besides nutritious benefits in food processing. So, the compositions and color stability of an aqueous anthocyanin-based PSP extract were investigated in order to promote its wide use in food industry. PSP anthocyanins were extracted with water, and nine individual anthocyanins (48.72 ug mL–1 in total, 24.36 mg/100 g fresh PSP in yield were found by HPLC analysis. The PSP extract also contained 17.11 mg mL–1 of protein, 0.44 mg mL–1 of dietary fiber, 2.82 mg mL–1 of reducing sugars, 4.02 ug mL–1 of Se, 54.21 ug mL–1 of Ca and 60.83 ug mL–1 of Mg. Changes in color and stability of the PSP extract, as affected by pH, heat, light and extraction process, were further evaluated. Results indicated that PSP anthocyanins had good stability at pH 2.0-6.0, while the color of PSP extract kept stable during 30 days of storage at 20 °C in dark. Both UV and fluorescent exposure weakened the color stability of PSP extract and UV showed a more drastic effect in comparison. A steaming pretreatment of fresh PSP is beneficial to the color stability.
Xylanase production by a local fungal isolate, Aspergillus niger USM AI 1 via solid state
Directory of Open Access Journals (Sweden)
Ibrahim Che Omar
2005-03-01
Full Text Available Isolate USM A1 I which was identified to be Aspergillus niger was selected as a potential producer of xylanase via a solid state fermentation system (SSF using palm kernel cake (PKC as substrate. The modification of the physical conditions of the SSF system indicated that the xylanase activity was 23.97 U/g PKC at the moisture ratio of 1:0.75 of PKC: moistening agent with the inoculum size of 1¥104 spores/ml and cultivated at the ambient temperature (28±3ºC. The supplementation of additional carbon and nitrogen sources in the PKC medium could enhance enzyme productivity. The maximum production of xylanase and growth obtained with the supplementation of xylose at 0.75% (w/w were 25.40 U/g and 1.69 mg glucosamine/ g PKC. Moreover, the presence of NaNO3 at 0.075% (w/w as additional nitrogen source further enhanced xylanase production to 33.99 U/g PKC although the growth remained unchanged at about 1.67 mg glucosa- mine/g PKC. The optimized conditions showed an increased xylanase production by 157% compared to before the optimization of the SSF system. The xylanase productivity was 23.12 U/mg glucosamine after optimization and 11.72 U/mg glucosamine before optimization.
Directory of Open Access Journals (Sweden)
Iván Lozada-Requena
2009-04-01
Full Text Available Objetivo. Determinar el efecto de un extracto hidroalcohólico de uña de gato, Uncaria tomentosa (UG sobre células dendríticas (DC de sangre periférica y la expresión de HLA-DR y CD86 en muestras de sangre periférica de individuos sanos tratadas con lipopolisacáridos (LPS. Materiales y métodos. El polvo de la corteza de UG se preparó como una decocción estéril a 30g/L por 30 minutos. Se obtuvo muestras de sangre periférica de individuos sanos. Las células mononucleares de sangre periférica (CMSP fueron separadas por gradiente de centrifugación, pretratadas o no durante dos horas con distintas concentraciones de UG y estimuladas 24 h con LPS, luego fueron marcadas con anticuerpos monoclonales fluorescentes específicos para HLA-DR, Linaje tipo 1 (Lin1, CD11c y CD86 y preparadas para la citometría de flujo. Resultados. Comparando con el grupo de CMSP con LPS pero sin UG se observó, de manera dosis dependiente, una disminución en el porcentaje de DC mieloides (DCm (p<0,05 y una tendencia a incrementar el porcentaje de DC plasmacitoides (DCp. En las DCp se observó una disminución de la intensidad de fluorescencia media (IFM de HLA-DR sólo a 500 y 1000 μg/mL de UG (p<0,001; mientras que hubo un incremento de la IFM de CD86 en todo el rango (p<0,05. En DCm a las mismas concentraciones no se observó efecto de UG sobre la IFM de HLA-DR y CD86. Conclusiones. Este extracto estandarizado de UG tiende a incrementar el porcentaje de DCp y disminuye el porcentaje de DCm. UG no afecta la expresión de HLA-DR y CD86 en DCm. Este estudio demuestra que este extracto de UG favorece la activación/diferenciación de DCp, la cual participa en mecanismos de respuesta inmune adaptativa.
Unigene BLAST: CBRC-HSAP-23-0073 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-23-0073 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-80 43% ...
Unigene BLAST: CBRC-GGAL-04-0034 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-30 26% ... ...CBRC-GGAL-04-0034 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-HSAP-10-0031 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-10-0031 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 4e-34 27% ...
Unigene BLAST: CBRC-GGAL-04-0026 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 1e-25 28% ... ...CBRC-GGAL-04-0026 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-HSAP-01-0117 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-01-0117 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 9e-33 31% ...
Unigene BLAST: CBRC-HSAP-10-0031 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-10-0031 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-32 28% ...
Unigene BLAST: CBRC-HSAP-23-0072 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-23-0072 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-80 43% ...
Unigene BLAST: CBRC-GGAL-19-0006 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-87 50% ... ...CBRC-GGAL-19-0006 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-GGAL-12-0011 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-32 30% ... ...CBRC-GGAL-12-0011 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-GGAL-19-0006 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 0.0 100% ... ...CBRC-GGAL-19-0006 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-HSAP-07-0070 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-07-0070 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 0.0 100% ...
Directory of Open Access Journals (Sweden)
P. M. Bermúdez
2016-01-01
Full Text Available La diseminación de Salmonella spp. resistente a antimicrobianos en las cadenas productivas de alimentos de origen animal es una preocupación de salud pública de carácter mundial. Este estudio describe los patrones de resistencia antimicrobiana de 283 aislamientos de Salmonella enterica procedentes de plantas de beneficio porcino en Colombia. Se evaluó la susceptibilidad antimicrobiana frente a diez antimicrobianos mediante el método de difusión en disco: amoxacilina-ácido clavulánico (30 ug, ampicilina (10 ug, ceftiofur (30 ug, ciprofloxacina (5 ug, cloranfenicol (30 ug, florfenicol (30 ug, gentamicina (10 ug, sulfadiazina/trimetroprim (25 ug, tetraciclina (30 ug y tilmicosina (15 ug. Los resultados evidenciaron la presencia de 279 aislamientos multirresistentes de Salmonella enterica de origen porcino provenientes del ambiente y del producto terminado en las plantas de beneficio evaluadas (46,64% n: 132. Se detectaron 52 patrones de multiresistencia: el más común fue ceftiofur-tetraciclina-tilmicosina en el 9,89% (n: 28 de los aislamientos. Con referencia a estos antimicrobianos, 96,82% (n: 274 de los aislamientos fueron resistentes a tetraciclina, 73,14% (n: 207 a tilmicosina y 28,27% (n: 80 a ceftiofur. De especial interés fue la alta proporción de aislamientos resistentes a ceftiofur, debido a una posible resistencia cruzada con ceftriaxona. Los resultados obtenidos demuestran la necesidad de promover el diseño e implementación de un Programa oficial Integrado de Vigilancia de la Resistencia Antimicrobiana, además de sistemas de monitoreo voluntario en cada eslabón de la cadena productiva porcina, para contribuir a la prevención y control de la transmisión de microorganismos resistentes de origen alimentario en el marco del sistema de gestión de inocuidad alimentaria en Colombia.
VHF signal power suppression in stratiform and convective precipitation
Directory of Open Access Journals (Sweden)
A. J. McDonald
2006-03-01
Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.
VHF signal power suppression in stratiform and convective precipitation
Directory of Open Access Journals (Sweden)
A. J. McDonald
2006-03-01
Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.
This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal
Unigene BLAST: CBRC-MDOM-06-0030 [SEVENS
Lifescience Database Archive (English)
Full Text Available ed neurotrophic factor (BDNF), mRNA /cds=p(1,786) /gb=XM_001368353 /gi=126332213 /ug=Mdm.339 /len=786 0.026 33% ... ...CBRC-MDOM-06-0030 gnl|UG|Mdm#S37377868 PREDICTED: Monodelphis domestica brain-deriv
Error-free versus mutagenic processing of genomic uracil--relevance to cancer.
Krokan, Hans E; Sætrom, Pål; Aas, Per Arne; Pettersen, Henrik Sahlin; Kavli, Bodil; Slupphaug, Geir
2014-07-01
Genomic uracil is normally processed essentially error-free by base excision repair (BER), with mismatch repair (MMR) as an apparent backup for U:G mismatches. Nuclear uracil-DNA glycosylase UNG2 is the major enzyme initiating BER of uracil of U:A pairs as well as U:G mismatches. Deficiency in UNG2 results in several-fold increases in genomic uracil in mammalian cells. Thus, the alternative uracil-removing glycosylases, SMUG1, TDG and MBD4 cannot efficiently complement UNG2-deficiency. A major function of SMUG1 is probably to remove 5-hydroxymethyluracil from DNA with general back-up for UNG2 as a minor function. TDG and MBD4 remove deamination products U or T mismatched to G in CpG/mCpG contexts, but may have equally or more important functions in development, epigenetics and gene regulation. Genomic uracil was previously thought to arise only from spontaneous cytosine deamination and incorporation of dUMP, generating U:G mismatches and U:A pairs, respectively. However, the identification of activation-induced cytidine deaminase (AID) and other APOBEC family members as DNA-cytosine deaminases has spurred renewed interest in the processing of genomic uracil. Importantly, AID triggers the adaptive immune response involving error-prone processing of U:G mismatches, but also contributes to B-cell lymphomagenesis. Furthermore, mutational signatures in a substantial fraction of other human cancers are consistent with APOBEC-induced mutagenesis, with U:G mismatches as prime suspects. Mutations can be caused by replicative polymerases copying uracil in U:G mismatches, or by translesion polymerases that insert incorrect bases opposite abasic sites after uracil-removal. In addition, kataegis, localized hypermutations in one strand in the vicinity of genomic rearrangements, requires APOBEC protein, UNG2 and translesion polymerase REV1. What mechanisms govern error-free versus error prone processing of uracil in DNA remains unclear. In conclusion, genomic uracil is an
Olson, L. K.; McGuire, J. T.; Cozzarelli, I.; Smith, E. W.; Kneeshaw, T.
2010-12-01
Biodegradation rates are often controlled by dynamic interactions that occur at mixing interfaces between water masses of differing redox state. This study seeks to understand the controls on rates of BTEX (benzene, toluene, ethylbenzene and m,p,o-xylenes) degradation at a mixing interface by using in-situ experiments to simulate contaminated aquifer water containing nitrate discharging to a methanogenic wetland. BTEX biodegradation was evaluated during “dry” conditions (2009) and “wet” conditions (2010) in a shallow wetland near Bemidji, MN using innovative in-situ microcosms (ISMs) to measure rates of change over 8 weeks (2009) and 9 weeks (2010). ISM samplers contained an inner chamber filled with wetland sediments that were allowed to incubate for 2 weeks. This chamber was then closed to the surrounding environment and amended with test solution composed of contaminated groundwater augmented with tracer (bromide), nitrate and BTEX spike. Analysis of ISM sediments suggests that nitrate reduction and biodegradation rates are a function of both mineralogical and microbiological controls. Loss of nitrate, interpreted as nitrate reduction, was observed in both the dry and wet years with reduction slightly faster in the dry year (2.21mg/L/day versus 1.59 mg/L/day). Nitrate reduction was likely coupled to oxidation of various electron donors present in the system, including not only BTEX but also naturally occurring labile organic matter (ex. acetate) and inorganic electron donors (ex. Fe2+). BTEX degradation rates were considerably higher during the “wet” year than the “dry” year, with the fastest rates occurring immediately following test solution additions. For example, in the first 2 days of the “wet” ISM experiments degradation rates were 57.97ug/L/day for Benzene, 73.24ug/L/day for Toluene, 12.37ug/L/day for Ethyl Benzene and 85.61ug/L/day for Xylene compared to an ISM from the dry year which had slower degradation rates of 2.83ug/L/day for
International Nuclear Information System (INIS)
Saha, Kunal; Yan Hui; Nelson, Julie A.E.; Zerhouni-Layachi, Bouchra
2005-01-01
Truncation of the envelope cytoplasmic tail has enabled FIV, SIV, and some laboratory HIV-1 strains to acquire broader cellular tropism and enhanced fusogenicity. Here we have characterized a primary CD4-independent HIV-1 isolate (92UG046-T8) with a truncated cytoplasmic tail that was able to infect and induce syncytia in primary lymphocytes from human, chimpanzee, and monkey, as well as CD4-negative cell lines from human and monkey. Increased syncytia were also noticeable with 293 cells expressing the cloned envelope from the 92UG046-T8 isolate suggesting envelope-mediated cellular fusion. Except pooled serum from HIV-1-infected individuals, monoclonal anti-envelope antibodies or antibodies/antagonists against CD4, CXCR4, and CCR5 were not able to prevent infection by the 92UG046-T8 isolate. This is the first report showing a primary HIV-1 variant with truncated cytoplasmic tail which is highly fusogenic and can infect a broad range of cells from human and non-human origins. In vivo evolution of similar HIV-1 mutants may have important implications in AIDS pathogenesis
Unigene BLAST: CBRC-MMUS-14-0020 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-14-0020 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 9e-37 29% ...
Unigene BLAST: CBRC-GGAL-03-0016 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 3e-50 34% ... ...CBRC-GGAL-03-0016 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-GGAL-02-0038 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-02-0038 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 4e-30 25% ...
Unigene BLAST: CBRC-GGAL-12-0011 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-12-0011 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 5e-38 44% ...
Unigene BLAST: CBRC-GGAL-26-0008 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-26-0008 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 8e-82 44% ...
Unigene BLAST: CBRC-GGAL-05-0037 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 4e-09 24% ... ...CBRC-GGAL-05-0037 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-GGAL-04-0026 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 6e-24 29% ... ...CBRC-GGAL-04-0026 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-MMUS-20-0033 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-20-0033 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 5e-78 42% ...
Unigene BLAST: CBRC-GGAL-06-0000 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 5e-36 29% ... ...CBRC-GGAL-06-0000 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-GGAL-03-0043 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 6e-26 26% ... ...CBRC-GGAL-03-0043 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-GGAL-26-0008 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 9e-84 48% ... ...CBRC-GGAL-26-0008 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-GGAL-03-0015 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 8e-27 32% ... ...CBRC-GGAL-03-0015 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-GGAL-01-0052 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 5e-43 30% ... ...CBRC-GGAL-01-0052 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-GGAL-06-0001 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 8e-21 24% ... ...CBRC-GGAL-06-0001 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-MMUS-01-0101 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-01-0101 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 3e-33 28% ...
Unigene BLAST: CBRC-GGAL-03-0043 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 8e-29 26% ... ...CBRC-GGAL-03-0043 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-HSAP-04-0044 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-04-0044 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 5e-23 25% ...
Unigene BLAST: CBRC-GGAL-03-0047 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 3e-24 24% ... ...CBRC-GGAL-03-0047 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
A cognitively plausible model for grammar induction
Directory of Open Access Journals (Sweden)
Roni Katzir
2015-01-01
Full Text Available This paper aims to bring theoretical linguistics and cognition-general theories of learning into closer contact. I argue that linguists' notions of rich UGs are well-founded, but that cognition-general learning approaches are viable as well and that the two can and should co-exist and support each other. Specifically, I use the observation that any theory of UG provides a learning criterion -- the total memory space used to store a grammar and its encoding of the input -- that supports learning according to the principle of Minimum Description-Length. This mapping from UGs to learners maintains a minimal ontological commitment: the learner for a particular UG uses only what is already required to account for linguistic competence in adults. I suggest that such learners should be our null hypothesis regarding the child's learning mechanism, and that furthermore, the mapping from theories of UG to learners provides a framework for comparing theories of UG.
Planar algebra of the subgroup-subfactor
Indian Academy of Sciences (India)
We think of R α G as the II1-factor (R ∪{ug: g ∈ G}) ⊂ L(L2(R)), where ug(ˆx) ..... define a global trace on P, where for 0± the trace for P0± ∼= C is the obvious identity .... function for strings is either a local maximum or a local minimum. ..... In order to understand how the inclusion tangles act on the subgroup-subfactor planar.
Effects of Nonlinear Absorption in BK7 and Color Glasses at 355 nm
International Nuclear Information System (INIS)
Adams, J J; McCarville, T; Bruere, J; McElroy, J; Peterson, J
2003-01-01
We have demonstrated a simple experimental technique that can be used to measure the nonlinear absorption coefficients in glasses. We determine BK7, UG1, and UG11 glasses to have linear absorption coefficients of 0.0217 ± 10% cm -1 , 1.7 ± 10% cm -1 , and 0.82 ± 10% cm -1 , respectively, two-photon absorption cross-sections of 0.025 ± 20% cm/GW, 0.035 ± 20% cm/GW, and 0.047 ± 20% cm/GW, respectively, excited-state absorption cross-sections of 8.0 x 10 -18 ± 20% cm 2 , 2.8 x 10 -16 ± 20% cm 2 , and 5 x 10 -17 ± 20% cm 2 , respectively, and solarization coefficients of 8.5 x 10 -20 ± 20% cm 2 , 2.5 x 10 -18 ± 20% cm 2 , and 1.3 x 10 -19 ± 20% cm 2 , respectively. For our application, nonlinear effects in 10-cm of BK7 are small ((le) 2%) for 355-nm fluences 2 for flat-top pulses. However, nonlinear effects are noticeable for 355-nm fluences at 0.8 J/cm 2 . In particular, we determine a 20% increase in the instantaneous absorption from linear, a solarization rate of 4% per 100 shots, and a 10% temporal droop introduced in the pulse, for 355-nm flat-top pulses at a fluence of 0.8 J/cm 2 . For 0.5-cm of UG1 absorbing glass the non-linear absorption has a similar effect as that from 10-cm of BK7 on the pulse shape; however, the effects in UG11 are much smaller
Agudelo-Florez, P.; Costa-Carvalho, Beatriz Tavares [UNIFESP; Lopez, J. A.; Redher, J.; Newburger, P. E.; Alla-Saad, S. T.; Condino-Neto, A.
2004-01-01
Patients with severe leukocyte G6PD deficiency may present with impairment of NADPH oxidase activity and a history of recurrent infections, mimicking the phenotype of chronic granulomatous disease. We report herein a child with recurrent infections who initially received the diagnosis of G6PD deficiency. His erythrocyte G6PD activity was reduced: 1.8 U/g Hb (normal: 12.1 +/- 2.1 U/g Hb). Further studies revealed that G6PD activity in neutrophils, mononuclear leukocytes, and Epstein-Barr virus...
Biochemical Effects of six Ti02 and four Ce02 Nanomaterials ...
Abstract The potential mammalian hepatotoxicity of nanomaterials were explored in dose-response and structure-activity studies with human hepatic HepG2 cells exposed to between 10 and 1000 ug/ml of six different TiO2 and four CeO2 nanomaterials for 3 days. Various biochemical parameters were then evaluated to study cytotoxicity, cell growth, hepatic function and oxidative stress. Few indications of cytotoxicity were observed between 10 and 100 ug/ml. In the 300 to 1000 ug/ml exposure range a moderate to substantial degree of cytotoxicity was observed. The percent of lactic dehydrogenase released from cells was the most sensitive cytotoxicity parameter. There were four major biochemical effects observed. By far decreased activities of glucose 6-phosphate dehydrogenase was the major finding of this enzymatic study with some significant decreases observed at 10 ug/ml. In the range of 100 to 1000 ug/ml, the activities of superoxide dismutase, glutathione reductase and glutathione peroxidase were decreased by many nanomaterials. There are six factors that contribute to substantial oxidative stress in cultured hepatocytes (decreased GSH content, and reduced G6PDH, GRD, GPX, SOD and altered catalase activities). Cytotoxicity per se did not seem to fully explain the patterns of biological responses observed. With respect to structure-activity, nanomaterials of CeO2 were more effective than TiO2 in reducing glutathione reductase and SOD activ
Carmona-Fonseca, Jaime
2006-12-01
Several techniques are available to measure red cell cholinesterase; therefore, evaluations with several methods provide a measure of concordance. An equation was formulated to transform native data of reference values to reference units of cholinesterase activity as measured by Michel and EQM tests. The experimental design was descriptive, transversal and prospective. The group sampled was a representative adult working population, aged 18-75, without previous exposure to cholinesterase inhibitors pesticides. The individuals were affiliated to the Social Security System and resided in Valle de Aburrá and Cercano Oriente Antioqueño (Antioquia Province, northwestern Colombia). Of 827 individuals, quantitative erythrocytes (Michel y EQM) tests exhibited "r" coefficients between 0.67 and R2 coefficient of 44%.,This indicated that one test explained the results in other test in 44% of the cases. The corelation was higher in Aburrá than in Oriente. The linear model for the 827 individuals was as follows: EQM U/g oxy-hemoglobin = 9.575 U/ g oxy-hemoglobin + 29.791 (Michel delta pH/hour). Michel delta pH/hr = 0.3312 delta pH/hour + 0.0149 (EQM U/g oxy-hemoglobin), where EQM was expressed in U/g oxy-hemoglobin and Michel pH change/hr. Inter-sections (coefficient a) and inclines (coefficient b) were significant in this model. In the adjusted equations, after exclusion of 12 extreme data (1.5% of 827), the r coefficient increased from 0.67 to 0.72 The adjusted equations were as follows: EQM U/g oxy-hemoglobin = 8.1884 U/g oxy-hemoglobin + 31.3920 (Michel delta pH/hour); Michel delta pH/hr = 0.2925 delta pH/hr + 0.0161 (EQM U/g oxy-hemoglobin). This system of linear equations permitted the transformation of Michel (delta PH/ hr) units to EQM (U/g oxy-hemoglobin) units and vice versa. This will facilitate data comparisons by clinicians and epidemiologists who are using these methods of cholinesterase measurement.
High Burden of Subclinical Lead Toxicity after Phase Out of Lead from Petroleum in Pakistan.
Majid, Hafsa; Khan, Aysha Habib; Khan, Nadeem Ullah; Siddiqui, Imran; Ghani, Farooq; Jafri, Lena
2017-12-01
To evaluate the frequency of subclinical lead toxicity. Cross-sectional study. Department of Pathology and Laboratory Medicine, The Aga Khan University Hospital, Karachi, from January 2011 to December 2014. Analysis of laboratory data for blood lead levels (BLL) was performed. Lead was tested by atomic absorption spectrometer. For all subjects, only initial test results were included while the results of repeated testing were excluded. Exemption was sought from institutional ethical review committee. BLL of 2-10 ug/dl and 10-70 ug/dl in children and adults, respectively were taken as subclinical lead toxicity. Amongst the total number of subjects tested (n=524), 26.5% (n=139) were children (lead level 16.9 ug/dl (36.1-4)] and lower level [4.2 ug/dl (6.8-2.6)] in children with lead levels while most had either subclinical (76%, n=106) or toxic lead levels (8%, n=11). In adults, (55%, n=212) subjects had desired lead levels, and 40% (n=154) and 4.99% (n=19) had subclinical and toxic lead levels. Presence of subclinical lead poisoning even after phasing out of lead petroleum in Pakistanis is alarming, especially in children. A national population-based study to determine the lead status and targeted intervention to identify potential sources is need of the time.
Dicty_cDB: Contig-U04426-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available MMBB... 32 2.9 5 ( AC174151 ) Homo sapiens chromosome 4 clone WI2-1953O14, comp... 42 2.9 2 ( CD147127 ) ML1...1-734E9, WORKI... 42 2.8 3 ( CC262481 ) CH261-167M9_Sp6.1 CH261 Gallus gallus gen...omic clo... 32 2.8 3 ( CD147117 ) ML1-0002T-M115-B10-U.G ML1-0002 Schistosoma manso... 38 2.8 2 ( BX842699 )
Directory of Open Access Journals (Sweden)
G. A. Ebong
2008-01-01
Full Text Available Dumpsites in Uyo and most cities in Nigeria are used nutrients rich soils for cultivating fruits and vegetables without regards to the risk of toxic metal pollution by the wastes. This development necessitated the research on the assessment of the impact of municipal and rural dumpsites on the metal levels of the underlying soils, the relationship between the dumpsite- soil metal content and the rate of bio-accumulation by plants, the effect of plant specie and plant part on the rate of metal uptake. Atomic absorption spectrophotometer was employed for the analysis of the samples and results obtained from municipal dumpsite soil indicated the following mean concentrations: Fe, 1711.20 μg/g; Pb, 43.28 ug/g; Zn, 88.34 ug/g; Ni, 12.18 ug/g; Cd, 14.10 ug/g and Cu, 56.33 ug/g. These concentrations were relatively higher than the following concentrations: Fe, 1016.98 ug/g; Pb, 18.57 ug/g; Zn, 57.90 ug/g; Ni, 7.98 ug/g; Cd, 9.25 ug/g and Cu, 33.70 ug/g recorded for the rural dumpsite soil. Consequently, plants grown on municipal dumpsites soil accumulated higher concentrations of the metals than those on rural dumpsites. Results obtained from this study also revealed that plants grown on dumpsite soils bio-accumulated higher metal concentrations than their counterparts obtained from normal agricultural soils. The ability of plants to bioaccumulate these metals were also observed as being different from one plant to the other and from one plant parts to the other. And apart from Fe and Zn which recorded higher concentrations in the leaves of the plants studied, other metals recorded higher concentrations in the roots. The general results obtained revealed that the levels of Cd in dumpsite-soil were above the standard while the levels of Cd and Pb in plants were also above the recommended levels in plants. The implications of these high concentrations of these metals in soil and plants have been discussed. Some useful recommendations on the proper
Unigene BLAST: CBRC-CFAM-35-0003 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CFAM-35-0003 gnl|UG|Cfa#S19200945 ip12b05.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip12b05, mRNA sequence /clone=ip12b05 /gb=CK996905 /gi=45760585 /ug=Cfa.32635 /len=996 1.5 24% ...
Evidence for disruption of normal circadian cortisol rhythm in women with obesity.
Al-Safi, Zain A; Polotsky, Alex; Chosich, Justin; Roth, Lauren; Allshouse, Amanda A; Bradford, Andrew P; Santoro, Nanette
2018-04-01
Hyperactivity of the hypothalamic-pituitary-adrenal (HPA) axis may play a role in the pathogenesis of comorbidities encountered in obesity, including the relative hypogonadotropic hypogonadism that we and others have observed. We sought to examine serum cortisol profiles throughout the day and evening in a sample of normal weight women and women with obesity. In this cross-sectional study, regularly cycling obese (n = 12) and normal weight (n = 10) women were recruited. Mean serum cortisol was measured by frequent blood sampling for 16 h (8am-midnight) in the luteal phase of the menstrual cycle. Women with obesity had significantly higher overall cortisol levels when compared to normal weight women (6.2 [4.3, 6.6] vs. 4.7 [3.7, 5.5] ug/dl, p = .04). Over the two-hour postprandial period, obese women displayed an almost two-fold greater (7.2 [6.5, 8.6] ug/dl) rise in cortisol than normal weight controls (4.4 [3.7, 6.2] ug/dl, p obese women demonstrated a sustained evening cortisol elevation compared to normal weight women, who displayed the typical decline in cortisol (3.2 [2.3, 4] vs. 2 [1.5, 3.2] ug/dl, p obesity may be related to risks of obesity-associated metabolic comorbidities and reproductive dysfunction often seen in these women.
Unigene BLAST: CBRC-FRUB-02-0118 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0118 gnl|UG|Tru#S21435395 AL837361 EFRh Takifugu rubripes cDNA clone EFRh101apc...A11, mRNA sequence /clone=EFRh101apcA11 /gb=AL837361 /gi=21879323 /ug=Tru.2111 /len=407 2.4 33% ...
Unigene BLAST: CBRC-FRUB-02-0784 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0784 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 2.0 26% ...
Unigene BLAST: CBRC-DMEL-02-0018 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0018 gnl|UG|Dm#S40592688 DMG1A.1_1.C09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3L.19.066.a, mRNA sequence /clone=DMG1-chr3L.19.066.a /gb=EW712727 /gi=156141533 /ug=Dm.35847 /len=1518 1.4 35% ...
Unigene BLAST: CBRC-ATHA-05-0034 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ATHA-05-0034 gnl|UG|At#S11736431 Arabidopsis thaliana ATMPK19 (Arabidopsis tha...liana MAP kinase 19); MAP kinase (ATMPK19) mRNA, complete cds /cds=p(1,1761) /gb=NM_112333 /gi=30683276 /ug=At.8069 /len=1897 6.9 42% ...
Unigene BLAST: CBRC-FRUB-02-0750 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0750 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 1.9 26% ...
Unigene BLAST: CBRC-FRUB-02-0743 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0743 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 1.4 26% ...
Unigene BLAST: CBRC-FRUB-02-0627 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0627 gnl|UG|Tru#S21434842 AL836687 EFRe Takifugu rubripes cDNA clone EFRe005apc...N22, mRNA sequence /clone=EFRe005apcN22 /gb=AL836687 /gi=21878649 /ug=Tru.3747 /len=363 1.4 48% ...
Power to punish norm violations affects the neural processes of fairness-related decision making
Directory of Open Access Journals (Sweden)
Xuemei eCheng
2015-12-01
Full Text Available Punishing norm violations is considered an important motive during rejection of unfair offers in the Ultimatum Game (UG. The present study investigates the impact of the power to punish norm violations on people’s responses to unfairness and associated neural correlates. In the UG condition participants had the power to punish norm violations, while an alternate condition, the Impunity Game (IG, was presented where participants had no power to punish norm violations since rejection only reduced the responder’s income to zero. Results showed that unfair offers were rejected more often in UG compared to IG. At the neural level, anterior insula and dorsal anterior cingulate cortex were more active when participants received and rejected unfair offers in both UG and IG. Moreover, greater dorsolateral prefrontal cortex activity was observed when participants rejected than accepted unfair offers in UG but not in IG. Ventromedial prefrontal cortex activation was higher in UG than IG when unfair offers were accepted as well as when rejecting unfair offers in IG as opposed to UG. Taken together, our results demonstrate that the power to punish norm violations affects not only people’s behavioral responses to unfairness but also the neural correlates of the fairness-related social decision-making process.
Investigation of Turkish marbles as shielding materials
International Nuclear Information System (INIS)
Atasoy, H.; Tarcan, G.; Doekmen, S.
1992-01-01
The natural Turkish marbles, especially Usak Green (UG), Aegean Purple (AP), and Marmara White (MW) were tested as shielding materials using standard gamma sources such as Co-60, Cs-137 and Eu-152. The experiment showed that UG, AP and MW are very effective shields against gamma-rays. The result for this experiment is that the gamma-ray attenuation coefficients of UG, AP and MW are almost equal for the energy range from 0.1 MeV to 1.4 MeV. Also, the elemental compositions of the natural UG, AP and MW marbles have been determined by fast and thermal neutron activation analysis and fourteen elements including Na, Mg, Al, Si, Cl, K, Ca, V, Ti, Mn, Fe, La, Ba and Sc have been found using the gamma spectroscopic method. The range of element contents of all Turkish marbles are remarkably different, but most of the elements are common such as Ca, Fe, Na, Cl, Mg, Si. (orig.)
Unigene BLAST: CBRC-DMEL-04-0014 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0014 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 1e-37 49% ...
Unigene BLAST: CBRC-DMEL-03-0045 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-03-0045 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 1e-23 38% ...
Unigene BLAST: CBRC-DMEL-03-0057 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-03-0057 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 6e-13 25% ...
Unigene BLAST: CBRC-DMEL-03-0039 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-03-0039 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 7e-31 40% ...
Unigene BLAST: CBRC-DMEL-02-0034 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0034 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 8e-12 25% ...
Unigene BLAST: CBRC-DMEL-04-0013 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0013 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 7e-29 43% ...
Unigene BLAST: CBRC-DMEL-02-0008 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0008 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 3e-12 22% ...
Unigene BLAST: CBRC-DMEL-04-0058 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0058 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 9e-26 32% ...
Unigene BLAST: CBRC-DMEL-04-0006 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0006 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 0.048 17% ...
Unigene BLAST: CBRC-DMEL-04-0015 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0015 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 9e-82 98% ...
Kubiak, Katarzyna; Malinowska, Katarzyna; Langer, Ewa; Dziki, Łukasz; Dziki, Adam; Majsterek, Ireneusz
2011-03-01
Colorectal cancer (CRC) is a serious medical and economical problem of our times. It is the most common gastrointestinal cancer in the world. In Poland, the treatment and detection of CRC are poorly developed and the pathogenesis is still unclear. One hypothesis suggests a role of reactive oxygen species (ROS) in the pathogenesis of CRC. Experimental studies in recent years confirm the participation of ROS in the initiation and promotion of CRC. The aim of the study was to examine the effect of the following coordination compounds coordination compounds: dinitrate (V) tetra(3,4,5-trimethyl-N1-pyrazole-κN2) copper(II), dichloro di(3,4,5-trimethyl-N1-pyrazole-κN2) copper(II), dinitrate (V) di(1,4,5-trimethyl-N1-pyrazole-κN2) copper(II), dichloro di(1,3,4,5-tetramethyl-N1-pyrazole-κN2) copper(II) on the activity of antioxidant enzymes superoxide dismutase (SOD, ZnCu-SOD) and catalase (CAT) in a group of patients with colorectal cancer (CRC) and in the control group consisting of patients with minor gastrointestinal complaints. The study was conducted in 20 patients diagnosed with colorectal cancer at the age of 66.5±10.2 years (10 men and 10 women) versus the control group of 20 people (10 men and 10 women) aged 57.89±17.10 years without cancer lesions in the biological material - hemolysate prepared in a proportion of 1ml of water per 1 ml of blood. CAT activity was measured by the Beers method (1952), while SOD activity was measured by the Misra and Fridovich method (1972). We found that patients with CRC showed a statistically significant decrease of SOD and CAT activity (CAT - 12,75±1.97 U/g Hb, SOD - 1111.52±155.52 U/g Hb) in comparison with the control group (CAT - 19.65±2,17 U/g Hb, SOD - 2046.26±507.22 U/g Hb). Simultaneously, we observed that the investigated coordination compounds of Cu(II) significantly increased the antioxidant activity of CAT and SOD in patients with CRC (mean: CAT 25.23±4.86 U/g Hb, SOD - 3075.96±940.20 U/g Hb). Patients with
Convective-stratiform rainfall separation of Typhoon Fitow (2013: A 3D WRF modeling study
Directory of Open Access Journals (Sweden)
Huiyan Xu
2018-01-01
Full Text Available Surface precipitation budget equation in a three-dimensional (3D WRF model framework is derived. By applying the convective-stratiform partition method to the surface precipitation budget equation in the 3D model, this study separated convective and stratiform rainfall of typhoon Fitow (2013. The separations are further verified by examining statistics of vertical velocity, surface precipitation budget, and cloud microphysical budget. Results show that water vapor convergence moistens local atmosphere and offsets hydrometeor divergence, and producing convective rainfall, while hydrometeor convergence primarily supports stratiform rainfall, since water vapor divergence and local atmospheric drying generally cancelled out. Mean ascending motions are prevailing in the entire troposphere in the convective region, whereas mean descending motions occur below 5 km and mean ascending motions occur above in the stratiform region. The frequency distribution of vertical velocity shows vertical velocity has wide distribution with the maximum values up to 13 m s-1 in the convective regions, whereas it has narrow distribution with absolute values confined within 7 m s-1 in the stratiform region. Liquid cloud microphysics is dominant in convective regions and ice cloud microphysics is dominant in stratiform regions. These indicate that the statistics results are generally consistent with the corresponding physical characteristics of the convective-stratiform rainfall structures generalized by previous studies.
Energy Technology Data Exchange (ETDEWEB)
Santos, Flora L; Pabroa, Preciosa Corazon B; Morco, Ryan P; Racho, Joseph Michael D [Analytical Measurements Research Group, Philippine Nuclear Research Institute, Commonwealth Ave., Diliman, Quezon City (Philippines)
2007-07-01
In the Philippines, it has been a yearly tradition to welcome the coming of the New Year with the loudest noise as can be achieved. Firecrackers and fireworks have been a necessity for Filipinos during this time despite bans on the use of most of these and despite the Department of Health (DOH) campaign to use alternative safe practices to welcome the New Year. Data for PM 10 samples (fractionated as PM 10-2.2 or the course fraction and PM2.2 or the fine fraction) collected in four PNRI sampling sites in Metro Manila show the air pollution impacts of fireworks on New Year's Eve. Samples were collected from 1998 to 2006 using a Gent dichotomous sampler in connection with the PNRI project {sup P}articulate Matter Source Apportionment Using Nuclear and Related Analytical Techniques{sup .} Particulate mass was determined by gravimetry. Elemental analysis of the air filters was done using X-ray Fluorescence Spectrometry (X RF) or Particle induced X-ray Emission (PIXE), multielemental non-destructive nuclear analytical techniques. Black carbon was analyzed using reflectometry. PM 10 values increased by two to four times the usual averages (36.4 to 55.4 ug/cum) and in 2002 even exceeded the PNAAQ short-term guideline value of 150 ug/cum at the ADMU sampling station. PM2.2 values increased by two to six times the usual averages (15 to 28 ug/cum), even many times exceeding US EPA short-term guideline value of 65 ug/cum. The increase in the particulate mass of New Year's Day samples can be attributed more to an increase in the metal pollutants rather than the black carbon, with higher contribution to the fine fraction. Increase in the elemental concentrations of Al, S, Cl, K, Ba, Sr, Ti, V, Mn, Cu and Pb were observed with the highest contribution from K. Results show that the usual practices of burning firecrackers and fireworks during New Year's day celebration is a very strong source of air pollution which contributes significantly high amount of metal pollutants in the
Directory of Open Access Journals (Sweden)
Soledad Cebrián-García
2018-06-01
Full Text Available A novel, environmentally friendly, and sustainable ultrasound-assisted methodology in the valorization of valeric acid to alkyl valerate using a biosilicified lipase from Candida antarctica is reported. This one-pot room temperature methodology of enzyme biosilicification leads to biosilicified lipases with improved activity and reaction efficiency as compared to free enzymes. Yields in the ultrasound-promoted esterification of valeric acid was ca. 90% in 2 h with 15% m/v of biosilicified lipase (Bio-lipase; 616 U/g biocatalyst enzymatic activity and a molar ratio 1:2 (valeric acid:ethanol, slightly superior to that observed by the free enzyme (75% conversion, 583U/g biocatalyst enzymatic activity. The reuse of enzymes in these conditions was tested and the results show a relatively good reusability of these biosilicified enzymes under the investigated conditions, particularly preserving fairly stable specific activities (616 vs. 430 U/g biocatalyst after four reuses.
U.S. Natural Gas Storage Risk-Based Ranking Methodology and Results
Energy Technology Data Exchange (ETDEWEB)
Folga, Steve [Argonne National Lab. (ANL), Argonne, IL (United States); Portante, Edgar [Argonne National Lab. (ANL), Argonne, IL (United States); Shamsuddin, Shabbir [Argonne National Lab. (ANL), Argonne, IL (United States); Tompkins, Angeli [Argonne National Lab. (ANL), Argonne, IL (United States); Talaber, Leah [Argonne National Lab. (ANL), Argonne, IL (United States); McLamore, Mike [Argonne National Lab. (ANL), Argonne, IL (United States); Kavicky, Jim [Argonne National Lab. (ANL), Argonne, IL (United States); Conzelmann, Guenter [Argonne National Lab. (ANL), Argonne, IL (United States); Levin, Todd [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-10-01
This report summarizes the methodology and models developed to assess the risk to energy delivery from the potential loss of underground gas storage (UGS) facilities located within the United States. The U.S. has a total of 418 existing storage fields, of which 390 are currently active. The models estimate the impacts of a disruption of each of the active UGS facilities on their owners/operators, including (1) local distribution companies (LDCs), (2) directly connected transporting pipelines and thus on the customers in downstream States, and (3) third-party entities and thus on contracted customers expecting the gas shipment. Impacts are measured across all natural gas customer classes. For the electric sector, impacts are quantified in terms of natural gas-fired electric generation capacity potentially affected from the loss of a UGS facility. For the purpose of calculating the overall supply risk, the overall consequence of the disruption of an UGS facility across all customer classes is expressed in terms of the number of expected equivalent residential customer outages per year, which combines the unit business interruption cost per customer class and the estimated number of affected natural gas customers with estimated probabilities of UGS disruptions. All models and analyses are based on publicly available data. The report presents a set of findings and recommendations in terms of data, further analyses, regulatory requirements and standards, and needs to improve gas/electric industry coordination for electric reliability.
Pesticides in surface waters in areas influenced by banana production in Costa Rica
International Nuclear Information System (INIS)
Castillo, L.E.; Ruepert, C.; Solis, E.
1999-01-01
Banana production in Costa Rica is highly dependent on pesticide use. However, only a few studies have been undertaken regarding the presence and environmental impact of the agrochemical substances used in the banana culture on the aquatic ecosystem of the Atlantic Region of Costa Rica. This study was, therefore, undertaken in Rio Suerte Basin that drains into the 'Nature Conservation Area' of Tortuguero in the Atlantic lowlands of the country from June 1993 to December 1994. In order to investigate further the occurrence of pesticides in the water bodies located near the possible sources especially during worst-case situations, water samples were analysed following pesticide applications during 1995-1997. Pesticide residues were determined by GC equipped with an electron capture detector (ECD) and a nitrogen phosphorous detector (NPD). The study targeted 11 of the 21 pesticides used in banana production, the others were not analyzed. The most frequently found compounds during the 1993-94 survey were the fungicide propiconazole and the nematocide cadusafos. Maximum concentrations measured after the pesticide applications were found in the main drainage canal and these were 2.1 ug/L carbofuran, 1.2 ug/L terbufos and 0.48 ug/L cadusafos. The peak concentration found shortly after the aerial application of the fungicide propiconazole was 13 ug/L in the creek leaving the banana plantation. (author)
Unigene BLAST: CBRC-DRER-15-0115 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0115 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 1e-41 67% ...
Unigene BLAST: CBRC-DRER-15-0114 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0114 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 1e-38 62% ...
Directory of Open Access Journals (Sweden)
Urmila Phutela
2005-03-01
Full Text Available A thermophilic fungal strain producing both pectinase and polygalacturonase was isolated after primary screening of 120 different isolates. The fungus was identified as Aspergillus fumigatus Fres. MTCC 4163. Using solid-state cultivation, the optimum levels of variables for pectinase and polygalacturonase (PG production were determined. Maximal levels of enzyme activities were achieved upon growing the culture in a medium containing wheat bran, sucrose, yeast extract and (NH42SO4 after 2-3 days of incubation at a temperature of 50ºC. Highest enzyme activities of 1116 Ug-1 for pectinase and 1270 Ug-1 for polygalacturonase were obtained at pH 4.0 and 5.0, respectively.Através da tiragem de 120 cepas de fungos, isolou-se uma cepa capaz de produzir tanto pectinase quanto poligalacturonase. A cepa foi identificada como Aspergillus fumigatus Fres. MTCC 4163. Empregando cultivo em estado sólido, determinou-se os níveis ótimos das variáveis para a produção de pectinase e de poligalacturonase. Os níveis máximos de atividade enzimática foram obtidos quando a cultura era realizada em meio contendo farelo de trigo, sacarose, extrato de levedura e (NH42SO4 por 2-3 dias a uma temperatura de 50ºC. A atividade máxima de pectinase (1116 Ug-1 e de poligalacturonase (1270 Ug-1 foi obtida em pH 4,0 e 5,0, respectivamente.
Underground gas storage in the World - Cedigaz survey
International Nuclear Information System (INIS)
Benquey, R.
2010-01-01
The 2010 edition of 'Underground Gas Storage in the World' provides an update to the previous survey released by CEDIGAZ in 2006. At that time, 610 underground gas storage (UGS) facilities were in operation worldwide, with a working capacity of 319 billion cubic metres (bcm). As of 1 January 2010, this number had reached 642 facilities with a working gas capacity of 333 bcm, or 10.8% of world gas consumption. By 2020, the global UGS demand is expected to grow at a pace of 3.3% per year, and according to the projects identified, more than 760 UGS sites could be active in the world with a total working capacity of approximately 465 bcm. In this survey, CEDIGAZ analyses the following trends which characterise the rapid development of underground gas storage in the world: - the strong dynamics of the European storage market, where 127 projects could add 75 bcm of working capacity by 2020, - the continued development of the UGS market in the United States (49 projects), encouraged by market-based rates allowed by the FERC, and rapid permitting processes, - the development of facilities in countries with little or no storage capacities at present, in Asia/Oceania, the C.I.S., and Eastern Europe in particular. This survey provides an analysis of the recent evolutions in the technic-economic aspects of the underground gas storage business, as well as an overview of the UGS markets and their developments in the world, country by country. A specific section is dedicated to the analysis of future UGS needs in Europe by 2020: - Technic-economic aspects of UGS: This part of the survey analyses the latest technical improvements and research axes in the field of underground gas storage. As it is more difficult to build greenfield storage facilities, a lot of work has been done to improve the performance and flexibility of existing storage sites. This section also deals with the evolution of investment and operational costs in storage over the last few years. Furthermore, the
Small battery operated unattended radar sensor for security systems
Plummer, Thomas J.; Brady, Stephen; Raines, Robert
2013-06-01
McQ has developed, tested, and is supplying to Unattended Ground Sensor (UGS) customers a new radar sensor. This radar sensor is designed for short range target detection and classification. The design emphasis was to have low power consumption, totally automated operation, a very high probability of detection coupled with a very low false alarm rate, be able to locate and track targets, and have a price compatible with the UGS market. The radar sensor complements traditional UGS sensors by providing solutions for scenarios that are difficult for UGS. The design of this radar sensor and the testing are presented in this paper.
Associations between physical activity and characteristics of urban green space
DEFF Research Database (Denmark)
Schipperijn, Jasper; Bentsen, Peter; Troelsen, Jens
2013-01-01
of the nearest UGS, and the presence of certain features. However, the evidence to date is somewhat inconclusive, and dominated by studies from North America and Australia. There is a large variation in city structures, and recommendations for North American or Australian cities are not automatically valid...... was found. The amount and number of UGS within one kilometre revealed no association either. For PA in the nearest UGS positive associations with size, walking/cycling routes, wooded areas, water features, lights, pleasant views, bike rack, and parking lot were found. This indicates that PA in an UGS might...
The Development of Theory of Mind and Positive and Negative Reciprocity in Preschool Children.
Schug, Joanna; Takagishi, Haruto; Benech, Catalina; Okada, Hiroyuki
2016-01-01
This study examined the relation between the acquisition of false-beliefs theory of mind (ToM) and reciprocity in preschoolers. Preschool-aged children completed a task assessing the understanding of false beliefs, and played an Ultimatum Game (UG) with another child in a face-to-face setting. Negative reciprocity was assessed by examining the rejection of unfair offers made by another child in the UG, while positive reciprocity was assessed by examining allocations made by participants in a Dictator Game (DG) following the UG. The results indicated that children who had passed a task assessing first-order false beliefs were more likely to make generous offers in a DG following a fair offer made by their partner in a proceeding UG, but that false beliefs ToM was unrelated to the rejection of unfair offers in the UG.
Germination and early plant development of 10 plant species exposed to Nano TiO2 and CeO2
Ten agronomic plant species were exposed to different concentrations of nano-TiO2 or CeO2 (0, 250, 500 and 1000 ug/l) and followed to examine effects on germination and early seedling development. For TiO2, cabbage showed increased and corn decreased percent germination, while ...
[Evaluation of adiponectin level in children and adolescents with diabetes type 1].
Peczyńska, Jadwiga; Urban, Mirosława; Głowińska, Barbara; Florys, Bozena
2008-01-01
Adipose tissue is not only an energy storage place, but it also secretes numerous "adipocytokines" - substances that have systemic influence. Adiponectin has an anti-inflammatory, antiatherogenic properties and increases insulin sensitivity. It is emphasized that adiponectin levels are different in type 1 and type 2 diabetes. was to evaluate adiponectin levels in young patients with diabetes type 1, and to analyse of the correlation between adiponectin and: BMI, lipid parameters, glomerular filtration rate and microalbuminuria. The study group was formed by 95 patients from the Outpatient Diabetology Department 2nd Department of Children's Diseases, 45 girls and 50 boys, aged from 7 to 20 years (mean - 14.97 yrs) suffering from diabetes from 1 to 17 years (mean 6.68 yrs). Control group consisted of healthy children, age matched, without family history of cardiovascular diseases. In all patients anthropometric measurements were performed (BMI was calculated), metabolic control was evaluated on the basis of HbA1c level, microalbuminuria was studied in 24 hour urine sample. We assessed glomerular filtration rate (endogenous creatinine clearance), lipid parameters and adiponectin level. In children and adolescents with diabetes type 1 we found significantly higher levels of adiponectin compared to control group: 32.72+/-13.49 vs. 26.53+/-7.63 ug/ml; p=0.024. Adiponectin level was higher in girls than in boys (33.56 vs. 28.75 ug/ml; p=0.036). Adiponectin level did not depend on metabolic control and on diabetes duration. We found a statistically significant negative correlation between adiponectin and creatinine (r=-0.26; p=0.011). In patients with diabetic complications we found insignificantly lower adiponectin level compared to patients without complications (30.99+/-14.29 vs. 33.67+/-11.68 ug/ml; p=0.35). 1. In patients with diabetes type 1 significantly higher level of adiponectin was found compared to healthy control group. 2. Adiponectin level correlated
Primary pollutants and potential photochemical smog formation in Makkah, Saudi Arabia
International Nuclear Information System (INIS)
Nasralla, M.M.; Seroji, A.R.
2007-01-01
This study was conducted in Mina Valley and the central district of the holy city, Makkah, during the pilgrimage (Hajj) season of 1424 Hijri (2004). During this season, more than 2.5 million people gathered in Makkah to perform the Hajj rituals. Two mobile air pollution laboratories were used to monitor NO, NO2, NOx, non-methane hydrocarbons and ozone (O3) in the atmosphere in Mina and Makkah. Instruments were calibrated periodically against standard gases. The present investigation showed clearly an ideal diurnal cycle of local ozone formation. Although the intensity of the incoming UV radiation was the lowest compared with other months of the year, recorded ozone levels approached the maximum allowable levels of 150 ug/m3 in Mina, and exceeded 160 ug/m3 in Makkah during the pilgrimage period. The problem was intensified by the high record levels NOx, sometimes reaching more than 800 ug/m3, 1h average, coupled with 1h average concentration of about 3 ppm non-methane hydrocarbons. Furthermore, the average maximum hourly ozone concentrations increased gradually from less than 60 ug/m3 during February to reach more than 200 ug/m3 (as an indication of smog formation) during some days of May. This coincides with the increase in the intensity of the incoming UV radiation reaching its maximum level in May. Consequently, it can be concluded that Makkah may face severe air pollution episodes when the pilgrimage season shifts to the summer months in the next few years. This may pose acute health problems for the elderly people and those with respiratory health problems. Good air quality and transportation management as well as the use of alternative clean fuel are highly recommended. (author)
International Nuclear Information System (INIS)
Ghaedi, M.; Mortazavi, K.; Janbezar, M.; Parham, H.
2006-01-01
Activated carbon modified methods were used for preconcentration and determination of copper in some real sample by flame atomic absorption spectrometry. The copper was adsorbed quantitatively on activated carbon due to their complexation with α-benzoinoxime and pyrimidin 2-thiole. The adsorbed copper on solid phase was eluted quantitatively using nitric acid. The important parameters such as pH, amount of carrier, flow rate, amount of activated carbon and type and concentration of eluting agent for obtaining maximum recovery was optimized. The methods based on α- benzoinoxime and pyrimidin 2-thiole at optimum conditions is linear over concentration range of 0.05-1.3 ug mL and 0.06-1.2 ug mL of copper with correlation coefficient of 0.9997 and 0.9994 and both detection limit of 1.2 ngmL, respectively. The preconcentration leads to enrichment factor of 200 and 240 and break through volume of 1200 mL for methods based on α- benzoinoxime and pyrimidin 2-thiole, respectively. The methods have good tolerance limit of interfering ion and selectivity that has been successfully applied for determination of copper content in real sample such as blood, wastewater and river sample. (author)
Unigene BLAST: CBRC-CFAM-23-0020 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CFAM-23-0020 gnl|UG|Cfa#S19198630 ip04e12.g1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip04e12, mRNA sequence /clone=ip04e12 /gb=CN002408 /gi=45766087 /ug=Cfa.29570 /len=708 8e-08 38% ...
Unigene BLAST: CBRC-CFAM-28-0014 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CFAM-28-0014 gnl|UG|Cfa#S19200361 ip42h12.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip42h12, mRNA sequence /clone=ip42h12 /gb=CK995838 /gi=45759518 /ug=Cfa.10205 /len=413 4e-05 37% ...
Unigene BLAST: CBRC-CFAM-01-0041 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CFAM-01-0041 gnl|UG|Cfa#S19200707 ip06d09.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip06d09, mRNA sequence /clone=ip06d09 /gb=CK996471 /gi=45760151 /ug=Cfa.45094 /len=754 7e-17 70% ...
High Magnetic Field in THz Plasma Wave Detection by High Electron Mobility Transistors
Sakowicz, M.; Łusakowski, J.; Karpierz, K.; Grynberg, M.; Valusis, G.
The role of gated and ungated two dimensional (2D) electron plasma in THz detection by high electron mobility transistors (HEMTs) was investigated. THz response of GaAs/AlGaAs and GaN/AlGaN HEMTs was measured at 4.4K in quantizing magnetic fields with a simultaneous modulation of the gate voltage UGS. This allowed us to measure both the detection signal, S, and its derivative dS/dUGS. Shubnikov - de-Haas oscillations (SdHO) of both S and dS/dUGS were observed. A comparison of SdHO observed in detection and magnetoresistance measurements allows us to associate unambiguously SdHO in S and dS/dUGS with the ungated and gated parts of the transistor channel, respectively. This allows us to conclude that the entire channel takes part in the detection process. Additionally, in the case of GaAlAs/GaAs HEMTs, a structure related to the cyclotron resonance transition was observed.
Meyer, Michael T.; Lee, Edward A.; Scribner, Elisabeth A.
2007-01-01
An analytical method for the determination of isoxaflutole and its sequential degradation products, diketonitrile and a benzoic acid analogue, in filtered water with varying matrices was developed by the U.S. Geological Survey Organic Geochemistry Research Group in Lawrence, Kansas. Four different water-sample matrices fortified at 0.02 and 0.10 ug/L (micrograms per liter) are extracted by vacuum manifold solid-phase extraction and analyzed by liquid chromatography/tandem mass spectrometry using electrospray ionization in negative-ion mode with multiple-reaction monitoring (MRM). Analytical conditions for mass spectrometry detection are optimized, and quantitation is carried out using the following MRM molecular-hydrogen (precursor) ion and product (p) ion transition pairs: 357.9 (precursor), 78.9 (p), and 277.6 (p) for isoxaflutole and diketonitrile, and 267.0 (precursor), 159.0 (p), and 223.1 (p) for benzoic acid. 2,4-dichlorophenoxyacetic acid-d3 is used as the internal standard, and alachlor ethanesulfonic acid-d5 is used as the surrogate standard. Compound detection limits and reporting levels are calculated using U.S. Environmental Protection Agency procedures. The mean solid-phase extraction recovery values ranged from 104 to 108 percent with relative standard deviation percentages ranging from 4.0 to 10.6 percent. The combined mean percentage concentration normalized to the theoretical spiked concentration of four water matrices analyzed eight times at 0.02 and 0.10 ug/L (seven times for the reagent-water matrix at 0.02 ug/L) ranged from approximately 75 to 101 percent with relative standard deviation percentages ranging from approximately 3 to 26 percent for isoxaflutole, diketonitrile, and benzoic acid. The method detection limit (MDL) for isoxaflutole and diketonitrile is 0.003 ug/L and 0.004 ug/L for benzoic acid. Method reporting levels (MRLs) are 0.011, 0.010, and 0.012 ug/L for isoxaflutole, diketonitrile, and benzoic acid, respectively. On the basis
Diehl, S.F.; Hageman, P.L.; Seal, R.R.; Piatak, N.M.; Lowers, H.
2011-01-01
Weathered mine waste consists of oxidized primary minerals and chemically unstable secondary phases that can be sources of readily soluble metals and acid rock drainage. Elevated concentrations of metals such as Cd, Cu, Fe, Mn, Ni, Pb, and Zn are observed in deionized water-based leachate solutions derived from complex sedex and Cu-Pb-Zn mine wastes. Leachate (USGS FLT) from the Elizabeth mine, a massive sulfide deposit, has a pH of 3.4 and high concentrations of Al (16700 ug/L), Cu (440 ug/L), and Zn (8620 ug/L). Leachate from the sedex Faro mine has a pH of 3.5 and high concentrations of Al (2040 ug/L), Cu (1930 ug/L), Pb (2080 ug/L), and Zn (52900 ug/L). In contrast, higher-pH leachates produced from tailings of polymetallic vein deposits have order of magnitude lower metal concentrations. These data indicate that highly soluble secondary mineral phases exist at the surface of waste material where the samples were collected. Sulfide minerals from all sites exhibit differential degrees of weathering, from dissolution etched grain rims, to rinds of secondary minerals, to skeletal remnants. These microscale mineral-dissolution textures enhance weathering and metal teachability of waste material. Besides the formation of secondary minerals, sulfide grains from dried tailings samples may be coated by amorphous Fe-Al-Si minerals that also adsorb metals such as Cu, Ni, and Zn.
Unigene BLAST: CBRC-DRER-15-0112 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0112 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-49 71% ...
Unigene BLAST: CBRC-DRER-15-0109 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0109 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 4e-51 71% ...
Unigene BLAST: CBRC-DRER-15-0107 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0107 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-59 84% ...
Unigene BLAST: CBRC-DRER-15-0111 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0111 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 4e-48 73% ...
Unigene BLAST: CBRC-DRER-15-0105 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0105 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 9e-35 69% ...
Unigene BLAST: CBRC-DRER-15-0102 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0102 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-30 54% ...
Unigene BLAST: CBRC-DRER-15-0103 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0103 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 6e-32 56% ...
Unigene BLAST: CBRC-DRER-15-0101 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0101 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-47 77% ...
Unigene BLAST: CBRC-DRER-15-0108 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0108 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-53 74% ...
Unigene BLAST: CBRC-DRER-15-0100 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0100 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-52 75% ...
Unigene BLAST: CBRC-DRER-15-0104 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0104 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 5e-58 79% ...
DEFF Research Database (Denmark)
Mortensen, R. W.; Corcoran, O.; Cornett, Claus
2001-01-01
. In both systems the elution order for the 2-, 3- and 4-O-acyl isomers corresponded with previously published results for 2-, 3-, and 4-fluorobenzoic acid glucuronide isomers determined by reversed phase HPLC-H-1 NMR [U.G. Sidelmann, S.H. Hansen, C. Gavaghan, A.W. Nicholls, H.A.J. Carless, J.C. Lindon, I...
Reversible uranyl fluoride nephrotoxicity in the Long Evans rat
International Nuclear Information System (INIS)
Diamond, G.L.; Morrow, P.E.; Panner, B.J.; Gelein, R.M.; Baggs, R.B.
1989-01-01
Severity and duration of renal injury produced by low levels of uranyl fluoride (UO2F2) were examined in the rat. Rats received multiple ip injections of UO2F2 (cumulative dose: 0.66 or 1.32 mg U/kg body wt). Renal injury was characterized histologically by cellular and tubular necrosis of pars recta of proximal tubule (S2 and S3), with less severe cellular injury to thick ascending limb of loop of Henle and collecting tubule. Injury was evident when renal uranium levels were between 0.7 and 1.4 micrograms U/g wet kidney and was most severe when renal uranium burden was between 3.4 and 5.6 micrograms U/g. Repair of injury was rapid, with complete restoration within 35 days after exposure. Associated with injury were abnormalities in renal function, including impaired tubular reabsorption, proteinuria, and enzymuria, which appeared temporally related, to variable degrees, to progression of renal injury. Thus, reversible renal injury occurs in the rat at levels of uranium in kidney below the present Nuclear Regulatory Commission standard of 3 micrograms U/g kidney for renal injury in humans
Email: pattuquayefio@ug.edu.gh
African Journals Online (AJOL)
Apusigah
making. ... study, the article hints at possible implications of the co-optation of human ... shortage, health challenges such as the Human Immunodeficiency Virus (HIV), and the causes ... appropriate framework for considering such challenges.
Fontaine, Emmanuel; Illingworth, Anthony, J.; Stein, Thorwald
2017-04-01
This study is performed using vertical profiles of radar measurements at 35GHz, for the period going from 29th of February to 1rst October 2016, at the Chilbolton observatory in United Kingdom. During this period, more than 40 days with precipitation events are investigated. The investigation uses the synergy of radar reflectivity factors, vertical velocity, Doppler spectrum width, and linear depolarization ratio (LDR) to differentiate between stratiform and convective rain events. The depth of the layer with Doppler spectrum width values greater than 0.5 m s-1 is shown to be a suitable proxy to distinguish between convective and stratiform events. Using LDR to detect the radar bright band, bright band characteristics such as depth of the layer and maximum LDR are shown to vary with the amount of turbulence aloft. Profiles of radar measurements are also compared to rain gauge measurements to study the contribution of convective and stratiform rainfall to total rain duration and amount. To conclude, this study points out differences between convective and stratiform rains and quantifies their contributions over a precipitation event, highlighting that convective and stratiform rainfall should be considered as a continuum rather than a dichotomy.
Directory of Open Access Journals (Sweden)
Jian-Xu ZHANG et al.
2009-10-01
Full Text Available Over-shadowed by eye-catching vocal and visual signals, chemical communication has long been overlooked in birds. This study aimed at exploring whether volatile composition of the uropygial gland secretion (UGS of birds was associated with the information about sex, individual and species. By using dichloromethane extraction and gas chromatography-mass spectrometry (GC-MS, we analyzed the UGS volatiles of domesticated Bengalese finches (Lonchura striata, Estrildiea which is also known as white-rumped munias. We characterized 16 volatile molecules from the UGS, including eight n-alkanols, five diesters, an ester, an aldehyde and a fatty acid, and quantified them in terms of GC peak area percentages (relative abundances. Among these compounds, hexadecanol and octadecanol were major components in both sexes. The former was richer in males than females and the latter richer in females than males, suggesting that they might be male and female pheromone candidates, respectively. The high inter-individual variations, in relative abundance, of the UGS volatiles implied that they might carry information about individuality. The similarity between GC profiles of the UGS and wing feather from same individuals indicates that the birds might preen the secretion to their feathers to transmit chemical cues. Additionally, by comparing with three sympatric passerine species,i.e., zebra finches Taeniopygia guttata, yellow-bowed buntings Emberiza chrysophrys and rooks Corvus frugilegus, we found that the composition of C13-C18 alkanols in the UGS might contain information about species. Our study also show that quantitative differences (degree of same UGS volatiles might be the key for the Bengalese finch to code for information about sex and individuality whereas both the kind and degree of UGS constituents could be utilized to code for information about species [Current Zoology 55 (5:–2009].
Naraian, Ram; Narayan, Om Prakash; Srivastava, Jatin
2014-01-01
Oyster mushroom Pleurotus florida was cultivated on different combinations of wheat straw (WS) as basal substrate and oyster shell powder (OSP) supplement. The OSP supplementation considerably responded to different cultivation phases. The mycelium grew fast and showed rapid growth rate (8.91 mmd(-1)) in WS + OSP (97 + 3) combination while WS + OSP (92 + 8) showed maximum laccase (3.133 U/g) and Mn peroxidase (MnP) activities (0.091 U/g). The climax level of laccase (5.433 U/g) and MnP (0.097 U/g) was recorded during fruit body initiation in WS + OSP (97 + 3) and WS + OSP (98 + 2) combinations, respectively. The WS + OSP (97 + 3) combination represented the best condition for mushroom cultivation and produced the highest biological efficiency (147%). In addition, protein and lipid contents in fruit bodies were slightly improved in response to OSP. The carbohydrate was significantly increased by raising concentration of OSP. The highest values of protein, carbohydrate, and lipid noted were 31.3 μg/g, 0.0639 (g/g), and 0.373 (g/g) correspondingly. Conclusively it was evident that lower concentrations of OSP acted positively and relatively to higher concentrations and improved nutritional content which may suitably be used to enhance both yield and nutritional values of mushroom.
Unigene BLAST: CBRC-RNOR-20-0133 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-20-0133 gnl|UG|Rn#S14181288 UI-R-DO1-cms-c-10-0-UI.s1 UI-R-DO1 Rattus nor...vegicus cDNA clone UI-R-DO1-cms-c-10-0-UI 3', mRNA sequence /clone=UI-R-DO1-cms-c-10-0-UI /clone_end=3' /gb=BQ202827 /gi=20419292 /ti=154455115 /ug=Rn.83937 /len=645 0.001 44% ...
Health risk assessment of plasticizer in wastewater effluents and receiving freshwater systems
CSIR Research Space (South Africa)
Fatoki, O
2012-03-01
Full Text Available t Ku ils Riv er riv er Ve ltw ach ter Ef flu en t Ve ltw ach ter Ri ve r Kir ste nb osc h R ive r ug /l DEHP DEP NP 2CP Fig. 4. Concentrations (?gl-1) of phthalate and phenolic congeners detected in river and WWTP... ter Eff lue nt Ve ltw ach ter Riv er Kir ste nb osc h R ive r ug/ l DBP Fig. 5. DBP concentrations (?gl-1) detected in effluent and river water samples at the different sites. Health Risk Assessment of Plasticizer...
Enhanced technologies for unattended ground sensor systems
Hartup, David C.
2010-04-01
Progress in several technical areas is being leveraged to advantage in Unattended Ground Sensor (UGS) systems. This paper discusses advanced technologies that are appropriate for use in UGS systems. While some technologies provide evolutionary improvements, other technologies result in revolutionary performance advancements for UGS systems. Some specific technologies discussed include wireless cameras and viewers, commercial PDA-based system programmers and monitors, new materials and techniques for packaging improvements, low power cueing sensor radios, advanced long-haul terrestrial and SATCOM radios, and networked communications. Other technologies covered include advanced target detection algorithms, high pixel count cameras for license plate and facial recognition, small cameras that provide large stand-off distances, video transmissions of target activity instead of still images, sensor fusion algorithms, and control center hardware. The impact of each technology on the overall UGS system architecture is discussed, along with the advantages provided to UGS system users. Areas of analysis include required camera parameters as a function of stand-off distance for license plate and facial recognition applications, power consumption for wireless cameras and viewers, sensor fusion communication requirements, and requirements to practically implement video transmission through UGS systems. Examples of devices that have already been fielded using technology from several of these areas are given.
Directory of Open Access Journals (Sweden)
Rito Zerpa Larrauri
2012-01-01
Full Text Available Antecedentes: Pruebas de susceptibilidad antiparasitaria in vitro para Blastocystis hominis, Entamoeba histolytica-E. dispar y Balantidium coli, así como el cultivo para protozoarios intestinales, han sido publicados escasamente en la literatura médica. En nuestro medio aún no se ha comunicado pruebas de susceptibilidad in vitro para los parásitos mencionados. Objetivos: Plantear una alternativa de prueba de susceptibilidad antiparasitaria in vitro y conocer su resistencia frente a los antimicrobianos. Diseño: Estudio prospectivo, descriptivo. Instituciones: Instituto de Medicina Tropical "Daniel Alcides Carrión", Universidad Nacional Mayor de San Marcos, e Instituto Especializado de Salud del Niño, Lima, Perú. Material biológico: Cultivos de Blastocystis hominis, Entamoeba histolytica-E. dispar y Balantidium coli frente a cinco antimicrobianos. Métodos: Se trabajó con 64 cultivos de Blastocystis hominis, 16 de Entamoeba histolytica-dispar y 16 de Balantidium coli, frente a cinco antimicrobianos: metronidazol, cotrimoxazol, tetraciclina, furazolidona y ciprofloxacina. Las cepas de B. hominis, E. histolytica-E. dispar fueron cultivadas en el medio de Pavlova modificado, de 500 muestras de heces de niños con diagnóstico de parasitosis intestinal y las de B. coli de heces de cerdo. Las pruebas de susceptibilidad in vitro se realizaron con el método de microcultivos en el medio de Pavlova modificado, en pocitos con 200 uL del medio sin antiparasitarios (control y con antiparasitarios en 10 concentraciones, desde 128 ug/mL hasta 0,25 ug/mL; luego de incubación a 36º C por 48 horas, la lectura por examen microscópico directo comparó el desarrollo en el medio control con el desarrollo en los pocitos conteniendo los antimicrobianos. Principales medidas de resultados: Concentración inhibitoria mínima (CIM. Resultados: Se encontró para B. hominis, con metronidazol CIM 90: 64 ug/mL y CIM 50: 2 ug/mL; para E. histolytica-E. dispar con
Homocysteine-lowering effect of 500 ug folic acid every other day versus 250 ug/day
Brouwer, I.A.; Rooij, van I.A.L.M.; Dusseldorp, van M.; Thomas, C.M.G.; Blom, H.J.; Hautvast, J.G.A.J.; Eskes, T.K.A.B.
2000-01-01
Elevated plasma total homocysteine (tHcy) concentrations are a risk factor for neural tube defects and vascular diseases. Supplementation with folic acid decreases tHcy. We investigated whether supplementation with 500 ?g folic acid every other day is as effective in lowering tHcy as 250 ?g folic
Kannoju, Balakrishna; Ganapathiwar, Swaruparani; Nunavath, Hanumalal; Sunkar, Bindu; Bhukya, Bhima
2017-02-01
Jatropha de-oiled seed cake was explored to utilize as a basic nutrient source for Candida parapsilosis, isolated from poultry garbage and selected based on the production of lipase and phytase enzymes under submerged fermentation. At optimized parameters under solid-state fermentation, lipase and phytase activities were recorded as 1056.66±2.92 and 833±2.5U/g of substrate (U/g), respectively. Besides enzyme production, complete elimination of phorbol esters and significant phytate reduction from 6.51±0.01 to 0.43±0.01g/100g of seed cake were noted after 3days incubation. Curcin and trypsin inhibition activity were reduced significantly from 26.33±0.43 to 0.56±0.02mg/100g and 229.33±2.02 to 11.66±0.28U/g, respectively after 5days incubation. Saponins were reduced from 5.56±0.19 to 1.95±0.01g/100g of seed cake after 7days incubation. Copyright © 2016 Elsevier Ltd. All rights reserved.
Silva-Díaz, Heber; Flores-Esqueche, Lorena; Llatas-Cancino, Dunalia; Guevara Vásquez, Génesis; Silva-García, Teresa
2016-01-01
To describe the frequency and antiparasitic in vitro susceptibility of Blastocystis hominis in patients admitted to theHospital Regional Lambayeque, Peru. A cross-sectional study was conducted from January to August 2015 at 313 patients of all ages. B. hominis detection was performed on serial fecal samples by direct microscopic examination and microculture in modified Locke solution. The in vitro susceptibility testing against the drug metronidazole, nitazoxanide, trimethoprim-sulfamethoxazole and erythromycin was performed in 24 strains of B. hominis, which grew up (microculture method) in 10 double concentrations of each antimicrobial (from 256 ug/ml to 0.5 ug/mL) plus a control. 46.3% (145/313) of the sample had B. hominis, also the age between 12 to 17 years and 60 years was associated with higher frequency of parasites (OR: 2.93 and 2.62). The minimum inhibitory concentration (MIC) 90 of metronidazole and nitazoxanide was 3.19 ug/mL and 11.19 ug/ml, respectively, whereas the MIC 90 of trimethoprim-sulfamethoxazole and erythromycin were above 256 ug/mL. B. hominis occurs in high frequency in patients admitted to the Hospital Regional in Lambayeque, proving to be an important problem of public health in the region. Also B. hominis isolated from these patients were shown to be susceptible in vitro to low concentrations of metronidazole and nitazoxanide so they could be chosen for treatment of this parasite.
Morphine-6-glucuronide: analgesic effects and receptor binding profile in rats
Energy Technology Data Exchange (ETDEWEB)
Abbott, F.V.; Palmour, R.M.
1988-01-01
The antinociceptive effects of morphine-6-glucuronide (M6G) were examined in two animal models of pain, the tail immersion test (reflex withdrawal to noxious heat) and the formalin test (behavioral response to minor tissue injury). In the tail immersion test, M6G produced and increase in withdrawal latency that rose rapidly between 0.01 and 0.025 ug ICV or 1 and 2 mg/kg SC. A further increase occurred at doses greater than 0.2 ug ICV or 4 mg/kg SC and was associated with marked catelepsy and cyanosis. Naloxone, 0.1 mg/kg SC, shifted the lower component of the dose-effect relation by a factor of 24. In the formalin test, 0.01 ug M6G ICV produced hyperalgesia, while between 0.05 and 0.2 ug ICV, antinociception increased rapidly without toxicity. The dose effect relations for hyperalgesia and antinociception were shifted to the right by factors of 20- and 3-fold, respectively. By comparison, ICV morphine was 60 (formalin test) to 145-200 (tail immersion test) times less potent than M6G. At sub-nanomolar concentrations, M6G enhanced the binding of (/sup 3/H)-etorphine, (/sup 3/H)-dihydromorphine and (/sup 3/H)-naloxone to rat brain membrane receptors by 20-40%. At higher concentrations, M6G displaced each ligand from binding sites, with K/sub i/ values of about 30 nM, as compared to morphine K/sub i/ values of about 3 nM.
Directory of Open Access Journals (Sweden)
Kostić Nada
2009-01-01
Full Text Available Introduction. Antioxidant systems are important factors affecting the oxidation of lipoproteins and thereby the progression of atherosclerotic disease. It has been suggested that physical activity might maintain and promote the antioxidant defence capacity against the oxidative stress. Left ventricular dysfunction (LVDD and hypertension are more common in subjects with diabetes mellitus (DM type 2. Objective. To evaluate the oxidative stress in patients with DM type 2, particularly with LVDD and hypertension and to determine the influence of acute exercise training on the investigated parameters. Methods. To assess the oxidative stress of patients, we determined the following antioxidative parameters: triglycerides (TG, total cholesterol, low density cholesterol, OxLDL cholesterol, superoxide dismutase (SOD, glutathione peroxidase (GSH-Px, plasminogen activator-type 1 (PAI-1 which were measured at rest and immediately after the acute bout of the cardiopulmonary exercise cycle ergometer test. Results. In basal conditions, diabetic patients had a significant increase of TG (3.12±1.09 vs 1.74±0.9 mmol/l; p<0.01, OxLDL cholesterol (84.73±16.9 vs 79.00±29.26 mmol/l; p<0.05 and SOD enzyme activity (913.38±120.36 vs 877.14 ±153.18; p<0.05 compared to controls. During the acute exercise test, there were significantly greater levels of OxLDL (84.73±16.90 vs 92.33±23.29 mmol/l; p<0.05 in study patients. SOD significantly increased in both groups during exercise, in diabetic patients (913.38±120.36 vs 921.50±130.03 U/g Hb; p<0.05 and in controls (877.14±153.18 vs 895.00±193.49 U/g Hb; p<0.05. GSH-Px significantly increased only in diabetic patients after acute exercise (45.04±11.19 vs 51.81±15.07 U/g Hb; p<0.01, but not in controls. PAI significantly decreased during the exercise test only in healthy subjects (2.60±0.35 vs 2.22±0.65; p<0.05. Type 2 diabetic patients with cardiovascular complications (LVDD and hypertension had a significant
Directory of Open Access Journals (Sweden)
Silva Dênis
2002-01-01
Full Text Available Pectin lyase and polygalacturonase production by newly isolated Penicillium viridicatum strain Rfc3 was carried out by means of solid state fermentation using orange bagasse, corn tegument, wheat bran and mango and banana peels as carbon sources. The maximal activity value of polygalacturonase (Pg (30U.g-1 was obtained using wheat bran as carbon source while maximal pectin lyase (Pl (2000 U.g-1 activity value was obtained in medium composed of orange bagasse. Mixtures of banana or mango peels with sugar cane bagasse resulted in increased Pg and Pl production compared to fermentations in which this residue was not used. The mixture of orange bagasse and wheat bran (50% increased the production of Pg and Pl to 55 U.g-1 and 3540 U.g -1 respectively. Fractions of Pg and Pl, isolated by gel filtration in Sephadex G50, presented optimum activity at pH 5.0 and 10.5 respectively. Maximal activity of Pg and Pl fractions was determined at 55ºC and 50ºC respectively. Pg was stable in neutral pH range and at 40ºC whereas Pl was stable in acidic pH and at 35ºC, for 1 h.
1996-10-01
static MTI/$AR oAutomatic target recognition o Fusion and integrated target tracking 21 3.2 Remote Precision Fires FIREPOWER Today * We use massive...support. * All galaxy sensors are netted plus organic sensors (VTOL, UGS) are required - Cell controls its own OPTEMPO; use sensors when they want with...ACTUATORS - HIGH DEFINITION VISIBLE / IR IMAGING o MINIATURE GPS / IMU - ACOUSTIC, SEISMIC, etc. * MINIATURE COMMUNICATIONS I - CHEM / BIO CONTROLS
Uniform Gauss-Weight Quadratures for Discrete Ordinate Transport Calculations
International Nuclear Information System (INIS)
Carew, John F.; Hu, Kai; Zamonsky, Gabriel
2000-01-01
Recently, a uniform equal-weight quadrature set, UE n , and a uniform Gauss-weight quadrature set, UG n , have been derived. These quadratures have the advantage over the standard level-symmetric LQ n quadrature sets in that the weights are positive for all orders,and the transport solution may be systematically converged by increasing the order of the quadrature set. As the order of the quadrature is increased,the points approach a uniform continuous distribution on the unit sphere,and the quadrature is invariant with respect to spatial rotations. The numerical integrals converge for continuous functions as the order of the quadrature is increased.The numerical characteristics of the UE n quadrature set have been investigated previously. In this paper, numerical calculations are performed to evaluate the application of the UG n quadrature set in typical transport analyses. A series of DORT transport calculations of the >1-MeV neutron flux have been performed for a set of pressure-vessel fluence benchmark problems. These calculations employed the UG n (n = 8, 12, 16, 24, and 32) quadratures and indicate that the UG n solutions have converged to within ∼0.25%. The converged UG n solutions are found to be comparable to the UE n results and are more accurate than the level-symmetric S 16 predictions
Underground gas storage Lobodice geological model development based on 3D seismic interpretation
International Nuclear Information System (INIS)
Kopal, L.
2015-01-01
Aquifer type underground gas storage (UGS) Lobodice was developed in the Central Moravian part of Carpathian foredeep in Czech Republic 50 years ago. In order to improve knowledge about UGS geological structure 3D seismic survey was performed in 2009. Reservoir is rather shallow (400 - 500 m below surface) it is located in complicated locality so limitations for field acquisition phase were abundant. This article describes process work flow from 3D seismic field data acquisition to geological model creation. The outcomes of this work flow define geometry of UGS reservoir, its tectonics, structure spill point, cap rock and sealing features of the structure. Improving of geological knowledge about the reservoir enables less risky new well localization for UGS withdrawal rate increasing. (authors)
Directory of Open Access Journals (Sweden)
L. Zukovski
Full Text Available Abstract Fodder radish (FR is an oilseed crop with a high potential for biodiesel production due to its high productivity and the quality of its seed oil. FR oil extraction results in a residue that is rich in protein and fiber. In this study, FR cake (FRC was evaluated as carbon and nitrogen source for the production of cellulases and xylanases using Penicillium echinulatum S1M29 during solid-state cultivation. It was determined that it is possible to partially replace wheat bran (WB by FRC, resulting in 24.22 ± 0.25U/g Filter Paper Activity (144 hours, 210.5 ± 5.8U/g endoglucanase activity (144 hours, 22.62 ± 0.01U/g (-glucosidase activity (96 hours and 784.7 ± 70.19U/g xylanase activity (120 hours. These values are equal or higher than the enzymatic activity obtained using WB. These results may contribute to the reduction of the cost of enzymes used in the production of cellulosic ethanol or other biotechnological applications.
Serum levels of zinc and copper in epileptic children during long-term therapy with anticonvulsants.
Talat, Mohamed A; Ahmed, Anwar; Mohammed, Lamia
2015-10-01
To evaluate the serum levels of zinc and copper in epileptic children during the long-term treatment of anticonvulsant drugs and correlate this with healthy subjects. A hospital-based group matched case-control study was conducted in the Department of Pediatrics, Faculty of Medicine, Zagazig University, Zagazig, Egypt between November 2013 and October 2014. Ninety patients aged 7.1 ± 3.6 years were diagnosed with epilepsy by a neurologist. The control group was selected from healthy individuals and matched to the case group. Serum zinc and copper were measured by the calorimetric method using a colorimetric method kit. The mean zinc level was 60.1 ± 22.6 ug/dl in the cases, and 102.1 ± 18 ug/dl in the controls (p<0.001). The mean copper level was 180.1 ± 32.4 ug/dl in cases compared with 114.5 ± 18.5 ug/dl in controls (p<0.001). Serum zinc levels in epileptic children under drug treatment are lower compared with healthy children. Also, serum copper levels in these patients are significantly higher than in healthy people. No significant difference in the levels of serum copper and zinc was observed in using one drug or multiple drugs in the treatment of epileptic patients.
Biochemical Effects of six Ti02 and four Ce02 Nanomaterials in HepG2 cells
Abstract The potential mammalian hepatotoxicity of nanomaterials were explored in dose-response and structure-activity studies with human hepatic HepG2 cells exposed to between 10 and 1000 ug/ml of six different TiO2 and four CeO2 nanomaterials for 3 days. Var...
Drop Size Distribution - Based Separation of Stratiform and Convective Rain
Thurai, Merhala; Gatlin, Patrick; Williams, Christopher
2014-01-01
For applications in hydrology and meteorology, it is often desirable to separate regions of stratiform and convective rain from meteorological radar observations, both from ground-based polarimetric radars and from space-based dual frequency radars. In a previous study by Bringi et al. (2009), dual frequency profiler and dual polarization radar (C-POL) observations in Darwin, Australia, had shown that stratiform and convective rain could be separated in the log10(Nw) versus Do domain, where Do is the mean volume diameter and Nw is the scaling parameter which is proportional to the ratio of water content to the mass weighted mean diameter. Note, Nw and Do are two of the main drop size distribution (DSD) parameters. In a later study, Thurai et al (2010) confirmed that both the dual-frequency profiler based stratiform-convective rain separation and the C-POL radar based separation were consistent with each other. In this paper, we test this separation method using DSD measurements from a ground based 2D video disdrometer (2DVD), along with simultaneous observations from a collocated, vertically-pointing, X-band profiling radar (XPR). The measurements were made in Huntsville, Alabama. One-minute DSDs from 2DVD are used as input to an appropriate gamma fitting procedure to determine Nw and Do. The fitted parameters - after averaging over 3-minutes - are plotted against each other and compared with a predefined separation line. An index is used to determine how far the points lie from the separation line (as described in Thurai et al. 2010). Negative index values indicate stratiform rain and positive index indicate convective rain, and, moreover, points which lie somewhat close to the separation line are considered 'mixed' or 'transition' type precipitation. The XPR observations are used to evaluate/test the 2DVD data-based classification. A 'bright-band' detection algorithm was used to classify each vertical reflectivity profile as either stratiform or convective
BIOACTIVITIES AND MECHANISM OF SPIRO ENOL ETHER ANALOGUES AGAINST PIERIS RAPAE
Institute of Scientific and Technical Information of China (English)
Zhi-xiangZhang; Dong-meiCheng; Han-hongXu; Yu-linWu; andJun-faFan
2004-01-01
Nineteen kinds of spiro enol ether analogues were screened with larvae of Pieris rapae for antifeedant activity. The results showed that the antifeedant activity of compounds No.20 and No.12 was higher than others. In non-choice test, AFC50 values within 24 h of compounds No.20 and No.12 against 3rd instar larvae of P. rapae were 226.93ug/mL and 370.00ug/mL, and that in choice test against 4th larvae were 280.54 ug/mL and 398.88 ug/mL, respectively. Compd. No.20 could prolong the eggs hatch time and reduce the haemolymph content and the protein content in haemolymph of 4th instar larvae obviously. Compd. No.20 could protect tested leaves and control larvae of P. rapae effectively.
Saiki, Michael K.; Martin, Barbara A.; May, Thomas W.
2008-01-01
concentrations in other matrices varied widely among drains and ponds, with at least one drain (for example, Trifolium 18) exhibiting especially high concentrations in food chain organisms (in detritus, 13.3-28.9 ug Se/g; in net plankton, 11.9-19.3 ug Se/g; in midge larvae, 12.7-15.4 ug Se/g) and fish (in mollies, 12.8-25.1 ug Se/g; in mosquitofish, 13.2-20.2 ug Se/g; all concentrations are dry weights). These elevated concentrations approached or exceeded average concentrations reported from flowing waters in seleniferous wetlands in the San Joaquin Valley.
Palma, M B; Pinto, A L; Gombert, A K; Seitz, K H; Kivatinitz, S C; Castilho, L R; Freire, D M
2000-01-01
Lipase, protease, and amylase production by Penicillium restrictum in solid-state fermentation was investigated. The basal medium was an industrial waste of babassu oil (Orbignya oleifera) production. It was enriched with peptone, olive oil, and Tween-80. The supplementation positively influenced both enzyme production and fungal growth. Media enriched with Tween-80 provided the highest protease activity (8.6 U/g), whereas those enriched with peptone and olive oil led to the highest lipase (27.8 U/g) and amylase (31.8 U/g) activities, respectively.
RFLPs for ATP1BL1 (. beta. subunit Na sup + /K sup + ATPase pseudogene) on chromosome 4
Energy Technology Data Exchange (ETDEWEB)
Georgiou, C.; Shull, M. (Univ. of Iowa Hospitals, Iowa City (USA)); Lingrel, J.B.; Murray, J.C.; Lane, L.K. (Univ. of Cincinnati College of Medicine, OH (USA))
1989-11-11
{beta}51-1(1.4) contains a 1.4kb EcoRI fragment, free of repetitive elements, from the {beta} subunit Na{sup +}/K{sup +} ATPase pseudogene (ATP1BL1). The vector is pUG18. EcoRI identifies 2 allelic bands of 7.0 and 14.0 kb. KpnI identifies 2 allelic bands of 19.0 and 23.0 kb. The probe was localized to chromosome 4 by linkage to chromosome 4 markers (D4S35, KIT) and somatic cell hybrid analysis. Co-dominant segregation was shown in 32 and 16 CEPH families for EcoRI and KpnI respectively.
Smartphone and Universal Goniometer for Measurement of Elbow Joint Motions: A Comparative Study
Behnoush, Behnam; Tavakoli, Nasim; Bazmi, Elham; Nateghi Fard, Fariborz; Pourgharib Shahi, Mohammad Hossein; Okazi, Arash; Mokhtari, Tahmineh
2016-01-01
Background Universal goniometer (UG) is commonly used as a standard method to evaluate range of motion (ROM) as part of joint motions. It has some restrictions, such as involvement of both hands of the physician, leads to instability of hands and error. Nowadays smartphones usage has been increasing due to its easy application. Objectives The study was designed to compare the smartphone inclinometer-based app and UG in evaluation of ROM of elbow. Materials and Methods The maximum ROM of elbow in position of flexion and pronation and supination of forearm were examined in 60 healthy volunteers with UG and smartphone. Data were analyzed using SPSS (ver. 16) software and appropriate statistical tests were applied, such as paired t-test, ICC and Bland Altman curves. Results The results of this study showed high reliability and validity of smartphone in regarding UG with ICC > 0.95. The highest reliability for both methods was in elbow supination and the lowest was in the elbow flexion (0.84). Conclusions Smartphones due to ease of access and usage for the physician and the patient, may be good alternatives for UG. PMID:27625754
Rêgo, Gabriel Gaudencio; Campanhã, Camila; do Egito, Julia Horta Tabosa; Boggio, Paulo Sérgio
2017-10-01
The ultimatum game (UG) is an endowment sharing game in which a proposer suggests a division of an asset to a recipient, who must accept or reject it. Economic studies showed that despite recipients usually rejecting unfair offers, perception and reaction to unfairness are highly dependent on who is the proposer. Event-related potentials (ERPs) commonly detected in UG games are the medial frontal negativity (MFN), a component detected in recipients facing unfair offers, and the P300, a component related to attentional and memory processes. Given this, we aimed to investigate the behavioral and ERP responses of healthy people playing the UG game with Down syndrome (DS) and typical development (TD) proposers. Nineteen subjects participated in this study. The UG behavioral data were similar to previous studies. ERP analysis showed no MFN in participants facing unfair offers. A higher P300 amplitude was detected when participants faced fair offers from TD compared to DS fair offers. We also found a positive correlation between P300 amplitude for TD offers and self-esteem scale score. Together these findings indicate that insertion of an atypical player in the UG led to changes in participants' perception and expectancy of the game.
Paddy Husk as Support for Solid State Fermentation to Produce Xylanase from Bacillus pumilus
Directory of Open Access Journals (Sweden)
Ranganathan KAPILAN
2011-03-01
Full Text Available To optimize culture conditions for xylanase production by solid state fermentation (SSF using Bacillus pumilus, with paddy husk as support, solid medium contained 200 g of paddy husk with 800 mL of liquid fermentation medium [xylan, 20.0 g/L; peptone, 2.0 g/L; yeast extract, 2.5 g/L; K2HPO4, 2.5 g/L; KH2PO4, 1.0 g/L; NaCl, 0.1 g/L; (NH42SO4, 2.0 g/L, CaCl2·2H2O, 0.005 g/L; MgCl2·6H2O, 0.005 g/L; and FeCl3, 0.005 g/L] at pH 9.0 was applied. The highest xylanase activity (142.0 ±0.47 U/g DM] was obtained on the 6th day at 30°C. The optimized paddy husk to liquid fermentation medium ratio was 2:9, and the optimized culture temperature was 40°C. When commercial Birchwood xylan was replaced with different concentrations of corncob, xylanase production was maximized (224.2 U/g DM in the medium with 150 g/L corncob. Xylanase production was increased by sucrose, fructose and arabinose, whereas reduced by glucose, galactose, lactose and amylose. When organic nitrogen sources were replaced with locally available nitrogen sources such as groundnut powder or sesame seedcake powder or coconut seedcake powder or soy meal powder, the highest xylanase production (290.7 U/g DM was obtained in the medium with soy meal powder and 16.0 g/L of soy meal powder was the optimum (326.5±0.34 U/g DM. Based on the optimization studies, B. pumilus produced 2.3 times higher xylanase activity. The medium cost was reduced from 2 458.3 to 178.3 SLR/kg and the total activity which could be obtained from 1 kg of the medium was increased from 48 624 to 220 253 Units.
UG311, An Oncofetal Marker Lost with Prostate Cancer Progression
2001-04-01
resulted in neonatal lethality and further exacerbation of the dwarfism to about 30% of control size [28]. By contrast, the overexpression of GH or IGF-1...inhibitory as retinoic acid (RA) treatment initiates rapid degradation of IGFBP-2 and an increased synthesis of IGF-2 [127]. As RA promotes cell growth both...upregulation of IGFBP-2 mRNA in response to low dose androgen treatment in the LNCaP human prostate cancer cell line. It is not clear 19 whether this is
Reduction of angiocidin contributes to decreased HepG2 cell ...
African Journals Online (AJOL)
EB
2013-09-03
Sep 3, 2013 ... Tris, 5 mM EDTA pH7.5, 1% Triton X-100, and supplemented with 1mM PMSF). BCA Protein. Assay Reagent kit (Pierce) was used to determine the protein concentration. Equal amounts of protein. (10ug) were separated by SDS-PAGE and transferred to PVDF membranes. The membranes were blocked in ...
Savery, Laura C; Wise, Sandra S; Falank, Carolyne; Wise, James; Gianios, Christy; Douglas Thompson, W; Perkins, Christopher; Zheng, Tongzhang; Zhu, Cairong; Wise, John Pierce
2014-02-15
Lead (Pb) is an oceanic pollutant of global concern. Anthropogenic activities are increasing oceanic levels, but to an unknown extent. The sperm whale (Physeter macrocephalus) has a global distribution and high trophic level. The aim of this study was to establish a global baseline of oceanic Pb concentrations using free-ranging sperm whales as an indicator species. Skin biopsies (n=337) were collected during the voyage of the Odyssey (2000-2005) from 17 regions considering gender and age. Pb was detectable in 315 samples with a global mean of 1.6 ug/gww ranging from 0.1 to 129.6 ug/gww. Papua New Guinea, Bahamas and Australia had the highest regional mean with 6.1, 3.4, and 3.1 ug/gww, respectively. Pb concentrations were not significantly different between sex and age in males. This is the first global toxicological dataset for Pb in a marine mammal and confirms Pb is widely distributed with hotspots in some regions. Copyright © 2014. Published by Elsevier Ltd.
Lee, Meng-Chih; Hsu, Chih-Cheng; Tsai, Yi-Fen; Chen, Ching-Yu; Lin, Cheng-Chieh; Wang, Ching-Yi
Current evidence suggests that grip strength and usual gait speed (UGS) are important predictors of instrumental activities of daily living (IADL) disability. Knowing the optimum cut points of these tests for discriminating people with and without IADL disability could help clinicians or researchers to better interpret the test results and make medical decisions. The purpose of this study was to determine the cutoff values of grip strength and UGS for best discriminating community-dwelling older adults with and without IADL disability, separately for men and women, and to investigate their association with IADL disability. We conducted secondary data analysis on a national dataset collected in the Sarcopenia and Translational Aging Research in Taiwan (START). The data used in this study consisted of health data of 2420 community-dwelling older adults 65 years and older with no history of stroke and with complete data. IADL disability was defined as at least 1 IADL item scored as "need help" or "unable to perform." Receiver operating characteristics analysis was used to estimate the optimum grip strength and UGS cut points for best discriminating older adults with/without IADL disability. The association between each physical performance (grip strength and UGS) and IADL disability was assessed with odds ratios (ORs). With IADL disability as the criterion, the optimal cutoff values of grip strength were 28.7 kg for men and 16.0 kg for women, and those for UGS were 0.76 m/s for men and 0.66 m/s for women. The grip strength test showed satisfactory discriminant validity (area under the curve > 0.7) in men and a strong association with IADL disability (OR > 4). Our cut points using IADL disability as the criterion were close to those indicating frailty or sarcopenia. Our reported cutoffs can serve as criterion-referenced values, along with those previously determined using different indicators, and provide important landmarks on the performance continua of older adults
Study on heat transfer coefficients during cooling of PET bottles for food beverages
Liga, Antonio; Montesanto, Salvatore; Mannella, Gianluca A.; La Carrubba, Vincenzo; Brucato, Valerio; Cammalleri, Marco
2016-08-01
The heat transfer properties of different cooling systems dealing with Poly-Ethylene-Terephthalate (PET) bottles were investigated. The heat transfer coefficient (Ug) was measured in various fluid dynamic conditions. Cooling media were either air or water. It was shown that heat transfer coefficients are strongly affected by fluid dynamics conditions, and range from 10 W/m2 K to nearly 400 W/m2 K. PET bottle thickness effect on Ug was shown to become relevant under faster fluid dynamics regimes.
Directory of Open Access Journals (Sweden)
Elena López Villarrubia
2008-01-01
Full Text Available Fundamento: El carácter insular de las ciudades de Las Palmas de Gran Canaria y Santa Cruz de Tenerife, su meteorología y la proximidad del continente africano que favorece la llegada de material particulado de origen natural sobre las islas, determinan unas especificidades en su calidad del aire. El objetivo de este artículo es la caracterización de la contaminación atmosférica durante los años 2000 a 2004 como indicador de exposición de los habitantes de estas dos ciudades. Métodos: Se elaboraron los siguientes indicadores de contaminación: promedios de 24 horas de PM10, PM2,5, NO2, SO2 y O3; máximo de las 17 medias móviles octohorarias diarias de O3 y CO; máximo horario diario de SO2, NO2, O3, CO, PM10 y PM2,5. También se calcularon los niveles de la moda gruesa de partículas, como la diferencia entre los valores de PM10 y PM2,5 (PM10-2,5. Se identificaron episodios de intrusión africana. Resultados: En Sta Cruz de TF los promedios de SO2 (14ug/m3N y de O3 (44,4 ug/m3N fueron superiores respecto a los de Las Palmas de GC (8 y 28,3 ug/m3N. Los promedios de NO2 en Las Palmas de GC: 45,8 ug/m3N fueron superiores a los de Sta. Cruz de TF: 30,3 ug/m3N. Debido a las intrusiones africanas, algunos días superaron los 600 ug/m3 de PM10 y los 200 de PM2.5 en ambas ciudades. Conclusiones: Se identifica un patrón de calidad del aire con episodios de polvo mineral africano que en superficie afecta a todas las fracciones granulométricas, una estacionalidad diferente a las ciudades europeas respecto al ozono, así como un patrón de contaminación urbano-industrial en Sta. Cruz de Tf y netamente urbano en Las Palmas de GC. Se hace necesario tener en cuenta estos resultados para analizar su posible impacto sobre la salud de los ciudadanos de las Islas Canarias y establecer sistemas adecuados de vigilancia.
Locating Ground-Water Discharge in the Hanford Reach of the Columbia River
International Nuclear Information System (INIS)
Lee, D.R.; Geist, D.R.; Saldi, K.; Hartwig, D.; Cooper, T.
1997-01-01
A bottom-contacting probe for measuring electrical conductivity at the sediment-water interface was used to scan the bed of the Columbia River adjacent to the Hanford Site in southeast Washington State during a 10-day investigation. Four river-sections, each about a kilometer in length, were scanned for variations in electrical conductivity. The probe was towed along the riverbed at a speed of 1 m/s and is position was recorded using a Global Positioning System. The bottom tows revealed several areas of elevated electrical conductivity. Where these anomalies were relatively easy to access, piezometers were driven into the riverbed and porewater electrical conductivity ranged from 111 to 150 uS/cm. The piezometers, placed in electrical conductivity ''hotspots'' yielded chemical or isotopic data consistent with previous analyses of water taken from monitoring wells and visible shoreline seeps. Tritium, nitrate, and chromium exceeded water quality standards in some porewaters. The highest tritium and nitrate levels were found near the Old Hanford Townsite at 120,000 pCi/L (+ 5,880 pCi/L total propagated analytical uncertainty) and ug/L (+ 5,880 ug/L), respectively. The maximum chromium (total and hexavalent) levels were found near 100-H reactor area where unfiltered porewater total chromium was 1,900 ug/L (+ 798 ug/L) and hexavalent chromium was 20 ug/L. The electrical conductivity probe provided rapid, cost-effective reconnaissance for ground-water discharge areas when used in combination with conventional piezometers. It may be possible to obtain quantitative estimates of both natural and contaminated ground-water discharge in the Hanford Reach with more extensive surveys of river bottom
Directory of Open Access Journals (Sweden)
Amber L. Pearson
2016-01-01
Full Text Available Many water-related illnesses show an increase during the wet season. This is often due to fecal contamination from runoff, yet, it is unknown whether seasonal changes in water availability may also play a role in increased illness via changes in the type of primary water source used by households. Very little is known about the dynamic aspects of access to water and changes in source type across seasons, particularly in semi-arid regions with annual water scarcity. The research questions in this study were: (1 To what degree do households in Uganda (UG and Tanzania (TZ change primary water source type between wet and dry seasons?; and (2 How might seasonal changes relate to water quality and health? Using spatial survey data from 92 households each in UG and TZ this study found that, from wet to dry season, 26% (UG and 9% (TZ of households switched from a source with higher risk of contamination to a source with lower risk. By comparison, only 20% (UG and 0% (TZ of households switched from a source with lower risk of contamination to a source with higher risk of contamination. This research suggests that one pathway through which water-related disease prevalence may differ across seasons is the use of water sources with higher risk contamination, and that households with access to sources with lower risks of contamination sometimes choose to use more contaminated sources.
Park, Jeong-ki; Lee, Dong-yeop; Kim, Jin-Seop; Hong, Ji-Heon; You, Jae-Ho; Park, In-mo
2015-01-01
[Purpose] The purpose of this study was to compare the effects of visibility and types of ground surface (stable and unstable) during the performance of squats on the muscle activities of the vastus medialis oblique (VMO) and vastus lateralis (VL). [Subjects and Methods] The subjects were 25 healthy adults in their 20s. They performed squats under four conditions: stable ground surface (SGS) with vision-allowed; unstable ground surface (UGS) with vision-allowed; SGS with vision-blocked; and UGS with vision-blocked. The different conditions were performed on different days. Surface electromyogram (EMG) values were recorded. [Results] The most significant difference in the activity of the VMO and VL was observed when the subjects performed squats on the UGS, with their vision blocked. [Conclusion] For the selective activation of the VMO, performing squats on an UGS was effective, and it was more effective when subjects’ vision was blocked. PMID:26356407
Visciano, Maria Luisa; Tagliamonte, Maria; Stewart-Jones, Guillaume; Heyndrickx, Leo; Vanham, Guido; Jansson, Marianne; Fomsgaard, Anders; Grevstad, Berit; Ramaswamy, Meghna; Buonaguro, Franco M; Tornesello, Maria Lina; Biswas, Priscilla; Scarlatti, Gabriella; Buonaguro, Luigi
2013-07-08
Trimeric soluble forms of HIV gp140 envelope glycoproteins represent one of the closest molecular structures compared to native spikes present on intact virus particles. Trimeric soluble gp140 have been generated by several groups and such molecules have been shown to induce antibodies with neutralizing activity against homologous and heterologous viruses. In the present study, we generated a recombinant trimeric soluble gp140, derived from a previously identified Ugandan A-clade HIV field isolate (gp14094UG018). Antibodies elicited in immunized rabbits show a broad binding pattern to HIV envelopes of different clades. An epitope mapping analysis reveals that, on average, the binding is mostly focused on the C1, C2, V3, V5 and C5 regions. Immune sera show neutralization activity to Tier 1 isolates of different clades, demonstrating cross clade neutralizing activity which needs to be further broadened by possible structural modifications of the clade A gp14094UG018. Our results provide a rationale for the design and evaluation of immunogens and the clade A gp14094UG018 shows promising characteristics for potential involvement in an effective HIV vaccine with broad activity.
Freund, Kristin A; Kieves, Nina R; Hart, Juliette L; Foster, Sasha A; Jeffery, Unity; Duerr, Felix M
2016-07-01
OBJECTIVE To evaluate accuracy and reliability of 3 novel goniometers for measurement of canine stifle joint angles and compare the results with those obtained with a universal goniometer (UG). SAMPLE 8 pelvic limbs from 4 canine cadavers. PROCEDURES Each limb was secured to a wooden platform at 3 arbitrarily selected fixed stifle joint angles. Goniometry was performed with 2 smartphone-based applications (novel goniometers A and B), a digital goniometer (novel goniometer C), and a UG; 3 evaluators performed measurements in triplicate for each angle with each device. Results were compared with stifle joint angle measurements on radiographs (used as a gold standard). Accuracy was determined by calculation of bias and total error, coefficients of variation were calculated to estimate reliability, and strength of linear association between radiographic and goniometer measurements was assessed by calculation of correlation coefficients. RESULTS Mean coefficient of variation was lowest for the UG (4.88%), followed by novel goniometers B (7.37%), A (7.57%), and C (12.71%). Correlation with radiographic measurements was highest for the UG (r = 0.97), followed by novel goniometers B (0.93), A (0.90), and C (0.78). Constant bias was present for all devices except novel goniometer B. The UG and novel goniometer A had positive constant bias; novel goniometer C had negative constant bias. Total error at 50° and 100° angles was > 5% for all devices. CONCLUSIONS AND CLINICAL RELEVANCE None of the devices accurately represented radiographically measured stifle joint angles. Additional veterinary studies are indicated prior to the use of novel goniometers in dogs.
Risch, Martin R.; Kenski, Donna M.
2018-01-01
Spatial patterns and temporal changes in atmospheric-mercury (Hg) deposition were examined in a five-state study area in the Midwestern USA where 32% of the stationary sources of anthropogenic Hg emissions in the continental USA were located. An extensive monitoring record for wet and dry Hg deposition was compiled for 2001–2016, including 4666 weekly precipitation samples at 13 sites and 27 annual litterfall-Hg samples at 7 sites. This study is the first to examine these Hg data for the Midwestern USA. The median annual precipitation-Hg deposition at the study sites was 10.4 micrograms per square meter per year (ug/m2/year) and ranged from 5.8 ug/m2/year to 15.0 ug/m2/year. The median annual Hg concentration was 9.4 ng/L. Annual litterfall-Hg deposition had a median of 16.1 ug/m2/year and ranged from 9.7 to 23.4 ug/m2/year. Isopleth maps of annual precipitation-Hg deposition indicated a recurring spatial pattern similar to one revealed by statistical analysis of weekly precipitation-Hg deposition. In that pattern, high Hg deposition in southeastern Indiana was present each year, frequently extending to southern Illinois. Most of central Indiana and central Illinois had similar Hg deposition. Areas with comparatively lower annual Hg deposition were observed in Michigan and Ohio for many years and frequently included part of northern Indiana. The area in southern Indiana where high Hg deposition predominated had the highest number of extreme episodes of weekly Hg deposition delivering up to 15% of the annual Hg load from precipitation in a single week. Modeled 48-h back trajectories indicated air masses for these episodes often arrived from the south and southwest, crossing numerous stationary sources of Hg emissions releasing from 23 to more than 300 kg Hg per year. This analysis suggests that local and regional, rather than exclusively continental or global Hg emissions were likely contributing to the extreme episodes and at least in part, to the spatial
1987-12-01
evaluated in San Diego Bay over a 7-month period using tributyltin ( TBT ) antifouling leachates. Three TBT concentrations (k = 0.065, 0.077 and 0.193 ug...tional value and epifaunal organisms and 2) test using tributyltin (TT) antifouling leachates. the efficacy of the PETS. The results of the TBT Three...Conoentrations of 0.200, study the effects of tributyltin (TBI), the primary 0.050 and 0.020 ug/l, respectively. Unfiltered toxic component of organotin AF
Liebelt, Veronika; Bartke, Stephan; Schwarz, Nina
2018-01-01
In the light of global urbanization and biodiversity loss, ecosystem services provided by urban green spaces (UGS) are becoming increasingly important, not least as a recovery and recreation opportunity for citizens. The valuation of UGS is significant for urban planners, who make decisions on the
Yakin, Mehmet; Eksioglu, Umit; Sungur, Gulten; Satana, Banu; Demirok, Gulizar; Ornek, Firdevs
2017-01-01
To evaluate short-term to long-term outcomes of Ahmed glaucoma valve (AGV) implantation in the management of uveitic glaucoma (UG) secondary to Behçet disease (BD). A retrospective chart review of 47 eyes of 35 patients with UG secondary to BD who underwent AGV implantation was conducted. Success was defined as having an intraocular pressure (IOP) between 6 and 21 mm Hg with (qualified success) or without (complete success) antiglaucomatous medications and without need for further glaucoma surgery. Mean postoperative follow-up was 57.72±26.13 months. Mean preoperative IOP was 35.40±8.33 mm Hg versus 12.28±2.90 mm Hg at the last follow-up visit (P<0.001). Mean number of preoperative topical antiglaucomatous medications was 2.96±0.29 versus 0.68±1.12 at the last follow-up visit (P<0.001). In all eyes, IOP could be maintained between 6 and 21 mm Hg with or without antiglaucomatous medications during follow-up. The cumulative probability of complete success was 46.8% at 6 months, 40.4% at 12 months, and 35.9% at 36 months, and the cumulative probability of eyes without complication was 53.2% at 6 months, 46.5% at 12 months, and 39.6% at 24 months postoperatively based on Kaplan-Meier survival analysis. No persistent or irreparable complications were observed. This study includes one of the largest series of AGV implantation in the management of UG with the longest follow-up reported. AGV implantation can be considered as a primary surgical option in the management of UG secondary to BD with 100% total success rate (with or without medications).
Directory of Open Access Journals (Sweden)
Zohreh Sanaat
2012-07-01
Full Text Available Chemotherapeutic agents used in patients with cancer cause to generate the enormous amounts of free radicals associated with cell injury. In this study we assess the effects of chemotherapy regimen on oxidant/antioxidant status in patients with acute myeloid leukemia (AML. 38 newly diagnosed patients with acute myeloid leukemia were recruited in this study. All patients received cytarabine and daunorubicin as chemotherapy regimen. Plasma levels of malondialdehyde (MDA, total antioxidant status (TAS, and the levels of erythrocyte activity of superoxide dismutase (SOD and glutathione peroxidase (GPx were determined before chemotherapy and 14 days after chemotherapy with cytarabine and daunorubicin. Plasma MDA concentrations increased significantly (from 2.68±0.89 nmol/L to 3.14±1.29 nmol/L during the 14days post-chemotherapy period (P=0.04. Plasma TAS concentrations changed with chemotherapy from 1.09±0.15 mmol/L to 1.02±0.14 mmol/L with P=0.005. Erythrocyte SOD and GPX activity decreased overtime from 1157.24±543.61 U/g Hb to 984.01±419.09 U/g Hb (P=0.04 and 46.96±13.70 U/g Hb to 41.40±6.44 U/g Hb (P=0.02 respectively. We report here that there is an increase in malondialdehyde levels and a decrease in the levels of antioxidant enzymes and total antioxidant status. This suggests that chemotherapy causes these changes as a result of enormous production of reactive oxygen species in the patients with AML. Antioxidant supplementation must be approached with caution because of the probability of reduction the therapeutic efficacy of these cytotoxic drugs.
Language specific bootstraps for UG categories
van Kampen, N.J.
2005-01-01
This paper argues that the universal categories N/V are not applied to content words before the grammatical markings for reference D(eterminers) and predication I(nflection) have been acquired (van Kampen, 1997, contra Pinker, 1984). Child grammar starts as proto-grammar with language-specific
Directory of Open Access Journals (Sweden)
Jacques Birraux
2015-01-01
Full Text Available Background: To open vaginal cavity to the pelvic floor is part of surgical treatment for urogenital sinus (UGS in girls with congenital adrenal hyperplasia (CAH. For high UGS, this operative procedure can be challenging and may jeopardise urinary continence. Combined perineal and laparoscopic approaches could be useful to minimise perineal dissection and to facilitate the vaginal lowering. Patients and Methods: We report the procedure of a laparoscopic-assisted vaginal pull-through for supra-sphincteric UGS in a 5-year-old girl with CAH. Laparoscopic dissection of the vagina from the posterior wall of the bladder and urethra, division of the confluence and vaginal pull-through to the perineum are described. Discussion: The technique is derived from laparoscopic-assisted treatment for high ano-rectal malformations. Compared with current procedures for treatment for high UGS, laparoscopic-assisted approach allows mobilising vagina with minimal dissection of perineum and complete preservation of urethra. Another major advantage is to provide a direct vision for dissection of the space between rectum and urethra prior to vaginal pull-through. Conclusion: Laparoscopic-assisted vaginal pull-through appears to be an interesting approach for high UGS in CAH patients, reducing dissection and risk of urinary incontinence. This new approach needs to be strengthened by other cases.
Unigene BLAST: CBRC-ATHA-03-0010 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ATHA-03-0010 gnl|UG|At#S11719378 Arabidopsis thaliana ATARP9 (ACTIN-RELATED PR...OTEIN 9); protein binding (ATARP9) mRNA, complete cds /cds=p(235,2025) /gb=NM_123716 /gi=30694311 /ug=At.26311 /len=2187 0.47 36% ...
Pramana – Journal of Physics | News
Indian Academy of Sciences (India)
A novel pedagogical technique is presented that can be used in the undergraduate (UG) class to formulate a relativistically extended kinetic theory of gases and thermal speed distribution, while assuming the basic thermal symmetry arguments of the famous Maxwell–Boltzmann distribution as presented at the UG level.
Unigene BLAST: CBRC-FRUB-02-0691 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0691 gnl|UG|Tru#S21434263 AL836416 EFRd Takifugu rubripes cDNA clone EFRd031apc...G19, mRNA sequence /clone=EFRd031apcG19 /gb=AL836416 /gi=21878378 /ug=Tru.2410 /len=418 0.24 31% ...
Unigene BLAST: CBRC-FRUB-02-0424 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0424 gnl|UG|Tru#S21433401 AL835449 EFRb Takifugu rubripes cDNA clone EFRb017apc...D5, mRNA sequence /clone=EFRb017apcD5 /gb=AL835449 /gi=21877411 /ug=Tru.1107 /len=522 8.4 39% ...
Unigene BLAST: CBRC-FRUB-02-0642 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0642 gnl|UG|Tru#S21434581 AL836626 EFRe Takifugu rubripes cDNA clone EFRe005apc...A11, mRNA sequence /clone=EFRe005apcA11 /gb=AL836626 /gi=21878588 /ug=Tru.118 /len=378 3.6 33% ...
Unigene BLAST: CBRC-FRUB-02-0924 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0924 gnl|UG|Tru#S21434557 AL836584 EFRe Takifugu rubripes cDNA clone EFRe005apc...K15, mRNA sequence /clone=EFRe005apcK15 /gb=AL836584 /gi=21878546 /ug=Tru.1833 /len=509 7.4 31% ...
Unigene BLAST: CBRC-FRUB-02-0587 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0587 gnl|UG|Tru#S21435116 AL837106 EFRf Takifugu rubripes cDNA clone EFRf030apc...H13, mRNA sequence /clone=EFRf030apcH13 /gb=AL837106 /gi=21879068 /ug=Tru.387 /len=294 4.9 35% ...
Unigene BLAST: CBRC-FRUB-02-0677 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0677 gnl|UG|Tru#S21435495 AL837483 EFRj Takifugu rubripes cDNA clone EFRj028apc...P21, mRNA sequence /clone=EFRj028apcP21 /gb=AL837483 /gi=21879445 /ug=Tru.1777 /len=323 7.9 50% ...
Unigene BLAST: CBRC-FRUB-02-0299 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0299 gnl|UG|Tru#S21434159 AL836234 EFRd Takifugu rubripes cDNA clone EFRd007apc...O23, mRNA sequence /clone=EFRd007apcO23 /gb=AL836234 /gi=21878196 /ug=Tru.1814 /len=463 0.63 32% ...
Unigene BLAST: CBRC-FRUB-02-0473 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0473 gnl|UG|Tru#S21435395 AL837361 EFRh Takifugu rubripes cDNA clone EFRh101apc...A11, mRNA sequence /clone=EFRh101apcA11 /gb=AL837361 /gi=21879323 /ug=Tru.2111 /len=407 0.47 28% ...
Unigene BLAST: CBRC-FRUB-02-0104 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0104 gnl|UG|Tru#S21435233 AL837260 EFRg Takifugu rubripes cDNA clone EFRg101apc...H6, mRNA sequence /clone=EFRg101apcH6 /gb=AL837260 /gi=21879222 /ug=Tru.2053 /len=465 3.3 30% ...
Unigene BLAST: CBRC-FRUB-02-0391 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0391 gnl|UG|Tru#S21434264 AL836417 EFRd Takifugu rubripes cDNA clone EFRd031apc...K15, mRNA sequence /clone=EFRd031apcK15 /gb=AL836417 /gi=21878379 /ug=Tru.1810 /len=428 0.75 34% ...
Unigene BLAST: CBRC-FRUB-02-0702 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0702 gnl|UG|Tru#S21434160 AL836235 EFRd Takifugu rubripes cDNA clone EFRd007apc...K11, mRNA sequence /clone=EFRd007apcK11 /gb=AL836235 /gi=21878197 /ug=Tru.2312 /len=411 6.4 28% ...
Dietary Management of Hyperthyroidism in a Dog.
Looney, Andrea; Wakshlag, Joseph
An 8 yr old female spayed golden retriever presented for a routine exam during which ventral cervical soft tissue masses were identified. History included weight loss, increased activity and appetite, gagging, and occasional diarrhea. Exam findings included a body condition score of 4/9 and palpable ventral cervical nodules. A serum thyroxine (T4) value was 8.0 ug/dL (normal = 0.8-3.5ug/dL). Doppler systolic blood pressure readings ranged from 200-210 mmHg (normal systolic blood pressure hyperthyroidism due to active thyroid masses. Due to financial constraints, the owner elected conservative management. Initial treatment with methimazole resulted in a decreased T4 value of 5.0 ug/dL at approximately 4 mo after initiation of treatment. A commercially available iodine-restricted feline diet was fed and this resulted in further reduction in serum T4 levels, improved sleeping cycles, reduced anxiety, and reduced systolic blood pressure. A temporary suspension of iodine-restricted feline diet for 2 mo resulted in increases in serum T4 concentrations, which, subsequently, decreased with re-introduction of the diet. Roughly 10 mo after initiation of the therapeutic diet and 16 mo after intial diagnosis, the dog remains relatively normal clinically despite active growing cervical masses with T4 concentration of 2.3 ug/dL.
Directory of Open Access Journals (Sweden)
Vero vanden Abeele
2008-01-01
Full Text Available A theoretical framework and practical case for designing likeable interactive media applications for preschoolers in the home environment are introduced. First, we elaborate on the theoretical framework. We introduce the uses and gratifications paradigm (U&G. We argue that U&G is a good approach to researching likeability of media applications. Next, we complete the U&G framework with expectancy-value (EV theory. EV theory helps us move from theoretical insights to concrete design guidelines. Together, the U&G framework and the EV model form the foundation of our extended likeability framework for the design and evaluation of interactive media applications, for preschoolers in the home environment. Finally, we demonstrate a practical case of our extended likeability framework via the research project CuTI. The CuTI project aims at revealing those particular user gratifications and design attributes that are important to support playful behaviour and fun activities of preschoolers in the home environment.
Directory of Open Access Journals (Sweden)
Duygu YENİCELİ
2010-08-01
Full Text Available Spectrophotometric, potentiometric and conductometric methods are developed for the determination of bupropion hydrochloride (BLIP in pharmaceutical tablets. For the first method, original UV-spectrophotometry, 252 nm was determined as the optimum wavelength and used for the determinations. For the other method, second derivative UV spectrophotometry, the absorbances were measured at 217.4 and 221.8 nm and the distance between these extremum values was determined according to peak to peak method. Two spectrophotometric methods were validated over the concentration range of 5.72 - 20.03 ug/mL. The limit of detection and limit of quantitation values of original UV-spectrophotometry were 0.75 ug/mL and 2.28 jug/mL. Also, these parameters were determined as 0.23 ug/mL and 0.68 ug/mL respectively, for the second derivative UV spectrophotometry. Developed methods were fully validated and the applicability of the methods for the determination of BUP in pharmaceuticals were demonstrated. Also, simple potentiometric and conductometric methods were developed and the applicability of these methods were demonstrated. The results of four analytical methods were compared with ANOVA test and no significant difference was found statistically. As a result, the developed methods could be proposed to the rutin content analysis to be simple, cheap, accurate, and precise
Inheritance of resistance to Ug99 stem rust pathogen in selected ...
African Journals Online (AJOL)
13 × 08-UT-86 (χ2 0.05 = 0.480, P ≥ 0.488), HKBL-1385-13 × 09-N2-19 (χ2 0.05 = 0.641, P ≥ 0.424), ND2649 × 09-AB-78 (χ2 0.05 = 1.05, P ≥ 0.309) and ND25882 × 09-AB-78 (χ2 0.05 = 3.599, P ≥ 0.058) exhibited Mendelian segregation ...
Alternative technology for arsenic removal from drinking water
Directory of Open Access Journals (Sweden)
Purenović Milovan
2007-01-01
Full Text Available Arsenic is a naturally occurring element in water, food and air. It is known as a poison, but in very small quantities it is showed to be an essential element. Actual problem in the world is arsenic removal from drinking water using modern and alternative technology, especially because EPA's and other international standards have reduced MCL from 50 to 10 ug/1. Because of rivers and lakes pollution, in a number of plants for natural water purification, average concentrations of arsenic in water are up to 100 ug/1. According to MCL, present technologies are unadjusted for safely arsenic removal for concentrations below of 10 ug/1. This fact has inspired many companies to solve this problem adequately, by using an alternative technologies and new process able materials. In this paper the observation of conventional and the alternative technologies will be given, bearing in mind complex chemistry and electrochemistry of arsenic, formation of colloidal arsenic, which causes the biggest problems in water purification technologies. In this paper many results will be presented, which are obtained using the alternative technologies, as well as the newest results of original author's investigations. Using new nanomaterials, on Pilot plant "VALETA H2O-92", concentration of arsenic was removed far below MLC value.
Blood Lead Levels And Potental Environmental Exposures Among ...
African Journals Online (AJOL)
p = 0.439). Low risk parental occupation (p = 0.001) and. Kales sourced from the market/kiosks (p = 0.001) were significantly associated with BLL ≥ 10ug/dl. Soil lead levels (Soil Pb) ranged from 3,000 to 90,000ug/kg, which was very high ...
Biodiversity in the city: key challenges for urban green space management
Myla F.J. Aronson; Christopher A. Lepczyk; Karl L. Evans; Mark A. Goddard; Susannah B. Lerman; J. Scott MacIvor; Charles H. Nilon; Timothy. Vargo
2017-01-01
Cities play important roles in the conservation of global biodiversity, particularly through the planning and management of urban green spaces (UGS). However, UGS management is subject to a complex assortment of interacting social, cultural, and economic factors, including governance, economics, social networks, multiple stakeholders, individual preferences, and social...
Directory of Open Access Journals (Sweden)
Laura Levin
2012-06-01
Full Text Available El objetivo de este trabajo fue evaluar el potencial del escobajo, un residuo agroindustrial, como sustrato para el crecimiento y la producción de enzimas lignocelulósicas de tres hongos causantes de pudrición blanca en la madera: Trametes trogii, Stereum hirsutum y Coriolus antarcticus. Para ello se utilizaron técnicas de fermentación en estado sólido. También se ensayó la decoloración de colorantes industriales sobre estos cultivos. La pérdida de peso seco del sustrato fue similar después del día 60 (33-43 %. C. antarcticus produjo las mayores actividades de lacasa y Mn-peroxidasa (33,0 y 1,6 U/g peso seco. La mayor actividad endoglucanasa fue medida en cultivos de S. hirsutum (10,4 U/g, y la mayor actividad endoxilanasa en T. trogii (14,6 U/g. El sistema C. antarcticus/escobap mostró un importante potencial para su aplicación en la biorremediación de efluentes textiles, con porcentajes de decoloración de 93, 86, 82, 82, 77 y 58 % para índigo carmín, verde de malaquita, azure B, azul R brillante de remazol, cristal violeta y xilidina, respectivamente, en 5 h.The aim of this work was to evaluate the potential of grape stalks, an agroindustrial waste, for growth and lignocellulolytic enzyme production via solid-state fermentation, using the following three white rot fungi: Trametes trogii, Stereum hirsutum and Coriolus antarcticus. The decolorization of several dyes by the above mentioned cultures was also investigated. Similar values of dry weight loss of the substrate were measured after 60 days (33-43 %. C. antarcticus produced the highest laccase and Mn-peroxldase activities (33.0 and 1.6 U/g dry solid. The maximum endoglucanase production was measured in S. hirsutum cultures (10.4 U/g, while the endoxylanase peak corresponded to T. trogii (14.6 U/g. The C. antarcticus/grape stalk system seems potentially competitive in bioremediation of textile processing effluents, attaining percentages of decolorization of 93, 86, 82, 82
Burnt sugarcane harvesting - cardiovascular effects on a group of healthy workers, Brazil.
Directory of Open Access Journals (Sweden)
Cristiane Maria Galvão Barbosa
Full Text Available Brazil is the world's largest producer of sugarcane. Harvest is predominantly manual, exposing workers to health risks: intense physical exertion, heat, pollutants from sugarcane burning.Panel study to evaluate the effects of burnt sugarcane harvesting on blood markers and on cardiovascular system.Twenty-eight healthy male workers, living in the countryside of Brazil were submitted to blood markers, blood pressure, heart rate variability, cardiopulmonary exercise testing, sympathetic nerve activity evaluation and forearm blood flow measures (venous occlusion plethysmography during burnt sugarcane harvesting and four months later while they performed other activities in sugar cane culture.Mean participant age was 31 ± 6.3 years, and had worked for 9.8 ± 8.4 years on sugarcane work. Work during the harvest period was associated with higher serum levels of Creatine Kinase - 136.5 U/L (IQR: 108.5-216.0 vs. 104.5 U/L (IQR: 77.5-170.5, (p = 0.001; plasma Malondialdehyde-7.5 ± 1.4 µM/dl vs. 6.9 ± 1.0 µM/dl, (p = 0.058; Glutathione Peroxidase - 55.1 ± 11.8 Ug/Hb vs. 39.5 ± 9.5 Ug/Hb, (p<0.001; Glutathione Transferase- 3.4±1.3 Ug/Hb vs. 3.0 ± 1.3 Ug/Hb, (p = 0.001; and 24-hour systolic blood pressure - 120.1 ± 10.3 mmHg vs. 117.0 ± 10.0 mmHg, (p = 0.034. In cardiopulmonary exercise testing, rest-to-peak diastolic blood pressure increased by 11.12 mmHg and 5.13 mmHg in the harvest and non-harvest period, respectively. A 10 miliseconds reduction in rMSSD and a 10 burst/min increase in sympathetic nerve activity were associated to 2.2 and 1.8 mmHg rises in systolic arterial pressure, respectively.Work in burnt sugarcane harvesting was associated with changes in blood markers and higher blood pressure, which may be related to autonomic imbalance.
Johnson, Linda B; Sumner, Sean; Duong, Tina; Yan, Posu; Bajcsy, Ruzena; Abresch, R Ted; de Bie, Evan; Han, Jay J
2015-12-01
Goniometers are commonly used by physical therapists to measure range-of-motion (ROM) in the musculoskeletal system. These measurements are used to assist in diagnosis and to help monitor treatment efficacy. With newly emerging technologies, smartphone-based applications are being explored for measuring joint angles and movement. This pilot study investigates the intra- and inter-rater reliability as well as concurrent validity of a newly-developed smartphone magnetometer-based goniometer (MG) application for measuring passive shoulder abduction in both sitting and supine positions, and compare against the traditional universal goniometer (UG). This is a comparative study with repeated measurement design. Three physical therapists utilized both the smartphone MG and a traditional UG to measure various angles of passive shoulder abduction in a healthy subject, whose shoulder was positioned in eight different positions with pre-determined degree of abduction while seated or supine. Each therapist was blinded to the measured angles. Concordance correlation coefficients (CCCs), Bland-Altman plotting methods, and Analysis of Variance (ANOVA) were used for statistical analyses. Both traditional UG and smartphone MG were reliable in repeated measures of standardized joint angle positions (average CCC > 0.997) with similar variability in both measurement tools (standard deviation (SD) ± 4°). Agreement between the UG and MG measurements was greater than 0.99 in all positions. Our results show that the smartphone MG has equivalent reliability compared to the traditional UG when measuring passive shoulder abduction ROM. With concordant measures and comparable reliability to the UG, the newly developed MG application shows potential as a useful tool to assess joint angles. Published by Elsevier Ltd.
Gene : CBRC-MMUS-09-0003 [SEVENS
Lifescience Database Archive (English)
Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-103 84% MIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCHIPGPTVCISHFSRFSLILS...LFKLSTACFSFSMIFNFLAIFHVLQWKFLYFPTFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLLWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRNIPGPTVCISHFP ...
Gene : CBRC-MMUS-09-0004 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4152306 /ug=Mm.330279 /len=4633 1e-108 87% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVIS...SFFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFSMIFSFLAIFHVPQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRF ...
Virucidal activity of the dendrimer microbicide SPL7013 against HIV-1.
Telwatte, Sushama; Moore, Katie; Johnson, Adam; Tyssen, David; Sterjovski, Jasminka; Aldunate, Muriel; Gorry, Paul R; Ramsland, Paul A; Lewis, Gareth R; Paull, Jeremy R A; Sonza, Secondo; Tachedjian, Gilda
2011-06-01
Topical microbicides for use by women to prevent the transmission of human immunodeficiency virus (HIV) and other sexually transmitted infections are urgently required. Dendrimers are highly branched nanoparticles being developed as microbicides. SPL7013 is a dendrimer with broad-spectrum activity against HIV type I (HIV-1) and -2 (HIV-2), herpes simplex viruses type-1 (HSV-1) and -2 (HSV-2) and human papillomavirus. SPL7013 [3% (w/w)] has been formulated in a mucoadhesive carbopol gel (VivaGel®) for use as a topical microbicide. Previous studies showed that SPL7013 has similar potency against CXCR4-(X4) and CCR5-using (R5) strains of HIV-1 and that it blocks viral entry. However, the ability of SPL7013 to directly inactivate HIV-1 is unknown. We examined whether SPL7013 demonstrates virucidal activity against X4 (NL4.3, MBC200, CMU02 clade EA and 92UG046 clade D), R5 (Ba-L, NB25 and 92RW016 clade A) and dual-tropic (R5X4; MACS1-spln) HIV-1 using a modified HLA-DR viral capture method and by polyethylene glycol precipitation. Evaluation of virion integrity was determined by ultracentrifugation through a sucrose cushion and detection of viral proteins by Western blot analysis. SPL7013 demonstrated potent virucidal activity against X4 and R5X4 strains, although virucidal activity was less potent for the 92UG046 X4 clade D isolate. Where potent virucidal activity was observed, the 50% virucidal concentrations were similar to the 50% effective concentrations previously reported in drug susceptibility assays, indicating that the main mode of action of SPL7013 is by direct viral inactivation for these strains. In contrast, SPL7013 lacked potent virucidal activity against R5 HIV-1 strains. Evaluation of the virucidal mechanism showed that SPL7013-treated NL4.3, 92UG046 and MACS1-spln virions were intact with no significant decrease in gp120 surface protein with respect to p24 capsid content compared to the corresponding untreated virus. These studies demonstrate that SPL
DEFF Research Database (Denmark)
Malling, Tine Halsen; Sigsgaard, Torben; Andersen, Helle Raun
2009-01-01
OBJECTIVE: Glutathione peroxidase 1 (GPX1) is one of the major oxidative enzymes. Our aim was to characterize factors influencing its activity and to determine whether or not the activity is associated with asthma. MATERIAL AND METHODS: Serum selenium concentration was measured, GPX1 polymorphisms...... %) had doctor-diagnosed asthma. RESULTS: The average serum selenium concentration was too low for optimal enzyme activity (mean (SE), 83.4 (0.76) ng/mL). GPX1 activity in men was lower than in women, 52.6 (0.66) and 56.4 (0.59) U/g protein, respectively (p... associated with serum selenium concentration (p = 0.005) and negatively associated with both active smoking (p = 0.009) and exposure to environmental tobacco smoke (p = 0.02). In women, activity was associated with genotypes with 59.2 (1.4), 56.0 (1.4) and 54.2 (1.4) U/g protein in the homozygote wild...
Wenghofer, Elizabeth F; Hogenbirk, John C; Timony, Patrick E
2017-02-20
The "rural pipeline" suggests that students educated in rural, or other underserviced areas, are more likely to establish practices in such locations. It is upon this concept that the Northern Ontario School of Medicine (NOSM) was founded. Our analysis answers the following question: Are physicians who were educated at NOSM more likely to practice in rural and northern Ontario compared with physicians who were educated at other Canadian medical schools? We used data from the College of Physicians and Surgeons of Ontario. We compared practice locations of certified Ontario family physicians who had graduated from NOSM vs. other Canadian medical schools in 2009 or later. We categorized the physicians according to where they completed their undergraduate (UG) and postgraduate (PG) training, either at NOSM or elsewhere. We used logistic regression models to determine if the location of UG and PG training was associated with rural or northern Ontario practice location. Of the 535 physicians examined, 67 had completed UG and/or PG medical education at NOSM. Over two thirds of physicians with any NOSM education were practicing in northern areas and 25.4% were practicing in rural areas of Ontario compared with those having no NOSM education, with 4.3 and 10.3% in northern and rural areas, respectively. Physicians who graduated from NOSM-UG were more likely to have practices located in rural Ontario (OR = 2.57; p = 0.014) whereas NOSM-PG physicians were more likely to have practices in northern Ontario (OR = 57.88; p education was associated with an increased likelihood of practicing in rural (NOSM-UG) and northern (NOSM-PG) Ontario.
DEFF Research Database (Denmark)
Mikkelsen, Lone Ramer; Petersen, Annemette Krintel; Søballe, Kjeld
(primary outcome, HOOS), anxiety (HADS), working status and patient satisfaction were administered before THR, 3 and 6 weeks after. Findings / Results HOOS function score at the 3 measurement times were (mean ± SD); UG: 46±17 - 76±9 - 83±14 compared to RG: 43±16 – 81±14 - 83±13, (difference between groups...... over time, p=0.004). For return to work 6 weeks post THR, UG compared to RG: 53% versus 32% (p=0.045). No significant differences between groups in anxiety, hip dislocations and patient satisfaction. Conclusions No clinically relevant difference between UG and RG on patient evaluated function was found...
Fatima, Bilqees; Ali, Sikander
2012-01-01
Sixteen different mould cultures viz. Aspergillus, Alternaria, Arthroderma, Trichoderma, Fusarium, Penicillium, Rhizopus and Chochliobolus were isolated from the soil samples of Qatar by serial dilution method. The preliminary screening of isolates was done by selecting initial colonies showing relatively bigger zones of starch hydrolysis on nutrient agar plates. The isolates were then subjected to secondary screening by submerged fermentation (SmF). The 1,4-α-D-glucan glucohydrolase (GGH) activity ranged from 1.906-12.675 U/ml/min. The product yield was analysed in dependence of mycelial morphology, biomass level and protein content. The isolate Aspergillus oryzae llB-6 which gave maximum enzyme production was incubated in M3 medium containing 20 g/l starch, 10 g/l lactose, 8.5 g/l yeast extract, 6 g/l corn steep liquor (CSL), 1.2 g/l MgSO4.7H2O, 1.3 g/l NH4Cl, 0.6 g/l CaCl2.2H2O, pH 5 at 30±2°C and 200 rpm. On the basis of kinetic variables, notably Qp (0.058±0.01(a) U/g/h), Yp/s (0.308±0.03(ab) U/g) and qp (0.210±0.032(abc) U/g fungal biomass/h), A. oryzae IIB-6 was found to be a hyper producer of GGH (LSD 0.0345) compared to A. kawachii IIB-2. A noticeable enhancement in enzyme activity of over 30% was observed (13.917±1.01 U/ml/min) when the process parameters viz. cultural conditions (pH 5, incubation period 72 h) and nutritional requirements (6 g/l CSL, 9.5 g/l yeast extract, 10 g/l starch, 20 g/l lactose) were further optimized using a 2-factorial Plackett-Burman design. The model terms were found to be highly significant (HS, p≤0.05), indicating the potential utility of the culture (dof~3).
1980-12-01
PRONGHOHN ’’f~l I~-along an o I ’ vDI . i M1,1l gradijqnf it, the Novada/lltah study areal. Table, 3. 2.2. 5-1I Majur \\(4NetaLt io I1 e inl vhe Nevada...I I 5 )1~~~~~ 1. (041 V 7 / A1 "N 12( *UG A13 _3t L~ Ill441 I 130 111 2048 IllI 43N E 0 A/f 113 tHo.Z64T, 8*208 ’X 210 2I ’* I---’----R
A low-noise MEMS accelerometer for unattended ground sensor applications
Speller, Kevin E.; Yu, Duli
2004-09-01
A low-noise micro-machined servo accelerometer has been developed for use in Unattended Ground Sensors (UGS). Compared to conventional coil-and-magnet based velocity transducers, this Micro-Electro-Mechanical System (MEMS) accelerometer offers several key benefits for battlefield monitoring. Many UGS require a compass to determine deployment orientation with respect to magnetic North. This orientation information is critical for determining the bearing of incoming signals. Conventional sensors with sensing technology based on a permanent magnet can cause interference with a compass when used in close proximity. This problem is solved with a MEMS accelerometer which does not require any magnetic materials. Frequency information below 10 Hz is valuable for identification of signal sources. Conventional seismometers used in UGS are typically limited in frequency response from 20 to 200 Hz. The MEMS accelerometer has a flat frequency response from DC to 5 kHz. The wider spectrum of signals received improves detection, classification and monitoring on the battlefield. The DC-coupled output of the MEMS accelerometer also has the added benefit of providing tilt orientation data for the deployed UGS. Other performance parameters of the MEMS accelerometer that are important to UGS such as size, weight, shock survivability, phase response, distortion, and cross-axis rejection will be discussed. Additionally, field test data from human footsteps recorded with the MEMS accelerometer will be presented.
Cooperative Behavior in the Ultimatum Game and Prisoner’s Dilemma Depends on Players’ Contributions
Directory of Open Access Journals (Sweden)
Amy R. Bland
2017-06-01
Full Text Available Economic games such as the Ultimatum Game (UG and Prisoner’s Dilemma (PD are widely used paradigms for studying fairness and cooperation. Monetary versions of these games involve two players splitting an arbitrary sum of money. In real life, however, people’s propensity to engage in cooperative behavior depends on their effort and contribution; factors that are well known to affect perceptions of fairness. We therefore sought to explore the impact of relative monetary contributions by players in the UG and PD. Adapted computerized UG and PD games, in which relative contributions from each player were manipulated, were administered to 200 participants aged 18–50 years old (50% female. We found that players’ contribution had large effects on cooperative behavior. Specifically, cooperation was greater amongst participants when their opponent had contributed more to joint earnings. This was manifested as higher acceptance rates and higher offers in the UG; and fewer defects in the PD compared to when the participant contributed more. Interestingly, equal contributions elicited the greatest sensitivity to fairness in the UG, and least frequent defection in the PD. Acceptance rates correlated positively with anxiety and sex differences were found in defection behavior. This study highlights the feasibility of computerized games to assess cooperative behavior and the importance of considering cooperation within the context of effortful contribution.
Brevers, Damien; Noël, Xavier; Hanak, Catherine; Verbanck, Paul; Kornreich, Charles
2015-01-01
Recent empirical findings suggest that alcohol dependence is characterized by heightened sensitivity to unfairness during social transactions. The present study went a step further and aimed to ascertain whether this abnormal level of sensitivity to unfairness is underlined by an increased emotional reactivity. Twenty-six recently abstinent alcohol-dependent (AD) individuals and 32 controls performed an ultimatum game (UG), in which participants had to respond to take-it-or-leave-it offers, ranging from fair to unfair and made by a fictive proposer. Emotional state was recorded during UG offers presentation and was indexed by the amplitude of skin conductance response (SCR). Results showed that AD decided to reject unfair offers more frequently than their controls, confirming previous data. The proportion of rejected unfair UG offers was correlated with SCR, in the AD but not in the control group. This finding suggests that deciding to accept or reject unfair UG offers is influenced by arousal-affective activity in AD, but not in controls. Heightened emotional reactivity may have driven AD to punish the proposer rather than acting as a rational economic agent. An implication of present findings is that AD might have difficult to cope with unfair situations triggered by social interactions. Future studies are needed in order to examine whether-emotional and behavioral-reactivity to unfairness during the UG could impact alcohol consumption and relapse in AD.
Measurement of superoxide dismutase-like activity in peel and pulp of apple from Anshan acres
Zhao, Lijuan
2018-04-01
Pyrogallol autoxidation method was used for measurement of SOD-like activity. They are 259.56 u/g and 148.78 u/g in peel and pulp of apple from Anshan acres. The proper-conditions for this measurement was determined through experiment as following: detection wavelength of spectrophotometer 325nm, buffer system Tris-HAc, concentration of Tris-HAc solution 50 mmoL and pH8.2. The inhibition rate of SOD-L again pyrogallol antioxidation are 92% and 90% in peel and pulp of apple.
Gene : CBRC-XTRO-01-1571 [SEVENS
Lifescience Database Archive (English)
Full Text Available gi=74306002 /ug=Str.68514 /len=887 2e-11 37% MHLVLRHPVLRHPVLRHPVLRHPVLLHPVLRHPVLLHPVLLHLVLLHPVLLHLVLRHPV...LRHPVLRHPVLRHLVLLHLVLLHLVLRHPVLRHPVLRHLVLLHLVLLHLVLLHPVLLHPVLLHPVLRHLVLLHLVLLHLVLRHPVLRHPV...LRHLVLLHLVLLHLVLLHLVLLHPVLRHPVLLHLVLLHLVLWHPVLPCRSARGSVVRKLIHCCIYHKIALVM ...
Gene : CBRC-CINT-01-0198 [SEVENS
Lifescience Database Archive (English)
Full Text Available gi=24256529 /ug=Cin.19191 /len=800 2.9 30% MELDHIVLVLGNILQMVVEQPFLQLVRRCQRMELDHIV...LVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQLLQQLERRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILLMVVEQPFLQLVRRCQRMELDHI...VLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILLQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQRMELDHIVLVLGKCVSRWLWTNAFRGGITTSMQGSGENFLLGER ...
A stratiform cloud parameterization for General Circulation Models
International Nuclear Information System (INIS)
Ghan, S.J.; Leung, L.R.; Chuang, C.C.; Penner, J.E.; McCaa, J.
1994-01-01
The crude treatment of clouds in General Circulation Models (GCMs) is widely recognized as a major limitation in the application of these models to predictions of global climate change. The purpose of this project is to develop a paxameterization for stratiform clouds in GCMs that expresses stratiform clouds in terms of bulk microphysical properties and their subgrid variability. In this parameterization, precipitating cloud species are distinguished from non-precipitating species, and the liquid phase is distinguished from the ice phase. The size of the non-precipitating cloud particles (which influences both the cloud radiative properties and the conversion of non-precipitating cloud species to precipitating species) is determined by predicting both the mass and number concentrations of each species
Gene : CBRC-MMUS-09-0002 [SEVENS
Lifescience Database Archive (English)
Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-136 70% MIFTFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFSMIFTFLAI...FHVPQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRFSVILSFFNLSTACFSFSMIFSFLAIFHVLQWKFLYFPTFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISH...FSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFFRFFSDFVIFHVVKWMFLIFHDFHFSCHISCPKVCISHFQ ...
Gene : CBRC-MMUS-09-0000 [SEVENS
Lifescience Database Archive (English)
Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-121 83% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVISS...FFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPTFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFFMIFSFLAIFHVPQWTFLN...VPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRFSVIFSFFNLSTACFSFSMIFSFLAIFQVLQCAFLIFHVFQ ...
Gene : CBRC-MMUS-09-0001 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4152306 /ug=Mm.330279 /len=4633 1e-115 71% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVIS...SFFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLQWTFL...NFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFFRFFSDFVIFHVVKWMFLIFHDFHFSCHISCPKVCISHFQ ...
Gene : CBRC-MDOM-02-0315 [SEVENS
Lifescience Database Archive (English)
Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...FASSFISFASFSSWLILAFKTVFSVSRLLILVFKFLSQLSSASLSCVLNCILSSSKACVQFAGISVLLLISSSVLLVLGSLPVQKLSIVISFFFFCCLLIFTSSLLPVFVCALAPLIFFWFWGFLSVSPLGALSELSVQSLGEECWLPCPLEAFDQIMLNWVGLYVL ... ...04581 [Lodderomyces elongisporus NRRL YB-4239] 2e-05 35% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona
Gene : CBRC-MDOM-01-0392 [SEVENS
Lifescience Database Archive (English)
Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...IFFTSSFICFASSFISFASFSSWLVLAFKTPFSCFSSSASVYKCLILVFKFFSQFYSASLNCVLNCILSSSKDCIQFAGISDFSFADPSPSVSFALCSLPVQKLSIVISFFFFCCLLKFTPSLLPIFVCALTPLIFFLFWGCQSPLLELCQISWYSL ... ...04581 [Lodderomyces elongisporus NRRL YB-4239] 2e-08 33% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona
Evidence for the Fundamental Difference Hypothesis or Not?: Island Constraints Revisited
Belikova, Alyona; White, Lydia
2009-01-01
This article examines how changes in linguistic theory affect the debate between the fundamental difference hypothesis and the access-to-Universal Grammar (UG) approach to SLA. With a focus on subjacency (Chomsky, 1973), a principle of UG that places constraints on "wh"-movement and that has frequently been taken as a test case for verifying…
A new multiplicity formula for the Weyl modules of type A
International Nuclear Information System (INIS)
Ye Jiachen; Zhou Zhongguo
2003-08-01
A monomial basis and a filtration of subalgebras for the universal enveloping algebra U(g) of a complex simple Lie algebra g l of type A I is given in this note. In particular, a new multiplicity formula for the Weyl module V(λ) of U(g l ) is obtained in this note. (author)
Gene : CBRC-PMAR-01-0559 [SEVENS
Lifescience Database Archive (English)
Full Text Available 9 /gi=114310048 /ug=Pma.7703 /len=689 1e-04 33% MSTSLLDFCMCWCGLSPLACLLHVFLCPNLHLPVCFTCLYGLSPLVCLLHVSLWPISTCL...PASRVSMAYLHLPACFTCLYGLSPLACLLHVFLWPISTCLPASRVSMAYLHLPACFTCLYGLISTCLPASRVSMAYLHLPACFTCLYGLSPLVCLLHVSLWPISTC...LPASRVSMSYLHLSACFTCLYGLISTCLPASRVSMGYLHLPACFTCLYCLIFTCLPASRVSMACLHLSACLPHLSV ...
Trustworthiness and Negative Affect Predict Economic Decision-Making.
Nguyen, Christopher M; Koenigs, Michael; Yamada, Torricia H; Teo, Shu Hao; Cavanaugh, Joseph E; Tranel, Daniel; Denburg, Natalie L
2011-09-01
The Ultimatum Game (UG) is a widely used and well-studied laboratory model of economic decision-making. Here, we studied 129 healthy adults and compared demographic (i.e., age, gender, education), cognitive (i.e., intelligence, attention/working memory, speed, language, visuospatial, memory, executive functions), and personality (i.e., "Big Five", positive affect, negative affect) variables between those with a "rational" versus an "irrational" response pattern on the UG. Our data indicated that participants with "rational" UG performance (accepting any offer, no matter the fairness) endorsed higher levels of trust, or the belief in the sincerity and good intentions of others, while participants with "irrational" UG performance (rejecting unfair offers) endorsed higher levels of negative affect, such as anger and contempt. These personality variables were the only ones that differentiated the two response patterns-demographic and cognitive factors did not differ between rational and irrational players. The results indicate that the examination of personality and affect is crucial to our understanding of the individual differences that underlie decision-making.
Evaluation of the use of transglutaminase in dairy drinks made from goat milk
Directory of Open Access Journals (Sweden)
Daniela Cristina Faria Vieira
2015-02-01
Full Text Available The aim of this study was to evaluate the use of transglutaminase in dairy drinks made from with goat milk with 45% of serum, and the physical, chemical, microbiological and sensory characteristics of these drinks within the expiration date of the product. In the first phase, five different levels of transglutaminase (0, 0.2, 0.3, 0.4, 0.5 U/g were evaluated. In the second phase, the drink that had the best sensory acceptability was evaluated for 30 days. It was observed that the dairy drink treated with 0.5 U/g transglutaminase showed higher sensory acceptability in relation to the 7.18 overall impression. The color values of the dairy drink treated with 0.5 U/g showed no significant difference (p<0.05. The values of lactic acid bacteria are established according to the legislation. Results show the feasibility of the use of transglutaminase in dairy drinks.
Jana, Arijit; Maity, Chiranjit; Halder, Suman Kumar; Mondal, Keshab Chandra; Pati, Bikash Ranjan; Mohapatra, Pradeep Kumar Das
2012-07-01
Tannase production by newly isolated Penicillium purpurogenum PAF6 was investigated by 'one variable at a time' (OVAT) approach followed by response surface methodology (RSM). Tannin-rich plant residues were used as supporting solid substrate and sole carbon source and, among them, tamarind seed was found to be the most favorable substrate than haritaki, pomegranate, tea leaf waste and arjun fruit. Physicochemical parameters were initially optimized using OVAT methodology and some important factors like incubation time, incubation temperature, substrate:moisture ratio as well as carbon, nitrogen and phosphate concentrations were verified with Box-Behken design of response surface methodology. Phosphate source, nitrogen source and temperature were found as the most favorable variables in the maximization of production. Tannase production was enhanced from 1.536 U/g to 5.784 U/g using tamarind seed OVAT optimization and further enhancement up to 6.15 U/g following RSM. An overall 3.76- and 4.0-fold increases in tannase production were achieved in OVAT and RSM, respectively.
International Nuclear Information System (INIS)
Cabral, R.G.
1981-02-01
The feasibility of the determination of uranium in oil shale, by the fission track registration technique is studied. The wet and dry methods were employed, using a Bayer policarbonate, Makrofol KG, as detector. It was created a new variant of the dry method. The fission track registration technique was used in samples of raw, retorted and spent shale from Irati, Parana in Brazil, 16 μg U/g, 20 μg U/g and 20μg U/g were found, respectively, with a total error ranging from 19% to 20%. Some experimental results were included for illustration and comparison. The feasibility of the determination of uranium in oil shale from Irati was verified. (Author) [pt
Directory of Open Access Journals (Sweden)
Rodrigo Ramirez-Campillo
2018-03-01
Full Text Available The aim of this study was to compare changes in young soccer player's fitness after traditional bilateral vs. unilateral combined plyometric and strength training. Male athletes were randomly divided in two groups; both received the same training, including strength training for knee extensors and flexors, in addition to horizontal plyometric training drills. The only difference between groups was the mode of drills technique: unilateral (UG; n = 9; age, 17.3 ± 1.1 years vs. bilateral (TG; n = 9; age, 17.6 ± 0.5 years. One repetition maximum bilateral strength of knee muscle extensors (1RM_KE and flexors (1RM_KF, change of direction ability (COD, horizontal and vertical jump ability with one (unilateral and two (bilateral legs, and limb symmetry index were measured before and after an 8-week in-season intervention period. Some regular soccer drills were replaced by combination of plyometric and strength training drills. Magnitude-based inference statistics were used for between-group and within-group comparisons. Beneficial effects (p < 0.05 in 1RM_KE, COD, and several test of jumping performance were found in both groups in comparison to pre-test values. The limb symmetry index was not affected in either group. The beneficial changes in 1RM_KE (8.1%; p = 0.074 and 1RM_KF (6.7%; p = 0.004, COD (3.1%; p = 0.149, and bilateral jump performance (from 2.7% [p = 0.535] to 10.5% [p = 0.002] were possible to most likely beneficial in the TG than in the UG. However, unilateral jump performance measures achieved likely to most likely beneficial changes in the UG compared to the TG (from 4.5% [p = 0.090] to 8.6% [p = 0.018]. The improvements in jumping ability were specific to the type of jump performed, with greater improvements in unilateral jump performance in the UG and bilateral jump performance in the TG. Therefore, bilateral strength and plyometric training should be complemented with unilateral drills, in order to maximize adaptations.
Optimizing detection filters for single-grain optical dating of quartz
International Nuclear Information System (INIS)
Ballarini, M.; Wallinga, J.; Duller, G.A.T.; Brouwer, J.C.; Bos, A.J.J.; Van Eijk, C.W.E.
2005-01-01
We investigate the use of different optical detection filters for single-grain optically stimulated luminescence (OSL) measurements of quartz samples with a Riso TL/OSL single-grain reader. We selected three filter combinations that considerably improve the light detection efficiency when compared with the 7.5 mm U340 filters that are routinely used. These are the UG1+BG4 filter combination, the 2 mm UG1 and the 2.5 mm U340 filters, which allow a greater transmission in the quartz emission band. This leads to two benefits: (1) more grains can be accepted for equivalent dose analysis, and (2) OSL responses on individual grains are determined with a greater precision. While these three alternative filter combinations perform equally well if compared to each other, we suggest the 2.5 mm thick Hoya U340 to be the filter of choice as it allows the use of blue-diode and IR-diode stimulation sources for bleaching purposes and feldspar detection
Biochemistry and Chemotherapy of Malaria and Leishmaniasis
1993-12-06
ethanol plant extracts including; nutmeg (Myristicaceae sp.), ginger ( Zingiber officinale ), goldenseal root (Hydrastis canadensis), garlic (Allium...scorodoprasum (elephant garlic), Ailium sativum (garlic), Zingiber officinale ,ginger), Myristicaceae sp. (nutmeg), Hydrastis canadensis (goldenseal...They were Glycyrrhiza glabra (IC25: 6 ug protein/ml)(Fig.7), Zingiber officinale (IC25: 14 ug protein/ ml), and ethanol extracts of Myristacea sp
Energy Technology Data Exchange (ETDEWEB)
Lopez del R, H.; Perez C, G. A.; Davila R, J. I.; Mireles G, F. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98060 Zacatecas, Zac. (Mexico); Rodriguez H, G., E-mail: hlopezdelrio@hotmail.com [Universidad Autonoma de Zacatecas, Unidad Academica de Agronomia, Carretera Zacatecas-Guadalajara Km 15.5, Cieneguillas, Zacatecas (Mexico)
2016-09-15
Phyto extraction is a technique that makes use of plants for the remediation of soils contaminated with heavy metals. In this study the uranium incorporation in the Brassica rapa L. species was evaluated, in artificially contaminated inert soils with 40 mg U/kg, and the effect of adding of the natural chelating agents citric acid and humic acids in the accumulation of uranium was analyzed. Soil free of organic matter and biologically inert was obtained by controlled calcination s of natural soil. Cultures in the prepared soil consisted of five growth treatments: 1) cultivation without uranium or additives; 2) cultivation in the uranium presence; 3) cultivation with uranium and citric acid (2 g/kg); 4) cultivation with uranium and humic acids (10 g/kg); 5) uranium cultivation and combination of citric and humic acids at the same concentrations. There was no adverse effect on plant growth with the presence of uranium at the given concentration. Regarding the controls, the total biomass in the presence of uranium was slightly higher, while the addition of humic acids significantly stimulated the production of biomass with respect to the citric acid. The combined action of organic acids produced the highest amount of biomass. The efficiency of phyto extraction followed the order Humic acids (301 μg U/g) > Non-assisted (224 μg U/g) >> Citric acid + Humic acids (68 μg U/g) > Citric acid (59 μg U/g). The values of uranium concentration in the total biomass show that the species Brassica rapa L. has the capacity of phyto extraction of uranium in contaminated soils. The addition of humic acids increases the uranium extraction while the addition of citric acid disadvantages it. (Author)
International Nuclear Information System (INIS)
Lopez del R, H.; Perez C, G. A.; Davila R, J. I.; Mireles G, F.; Rodriguez H, G.
2016-09-01
Phyto extraction is a technique that makes use of plants for the remediation of soils contaminated with heavy metals. In this study the uranium incorporation in the Brassica rapa L. species was evaluated, in artificially contaminated inert soils with 40 mg U/kg, and the effect of adding of the natural chelating agents citric acid and humic acids in the accumulation of uranium was analyzed. Soil free of organic matter and biologically inert was obtained by controlled calcination s of natural soil. Cultures in the prepared soil consisted of five growth treatments: 1) cultivation without uranium or additives; 2) cultivation in the uranium presence; 3) cultivation with uranium and citric acid (2 g/kg); 4) cultivation with uranium and humic acids (10 g/kg); 5) uranium cultivation and combination of citric and humic acids at the same concentrations. There was no adverse effect on plant growth with the presence of uranium at the given concentration. Regarding the controls, the total biomass in the presence of uranium was slightly higher, while the addition of humic acids significantly stimulated the production of biomass with respect to the citric acid. The combined action of organic acids produced the highest amount of biomass. The efficiency of phyto extraction followed the order Humic acids (301 μg U/g) > Non-assisted (224 μg U/g) >> Citric acid + Humic acids (68 μg U/g) > Citric acid (59 μg U/g). The values of uranium concentration in the total biomass show that the species Brassica rapa L. has the capacity of phyto extraction of uranium in contaminated soils. The addition of humic acids increases the uranium extraction while the addition of citric acid disadvantages it. (Author)
Analytical study on U/G coal mine CPT and inferences
Energy Technology Data Exchange (ETDEWEB)
Dey, N.C.; Mukhopadhyay, S. [Bengal Engineering College, Howrath (India). Dept. of Mining and Geology
1999-08-01
The analytical aspects of underground CPT (coal mine cost per tonne), which varies from mine to mine due to the different weightages of various contributing factors, are described. The CPT is not only dictated by the increasing wages but also by the availability of man-hour and accountability of machine utilization. An optimal blend of labour-intensive and machine-intensive methods involving least investment and operating cost, is a challenge for the coal industry. Technology upgradation and implementation, higher skill and morale, excellence in planning and monitoring, optimization in capacity utilization, and better consumer acceptability of coal will consistently improve the financial health of the coal mining sector. Other factors which will help improve the financial health of coal mining industries are (1) cost propaganda like safety week celebration; (2) cost consciousness at all levels; (3) noticeboard comprising the cost of man-hour and machine- hour; (4) no idle time for men as well as machine; (5) care to increase the life of machines; (6) scope of target amendment in a year; (7) prior to introducing costly machines, due weightage to be given on coal grade, mine life, geo-mining conditions; and (8) award to most economic mine and punishment to others rated below the BEP (break- even point). 2 refs., 3 figs.
Directory of Open Access Journals (Sweden)
Damien eBrevers
2015-07-01
Full Text Available Recent empirical findings suggest that alcohol dependence is characterized by heightened sensitivity to unfairness during social transactions. The present study went a step further and aimed to ascertain whether this abnormal level of sensitivity to unfairness is underlined by an increased emotional reactivity. Twenty-six recently abstinent alcohol-dependent individuals (AD and 32 controls performed an Ultimatum Game (UG, in which participants had to respond to take-it-or-leave-it offers, ranging from fair to unfair and made by a fictive proposer. Emotional state was recorded during UG offers presentation and was indexed by the amplitude of skin conductance response (SCR. Results showed that AD decided to reject unfair offers more frequently than their controls, confirming previous data. The proportion of rejected unfair UG offers was correlated with SCR, in the AD but not in the control group. This finding suggests that deciding to accept or reject unfair UG offers is influenced by arousal-affective activity in AD, but not in controls. Heightened emotional reactivity may have driven AD to punish the proposer rather than acting as a rational economic agent. An implication of present findings is that AD might have difficult to cope with unfair situations triggered by social interactions. Future studies are needed are needed in order to examine whether - emotional and behavioral - reactivity to unfairness during the UG could impact alcohol consumption and relapse in AD.
DeVries, Rebecca; Kriebel, David; Sama, Susan
2017-02-01
A systematic literature review was performed to identify all peer-reviewed literature quantifying the association between short-term exposures of particulate matter <2.5 microns (PM 2.5 ), nitrogen dioxide (NO 2 ), and sulfur dioxide (SO 2 ) and COPD-related emergency department (ED) visits, hospital admissions (HA), and mortality. These results were then pooled for each pollutant through meta-analyses with a random effects model. Subgroup meta-analyses were explored to study the effects of selected lag/averaging times and health outcomes. A total of 37 studies satisfied our inclusion criteria, contributing to a total of approximately 1,115,000 COPD-related acute events (950,000 HAs, 80,000 EDs, and 130,000 deaths) to our meta-estimates. An increase in PM 2.5 of 10 ug/m 3 was associated with a 2.5% (95% CI: 1.6-3.4%) increased risk of COPD-related ED and HA, an increase of 10 ug/m 3 in NO 2 was associated with a 4.2% (2.5-6.0%) increase, and an increase of 10 ug/m 3 in SO 2 was associated with a 2.1% (0.7-3.5%) increase. The strength of these pooled effect estimates, however, varied depending on the selected lag/averaging time between exposure and outcome. Similar pooled effects were estimated for each pollutant and COPD-related mortality. These results suggest an ongoing threat to the health of COPD patients from both outdoor particulates and gaseous pollutants. Ambient outdoor concentrations of PM 2.5 , NO 2 , and SO 2 were significantly and positively associated with both COPD-related morbidity and mortality.
Gao, Qinling; Yuan, Shuhua; Yuan, Dawei
2017-09-15
We explored the correlation between the TGFBR2 gene that is mediated by NF-kb signaling pathways and the pathogenesis of Kawasaki disease in children. In this study, 43 children with Kawasaki disease from April 2014 to January 2016 at our hospital were selected as the observation group, and 42 healthy children were selected as the control group. The mRNA expression levels of NF-kb gene and TGFBR2 gene in different groups were detected using fluorescence quantitative PCR. The protein expression levels of the NF-kb and TGFBR2 were detected using enzyme-linked immunosorbent assay (ELISA) in different groups. The expression levels of NF-kb and TGFBR2 in the observation group and the control group were detected using immunohistochemistry. Compared to the control group, the mRNA expression levels of NF-kb and TGFBR2 were 12.3 times and 27.5 times as high as those in the control group respectively and there were significant differences between the two groups (pkb and TGFBR2 in the control group (0.87±0.12, 1.25±0.18) ug/l and those in the observation group (3.27±0.17, 8.16±0.22) ug/l (pkB and TGFBR2 in children with Kawasaki disease were significantly higher than those in healthy subjects (pkB signaling pathways.
Tropical Freshwater Biology - Vol 18, No 2 (2009)
African Journals Online (AJOL)
Organic fertilizer decomposition and nutrient loads in water reservoir with changing temperature, Wakiso – Ug · EMAIL FULL TEXT EMAIL FULL TEXT ... benthos in response to the biodeposition and bioturbation activities of the freshwater mussel Lamellidens marginalis (Lamarck) · EMAIL FULL TEXT EMAIL FULL TEXT
Gene : CBRC-OANA-01-1685 [SEVENS
Lifescience Database Archive (English)
Full Text Available | PREDICTED: similar to vomeronasal V1r-type receptor V1rg7 [Ornithorhynchus anatinus] 1e-148 100% gnl|UG|Oa...LSIFQAITISPSTSWWAGRKTKLPKCILPSFVIFWILNMLIDFHTLIVVTGPHNARIHQDMKYCSLGNASARATLIFSVVLSLRDLFFVGLMSVASVYMVFVLYSHHR
Gene : CBRC-PMAR-01-0595 [SEVENS
Lifescience Database Archive (English)
Full Text Available =3' /gb=EE272592 /gi=111172325 /ug=Pma.6919 /len=680 2e-04 30% MRLEYLAAIHFNVMMSHFVMMSHFVMMSHFVMMSHVVMMS...YFVMMSHFVMMSHFVMSHVVMMSHFVMSHFVMMSHVVMMSHFVMMSHFVMMSHVVMMSHFVMMNHFVMMNHFVMMSHFVMMSHFVMMSHFVMSHVVMMS...HFVMMNHFVMMNHFVMMSHFVMMSHFVMMSHFVMMNHFVMMNHFVMMSHFVMMSHFVXXXXEPLRDDEPLRDDEPLRDDEPLRDDEPLRDDESLR
Gene : CBRC-CINT-01-0197 [SEVENS
Lifescience Database Archive (English)
Full Text Available 1561) /gb=AY895021 /gi=62903344 /ug=Cin.18201 /len=1561 1.4 25% MELDHIVLVLRNIFLMV...VDWPFLWSVRRCHRMELDHTVLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQRMELDHIVLVLGNTLLMVVEQPFLQLVRRYQRMELDHI...VLVLGNTLLIVVEQPFLQLVRRYQRMELDHIVLVLGNTLLIVVEQPFLQLVRRYQRMELDHIVLVLGNTLLMEQPFLQLVRRYQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQCMEQEQMKQVKE ...
Geogenic arsenic occurs in groundwater within the polymethamorphic amphibolite-grade Waldoboro Pluton Complex in mid-coastal Maine. A few As water samples exceeded 10 ug l(-1). Part of the fractured hydrogeologic "aquifer" is exposed in the Goose River groundwatershed (33 km(2))....
International Development Research Centre (IDRC) Digital Library (Canada)
Organic agriculture is often promoted as a sustainable way to increase overall farm performance, reduce poverty, mitigate climate change, and improve food security. ... La Molina, Peru. University of British Columbia, Canada. Dr. Roberto Ugás. Implementation of sustainable organic farming techniques. Dr. Andrew Riseman.
Directory of Open Access Journals (Sweden)
Jane M. RUBENSAM
1998-10-01
Full Text Available Amostras de contrafilé (músculo L. dorsi provenientes de 26 bovinos, sendo 14 Polled Hereford (HH, sete 3/4Hereford 1/4Nelore (3/4H1/4N e cinco 5/8Hereford 3/8Nelore (5/8H3/8N, machos castrados, abatidos aos dois anos de idade, foram coletadas 24 h após o abate e analisadas quanto à atividade de calpastatina e textura, tanto no 1o dia post mortem quanto após um período de maturação de 10 dias a 2o C. A atividade de calpastatina foi determinada pelo ensaio de inibição da m-calpaína e a textura através da força de cisalhamento (Warner-Bratzler. A carne de novilhos 5/8H3/8N apresentou, no 1o dia, maiores (p0,05 entre os grupos HH e 3/4H1/4N para as mesmas características. Após 10 dias, houve uma diferença na atividade de calpastatina, porém não significativa (p>0,05, entre o grupo 5/8H3/8N (1,57U/g e os demais (HH=1,23U/g; 3/4H1/4N=1,35U/g, e diferença significativa entre os grupos HH e 5/8H3/8N para força de cisalhamento (3,67 e 5,00kg, respectivamente. Conclui-se que a atividade de calpastatina determinada 24 h post mortem pode ser útil para a previsão da textura da carne, maturada ou não, em programas de melhoramento genético, e que a participação crescente do genótipo Bos indicus nos rebanhos da Região Sul, a par das conhecidas vantagens zootécnicas, poderá resultar em carne de pior textura.Boneless rib steaks (L. dorsi muscle from 26 two years old steers, 14 Polled Hereford, seven 3/4Hereford 1/4Nelore (3/4H1/4N and five 5/8Hereford 3/8Nelore (5/8H3/8N, were collected 24 hs after slaughter and analysed for calpastatin activity and texture at the 1st day post mortem and at the 10th day of aging at 2o C. Calpastatin activity was determined by m-calpain inhibition assay and texture by shear force (Warner-Bratzler. Beef from 5/8H3/8N steers showed higher (p0.05 were detected in the same traits between groups HH and 3/4H1/4N. After 10 days of aging, there was a difference in calpastatin activity, although non
In vitro cancer models have been used to study the effect of relatively high concentrations (>200 ug/ml) of phenolic plant extracts upon cell proliferation. In this study we report that the treatment of human hepatocarcinoma HepG2 cells with lower concentrations of blueberry phenolic extract (6.5-10...
Development of a process for continuous extraction of uranium from seawater
International Nuclear Information System (INIS)
Yun, C.K.
1982-03-01
Hydrous titanium oxide, titanium phosphate, galena (PbS), polystyrene beads containing TBP were preliminarily tested, using artificial seawater. Galena indicated the capacity of 1.1mg U/g PbS and faster reaction rates, whereas, hydrous titanium oxide showed 0.6mg U/g Ti and slow rates. The adsorption performance of galena was not changed after repeated use and regeneration with dil. HCl solutions. The effective surface of galena beads was 0.4mm in depth. Elution of uranium form adsorbents was examined by both acid and alkali methods; the latter showed preferred condition. Secondary concentration of uranium by Amberlite IRA-400 was also studies. Eventually, two types of packed systems with galena (columns and panels) were installed in the seawater channel of a thermal power plant. The maximum adsorption of 150μg U/g PbS was obtained using the packed column. Based on the experimental data, the authors made a conceptual design for a test plant of the production capacity 12Kg U 3 O 8 /y. The construction would cost about $1 million and the operation cost is estimated at $115.20/lb U 3 O 8
Gene : CBRC-FRUB-02-0753 [SEVENS
Lifescience Database Archive (English)
Full Text Available AB246172 /gi=115305877 /ug=Tru.3675 /len=5037 2e-47 41% MSNITTTTSATTSQTSSSTSTSPSTTSA...TTSSPTTSTTTSQTSSSTSTSPSTTSATTSSPTTSATTSQTSSSTATSPSTTSATTSSPTTSATTSQTSSSTSTSPSTTSATTSSPTTSATSSQTSSSTATSPSTTSETTSSPTTSA...TTSQTSSSTTSPSTSSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSKTSSSTDTNPSTTSATTSSPTTSA...TTSQTSSSTTTNPSTTSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSKKSSSTDTNPSTTSATTSSPTTSA...TSSQTSSSTSTSPSTTSTTTSSPTTSATTSQTSSSTSTSPSTSSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSQTSSSTTSPSTTSTTTSSPTTSA
Gene : CBRC-MMUS-09-0006 [SEVENS
Lifescience Database Archive (English)
Full Text Available equence /gb=AK156981 /gi=74152306 /ug=Mm.330279 /len=4633 1e-120 79% MIFSFLAIFQVLQWTFPNFRPLSVFLAIFHVPKCVFLIFHDFQFPRHIPGPTVCISH...FSRFSVISSFFKTSSGCFSFFMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCHIPGPTVCISHFSRFSVILSFFN...LSTACFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFTFLAIFQVLQGHFSFFTFSVILSFSICQLHVSHFP ...
Gene : CBRC-OLAT-01-0033 [SEVENS
Lifescience Database Archive (English)
Full Text Available /clone_end=3' /gb=DC259951 /gi=141600100 /ug=Ola.17741 /len=827 1e-20 31% MVVCTAVCMAVCAAVCTAVCKEVCIAICTAICAVDCMAVFIAVCTDVLTAVCTAVC...VAVCTAVCTAICAVDCMAVCIAVCTDILTAVYTAVCTAVCTAVCTAICAVDCMAVCIAVCTDILTAVYTAVCTAVCMVVCTDVLTAVCKAVCMAVCKAICTAVCTAVCTAVCLYE ...
Gene : CBRC-MDOM-04-0140 [SEVENS
Lifescience Database Archive (English)
Full Text Available /cds=p(1,2634) /gb=NM_001099531 /gi=156119554 /ug=Mdm.4760 /len=2634 0.33 30% MPNSLTSALLNLLIYELKDMNFPLTTALAASHRFCKDVSSLSFSSMKLLIISTI...CSLSNQFWRIVFFNFQLIFDLPLHVPLLIIIFIALLSEKVAFIISALLNLFGMFLC
Effects of lead-contaminated sediment on Rana sphenocephala tadpoles
Sparling, D.W.; Krest, S.K.; Ortiz-Santaliestra, M.
2006-01-01
We exposed larval southern leopard frogs (Rana sphenocephala) to lead-contaminated sediments to determine the lethal and sublethal effects of this metal. Tadpoles were laboratory-raised from early free-swimming stage through metamorphosis at lead concentrations of 45, 75, 180, 540, 2360, 3940, 5520, and 7580 mg/kg dry weight in sediment. Corresponding pore water lead concentrations were 123, 227, 589, 1833, 8121, 13,579, 19,038, and 24,427 ug/L. Tadpoles exposed to lead concentrations in sediment of 3940 mg/kg or higher died within 2 to 5 days of exposure. At lower concentrations, mortality through metamorphosis ranged from 3.5% at 45 mg/kg lead to 37% at 2360 mg/kg lead in sediment. The LC50 value for lead in sediment was 3728 mg/kg (95% CI=1315 to 72,847 mg/kg), which corresponded to 12,539 ug/L lead in pore water (95% CI= 4000 to 35,200 ug/L). Early growth and development were depressed at 2,360 mg/kg lead in sediment (8100 ug/L in pore water) but differences were not evident by the time of metamorphosis. The most obvious effect of lead was its pronounced influence on skeletal development. Whereas tadpoles at 45 mg/kg lead in sediment did not display permanent abnormalities, skeletal malformations increased in frequency and severity at all higher lead concentrations. By 2360 mg/kg, 100% of surviving metamorphs displayed severe spinal problems, reduced femur and humerus lengths, deformed digits, and other bone malformations. Lead concentrations in tissues correlated positively with sediment and pore water concentrations.
Chaplin, Jeffrey J.; Cravotta,, Charles A.; Weitzel, Jeffrey B.; Klemow, Kenneth M.
2007-01-01
alkaline (net alkalinity range was 2.0 to 25.0 mg/L CaCO3), with relatively low concentrations of sulfate (6.40 to 24.0 mg/L) and dissolved metals (less than 500 ug/L [micrograms per liter] of iron, manganese, and aluminum). In contrast, the AMD discharges and downstream waters were characterized by elevated concentrations of sulfate and dissolved metals that exceeded Federal and State regulatory limits. The largest AMD sources were the Susquehanna Number 7 Mine discharge entering Newport Creek near its mouth (flow range was 4.7 to 19 ft3/s [cubic feet per second]), the Truesdale Mine Discharge (Dundee Outfall) entering Nanticoke Creek about 0.5 mile upstream of Loomis Park (flow range was 0.00 to 38 ft3/s), and a mine-pit overflow entering near the midpoint of Newport Creek (flow range was 4.0 to 6.9 ft3/s). The three large discharges were poorly oxygenated (dissolved oxygen concentration range was <0.05 to 6.4 mg/L) and had elevated concentrations of sulfate (range was 710 to 890 mg/L) and low concentrations of dissolved aluminum (less than 25 ug/L), but they had distinctive concentrations of net alkalinity and dissolved iron and manganese. Effluent from the Susquehanna Number 7 Mine was near-neutral (pH range was 5.9 to 6.6) and net alkaline (net alkalinity range was 12.0 to 42.0 mg/L CaCO3) with elevated concentrations of sulfate (718 to 1,170 mg/L), dissolved iron (52,500 to 77,400 ug/L), and manganese (5,200 to 5,300 ug/L). Effluent from the Truesdale Mine also was near-neutral (pH range was 5.9 to 6.3) but had variable net alkalinity (-19.0 to 57.0 mg/L CaCO3) with elevated concentrations of sulfate (571 to 740 mg/L), dissolved iron (30,500 to 43,000 ug/L), and manganese (3,600 to 5,200 ug/L). Effluent from the mine-pit overflow in Newport Creek Basin was acidic (pH range was 4.3 to 5.0; net alkalinity range was -42 to -38 mg/L CaCO3) with elevated concentrations of sulfate (800 to 840 mg/L), iron (13,000 to 16,000 ug/L), and manganese (6,800 to 7,000 ug
Energy Technology Data Exchange (ETDEWEB)
Sedlacek, R. [NlfB, Germany (Germany); Rott, W. [Wintershall AG, Celle (Germany); Rokosz, W. [POGC, Poland (PL)] (and others)
2000-07-01
The Working Party on Gas of the United Nations Economic Commission for Europe (UN/ECE), at its sixth session in 1996, decided to undertake a study on 'Underground gas storage in Europe and Central Asia'. The study was launched by the Working Party on Gas in the recognition of the role of underground gas storage (UGS) in the creation of unified European gas market, its liberalization, security of gas supply and cooperation among gas enterprises. The data analysed by the study was collected through the comprehensive questionnaire, circulated among gas companies/organizations of the ECE member-countries. To carry out the study, a special Ad Hoc Group of Experts, representing leading gas companies of the region, was set up. The study deals with a wide range of issues related to the underground storage of gas, such as current status of UGS in Europe and Central Asia, new and emerging technologies, new and existing UGS projects, regulatory framework, cost of storage in USA and in Europe, future gas markets development. An attempt was also made to identify the UGS facilities that play (and could provide in the future) the international contract border services. (authors)
Gene : CBRC-HSAP-02-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-02-0021 Novel 2 B UNKNOWN ZNF99_HUMAN 2e-13 48% gb|EAX02144.1| hCG1991981 [Homo sapi...ens] 2e-18 68% gnl|UG|Hs#S6686832 Homo sapiens hypothetical LOC387790, mRNA (cDNA clone MGC:42208...SRLRPSVRFCFFLQISLIVNIFFPGILSCLHCERNALLLYSPNCHSSLLTGEPIVCDPWASTELHKMIYKNVHVSGFSVEKTMHAAPI
Vapour pressures of uranium and uranium nitride over UN(s)
International Nuclear Information System (INIS)
Venugopal, V.; Kulkarni, S.G.; Subbanna, C.S.; Sood, D.D.
1992-01-01
The vaporization of uranium mononitride is investigated in the temperature range 1757 to 2400 K by Knudsen effusion cell mass spectrometry. The vaporization occurs incongruently by the preferential loss of nitrogen and the formation of U(1) in equilibrium with UN phase. In addition the vapour phase has U(g) and UN(g). The vapour pressure of U(g) and UN(g) are measured and their dependence with temperatures can be represented by: log(p U (Pa))=[(10.59±0.18)-(26857±357)/T(K)] (1757 UN (Pa))=[(12.19±0.57)-(37347±235)/T(K)] (2190 f G 0 (UN, g, T)(kJ/mol)=352.75-0.0494 T(K). The equilibrium constants for the dissociation of UN(s)(K 1 ) and UN(g)(K 2 ) into gaseous elements are given by: log(K 1 )=(13.03±0.18)-(42857±357)/T(K), log(K 2 )=(0.84±0.60)-(5510±427)/T(K). (orig.)
Girelli Zubani, Giulia; Zivojnovic, Marija; De Smet, Annie; Albagli-Curiel, Olivier; Huetz, François; Weill, Jean-Claude; Reynaud, Claude-Agnès; Storck, Sébastien
2017-04-03
During somatic hypermutation (SHM) of immunoglobulin genes, uracils introduced by activation-induced cytidine deaminase are processed by uracil-DNA glycosylase (UNG) and mismatch repair (MMR) pathways to generate mutations at G-C and A-T base pairs, respectively. Paradoxically, the MMR-nicking complex Pms2/Mlh1 is apparently dispensable for A-T mutagenesis. Thus, how detection of U:G mismatches is translated into the single-strand nick required for error-prone synthesis is an open question. One model proposed that UNG could cooperate with MMR by excising a second uracil in the vicinity of the U:G mismatch, but it failed to explain the low impact of UNG inactivation on A-T mutagenesis. In this study, we show that uracils generated in the G1 phase in B cells can generate equal proportions of A-T and G-C mutations, which suggests that UNG and MMR can operate within the same time frame during SHM. Furthermore, we show that Ung -/- Pms2 -/- mice display a 50% reduction in mutations at A-T base pairs and that most remaining mutations at A-T bases depend on two additional uracil glycosylases, thymine-DNA glycosylase and SMUG1. These results demonstrate that Pms2/Mlh1 and multiple uracil glycosylases act jointly, each one with a distinct strand bias, to enlarge the immunoglobulin gene mutation spectrum from G-C to A-T bases. © 2017 Girelli Zubani et al.
Stworzenie świata według Leibniza
Directory of Open Access Journals (Sweden)
Michał Heller
2008-06-01
Full Text Available Leibniz's idea of creation is best epitomized by a note written by him on the margin of his work entitled 'Dialogus'. The note reads:'When God thinks things through and calculates, the world is made'. Simple calculations are almost mechanical. The true mathematical thinking begins when one is confronted with a problem that has to be solved, when starting from the known mathematical structure one has to construct a new structure, to comprehend its intricacies, the ways of its functioning, and its connections with other mathematical structures. And when one successfully applies the new mathematical structure to a physical theory, the new world is made. This was Leibniz's experience when he was discovering calculus and tried to apply it to mechanical problems. Leibniz's doctrine that our world is the best of all possible words is often ridiculed, but this attitude is the result of a very superficial reading of Leibniz's texts. In fact, God's calculations to choose the best possible world are similar to solving the variational problem in mathematics. Leibniz claims that in mathematical reasoning if there is neither 'maximum' nor 'minimum' nothing can happen. Similarly, if there were no world better that other possible worlds, God's wisdom would have not been able to create anything. Some consequences of this doctrine, concerning the nature of space, time and causality, are also considered.
Gene : CBRC-PMAR-01-0324 [SEVENS
Lifescience Database Archive (English)
Full Text Available d=5' /gb=EG024802 /gi=115341549 /ug=Pma.618 /len=652 2e-14 24% MFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFM...FCRCRCHWFFMFCRCRYHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFVFCRSRCHWFFM...FCRCRCHWFFMFCRCRFNWFFMFCRCRCHWFFMFCRSRCHWFFMFCRCRCHWFFVFCRSRCHWFFMFCRCRCHWFFVFCRSRCHWFFMFCRCRCHWFFMFYRCRCLNDAAVHKNKNTAIVHVCKVTP ...
Gene : CBRC-RNOR-14-0029 [SEVENS
Lifescience Database Archive (English)
Full Text Available ' /gb=CB805046 /gi=29921778 /ug=Rn.215427 /len=409 2e-13 100% MYHFLGFATLMLLMCSATM...MFMLSVNMLLMRSVNLLLTFSVHVLLICSVNTLPMCSVNMFMHSTIMLLMCSAIMLLMSSKVMLLMSSAIMLLMWSAILLRVRLATMLLMCSVITLFMGSATMLSMCPETMLITCSATTLSMCSATM...QSMGSATMQFMGSATMQFMHSANMLFMGSATMQFMHSSNMLFMGSATMQFMHSSNMLFMGSATMLFMGSATMQFMHSATMQVMGSATML...HMGSATTLFMGSATTLFMGPAIMLHMGSATTLFMGPAIMLHMGSATTLFMGPAIMLHMGSATMLFMGPAIMLHMGSATMLHMGSAIMLCMCPATM...LLMCSAIILYMGSATMLSMCSATMQFMGSATMQFMGSATMQFMGSATMLSMYSAIMQFMGSATMLSMCSATMQFMGSATMQFMHSATMQFMGSATMLSMCSATMQFMGSATMQFMGSATM ...
The effects of the MEGA BORG spill on Gulf of Mexico shrimp
International Nuclear Information System (INIS)
Nance, J.
1993-01-01
A brown shrimp stock model was developed at the NMFS Galveston Laboratory to assess the effects of the MEGA BORG oil spill on the brown shrimp population along the Texas coast. Water and sediment samples from near the MEGA BORG spill area were collected and analyzed by the Geochemical and Environmental Research Group at Texas A ampersand M University. Hydrocarbon concentrations found at the sediment collection stations ranged from 1.38 ug/g to 7.42 ug/g, while concentrations at the water column sampling sites ranged from 0.69 ug/l to 27.39 ug/l. Evaluation of chromatograms and analytical data suggested that sediments from the area contained primarily biogenic hydrocarbons. Only one station had elevated hydrocarbon levels. However, these values were only three to five times higher than the concentrations measured at the other stations. Evaluation of the water samples from the area showed only very low concentration levels of hydrocarbons were present in the water column. A bioassay study was conducted by the US Environmental Protection Agency, Environmental Research Laboratory in Gulf Breeze, Florida. The main conclusion from the bioassay study was that the concentrations of hydrocarbons measured at the field sites where water samples were taken tended to be three orders of magnitude lower than the hydrocarbon concentrations causing toxic responses in mysid and white shrimp. There were no detected effects of the brown shrimp population along the Texas coast from the MEGA BORG oil spill
Thitanuwat, Bussarakam; Polprasert, Chongchin; Englande, Andrew J
2017-03-01
Effective ways to integrate human life quality, environmental pollution mitigation and efficient waste management strategies are becoming a crisis challenge for sustainable urban development. The aims of this study are: (1) to evaluate and recommend an optimum Urban Green Space (UGS) area for the Bangkok Metropolitan Administration (BMA); and (2) to quantify potential renewable resources including electricity generation and potential nutrient recovery from generated ash. Green House Gases (GHGs) emissions from the management of Green Residues (GR) produced in a recommended UGS expansion are estimated and compared with those from the existing BMA waste management practice. Results obtained from this study indicate that an increase in UGS from its current 2.02% to 22.4% of the BMA urban area is recommended. This optimum value is primarily due to the area needed as living space for its population. At this scale, GR produced of about 334kt·y -1 may be used to generate electricity at the rate of 206GWh·y -1 by employing incineration technology. Additionally, instead of going to landfill, phosphorus (P) contained in the ash of 1077 t P·y -1 could be recovered to produce P fertilizer to be recycled for agricultural cultivation. Income earned from selling these products is found to offset all of the operational cost of the proposed GR management methodology itself plus 7% of the cost of BMA's Municipal Solid Waste (MSW) operations. About 70% of the current GHGs emission may be reduced based on incineration simulation. Copyright © 2016 Elsevier Ltd. All rights reserved.
Unattended Ground Sensors for Expeditionary Force 21 Intelligence Collections
2015-06-01
little impact on modern intelligence collections. This thesis analyzes and compares the units and individual Marine skillsets that employ UGS, and the...the sensor employment planning cycle, and the socialization of this plan through the proper chain-of-command [4]. Figure 8 depicts the Sensor...the use of newly developed cellphone based technologies and emerging UGS capabilities to assist in Listening Post/ Observation Post (LP/OP
Pribil, Michael J.; Maddaloni, Mark A.; Staiger, Kimberly; Wilson, Eric; Magriples, Nick; Ali, Mustafa; Santella, Dennis
2014-01-01
Lead (Pb) concentration and Pb isotopic composition of surface and subsurface soil samples were used to investigate the potential for off-site air transport of Pb from a former white Pb processing facility to neighboring residential homes in a six block area on Staten Island, NY. Surface and subsurface soil samples collected on the Jewett White Pb site were found to range from 1.122 to 1.138 for 206Pb/207Pb and 2.393 to 2.411 for 208Pb/207Pb. The off-site surface soil samples collected from residential backyards, train trestle, near site grass patches and background areas varied from 1.144 to 1.196 for 206Pb/207Pb and 2.427 to 2.464 for 208Pb/207Pb. Two soil samples collected along Richmond Terrace, where Jewett site soils accumulated after major rain events, varied from 1.136 to 1.147 for 206Pb/207Pb and 2.407 to 2.419 for 208Pb/207Pb. Lead concentration for on-site surface soil samples ranged from 450 to 8000 ug/g, on-site subsurface soil samples ranged from 90,000 to 240,000 ug/g and off-site samples varied from 380 to 3500 ug/g. Lead concentration and isotopic composition for the Staten Island off-site samples were similar to previously published data for other northeastern US cities and reflect re-suspension and re-mobilization of local accumulated Pb. The considerable differences in both the Pb isotopic composition and Pb concentration of on-site and off-site samples resulted in the ability to geochemically trace the transport of particulate Pb. Data in this study indicate minimal off-site surface transport of Pb from the Jewett site into the neighboring residential area.
1986-11-01
I c 0A 00r . O"C:0. JUm 3 M1. : - z I a0 U ~ 4 044 01 I C -1 .. >.* c. 0.1 A 0 WIX W wu C 0 10 0161c 0 .5 0 4.O1 C 00)id 0.t A12 -On-r L Vrrn- n- u... WIx in ug ug c US mug mcug NL 19,II 1-z w NO I SO W I VI m00 g 01 010 1 a~~ gA >. It m~) * .8 S~l Zaga ~ Z.Ig-.j ..I Z...j -A Z..J-.jNI .. a4.. N c- I...8217.I7. ~ ~ a f %.a 0,%D Im 2. 4 @C;CCCCC@@.oooooCooooaooooaooooooooa Z 9 O a I& A, I I I 1 4 0 LL. La @N %DA Web -Ina %b a W a N C’?C aP.0 a 0 % WN 0
Epidemiology and effects of gastrointestinal nematode infection on milk productions of dairy ewes
Directory of Open Access Journals (Sweden)
Suarez V.H.
2009-06-01
Full Text Available 66 Pampinta breed ewes were studied during milking to evaluate the infection and the effect of gastrointestinal nematode on milk production sheep system. Naturally infected ewes on pasture were randomly allocated to two groups: TG, suppressively treated group every four weeks with levamisole and UG, untreated group. Faecal nematode egg counts and larval differentiation were conducted monthly. Successive groups of worm free tracer lambs were grazed with ewes and then slaughtered for worm counts. Test-day milk yield of individual ewes was recorded and ewe machine-milking period length (MPL were estimated. Faecal egg counts and tracer nematode numbers increased towards midsummer and declined sharply toward the end of the study. TG (188.0 ± 60 liters produced more (p < 0.066 milk liters than UG (171.9 ± 52.2 and TG had significantly more extended (p < 0.041 MPL than those of UG. The present study showed that dairy sheep were negatively affected by worms, even when exposed to short periods of high acute nematode (mainly Haemonchus contortus infection.
Gene : CBRC-MMUS-23-0040 [SEVENS
Lifescience Database Archive (English)
Full Text Available LLKCVFVIYRDFHFSRHFPGPTVCISHFSRLLVNLSFFKSSSGCFSFSMIISFLSIFHVLQWRFLNFPPFSVFLAIFHILKCVLLIFWDFQFSCNIPGPTVCISHFSR...FSVISSFFKSSSGCFSFSMIFSFLAIFHVLQWILLYFPPFSVFLAIFHILKHVFLIFRDFQFSLNIPGPIVCISHFSCFSI...ISSSYFTSLTSLILFFRDFQFSRHIPGHTVCISHFSRFYCDIVIFQVVKWMFLIFHDFQFSCNIPCRTVDISKFFTFFSFPHHISRHKVCISHFP ... ... insert sequence /gb=AK156981 /gi=74152306 /ug=Mm.330279 /len=4633 1e-112 58% MIFSFLSIFHVLQWTFLNYLPFSVFLAIFH
Wise, Catherine F.; Wise, Sandra S.; Thompson, W. Douglas; Perkins, Christopher; Wise, John Pierce
2015-01-01
Hexavalent chromium (Cr(VI)) is present in the marine environment and is a known carcinogen and reproductive toxicant. Cr(VI) is the form of chromium that is well absorbed through the cell membrane. It is also the most prevalent form in seawater. We measured the total Cr levels in skin biopsies obtained from healthy free-ranging fin whales from the Gulf of Maine and found elevated levels relative to marine mammals in other parts of the world. The levels in fin whale biopsies ranged from 1.71 ug/g to 19.6 ug/g with an average level of 10.07 ug/g. We also measured the cytotoxicity and genotoxicity of Cr(VI) in fin whale skin cells. We found that particulate and soluble Cr(VI) are both cytotoxic and genotoxic to fin whale skin cells in a concentration-dependent manner. The concentration range used in our cell culture studies used environmentally relevant concentrations based on the biopsy measurements. These data suggest that Cr(VI) may be a concern for whales in the Gulf of Maine. PMID:25805270
Takagishi, Haruto; Koizumi, Michiko; Fujii, Takayuki; Schug, Joanna; Kameshima, Shinya; Yamagishi, Toshio
2014-01-01
We conducted a simple resource allocation game known as the ultimatum game (UG) with preschoolers to examine the role of cognitive and emotional perspective-taking ability on allocation and rejection behavior. A total of 146 preschoolers played the UG and completed a false belief task and an emotional perspective-taking test. Results showed that cognitive perspective taking ability had a significant positive effect on the proposer's offer and a negative effect on the responder's rejection behavior, whereas emotional perspective taking ability did not impact either the proposer's or responder's behavior. These results imply that the ability to anticipate the responder's beliefs, but not their emotional state, plays an important role in the proposer's choice of a fair allocation in an UG, and that children who have not acquired theory of mind still reject unfair offers.
Active use of urban park facilities
DEFF Research Database (Denmark)
Lindberg, Michael; Schipperijn, Jasper
2015-01-01
groups of the facilities. Facilities that provide the opportunity for games and playing activities are more used for PA than facilities directed at individual training of strength and fitness. The opportunity for socializing and playing while being physically active seems important for many users...... was mentioned as a key factor when designing facilities. Our results provide important knowledge to architects, planners and policy makers when aiming at designing activity-promoting facilities in UGS. Future studies need to further investigate the use of facilities among specific target groups, particularly......Abstract Urban green spaces (UGS), and more specific a higher number of facilities in UGS, have been positively associated with physical activity (PA). However, more detailed studies of which facilities generate high levels of PA, for which type of users, are relevant as existing knowledge...
Leaf Surface Effects on Retrieving Chlorophyll Content from Hyperspectral Remote Sensing
Qiu, Feng; Chen, JingMing; Ju, Weimin; Wang, Jun; Zhang, Qian
2017-04-01
Light reflected directly from the leaf surface without entering the surface layer is not influenced by leaf internal biochemical content. Leaf surface reflectance varies from leaf to leaf due to differences in the surface roughness features and is relatively more important in strong absorption spectral regions. Therefore it introduces dispersion of data points in the relationship between biochemical concentration and reflectance (especially in the visible region). Separation of surface from total leaf reflection is important to improve the link between leaf pigments content and remote sensing data. This study aims to estimate leaf surface reflectance from hyperspectral remote sensing data and retrieve chlorophyll content by inverting a modified PROSPECT model. Considering leaf surface reflectance is almost the same in the visible and near infrared spectral regions, a surface layer with a reflectance independent of wavelength but varying from leaf to leaf was added to the PROSPECT model. The specific absorption coefficients of pigments were recalibrated. Then the modified model was inverted on independent datasets to check the performance of the model in predicting the chlorophyll content. Results show that differences in estimated surface layer reflectance of various species are noticeable. Surface reflectance of leaves with epicuticular waxes and trichomes is usually higher than other samples. Reconstruction of leaf reflectance and transmittance in the 400-1000 nm wavelength region using the modified PROSPECT model is excellent with low root mean square error (RMSE) and bias. Improvements for samples with high surface reflectance (e.g. maize) are significant, especially for high pigment leaves. Moreover, chlorophyll retrieved from inversion of the modified model is consequently improved (RMSE from 5.9-13.3 ug/cm2 with mean value 8.1 ug/cm2, while mean correlation coefficient is 0.90) compared to results of PROSPECT-5 (RMSE from 9.6-20.2 ug/cm2 with mean value 13.1
Effects of ELMs and disruptions on ITER divertor armour materials
Federici, G.; Zhitlukhin, A.; Arkhipov, N.; Giniyatulin, R.; Klimov, N.; Landman, I.; Podkovyrov, V.; Safronov, V.; Loarte, A.; Merola, M.
2005-03-01
This paper describes the response of plasma facing components manufactured with tungsten (macro-brush) and CFC to energy loads characteristic of Type I ELMs and disruptions in ITER, in experiments conducted (under an EU/RF collaboration) in two plasma guns (QSPA and MK-200UG) at the TRINITI institute. Targets were exposed to a series of repetitive pulses in QSPA with heat loads in a range of 1-2 MJ/m 2 lasting 0.5 ms. Moderate tungsten erosion, of less than 0.2 μm per pulse, was found for loads of ˜1.5 MJ/m 2, consistent with ELM erosion being determined by tungsten evaporation and not by melt layer displacement. At energy densities of ˜1.8 MJ/m 2 a sharp growth of tungsten erosion was measured together with intense droplet ejection. MK-200UG experiments were focused on studying mainly vapor plasma production and impurity transport during ELMs. The conditions for removal of thin metal deposits from a carbon substrate were characterized.
Effects of ELMs and disruptions on ITER divertor armour materials
International Nuclear Information System (INIS)
Federici, G.; Zhitlukhin, A.; Arkhipov, N.; Giniyatulin, R.; Klimov, N.; Landman, I.; Podkovyrov, V.; Safronov, V.; Loarte, A.; Merola, M.
2005-01-01
This paper describes the response of plasma facing components manufactured with tungsten (macro-brush) and CFC to energy loads characteristic of Type I ELMs and disruptions in ITER, in experiments conducted (under an EU/RF collaboration) in two plasma guns (QSPA and MK-200UG) at the TRINITI institute. Targets were exposed to a series of repetitive pulses in QSPA with heat loads in a range of 1-2 MJ/m 2 lasting 0.5 ms. Moderate tungsten erosion, of less than 0.2 μm per pulse, was found for loads of ∼1.5 MJ/m 2 , consistent with ELM erosion being determined by tungsten evaporation and not by melt layer displacement. At energy densities of ∼1.8 MJ/m 2 a sharp growth of tungsten erosion was measured together with intense droplet ejection. MK-200UG experiments were focused on studying mainly vapor plasma production and impurity transport during ELMs. The conditions for removal of thin metal deposits from a carbon substrate were characterized
Directory of Open Access Journals (Sweden)
Michał Gajek
2016-12-01
Full Text Available Polish influence on Yiddish as described in Max Weinreich’s History of the Yiddish Language – overview and attempts at verification The Article concentrates on the findings regarding Slavic influence on Yiddish, described in the newest English-language edition of Max Weinreich’s History of the Yiddish Language – a canonical title for modern Yiddish studies. Its first task is to acquaint Polish readers with M. Weinreich’s propositions and findings on the general character of Polish-Yiddish and Slavic-Yiddish language contact. This will also be taken as an opportunity to briefly review the research on this subject conducted by Polish scholars. Additionally, the article will elaborate (albeit not exhaustively on the attempts to question and verify M. Weinreich’s theories which may prove interesting from the point of view of Slavic studies. Its second, equally important task is to describe chosen examples of the results of Slavic influence, in which Polish played a significant role, as they present themselves in the lexicon, morphology, word formation and syntax of Yiddish. Wpływy polskie w jidysz według History of the Yiddish Language Maxa Weinreicha – przegląd i próby weryfikacji Artykuł skupia się na ustaleniach na temat wpływów słowiańskich w jidysz, zawartych w najnowszym, anglojęzycznym wydaniu pracy Maxa Weinreicha pt. History of the Yiddish Language, mającej status pozycji kanonicznej współczesnej jidyszystyki. Jego pierwszym celem jest przybliżenie polskiemu czytelnikowi tez i ustaleń M. Weinreicha, dotyczących ogólnego charakteru językowych kontaktów polsko- i słowiańsko-żydowskich. Przy tej okazji uwzględnione zostaną informacje na temat badań, jakie do tej pory poczynili w tej materii językoznawcy polscy. Ponadto (niewyczerpująco poruszona zostanie kwestia prób weryfikacji i podważenia jego twierdzeń, interesująca z punktu widzenia slawistyki. Drugim, nie mniej wa
Toxicity of lead-contaminated sediment to mute swans
Day, D.D.; Beyer, W.N.; Hoffman, D.J.; Morton, Alexandra; Sileo, L.; Audet, D.J.; Ottinger, M.A.
2003-01-01
Most ecotoxicological risk assessments of wildlife emphasize contaminant exposure through ingestion of food and water. However, the role of incidental ingestion of sediment-bound contaminants has not been adequately appreciated in these assessments. This study evaluates the toxicological consequences of contamination of sediments with metals from hard-rock mining and smelting activities. Lead-contaminated sediments collected from the Coeur d'Alene River Basin in Idaho were combined with either a commercial avian maintenance diet or ground rice and fed to captive mute swans (Cygnus olor) for 6 weeks. Experimental treatments consisted of maintenance or rice diets containing 0, 12 (no rice group), or 24% highly contaminated (3,950 ug/g lead) sediment or 24% reference (9.7 ug/g lead) sediment. Although none of the swans died, the group fed a rice diet containing 24% lead-contaminated sediment were the most severely affected, experiencing a 24% decrease in mean body weight, including three birds that became emaciated. All birds in this treatment group had nephrosis; abnormally dark, viscous bile; and significant (p < 0.05) reductions in hematocrit and hemoglobin concentrations compared to their pretreatment levels. This group also had the greatest mean concentrations of lead in blood (3.2 ug/g), brain (2.2 ug/g), and liver (8.5 ug/g). These birds had significant (alpha = 0.05) increases in mean plasma alanine aminotransferase activity, cholesterol, and uric acid concentrations and decreased plasma triglyceride concentrations compared to all other treatment groups. After 14 days of exposure, mean protoporphyrin concentrations increased substantially, and mean delta-aminolevulinic acid dehydratase activity decreased by more than 95% in all groups fed diets containing highly contaminated sediments. All swans fed diets that contained 24% lead-contaminated sediment had renal acid-fast intranuclear inclusion bodies, which are diagnostic of lead poisoning in waterfowl. Body
Evans, Nicholas P.; Gázquez, Fernando; McKenzie, Judith A.; Chapman, Hazel J.; Hodell, David A.
2016-04-01
We used oxygen and hydrogen isotopes of gypsum hydration water (GHW) coupled with salinity deduced from ice melting temperatures of primary fluid inclusions in the same samples (in tandem with 87Sr/86Sr, δ34S and other isotopic measurements) to determine the composition of the mother fluids that formed the gypsum deposits of the Messinian Salinity Crisis from shallow and intermediate-depth basins. Using this method, we constrain the origin of the Messinian Primary Lower Gypsum (PLG) of the Sorbas basin (Betic foreland) and both the Upper Gypsum (UG) and the Lower Gypsum of the Sicilian basin. We then compare these results to measurements made on UG recovered from the deep Ionian and Balearic basins drilled during DSDP Leg 42A. The evolution of GHW δ18O/δD vs. salinity is controlled by mixing processes between fresh and seawater, coupled with the degree of evaporation. Evaporation and subsequent precipitation of gypsum from fluids dominated by freshwater will result in a depressed 87Sr/86Sr values and different trajectory in δ18O/δD vs. salinity space compared to fluids dominated by seawater. The slopes of these regression equations help to define the end-members from which the fluid originated. For example, salinity estimates from PLG cycle 6 in the Sorbas basin range from 18 to 51ppt, and after correction for fractionation factors, estimated δ18O and δD values of the mother water are low (-2.6 meteoric water during gypsum deposition, while 87Sr/86Sr (0.708942 fall below those expected from the evaporation of seawater alone, the slope of the regression equation is similar to that of seawater evaporation. This implies that there is a change up-section from a dominantly marine environment in cycle 2 to a greater influence of meteoric water in cycle 6. The UG from the Sicilian basin display greater δ18O/δD values (2.9 meteoric water that subsequently underwent intense evaporation. This observation concurs with the low values of 87Sr/86Sr from the same UG
Directory of Open Access Journals (Sweden)
Mohamad Samsudin
2017-02-01
Full Text Available Background. IDD survey results indicate the high incidence of hyperthyroidism atschoolchildren in most areas, including Semarang (42.0%. Households that consumeiodized salt with >= 30 ppm (above minimal requirement in the region is already high(80.0%. Because people living in non-endemic coastal areas assumed to consumehigher iodine from food sources, the role of iodine in salt for causing hyperthyroidsymptoms need to be investigated. Objective. Examining the effects of iodizedsalt (SNI >=30 ppm consumption for the adequacy of iodine in elementary schoolchildren who consume high iodine foods sources in non endemic regions coastalarea. Method. Study design was quasi experimental. The intervention materials werestandardized iodized salt (>=30 ppm KIO3. The study was conducted in SemarangCity and Magelang District for 9 months. Samples were 160 grade 4-6 elementaryschool children Research variables were urinary iodine excretion (24-hours urinesamples; consumption of iodine food sources, nutritional status, iodized salt, andnutrients intake. Results. Pretest result in group I (coastal area showed that themedian value of urinary iodine excretion (UIE in subject was 191 ug/day (normal.The proportion of subjects with iodine deficiency and excess were 10.4 and 23.4%.Pretest result in group II (non-coastal area showed the median value of UIE insubjects was 96 ug/day (deficience. The proportion of subjects with iodine deficiencyand excess were 51.8 and 1.2 percents. After 9 months intervention, group I showedthe median value of UIE in subject was 148 ug/day (normal category. The proportionof subjects with iodine deficiency and excess were 28.6 and 13 percents. In groupII, after 9 months intervention, the median value of UIE in subjects was 83 ug/day(deficience. The proportion of subjects with iodine deficiency and excess were 60.2and 2.4 percents. Conclusion. After 9 months standardized iodized salt (>=30 ppmKIO3 intervention, school children in the
Directory of Open Access Journals (Sweden)
James Furness
2018-03-01
.5°, +15.3°. The UG was found to consistently measure higher values than the compass app (mean difference 2.8°, P < 0.001. Conclusion This study reveals that the iPhone® app (Compass is a reliable tool for measuring thoracic spine rotation which produces greater reproducibility of measurements both within and between raters than a UG. As a significant positive correlation exists between the Compass app and UG, this supports the use of either device in clinical practice as a reliable and valid tool to measure thoracic rotation. Considering the levels of agreement are clinically unacceptable, the devices should not be used interchangeably for initial and follow up measurements.
Scheiber-Enslin, S. E.; Manzi, M. S.; Webb, S. J.
2017-12-01
Loss-of-ground in mining is a common problem. Using the integration of high resolution aeromagnetic and 3D reflection seismic data to delineate the causative geological features allows for more efficient mine planning and risk reduction. High resolution data from Impala Platinum mine in the western Bushveld Complex are used to image potholes, iron-rich ultramafic pegmatoids (IRUPs), faults, dykes and diapirs that may impact the economic horizons (UG2). Imaging of these structures was previously limited to outcrop, both on surface and underground, as well as 2D seismic data. These high resolution seismic data are able to resolve faults with throws as small as 10 m. A diapir is imaged in the southwest of the study area with a diameter of approximately 6 km. The diapir has a depth extend of around 4 km below the UG2 horizon and displaces the horizon by 350 m. It has been suggested that topographic highs in the Transvaal Supergroup basement initiate the formation of these diapirs as new magma is injected into the chamber. The origin of the diapir within the layered basement rocks, and disruption of layering within the complex is visible on the seismic section. In the north of the study area a large region of slumping or several merged potholes is identified that is up to 2.5 km in length, with up to 700 m of vertical displacement. Ductile deformation that formed the potholes is imaged on the seismic section, with the UG2 cutting down into the footwall. However, brittle deformation of the UG2 is also imaged with faulting at the edges of the regions of slumping. The edges of these slump regions are also characterised by the emplacement of iron-rich ultramafic pegmatoids (IRUPs), which show up as regions of diffuse reflectivity on the seismic data and magnetic highs. The proximity of these faults and IRUPs to the edges of the slump structure brings in to question whether they contribute to pothole formation. The diapir and slump structure displaces the economic UG2
Gene : CBRC-DRER-26-0260 [SEVENS
Lifescience Database Archive (English)
Full Text Available 3384097, mRNA sequence /clone=3384097 /gb=EB959993 /gi=102920926 /ug=Dr.79541 /len=690 2e-68 82% MECAARSGDEKELENSKAGVVATRVLNSGVVAR...VLISCVVARVLNSGVVARVLISCVVARALISCVVARVLNSSVVARVLINSVVARVLISCVVARVLNSGVVARVLISCVVAR...VLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARFLISCVVARVLNSGVVSTLFRLMQT ...
Directory of Open Access Journals (Sweden)
Agus D. Susanto
2008-09-01
Full Text Available This study aimed to evaluate effect of proton pump inhibitor (esomeprazole on asthma symptoms, use of inhaled bronchodilator and peak expiratory flow rate (PEFR in moderate persistent asthma with gastroesofageal refluks disease (GERD. This randomized single blind, controlled clinical trial study was conducted at Persahabatan Hospital, Jakarta from July 2004 until October 2005. Samples were moderate persistent asthma patients with GERD. GERD is diagnosed GERD symptoms and proof of oesophagitis from endoscopy and or histapatologic examination from oesophagus biopsy. Phase 1:2 week run-in period patient received inhaled budesonide 2x200 ug/day. Phase 2: patient randomised to receive inhaled budesonide 2 x 400 ug/day with esomeprazole 40 mg/day or without esomeprazole (control group for 8 weeks. Phase 3: 4 week wash out period, patient receive inhaled budesonide 2 x 200 ug/day. Diary cards were assessed at run-in periode, after treatment 4 weeks, 8 weeks and wash out. There were 32 patients (23 female and 9 male completed the study. Mean total asthma symptoms score daily were significantly decreased on esomeprazole vs without esomeprazole after 8 weeks (-2.29 vs -0.90; p < 0.05. Mean use of inhaled bronchodilator was significantly decreased on esomeprazole vs without esomeprazole after 8 weeks (-1.09 vs -0.42; p < 0.05. Morning and evening PEFR improved higher on esomeprazole than without esomeprazol but were not significantly difference. In conclusion, administration esomeprazole 40 mg daily improved asthma symptoms and lower the use of inhaled bronchodilator in moderate persistent asthma patients with GERD. (Med J Indones 2008; 17: 169-74Keywords: Asthma symptoms, inhaled bronchodilator, moderate persistent asthma, GERD, esomeprazole
Gene : CBRC-CELE-01-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CELE-01-0021 Novel I A UNKNOWN TBA1C_RAT 0.0 70% ref|NP_492419.2| TuBulin, Alpha family member (tba...is elegans] 0.0 88% gnl|UG|Cel#S5829910 Caenorhabditis elegans TuBulin, Alpha family member (tba-6) (tba-6)
Equal status in Ultimatum Games promotes rational sharing.
Han, Xiao; Cao, Shinan; Bao, Jian-Zhang; Wang, Wen-Xu; Zhang, Boyu; Gao, Zi-You; Sánchez, Angel
2018-01-19
Experiments on the Ultimatum Game (UG) repeatedly show that people's behaviour is far from rational. In UG experiments, a subject proposes how to divide a pot and the other can accept or reject the proposal, in which case both lose everything. While rational people would offer and accept the minimum possible amount, in experiments low offers are often rejected and offers are typically larger than the minimum, and even fair. Several theoretical works have proposed that these results may arise evolutionarily when subjects act in both roles and there is a fixed interaction structure in the population specifying who plays with whom. We report the first experiments on structured UG with subjects playing simultaneously both roles. We observe that acceptance levels of responders approach rationality and proposers accommodate their offers to their environment. More precisely, subjects keep low acceptance levels all the time, but as proposers they follow a best-response-like approach to choose their offers. We thus find that status equality promotes rational sharing while the influence of structure leads to fairer offers compared to well-mixed populations. Our results are far from what is observed in single-role UG experiments and largely different from available predictions based on evolutionary game theory.
Evaluating detection and estimation capabilities of magnetometer-based vehicle sensors
Slater, David M.; Jacyna, Garry M.
2013-05-01
In an effort to secure the northern and southern United States borders, MITRE has been tasked with developing Modeling and Simulation (M&S) tools that accurately capture the mapping between algorithm-level Measures of Performance (MOP) and system-level Measures of Effectiveness (MOE) for current/future surveillance systems deployed by the the Customs and Border Protection Office of Technology Innovations and Acquisitions (OTIA). This analysis is part of a larger M&S undertaking. The focus is on two MOPs for magnetometer-based Unattended Ground Sensors (UGS). UGS are placed near roads to detect passing vehicles and estimate properties of the vehicle's trajectory such as bearing and speed. The first MOP considered is the probability of detection. We derive probabilities of detection for a network of sensors over an arbitrary number of observation periods and explore how the probability of detection changes when multiple sensors are employed. The performance of UGS is also evaluated based on the level of variance in the estimation of trajectory parameters. We derive the Cramer-Rao bounds for the variances of the estimated parameters in two cases: when no a priori information is known and when the parameters are assumed to be Gaussian with known variances. Sample results show that UGS perform significantly better in the latter case.
Directory of Open Access Journals (Sweden)
Haruto Takagishi
Full Text Available We conducted a simple resource allocation game known as the ultimatum game (UG with preschoolers to examine the role of cognitive and emotional perspective-taking ability on allocation and rejection behavior. A total of 146 preschoolers played the UG and completed a false belief task and an emotional perspective-taking test. Results showed that cognitive perspective taking ability had a significant positive effect on the proposer's offer and a negative effect on the responder's rejection behavior, whereas emotional perspective taking ability did not impact either the proposer's or responder's behavior. These results imply that the ability to anticipate the responder's beliefs, but not their emotional state, plays an important role in the proposer's choice of a fair allocation in an UG, and that children who have not acquired theory of mind still reject unfair offers.
Trustworthiness and Negative Affect Predict Economic Decision-Making
Nguyen, Christopher M.; Koenigs, Michael; Yamada, Torricia H.; Teo, Shu Hao; Cavanaugh, Joseph E.; Tranel, Daniel; Denburg, Natalie L.
2011-01-01
The Ultimatum Game (UG) is a widely used and well-studied laboratory model of economic decision-making. Here, we studied 129 healthy adults and compared demographic (i.e., age, gender, education), cognitive (i.e., intelligence, attention/working memory, speed, language, visuospatial, memory, executive functions), and personality (i.e., “Big Five”, positive affect, negative affect) variables between those with a “rational” versus an “irrational” response pattern on the UG. Our data indicated t...
Macrozoobenthic recolonization of the littoral and the soft bottom after an oil spill
International Nuclear Information System (INIS)
Lax, H.J.; Vainio, T.
1988-01-01
Two years after the Eira oil spill the oil concentration in the water had returned to its background level (0.5 ug/l) in the open sea areas. On the polluted shores (depth 0.1- 0.5 m) higher concentrations (2.3 ug/l) occurred occasionaly. No clear effects related to the oil spill were noticed on the dominating soft bottom species (Macoma baltica, Pontoporeia affinis). Among the other soft bottom species the crustacean Corophium volutator showed its lowest density immediately after the spill, becoming more and more abundant during the following two years. The effect of the oil spill on the littoral fauna could still be noticed two years after the spill. The crustacean Gammarus duebeni avoided its natural habitat (uppermost littoral zone). Lymnaea palustris showed and increased mortality immediately after the oil spill but recolonized the polluted shores a normal distribution
Treatment of dark germinating cottonseed (Gossypium hirsutum Acala cultivar) with 0.72 mM 2(4-methylphenoxy) triethylamine (MPTA) resulted in a 18-fold increase in carotenoid biosynthesis. In comparison to H2O treated control seed germinating in the dark that formed 8.4 ug/g fr wt of lutein and 1.6 ...
Gene : CBRC-RNOR-10-0236 [SEVENS
Lifescience Database Archive (English)
Full Text Available lete cds /cds=p(41,1927) /gb=AY325173 /gi=33086523 /ug=Rn.6897 /len=1933 1e-73 64% MVATITQDNRVNNNSSSSNNNSSSDHNKSNNSSNSSNSNNSSNSNNSS...NSNNSSNSSNSNNSSNSSNSSNSSNNSNSNNSSNSSNSSNSSNSNNNNSNSNNSSNSNNSSNINNSSNSNNSNSNNSS...NINNSSNSNNSNSNNSSNSNNSSNSNNSSNSNNSNSNNSNSNNSSNSNNSSNINNSSNSNNSNSNNSSNINNSSNSNNSNSNNSSNSNNSSNSNNSNSNNSSNINNSS...NSNNSNSNNSSNSNNSSNSNNSSNSSNSSNSSNNSNSNNSSKATTAVTATTAATATTAVTATTATATTAAKQQQQGWQCSSLVPGNRRQRQADPLS ...
Gene : CBRC-RNOR-08-0111 [SEVENS
Lifescience Database Archive (English)
Full Text Available complete cds /cds=p(41,1927) /gb=AY325173 /gi=33086523 /ug=Rn.6897 /len=1933 1e-76 65% MDDRSQKMNSYNNSSSNNNNNSSKNSNNSNSSSNNNSSNNNSNNSS...NNNSNSNNSKNSSSNNSSNSSNNSNSNNSNNSNSNNSSNNNSSNNNSNSNNSNNSSSNNSSNSNNNSSSNNSNNSNSNNSS...NSSSNNSSNSNNSSSSNNSSNSNNNSSSNNSNSNNSSNNSSNSNNSSSSNNSNSNSNNSNNSSNNSNNSSSNNSNNSNSNNSNSSSRNSNNSSNNSSNSNNSS...SSNNSNSSSSNSNNSSNSNNSKRLSLFRLTKLEIEENYLTYACGGSGVHDGSYIPSEDVCLGIPGDLKGVIVTLSDDGHLQCSYLGTD
Petrography, geochemistry and regional significance of crystalline ...
Indian Academy of Sciences (India)
and K2O content. To demonstrate the nature of these rocks, A/CNK ratios were derived (where molecular A/CNK= {mol. [Al2O3/(CaO+Na2O+. K2O)]}, which range between 1.24 and 2.37. (UG: 1.39–0.37, DP: 1.28–1.45, BMG: ..... The petrographic studies and the age determination of. Koidal gneiss, Kumaon Himalaya; Curr.
International Nuclear Information System (INIS)
Gharebaghi, Manizheh M.; Peirovifar, A.; Gharebaghi, Parvin M.
2008-01-01
Objective was to compare inflammatory mediators in the cord blood of premature newborn infants with premature rupture of membranes (PROM) and intact membranes. Eighty-nine premature neonates with gestational age of 27-34 weeks that delivered in Ghaem Hospital in Mashhad, Iran from June 2005 to March 2006 were enrolled in a prospective observational study and their umbilical cord plasma was collected at birth. They were allocated into 2 groups (45 patients with PROM and 44 neonates with intact membranes). Interleukin-6 (IL-6) and C-reactive protein (CRP) levels were measured in cord plasma by the enzyme linked immunoassay (ELISA) method. Mean cord plasma IL-6 levels in preterm neonates with PROM was 205.71 pg/ml and in neonates with intact membranes was 33.3 pg/ml for IL-6 (p=0.000). The mean cord blood CRP level in newborns was 10.2 ug/ml, and in those with intact membranes was 1.6 ug/ml and in those with intact membranes was 1.6 ug/ml (p=0.41). Early onset sepsis was more frequent in infants with PROM than premature infants with intact membrane (38% versus 10%, p=0.001). In neonates with PROM, the mean cord blood IL-6 level was significantly higher in septic newborns (414.28 versus 40.44 pg/ml, p=0.000). The premature newborn infants with PROM had increased IL-6 levels in cord blood, which was significantly higher in neonates that developed early onset sepsis. (author)
Deshpande, Sachin M.; Dhangar, N.; Das, S. K.; Kalapureddy, M. C. R.; Chakravarty, K.; Sonbawne, S.; Konwar, M.
2015-11-01
Single Doppler analysis techniques known as velocity azimuth display (VAD) and volume velocity processing (VVP) are used to analyze kinematics of mesoscale flow such as horizontal wind and divergence using X-band Doppler weather radar observations, for selected cases of convective, stratiform, and shallow cloud systems near tropical Indian sites Pune (18.58°N, 73.92°E, above sea level (asl) 560 m) and Mandhardev (18.51°N, 73.85°E, asl 1297 m). The vertical profiles of horizontal wind estimated from radar VVP/VAD methods agree well with GPS radiosonde profiles, with the low-level jet at about 1.5 km during monsoon season well depicted in both. The vertical structure and temporal variability of divergence and reflectivity profiles are indicative of the dynamical and microphysical characteristics of shallow convective, deep convective, and stratiform cloud systems. In shallow convective systems, vertical development of reflectivity profiles is limited below 5 km. In deep convective systems, reflectivity values as large as 55 dBZ were observed above freezing level. The stratiform system shows the presence of a reflectivity bright band (~35 dBZ) near the melting level. The diagnosed vertical profiles of divergence in convective and stratiform systems are distinct. In shallow convective conditions, convergence was seen below 4 km with divergence above. Low-level convergence and upper level divergence are observed in deep convective profiles, while stratiform precipitation has midlevel convergence present between lower level and upper level divergence. The divergence profiles in stratiform precipitation exhibit intense shallow layers of "melting convergence" at 0°C level, near 4.5 km altitude, with a steep gradient on the both sides of the peak. The level of nondivergence in stratiform situations is lower than that in convective situations. These observed vertical structures of divergence are largely indicative of latent heating profiles in the atmosphere, an
Unigene BLAST: CBRC-OANA-01-0921 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 1.2 76% ...
Gas Storage in Europe, recent developments and outlook to 2035
International Nuclear Information System (INIS)
Hureau, Geoffroy
2015-01-01
These slides present: the European gas storage market in 2014 (Review of 2014 trends, Current challenges, Role of storage); the Outlook to 2035 (Supply/Demand factors, Estimated Storage needs, Project backlog). In conclusion: an over capacity is expected until 2025.Supply and demand evolution, market liberalization and environmental constraints on coal will drive a new period of growth for UGS. Cedigaz estimates that European UGS capacity will increase by around 45 bcm by 2035. UGS projects represent 77 bcm Of which 22 bcm is under construction, there is a majority of salt-cavern projects (market liberalization), not so much new seasonal storage (security of supply?), not all planned storage will be built (Projects under competition for the same (regional) market, the situation is quite contrasted between NW Europe and South-Southeast Europe (and UK)). The challenges are the investment and the security of supply
Directory of Open Access Journals (Sweden)
Lorena M Salto
Full Text Available An urgent need exists for graduate and professional schools to establish evidence-based STEM (science, technology, engineering, and math pipeline programs to increase the diversity of the biomedical workforce. An untapped yet promising pool of willing participants are capable high school students that have a strong STEM interest but may lack the skills and the guided mentoring needed to succeed in competitive STEM fields. This study evaluates and compares the impact of the Loma Linda University (LLU Summer Health Disparities Research Program on high school (HS and undergraduate (UG student participants. The primary focus of our summer research experience (SRE is to enhance the research self-efficacy of the participants by actively involving them in a research project and by providing the students with personalized mentoring and targeted career development activities, including education on health disparities. The results of our study show that our SRE influenced terminal degree intent and increased participant willingness to incorporate research into future careers for both the HS and the UG groups. The quantitative data shows that both the HS and the UG participants reported large, statistically significant gains in self-assessed research skills and research self-efficacy. Both participant groups identified the hands-on research and the mentor experience as the most valuable aspects of our SRE and reported increased science skills, increased confidence in science ability and increased motivation and affirmation to pursue a science career. The follow-up data indicates that 67% of the HS participants and 90% of the UG participants graduated from college with a STEM degree; for those who enrolled in graduate education, 61% and 43% enrolled in LLU, respectively. We conclude that structured SREs can be highly effective STEM strengthening interventions for both UG and HS students and may be a way to measurably increase institutional and biomedical
Yoshida, Y.; Koide, S.; Hirose, N.; Takada, K.; Tomiyama, K; Koshikawa, N.; Cools, A.R.
1999-01-01
The effects of the u-receptor agonist fentanyl on extracellular levels of dopamine in rat nucleus accumbens were studied in awake animals by in vivo brain microdialysis. Fentanyl dosedependently increased the levels of dopamine when given intravenously (ug/kg) or via a microdialysis probe placed
Dinicola, R.S.; Huffman, R.L.
2009-01-01
chlorinated VOCs. For the upper aquifer beneath the northern phytoremediation plantation, chlorinated VOC concentrations in 2007 and 2008 at most piezometers were similar to or slightly less than chlorinated VOC concentrations measured in previous years. The only chlorinated VOC positively detected at piezometers P1-1 and P1-5 was cis-1,2-dichloroethene (cis-DCE); most chlorinated VOC concentrations at piezometer P1-3 were at the lowest levels since monitoring began in 1999. Most VOC concentrations at piezometer P1-4 were similar to VOC concentrations measured in previous years except that vinyl chloride (VC) concentrations inexplicably increased from 280 micrograms per liter (ug/L) in June 2007 to 750 ug/L in June 2008. In 2008, measurement of the sum of concentrations of ethane and ethene, reductive dechlorination byproducts, was at the highest level at most northern plantation wells and piezometers, which is evidence of reductive dechlorination of chlorinated VOCs. For the upper aquifer beneath the southern phytoremediation plantation, chlorinated VOC concentrations in 2007 and 2008 at the piezometers were most often extremely high and they continued to vary considerable over space and between years. At piezometer P1-6, the total chlorinated VOC concentration increased from 380 ug/L in 2007 to more than 20,000 ug/L in 2008. At piezometer P1-7 in 2008, the concentrations of trichloroethene, cis-DCE, and VC were the highest to date, but total chlorinated VOC concentrations at piezometers P1-8, P1-9, and P1-10 in 2008 were relatively low compared to historical levels. The magnitude and persistence of chlorinated VOC concentrations indicate that non-aqueous phase liquid chloroethenes likely are beneath the southern plantation, and the temporal variability in concentrations likely is a result of variations in precipitation and groundwater levels interacting with the non-aqueous phase liquid. The reductive dechlorination byproducts ethane and ethene were detected at
Antiamoebic activity of marine sponge Haliclona exigua (Krikpatrick
Directory of Open Access Journals (Sweden)
V Lakshmi
2009-03-01
Full Text Available The methanol and methanol-chloroform (1:1 extracts of the freshly collected Haliclona exigua showed minumim inhibitory concentration (MIC of 125 ug/ml and 250 ug/ml respectively in in vitro studies, but when both of these were tested in vivo in rats, only methanol-chloroform showed 80% inhibition of trophozoites at the dose of 900 mg/kg body weight against Entamoeba histolytica. Therefore only methanol-chloroform extract was further fractionated into four fractions (hexane, chloroform, n-butanol soluble and n-butanol insoluble fractions. Out of these, only hexane and n-butanol soluble fractions showed 80% inhibition of trophozoites at 900 mg/kg dose. Further the chromatography of the n-butanol fraction yielded araguspongin-C which showed promising results at different doses.
Arsenic removal by lime softening
DEFF Research Database (Denmark)
Kaosol, T.; Suksaroj, C.; Bregnhøj, Henrik
2002-01-01
This paper focuses on the study of arsenic removal for drinking water by lime softening. The initial arsenic (V) concentration was 500 and 1,000 ug/L in synthetic groundwater. The experiments were performed as batch tests with varying lime dosages and mixing time. For the synthetic groundwater......, arsenic (V) removal increased with increasing lime dosage and mixing time, as well as with the resulting pH. The residual arsenic (V) in all cases was lower than the WHO guideline of 10 ug/L at pH higher than 11.5. Kinetic of arsenic (V) removal can be described by a first-order equation as C1 = C0*e......^-k*t. The relation between the constant (k value) and increasing lime dosage was found to be linear, described by k = 0.0034 (Dlime). The results support a theory from the literature that the arsenic (V) was removed by precipitation af Ca3(AsO4)2. The results obtained in the present study suggest that lime...
Characterization of stem rust resistance gene Sr2 in Indian wheat ...
African Journals Online (AJOL)
Stem rust or black rust is one of the most important diseases of wheat worldwide. In India, central, peninsular and southern hill zones are particularly prone to stem rust where favourable environmental conditions exist. The recent emergence of wheat stem rust race Ug99 (TTKSK) and related strains threatens global wheat ...
Experimental assessment of the effects of ELMs and disruptions on ITER divertor armour materials
International Nuclear Information System (INIS)
Zhitlukhin, A.; Federici, G.; Giniyatulin, R.; Landman, I.; Linke, J.; Loarte, A.; Merola, M.; Podkovyrov, V.; Safronov, V.
2005-01-01
The response of plasma protection materials to thermal energy deposited during simulated Type I Edge Localised Modes (ELMs) and disruptions was studied. The paper describes the design and manufacture of special CFC and tungsten macrobrush targets, the experimental conditions achievable at simulating facilities and results of selected experiments. Experiments are conducted primarily under an EU/RF research collaboration in two plasma guns (QSPA and MK-200UG) located in TRINITI, Troitsk, Russia. The targets were exposed to a large number of repetitive pulses in QSPA plasma gun with heat loads varying in a range of 1-2 MJ/m 2 lasting 0.1-0.5 ms, with the purpose to determine the total expected erosion rate in ITER. MK-200UG experiments were focused on studying mainly vapour plasma production and impurity transport during ELMs. Moderate tungsten erosion less than 0.3 microns per shot was demonstrated for 1.5 MJ/m 2 energy densities. Energy density increasing up to 1.8 MJ/m 2 resulted in sharp growth of tungsten erosion, caused by intensive droplet ejection from irradiated tungsten surface. The program of further experiments is discussed. (author)
Neural correlates of decision making after unfair treatment
Directory of Open Access Journals (Sweden)
Yan eWu
2015-03-01
Full Text Available Empirical evidence indicates that people are inequity averse. However, it is unclear whether and how suffering unfairness impacts subsequent behavior. We investigated the consequences of unfair treatment in subsequent interactions with new interaction partners and the associated neural mechanisms. Participants were experimentally manipulated to experience fair or unfair treatment in the ultimatum game (UG, and subsequently, they were given the opportunity to retaliate in the dictator game (DG in their interactions with players who had not played a role in the previous fair or unfair treatment. The results showed that participants dictated less money to unrelated partners after frequently receiving unfair offers in the previous UG (versus frequently receiving fair offers in the previous UG, but only when they were first exposed to unfair UG/DG. Stronger activation in the right dorsal anterior insula was found during receiving unfair offers and during the subsequent offer-considering phase. The regional homogeneity (ReHo, a measure of the local synchronization of neighboring voxels in resting-state brain activity, in the left ventral anterior insula and left superior temporal pole was positively correlated with the behavior change. These findings suggest that unfair treatment may encourage a spread of unfairness, and that the anterior insula may be not only engaged in signaling social norm violations, but also recruited in guiding subsequent adaptive behaviors.
International Nuclear Information System (INIS)
AbdulRasheed, Omar F
2009-01-01
To evaluate the relationship between sperm motility and total seminal plasma zinc concentration and high molecular weight zinc bound protein values in infertile Iraqi men. A case-control study was conducted at the Chemistry and Biochemistry Department, College of Medicine, Al-Nahrain University, Baghdad, Iraq between March 2005 to February 2006. The subjects for the study included 60 infertile male patients who were recruited Al-Kadhimiya Teaching Hospital, and Institute of Embryo Research and Infertility Treatment, Baghdad, Iraq. They were categorized according to their seminal parameters to oligozoospermia (n=32), azoospermia (n=22), and asthenozoospermia (n=6). Thirty nine fertile men (age range 31.87 +/- 3.76 years) were selected as controls, whose partners had conceived within the last year before participation with this study, and having normal spermiogram parameters. Seminal plasma zinc concentration and high molecular weight zinc binding proteins (HMW-Zn) were assayed in the ejaculates of fertile and infertile men. The seminal plasma zinc levels were 181.92 +/- 23.40 ug/mL in the oligozoospermia group, 178.50 +/- 18.61 ug/mL in the azoospermia group, 195.33 +/- 13.00 ug/mL in the asthenozoospermia group, and 184.66 +/- 21.31 ug/mL in the control group. The HMW-Zn% is a good index of sperm function rather than the total seminal plasma zinc levels. (author)
Directory of Open Access Journals (Sweden)
Maria Greenwald
2017-12-01
Full Text Available Citrullinated Immunoglobulin Binding Protein (BiP is a newly described autoimmune target in rheumatoid arthritis (RA, one of many cyclic citrullinated peptides(CCP or ACPA. BiP is over-expressed in RA patients causing T cell expansion and increased interferon levels during incubation for the QuantiFERON-Gold tuberculosis test (QFT-G TB. The QFT-G TB has never been validated where interferon is increased by underlying disease, as for example RA.Of ACPA-positive RA patients (n =â¯126, we found a 13% false-positive TB test rate by QFT-G TB. Despite subsequent biologic therapy for 3 years of all 126 RA patients, none showed evidence of TB without INH. Most of the false-positive RA patients after treatment with biologic therapy reverted to a negative QFT-G test. False TB tests correlated with ACPA level (p <â¯0.02.Three healthy women without arthritis or TB exposure had negative QFT-G TB. In vitro, all three tested positive every time for TB correlating to the dose of BiP or anti-BiP added, at 2 ug/ml, 5 ug/ml, 10 ug/ml, and 20 ug/ml.BiP naturally found in the majority of ACPA-positive RA patients can result in a false positive QFT-G TB. Subsequent undertreatment of RA, if biologic therapy is withheld, and overtreatment of presumed latent TB may harm patients. Keywords: Tuberculosis, IGRA, Rheumatoid arthritis, Interferon, Anti-citrullinated peptide antibody (ACPA, Immunoglobulin binding protein (BiP
The Boundary Element Method Applied to the Two Dimensional Stefan Moving Boundary Problem
1991-03-15
Unc), - ( UGt )t - (UG,,),,] - (UG), If we integrate this equation with respect to r from 0 to t - c and with respect to and ij on the region 11(r...and others. "Moving Boundary Problems in Phase Change Mod- els," SIGNUM Newsletter, 20: 8-12 (1985). 21. Stefan, J. "Ober einige Probleme der Theorie ...ier Wirmelcitung," S.-B. \\Vein. Akad. Mat. Natur., 98: 173-484 (1889). 22.-. "flber (lie Theorie der Eisbildung insbesondere fiber die lisbildung im
Indoor Air Pollution and Risk of Lung Cancer among Chinese Female Non-Smokers
Mu, Lina; Liu, Li; Niu, Rungui; Zhao, Baoxing; Shi, Jianping; Li, Yanli; Scheider, William; Su, Jia; Chang, Shen-Chih; Yu, Shunzhang; Zhang, Zuo-Feng
2013-01-01
Purpose To investigate indoor particulate matter (PM) level and various indoor air pollution exposure, and to examine their relationships with risk of lung cancer in an urban Chinese population, with a focus on non-smoking women. Methods We conducted a case-control study in Taiyuan, China, consisting of 399 lung cancer cases and 466 controls, of which 164 cases and 218 controls were female non-smokers. Indoor PM concentrations, including PM1, PM2.5, PM7, PM10 and TSP, were measured using a particle mass monitor. Unconditional logistic regression models were used to calculate odds ratios (ORs) and 95% confidence intervals after adjusting for age, education, annual income and smoking. Results Among non-smoking women, lung cancer was strongly associated with multiple sources of indoor air pollution 10 years ago, including heavy exposure to ETS at work (aOR=3.65), high frequency of cooking (aOR=3.30), and solid fuel usage for cooking (aOR=4.08) and heating (aORcoal stove=2.00). Housing characteristics related to poor ventilation, including single-story, less window area, no separate kitchen, no ventilator and rarely having windows open, are associated with lung cancer. Indoor medium PM2.5 concentration was 68ug/m3, and PM10 was 230ug/m3. PM levels in winter are strongly correlated with solid fuel usage for cooking, heating and ventilators. PM1 levels in cases are more than 3-time higher than that in controls. Every 10 ug/m3 increase in PM1 is associated with 45% increased risk of lung cancer. Conclusions Indoor air pollution plays an important role in the development of lung cancer among non-smoking Chinese women. PMID:23314675
The Acquisition of Relative Clauses: How Do Second Language Learners of Arabic Do It?
Algady, Dola
2013-01-01
The new developments in syntactic theory under Minimalism reconsiders the relation between the language faculty and general cognitive systems whereby language acquisition is accomplished by the interaction of Chomsky (2005)'s three factors: (F1) a minimally specified UG (Genetic endowment); (F2) Primary Linguistic Data (PLD), i.e., input; and (F3)…
Brethel-Haurwitz, Kristin M; Stoycos, Sarah A; Cardinale, Elise M; Huebner, Bryce; Marsh, Abigail A
2016-01-07
In the Ultimatum Game (UG), incurring a cost to punish inequity is commonly termed altruistic punishment. This behaviour is thought to benefit others if the defector becomes more equitable in future interactions. However, clear connections between punishment in the UG and altruistic behaviours outside the laboratory are lacking. We tested the altruistic punishment hypothesis in a sample of extraordinarily altruistic adults, predicting that if punishing inequity is predictive of altruism more broadly, extraordinary altruists should punish more frequently. Results showed that punishment was not more prevalent in extraordinary altruists than controls. However, a self-reported altruism measure previously linked to peer evaluations but not behaviour, and on which extraordinary altruists and controls did not differ, did predict punishment. These findings support suggestions that altruistic punishment in the UG is better termed costly punishment and may be motivated by social, but not necessarily prosocial, concerns. Results also support prior suggestions that self-reported altruism may not reliably predict altruistic behaviour.
Evolution of Fairness in the Not Quite Ultimatum Game
Ichinose, Genki; Sayama, Hiroki
2014-05-01
The Ultimatum Game (UG) is an economic game where two players (proposer and responder) decide how to split a certain amount of money. While traditional economic theories based on rational decision making predict that the proposer should make a minimal offer and the responder should accept it, human subjects tend to behave more fairly in UG. Previous studies suggested that extra information such as reputation, empathy, or spatial structure is needed for fairness to evolve in UG. Here we show that fairness can evolve without additional information if players make decisions probabilistically and may continue interactions when the offer is rejected, which we call the Not Quite Ultimatum Game (NQUG). Evolutionary simulations of NQUG showed that the probabilistic decision making contributes to the increase of proposers' offer amounts to avoid rejection, while the repetition of the game works to responders' advantage because they can wait until a good offer comes. These simple extensions greatly promote evolution of fairness in both proposers' offers and responders' acceptance thresholds.
International Nuclear Information System (INIS)
Shibata, Toshiya; Yamashita, Keiji; Konishi, Junji; Hayakawa, Katsumi; Hamanaka, Daizaburo; Okumura, Ryouji; Ishi, Yasushi.
1988-01-01
The image quality of intra-arterial digital subtraction portography (IADSP) was studied in 50 randomly assigned patients using one of three contrast agents: iopamidol, (IOP, 20 cases), 76 % Na-meglumine diatrzioate (76 % UG, 20 cases), and 38 % Na-meglumine diatrizoate (38 % UG, 10 cases). Sharpness and contrast of images, and portal vein visualization were evaluated in these groups. IOP provided better image quality and portal vein visualization than 76 % UG. There was no significant difference between them in terms of side effects, such as contrast medium-induced pain and feeling of warmth, or changes in physiological parameters like blood pressure and heart rate. When a low osmolar contrast agent like IOP passes through the mesentery capillary bed, the eflux of the contrast agent into the interstitial space and the influex of water into the capillary may be less, resulting in less dilution of the contrast agent in the superior mesenteric vein. This might explain the better image quality and portal vein visualization of IOP. (author)
Module Cluster: UG - 001.00 (GSC) Urban Geography.
Currier, Wade R.
This is one of several module clusters developed for the Camden Teacher Corps project. This module cluster is designed to introduce students to urban studies through the application of a geographic approach. Although geography shares with other social sciences many concepts and methods, it has contributed a distinctive set of viewpoints and a…
Directory of Open Access Journals (Sweden)
G Lutosławska
2003-12-01
Full Text Available This study was undertaken to evaluate plasma TBARS and blood GSH concentration and erythrocyte antioxidant enzymes (glutathione peroxidase, catalase and superoxide dismutase in active, regularly menstruating female physical education students with ovulatory and anovulatory menstrual cycles and in their male counterparts. A total of 27 subjects (12 males and 15 females volunteered to participate in the study. All females were regularly menstruating with cycle length between 26-31 days. Plasma progesterone and 17-β-estradiol concentrations were assayed during the 7th-9th and 22nd-25th day of the menstrual cycle. Women with plasma progesterone concentration exceeding 19 nmol•l-1 during the 22nd-25th day were referred to as ovulatory (Group OV; n=7. Women without a peak plasma progesterone concentration were referred to as anovulatory (Group AN; n=8. Blood from male subjects was withdrawn twice - two weeks apart, at their convenience. It was found that the menstrual cycle phases did not affect plasma TBARS and blood glutathione concentration and erythrocyte GPX, CAT and SOD activity. However, erythrocyte GPX activity either in ovulatory or anovulatory women was by about 30% higher than in male subjects. Erythrocyte SOD activity in ovulatory women both in follicular and luteal phase of the menstrual cycle (1557 U/g Hb and 1394.6 U/g Hb, respectively was markedly lower than in men (1951.8 and 1937.7 U/g Hb for blood sampling I and II, respectively. In contrast, erythrocyte SOD activity in anovulatory women (1855.5 U/g Hb and 1745.7 U/g Hb in the follicular and luteal phases, respectively was similar to that found in men. The above data indicated that erythrocyte GPX and SOD activities are sensitive to plasma ovarian hormone concentration. In addition, they suggested that due to higher erythrocyte GPX activity females even with anovulatory menstrual cycles are protected better than males against hydrogen peroxide action. However, lower superoxide
Characteristics of uveitic glaucoma and evaluation of its surgical treatment
Directory of Open Access Journals (Sweden)
Shimizu A
2014-11-01
Full Text Available Ai Shimizu, Kazuichi Maruyama, Yu Yokoyama, Satoru Tsuda, Morin Ryu, Toru Nakazawa Department of Ophthalmology, Tohoku University Graduate School of Medicine, Sendai, Japan Purpose: To investigate the characteristics of uveitic glaucoma (UG and evaluate surgical treatments.Methods: This study examined a retrospective, nonrandomized comparative interventional case series of 105 UG patients (141 eyes followed between April 1, 2001 and July 30, 2014 at the outpatient clinic of Tohoku University Hospital. The study group included 47 patients (47 eyes who underwent glaucoma surgery: trabeculectomy, trabeculotomy, and trabectome surgery. The analysis used Kaplan–Meier life tables, with surgical failure defined as intraocular pressure ≧21 mmHg or the need for additional glaucoma surgery.Results: UG patients represented 9.73% of our database of glaucoma patients. The mean follow-up period was 40.32±32.53 months. Seventy-one patients had granulomatous uveitis (67.62% and 34 had nongranulomatous uveitis (32.38%. The causes of uveitis included sarcoidosis (n=25, Behçet’s disease (n=11, Vogt–Koyanagi–Harada disease (n=9, Posner–Schlossman syndrome (n=12, herpes simplex virus infectious uveitis (n=7, acute anterior uveitis (n=5, intermediate uveitis (n=4, scleritis (n=4, inflammatory bowel disease (n=4, varicella zoster virus uveitis (n=2, and others (n=6. An additional 16 patients were diagnosed with idiopathic UG. Surgical success rates were 82.86% for trabeculectomy, 62.50% for trabeculotomy, and 75.00% for trabectome. Significant risk factors for surgical failure included male sex (P=0.02, age less than 45 years (P=0.0009, nongranulomatous uveitis (P=0.04, and postoperative inflammation (P=0.01.Conclusion: Young male patients with nongranulomatous uveitis had a significant risk of surgical failure. Moreover, prolonged postoperative inflammation created a susceptibility to surgical failure, indicating the importance of postoperative
Directory of Open Access Journals (Sweden)
Shoubao Yan
2012-04-01
Full Text Available The enzymatic hydrolysis of food waste by commercially available enzymes and the subsequent ethanol fermentation of the hydrolysates by Saccharomyces cerecisiae H058 were studied in this work. The optimum batch enzymatic conditions were found to be saccharification pH of 4.5, temperature of 55!, glucoamylase concentration of 120 u/g, α-amylase concentration of 10 u/g, solid-liquid ratio of 1: 0.75 (w/w. Fed batch hydrolysis process was started with a solid-liquid ratio of 1: 1 (w/w, with solid food waste added at time lapse of 2 h to get a final solid-liquid ratio of 1: 0.5 (w/w. After 4 h of reaction, the reducing sugar concentration reached 194.43 g/L with a enzymatic digestibility of 93.12%. Further fermentation of the batch and fed batch enzymatic hydrolysates, which contained reducing sugar concentration of 131.41 and 194.43 g/L respectively, was performed using Saccharomyces cerevisiae H058, 62.93 and 90.72 g/L ethanol was obtained within 48 h.
Gene : CBRC-MDOM-01-0411 [SEVENS
Lifescience Database Archive (English)
Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...LAFWSSFSFWSDFLWRSSFILFTSSFISFFLIFHLLHLIFYLLCLIFHLLCLISSWLILTFKTLFSCFSSSASVSRSLILVFKFFSQLSSASLNCILNCILSSSKACFQFAGIS...04581 [Lodderomyces elongisporus NRRL YB-4239] 1e-06 32% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona
Lacaux, J. P.; Loemba-Ndembi, J.; Lefeivre, B.; Cros, B.; Delmas, R.
An automatic wet-only precipitation collector and a fogwater collector were operated in the coastal forest of equatorial Congo (Dimonika), for a complete seasonal cycle (November 1986-September 1987). Inorganic (Na +, K +, NH 4+, Ca 2+, NO 3-, Cl -, SO 42-) and organic (HCOO -, CH 3COO -) ions were determined in 33 stratiform rain events and nine fog events. With the raindrop size distributions, measured over a 1 year period (June 1988-June 1989) at the site of Enyelé in the Equatorial forest of Congo, were established the relationship between the liquid water content ( LWC in gm -3) and the rate of rainfall ( R in mm h -1) for the stratiform rains: LWC = 0.055 × R0.871 with a correlation coefficient of 0.98. Taking into account the dilution effect due to LWC, ionic concentrations of fogwater and stratiform precipitation are enriched during the dry season. In particular, K +, NO 3-, SO 42- and Ca 2+ are considerably enriched indicating the seasonal influence of the biomass burning due to savanna fires and terrigenous source from deserts of the Southern Hemisphere. Comparison of the chemical contents of fogwater—which mainly represents the local emission of the forest—and stratiform precipitation—which represent the air chemical content of the planetary boundary layer—during the dry season enabled us to show the following. Fog and rain with comparable chemical contents in mineral elements indicate a generalized contamination of the boundary layer by marine (Na +, Cl -), terrigenous (Ca 2+) and above all by biomass burning (K +, NO 3-, SO 42-) sources. The organic content (HCOO -, CH 3COO -) higher for the fogs than for rains, unexplainable by the dilution effect, has its source at a local level in the forest ecosystem. The estimation, from the organic content of fog and rain, of the gaseous concentrations of formic and acetic acids confirm the production of carboxylic acids measured in Amazonia during ABLE (for HCOOH : 510 ppt at canopy level and 170 ppt
Ma, Lei; Zhong, Mengying; Zhu, Yuhao; Yang, Helong; Johnson, Douglas A.; Rong, Yuping
2018-02-01
Methane (CH4) emission from animal husbandry accounts for a large percentage of anthropogenic contributions to CH4 emissions. Fully understanding of grazing management effects on the CH4 budget is essential for mitigating CH4 emissions in the temperate grazing steppe systems. Annual CH4 budgets for the sheep grazed steppes at various grazing intensities, un-grazing (UG, 0 sheep ha-1year-1), defer grazing (DG, 1.0 sheep ha-1 year-1), moderate grazing (MG, 1.43 sheep ha-1year-1), and heavy grazing (HG, 2.43 sheep ha-1year-1) were assessed across 2012-2014 in the agro-pastoral region of northern China. Annual soil CH4 uptake averaged across 2012-2014 were 1.1 ± 0.1, 2.4 ± 0.2, 2.2 ± 0.2, and 1.3 ± 0.1 kg CH4-C ha-1 for UG, DG (only 2013-2014), MG and HG sites. Non-growing season CH4 uptake comprised 50.0 ± 4.3% of annual CH4 uptake in 2012-2013 and 37.7 ± 2.0% in 2013-2014. DG and MG significantly promoted annual soil CH4 uptake (P 0.05). Bell-shaped relationship was presented between stocking rates and soil CH4 uptake (r2 = 0.59, P budgets for the grazed grasslands were -1.1 ± 0.1, 5.7 ± 0.6, 11.5 ± 1.5 and 15.5 ± 1.3 kg CH4-C ha-1 year-1 in UG, DG (only 2013-2014), MG and HG across 2012-2014. Soil CH4 uptake could offset 29.7 ± 5.6, 15.9 ± 4.3 and 6.8 ± 1.0% of total annual CH4 emissions from sheep, sheepfold and faeces in DG, MG, and HG. All grazed steppes are sources for atmospheric CH4 and the magnitude is regulated by grazing intensities. Sheep CH4 emissions for 1-g liveweight gain were 0.21, 0.32 and 0.37 g CH4-C in DG, MG and HG, respectively. DG is the recommended grazing management in this region to achieve greater herbage mass, higher sheep performance and lower CH4 emissions simultaneously.
Gene : CBRC-PMAR-01-0008 [SEVENS
Lifescience Database Archive (English)
Full Text Available o Petromyzon marinus cDNA 3', mRNA sequence /clone_end=3' /gb=EE272683 /gi=111169662 /ug=Pma.1613 /len=663 1e-08 26% MEVGIS...IMEVAISIMEVDISIMEVDISIMEVGISIMEVGISIMEVGISIMEVDISIMEVGISIMEVAISIMEVAISIMEVGISITEVRISIMEVGIS...IMEVGISITEVGISITEVGISIMEVGISIMEVGISITEVGISITEVGISITEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGIS...ITEVGISIMEVGISITEVRISIMEVGFTITASSTSSLSSLTQARLLHLFPSTLQRTTSSCLMLSSSLSAMNNPLLDENLSTPPPLIILQIRHPSIHPHGGRPLSDAFRPWAAALFLVSAIGHRPSLAVTTRPDKAQISSGAV ...
Learnability and linguistic performance
DEFF Research Database (Denmark)
Drozd, Kenneth
2004-01-01
of the human biological endowment for language in the form of a UNIVERSAL GRAMMAR (UG) (Chomsky, 1965). With respect to experimental design, C&T have strongly maintained that even young children know UG constraints but perform poorly in some experiments-due to the extralinguistic demands associated...... with experimental tasks, particularly those involved in presupposition accommodation and complex response planning. C&T specifically design their experiments to reduce the impact of extralinguistic demands on children's linguistic performance while at the same time providing felicitous environments for adultlike...... performance....
Assessment of acrylamide level in food stuffs in Poland
Mojska, H.; Gielecinska, I.; Marecka, D.; Szponar, L.; Swiderska, K.
2009-01-01
The aim of the study was to assess acrylamide content in 159 samples of nine groups of food products randomly collected in Poland in 2004-2007. The analysis was performed by gas chromatography tandem mass spectrometry (GC-MS/MS) using Finnigan GCQ instrument. Deuterium-labelled (d3 labelled) acrylamide was used as internal standard. The highest level of acrylamide was observed in potato crisps and crackers: (904 and 859ug/kg, respectively). The lowest level was found in oat flakes (23ug/kg) a...
Macrophages in Mildly Acid Microenvironment
African Journals Online (AJOL)
1College of Stomatology, Guiyang Medical University, 2Guiyang Stomatological Hospital, Guiyang, Guizhou 550004, PR China ... supernatants were collected after 24-h culture, and the content of VEGF and VEGF-C in each ... concentration at the same pH value, and reached a minimum at 50 ug/mL and pH 6.6. Conclusion ...
Unigene BLAST: CBRC-OANA-01-0659 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2.3 66% ...
Unigene BLAST: CBRC-OANA-01-1244 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2e-04 85% ...
Unigene BLAST: CBRC-OANA-01-1611 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2.4 35% ...
Unigene BLAST: CBRC-OANA-01-2061 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2e-07 54% ...
Unigene BLAST: CBRC-OANA-01-0778 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 6.2 81% ...
Unigene BLAST: CBRC-OANA-01-1584 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2e-05 56% ...
Unigene BLAST: CBRC-OANA-01-0287 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2e-09 80% ...
Unigene BLAST: CBRC-OANA-01-0688 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2e-07 66% ...
International Nuclear Information System (INIS)
Ofulla, A.V.O.
1995-01-01
The antimalarial activities of extracts of Albizia gummifera and Aspilia mossambicensis against culture adapted isolates of Plasmodium falciparum were evaluated using an in citro 3 H-hypoxanthine uptake technique. Chloroquine was used as a standard antimalarial drug for comparison with the plant extracts. The plant extracts showed various levels of activities (expressed as 50% inhibitory concentration (IC 50 s) in ug/ml of test culture) against P. falciparum in vitro, with Al gummifera showing the highest activity (eman IC 50 of 5.98 ± 2.9 SD, n=6), followed by A. mossambicensis (mean IC 50 73.36 ± 59.3 SD, n=18). The mean antimalarial activity of chloroquine (in ug/ml) was 0.037 (± 0.04 SD, n=10), far higher than that of the plant extracts. (author). 5 refs, 2 tabs
Energy Technology Data Exchange (ETDEWEB)
Wallbrecht, J.; Beckmann, H.; Reiser, H.; Wilhelm, R. [BEB Erdgas und Erdoel GmbH, Hannover (Germany)
1998-12-31
The underground gas storage at Uelsen which was built as a H-gas storage in a former variegated sandstone gasfield in Western Lower Saxony close to the town of Nordhorn has added to the gas supply system of the BEB Erdgas and Erdoel GmbH. The underground storage is connected to the Bunde-Rheine transport pipeline BEB-grid gas system by a 27 km pipeline and is a consequent expansion of BEB`s underground storage/transport system. Planning, building and commissioning were handled by BEB. Findings to date are described. [Deutsch] Der Untertagegasspeicher (UGS) Uelsen, der in einem ehemaligen Buntsandstein Gasfeld im westlichen Niedersachsen in der Naehe der Stadt Nordhorn als H-Gasspeicher eingerichtet wurde, hat die BEB Erdgas und Erdoel GmbH eine weitere Staerkung ihres Gasversorgungssystems erreicht. Der UGS Uelsen ist ueber eine 27 km lange Anbindungsleitung mit der zum BEB - Ferngasleitungssystems gehoerenden Bunde-Rheine Transportleitung verbunden und stellt eine konsequente Erweiterung des BEB Untertagegasspeicher-/Transportsystems dar. Planung, Bau und Inbetriebnahme erfolgten durch BEB im Rahmen einer integrierten bereichsuebergreifenden Projektbearbeitung. Die hierbei gewonnenen Erkenntnisse werden im Folgenden fuer den Untertagebereich dargestellt. (orig.)
Directory of Open Access Journals (Sweden)
Spyros A Kalams
Full Text Available DNA vaccines are a promising approach to vaccination since they circumvent the problem of vector-induced immunity. DNA plasmid cytokine adjuvants have been shown to augment immune responses in small animals and in macaques.We performed two first in human HIV vaccine trials in the US, Brazil and Thailand of an RNA-optimized truncated HIV-1 gag gene (p37 DNA derived from strain HXB2 administered either alone or in combination with dose-escalation of IL-12 or IL-15 plasmid cytokine adjuvants. Vaccinations with both the HIV immunogen and cytokine adjuvant were generally well-tolerated and no significant vaccine-related adverse events were identified. A small number of subjects developed asymptomatic low titer antibodies to IL-12 or IL-15. Cellular immunogenicity following 3 and 4 vaccinations was poor, with response rates to gag of 4.9%/8.7% among vaccinees receiving gag DNA alone, 0%/11.5% among those receiving gag DNA+IL-15, and no responders among those receiving DNA+high dose (1500 ug IL-12 DNA. However, after three doses, 44.4% (4/9 of vaccinees receiving gag DNA and intermediate dose (500 ug of IL-12 DNA demonstrated a detectable cellular immune response.This combination of HIV gag DNA with plasmid cytokine adjuvants was well tolerated. There were minimal responses to HIV gag DNA alone, and no apparent augmentation with either IL-12 or IL-15 plasmid cytokine adjuvants. Despite the promise of DNA vaccines, newer formulations or methods of delivery will be required to increase their immunogenicity.Clinicaltrials.gov NCT00115960 NCT00111605.
Methanol Extract of Codonopsis pilosula Inhibits Inducible Nitric ...
African Journals Online (AJOL)
HP
Department of Pharmacology and Toxicology, School of Dentistry, Kyung Hee University, .... triton X-100, 0.5 % NP-40, 1 ug/ml leupetin, and .... oxidative stress like smoking, ultraviolet rays, ... thereby disturbing the normal protein structure.
Energy Technology Data Exchange (ETDEWEB)
Yu, Rucong [Chinese Academy of Sciences, LASG, Institute of Atmospheric Physics, Beijing (China); China Meteorological Administration, LaSW, Chinese Academy of Meteorological Sciences, Beijing (China); Yuan, Weihua [Chinese Academy of Sciences, LASG, Institute of Atmospheric Physics, Beijing (China); Graduate School of the Chinese Academy of Sciences, Beijing (China); Li, Jian [China Meteorological Administration, LaSW, Chinese Academy of Meteorological Sciences, Beijing (China); Fu, Yunfei [Chinese Academy of Sciences, LASG, Institute of Atmospheric Physics, Beijing (China); University of Science and Technology of China, Laboratory of Satellite Remote Sensing and Climate Environment, Hefei, Anhui (China)
2010-09-15
Using the tropical rainfall measuring mission (TRMM) Precipitation Radar (PR) observations combined with the surface rain gauge data during 1998-2006, the robust diurnal features of summer stratiform and convective precipitation over the southern contiguous China are revealed by exploring the diurnal variations of rain rate and precipitation profile. The precipitation over the southern contiguous China exhibits two distinguishing diurnal phases: late-night (2200-0600 LST) and late-afternoon (1400-2200 LST), dependent on the location, precipitation type and duration time. Generally, the maximum rain rate and the highest profile of stratiform precipitation occur in the late-afternoon (late-night) over the southeastern (southwestern) China, while most of the stratiform short-duration rain rate tends to present late-afternoon peaks over the southern China. For convective precipitation, the maximum rain rate and the highest profile occur in the late-afternoon over most of the southern contiguous China, while the convective long-duration rain rate exhibits late-night peaks over the southwestern China. Without regional dependence, the convective precipitation exhibits much larger amplitude of diurnal variations in both near surface rain rate and vertical extension compared with stratiform precipitation and the convective rain top rises most rapidly between noon and afternoon. However, there are two distinctive sub-regions. The diurnal phases of precipitation there are very weakly dependent on precipitation type and duration time. Over the eastern periphery of the Tibetan Plateau, the maximum rain rate and the highest profile of either convective or stratiform precipitation occur in the late-night. Over the southeastern coastal regions, both the near surface rain rate and rain top of convective and stratiform precipitation peak in the late-afternoon. (orig.)
Directory of Open Access Journals (Sweden)
Didah Nur Faridah1*
2010-12-01
Full Text Available The effects of lintnerization (2.2 N HCl, 2 hours, debranching with pullulanase (1.3 U/g and 10.4 U/g starch and/or three-auctoclaving-cooling cycles at 121oC for 15 minutes on the changes of arrowroot starch structures were studied. The structural modifications of amylose and amylopectin were measured by Gel Permiation Chromatography (GPC, and the distribution of degree of polimerization (DP was analyzed by Fluorophore-Assisted Capillary Electrophoresis (FACE. The GPC profile of native starch using Toyopearl HW-65S gel gave mainly two fractions. Fraction I (Fr. I was a high molecular weight component and Fraction II (Fr. II was a low molecular weight component. After acid modification, the carbohydrate content of Fr. II increased while that of Fr. I decreased. The amount of DP of 6 to 8 increased in all modified arrowroot starches. The GPC and FACE analyses showed that all starch modification techniques caused the structural changes of amylopectin molecules to form short chain amyloses.
Directory of Open Access Journals (Sweden)
Flávio Carlos Dalchiavon
2014-04-01
Full Text Available A cultura da cana-de-açúcar desempenha, sobretudo no aspecto relacionado às fontes energéticas alternativas, importantíssimo papel. No ano de 2009, no município de Suzanápolis (SP, cujas coordenadas são 20º 28' 10'' S e 50º 49' 20'' W, no cerrado brasileiro foi analisada a produtividade da cana soca (2º ciclo em razão da resistência à penetração, umidade gravimétrica e matéria orgânica de um Argissolo Vermelho eutrófico. O objetivo foi selecionar, entre os atributos pesquisados, aquele com a melhor correlação, a linear e a espacial, para explicar a variabilidade da produtividade da cana-de-açúcar. Foi instalada a malha geoestatística para a coleta de dados do solo e da planta, com 120 pontos amostrais, numa área de 14,53 ha. A matéria orgânica correlaciona-se linear e negativamente com a resistência à penetração, indicando que manejos do solo que visem seu aumento no perfil melhoram suas condições físicas e, por conseguinte, o desenvolvimento e a produtividade da cana-de-açúcar. A umidade gravimétrica (UG e o teor de matéria orgânica do solo (MO correlacionam-se direta, linear (UG2 e MO1 e espacialmente (UG1 e MO1 com a produtividade da cana-de-açúcar, demonstrando serem os melhores atributos, dentre os pesquisados, para estimar e aumentar a produtividade agrícola da cana-de-açúcar.
Theory of mind deficits partly mediate impaired social decision-making in schizophrenia.
Yang, Liuqing; Li, Peifu; Mao, Haiying; Wang, Huiling; Shu, Chang; Bliksted, Vibeke; Zhou, Yuan
2017-05-05
Using paradigms from game theory, researchers have reported abnormal decision-making in social context in patients with schizophrenia. However, less is known about the underpinnings of the impairment. This study aimed to test whether theory of mind (ToM) deficits and/or neurocognitive dysfunctions mediate impaired social decision-making in patients with schizophrenia. We compared thirty-five patients with schizophrenia to thirty-eight matched healthy controls with regard to social decision-making using the mini Ultimatum Game (mini UG), a paradigm from game theory. Additionally, we assessed ToM using the Theory of Mind Picture Stories Task, a mental state attribution task, and assessed neurocognition using the Brief Assessment of Cognition in Schizophrenia. Mediation analyses were performed on the data. In contrast to the behavioral pattern of healthy controls in the mini UG, the patients with schizophrenia significantly accepted more disadvantageous offers and rejected more advantageous offers, and showed reduced sensitivity to the fairness-related context changes in the mini UG. Impaired ToM and neurocognition were also found in the patients. Mediation analyses indicated that ToM but not neurocognition partially mediated the group differences on the disadvantageous and advantageous offers in the mini UG. Patients with schizophrenia exhibited impaired social decision-making. This impairment can be partly explained by their ToM deficits rather than neurocognitive deficits. However, the exact nature of the ToM deficits that mediate impaired social decision-making needs to be identified in future.
Terra Harvest software architecture
Humeniuk, Dave; Klawon, Kevin
2012-06-01
Under the Terra Harvest Program, the DIA has the objective of developing a universal Controller for the Unattended Ground Sensor (UGS) community. The mission is to define, implement, and thoroughly document an open architecture that universally supports UGS missions, integrating disparate systems, peripherals, etc. The Controller's inherent interoperability with numerous systems enables the integration of both legacy and future UGS System (UGSS) components, while the design's open architecture supports rapid third-party development to ensure operational readiness. The successful accomplishment of these objectives by the program's Phase 3b contractors is demonstrated via integration of the companies' respective plug-'n'-play contributions that include controllers, various peripherals, such as sensors, cameras, etc., and their associated software drivers. In order to independently validate the Terra Harvest architecture, L-3 Nova Engineering, along with its partner, the University of Dayton Research Institute, is developing the Terra Harvest Open Source Environment (THOSE), a Java Virtual Machine (JVM) running on an embedded Linux Operating System. The Use Cases on which the software is developed support the full range of UGS operational scenarios such as remote sensor triggering, image capture, and data exfiltration. The Team is additionally developing an ARM microprocessor-based evaluation platform that is both energy-efficient and operationally flexible. The paper describes the overall THOSE architecture, as well as the design decisions for some of the key software components. Development process for THOSE is discussed as well.
Fairness considerations when I know more than you do: Developmental comparisons
Directory of Open Access Journals (Sweden)
Sandy eOvergaauw
2012-10-01
Full Text Available The Ultimatum Game (UG is a valuable paradigm to study fairness considerations. Here, we tested developmental differences between altruistic and strategic motivations in fairness considerations using a version of the UG with hidden conditions. Participants were proposers and could divide coins between themselves and an anonymous other. Hidden information conditions involved division of coins where some coins were only visible to the participant (e.g., 8/2 condition where, from the total of 10 coins, 8 coins were visible to both players and 2 coins only visible to the proposer. In total, 22 young adults and 79 children between ages 8 and 13 played multiple one-shot versions of the ultimatum game with hidden conditions with anonymous others. Overall analyses confirmed validity of the task and showed that participants of all age groups had strategic intentions. Specific task analyses revealed that adults divided the coins equally in the standard UG conditions, but gave less to the second player in the hidden information conditions. The developmental comparisons revealed an age x condition interaction, such that adults and 10-12-year-old children differentiated between standard and hidden conditions more than 8-9-year-old children. These findings indicate that young children have a basic understanding of different strategic motives, but that behavior of adults and older children is driven more by strategic intentions.
Sungur, G; Yakin, M; Eksioglu, U; Satana, B; Ornek, F
2017-10-01
PurposeThere is little known about the long-term efficacy and safety of Ahmed glaucoma valve (AGV) implant and about the conditions affecting surgical success in uveitic glaucoma (UG).Patients and methodsThe charts of adult patients with UG who underwent AGV implantation from 2006 to 2015 were reviewed retrospectively.ResultsData of 46 eyes of 39 patients were evaluated. Mean follow-up was 51.93±23.08 months. Mean preoperative IOP was 37.05±9.62 mm Hg and mean number of preoperative topical anti-glaucomatous medications was 2.98±0.27. One eye (2%) was defined as failure because of implant extraction surgery. In the rest of the eyes, intraocular pressure (IOP) was under control with or without anti-glaucomatous medications during follow-up. The cumulative probability of complete success (IOP control without medications) was 78% at 6 months, 76% at 1 year, 71% at 2 years, 66% at 3 years, and 63% at 4 years (95% confidence interval, 61.24-87.81). The cumulative probability of eyes without complication was 64% at 6 months, 48% at 12 months, 44% at 24 months, 41% at 36 months, and 38% at 48 months (95% confidence interval, 34.64-62.85). Complete success was lower in eyes with previous ocular surgery than the eyes without (P=0.061) and it was lower in eyes with active inflammation at the time of surgery than the eyes without (P=0.011).ConclusionAGV implantation is an effective and safe alternative method in the management of UG, especially when it is performed as a primary surgical option and when no inflammation is present preoperatively.
Elkot, Ahmed Fawzy Abdelnaby; Chhuneja, Parveen; Kaur, Satinder; Saluja, Manny; Keller, Beat; Singh, Kuldeep
2015-01-01
Powdery mildew (PM), caused by Blumeria graminis f. sp. tritici, is one of the important wheat diseases, worldwide. Two PM resistance genes, designated as PmTb7A.1 and PmTb7A.2, were identified in T. boeoticum acc. pau5088 and mapped on chromosome 7AL approximately 48cM apart. Two resistance gene analogue (RGA)-STS markers Ta7AL-4556232 and 7AL-4426363 were identified to be linked to the PmTb7A.1 and PmTb7A.2, at a distance of 0.6cM and 6.0cM, respectively. In the present study, following marker assisted selection (MAS), the two genes were transferred to T. aestivum using T. durum as bridging species. As many as 12,317 florets of F1 of the cross T. durum /T. boeoticum were pollinated with T. aestivum lines PBW343-IL and PBW621 to produce 61 and 65 seeds, respectively, of three-way F1. The resulting F1s of the cross T. durum/T. boeoticum//T. aestivum were screened with marker flanking both the PM resistance genes PmTb7A.1 and PmTb7A.2 (foreground selection) and the selected plants were backcrossed to generate BC1F1. Marker assisted selection was carried both in BC1F1 and the BC2F1 generations. Introgression of alien chromatin in BC2F1 plants varied from 15.4-62.9 percent. Out of more than 110 BC2F1 plants showing introgression for markers linked to the two PM resistance genes, 40 agronomically desirable plants were selected for background selection for the carrier chromosome to identify the plants with minimum of the alien introgression. Cytological analysis showed that most plants have chromosome number ranging from 40-42. The BC2F2 plants homozygous for the two genes have been identified. These will be crossed to generate lines combining both the PM resistance genes but with minimal of the alien introgression. The PM resistance gene PmTb7A.1 maps in a region very close to Sr22, a stem rust resistance gene effective against the race Ug99. Analysis of selected plants with markers linked to Sr22 showed introgression of Sr22 from T. boeoticum in several BC2F1 plants
Directory of Open Access Journals (Sweden)
Ahmed Fawzy Abdelnaby Elkot
Full Text Available Powdery mildew (PM, caused by Blumeria graminis f. sp. tritici, is one of the important wheat diseases, worldwide. Two PM resistance genes, designated as PmTb7A.1 and PmTb7A.2, were identified in T. boeoticum acc. pau5088 and mapped on chromosome 7AL approximately 48cM apart. Two resistance gene analogue (RGA-STS markers Ta7AL-4556232 and 7AL-4426363 were identified to be linked to the PmTb7A.1 and PmTb7A.2, at a distance of 0.6cM and 6.0cM, respectively. In the present study, following marker assisted selection (MAS, the two genes were transferred to T. aestivum using T. durum as bridging species. As many as 12,317 florets of F1 of the cross T. durum /T. boeoticum were pollinated with T. aestivum lines PBW343-IL and PBW621 to produce 61 and 65 seeds, respectively, of three-way F1. The resulting F1s of the cross T. durum/T. boeoticum//T. aestivum were screened with marker flanking both the PM resistance genes PmTb7A.1 and PmTb7A.2 (foreground selection and the selected plants were backcrossed to generate BC1F1. Marker assisted selection was carried both in BC1F1 and the BC2F1 generations. Introgression of alien chromatin in BC2F1 plants varied from 15.4-62.9 percent. Out of more than 110 BC2F1 plants showing introgression for markers linked to the two PM resistance genes, 40 agronomically desirable plants were selected for background selection for the carrier chromosome to identify the plants with minimum of the alien introgression. Cytological analysis showed that most plants have chromosome number ranging from 40-42. The BC2F2 plants homozygous for the two genes have been identified. These will be crossed to generate lines combining both the PM resistance genes but with minimal of the alien introgression. The PM resistance gene PmTb7A.1 maps in a region very close to Sr22, a stem rust resistance gene effective against the race Ug99. Analysis of selected plants with markers linked to Sr22 showed introgression of Sr22 from T. boeoticum in
2015-10-01
28 Magnetometer Applied Physics Model 1540-digital 3-axis fluxgate 5 Amplifiers Alligator Technologies USBPGF-S1 programmable instrumentation...Acoustic, Seismic, magnetic, footstep, vehicle, magnetometer , geophone, unattended ground sensor (UGS) 16. SECURITY CLASSIFICATION OF: 17. LIMITATION
About the differential calculus on the quantum groups
International Nuclear Information System (INIS)
Bernard, D.
1992-01-01
Given a solution R of the Yang-Baxter equation admitting a quasi-triangular decomposition we define a quasi-triangular quantum Lie algebra. We describe how to any quasi-triangular quantum Lie algebra U(G R ) is associated a Hopf algebra F(G R ) with a differential calculus on it such that the algebra of the quantum Lie derivatives is the algebra U(G R ). This allows us to make the connection between the differential calculus on quantum groups and the exchange algebras of the algebraic Bethe ansatz. (orig.)
Leśniewska, Aleksandra; Stosik, Aneta
2016-01-01
Streszczenie Rynek usług fitness w Polsce nieustannie i dynamicznie się rozwija. Kluby fitness oferują obecnie swoim klientom szeroką gamę usług, od zorganizowanych zajęć grupowych po indywidualne formy treningowe, takie jak trening personalny, który cieszy się coraz większym zainteresowaniem. Jednak trenerzy personalni, mimo tak sprzyjających trendów rynkowych, borykają się aktualnie z problemem braku standardów kwalifikacji zawodowych oraz niespójnym systemem kształcenia w Polsce. Celem...
Use and activity levels on newly built bicycle playgrounds
DEFF Research Database (Denmark)
Schipperijn, Jasper; Hansen, Christine Kier; Rask, Simon
2015-01-01
Increasing the use of urban green space (UGS) as well as increasing cycling could potentially help address the growing inactivity problem. Three bicycle playgrounds were designed based on a participatory process and afterwards constructed in the UGS along a cycle-route on the historic outer defence...... close to one of the sites. A future study involving objective before and after measures when a new bicycle playground is build will be needed to reveal if bicycle playgrounds can provide additional activity to its users, or ‘just’ a different type of activity, in a different location....
Directory of Open Access Journals (Sweden)
Anna Kozajda
2013-12-01
Full Text Available Objectives: The study was aimed at assessment of exposure to endotoxins, (1→3-β-D-glucans and mite, cockroach, cat, dog allergens present in settled dust in premises of children as agents which may be significantly correlated with the occurrence of allergic symptoms and diseases in children. Materials and Methods: The study covered 50 homes of one- or two-year-old children in Poland. Samples of settled dust were taken from the floor and the child's bed. The levels of (1→3-β-D-glucans (floor, endotoxins (floor and allergens of mite, cat, dog and cockroach (floor and bed were analyzed. Results: Average geometric concentrations (geometric standard deviation of endotoxins, (1→3-β-D-glucans, Der p1, Fel d1, Can f1 and Bla g1 in children homes were on the floor 42 166.0 EU/g (3.2, 20 478.4 ng/g (2.38, 93.9 ng/g (6.58, 119.8 ng/g (13.0, 288.9 ng/g (3.4, 0.72 U/g (4.4 and in their beds (only allergens 597.8 ng/g (14.2, 54.1 ng/g (4.4, 158.6 ng/g (3.1 0.6 U/g (2.9, respectively. When the floor was covered with the carpet, higher concentrations of endotoxins, (1→3-β-D-glucans and allergens (each type were found in the settled dust (p < 0.05. The trend was opposite in case of allergens (except dog analyzed from bed dust and significantly higher concentrations were found in the rooms with smooth floor (p < 0.05. Conclusions: Among the analyzed factors only the type of floor significantly modified both the level of biological indicators and allergens. The results of this study could be the base for verifying a hypothesis that carpeting may have a protective role against high levels of cockroach, dog and cat allergens.
3, 4-methylenedioximethamphetamin reverses anxiety induced by chronic mild stress
Directory of Open Access Journals (Sweden)
Laura Andrea León A
2013-01-01
Full Text Available Here we report the effects of subchronic 3, 4 methylenedioximethamphetamine (MDMA on the elevated plusmaze, a widely used animal model of anxiety. Rats exposed to a mild chronic stress (MCS protocol received intracerebroventricular microinjections of the selective serotonin reuptake inhibitor (SSRI – fluoxetine (2.0 ug/ul or MDMA, (2.0 ug/ul for seven days. On the eighth day rats were tested in the elevated plus-maze. Our results showed that sub chronic MDMA interacted with MCS leading to a decrease in anxiety related behaviors including: percentage of open arms entries (F [2, 26] = 4.00; p = 0.031, time spent in the open arms (F [2, 26] = 3.656; p = 0.040 and time spent in the open arms extremities (F [2, 26] = 5.842; p = 0.008. These results suggest a potential effect of MDMA in the reversion of the emotional significance of aversive stimuli.
Gene : CBRC-DMEL-06-0010 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-06-0010 X D UNKNOWN PCX_DROME 0.0 95% ref|NP_525045.2| pecanex CG3443-PB ...[Drosophila melanogaster] sp|P18490|PCX_DROME Protein pecanex gb|AAF45756.2| CG3443-PB [Drosophila melanogas...ter] 0.0 95% gnl|UG|Dm#S13283457 Drosophila melanogaster pecanex CG3443-RB (pcx), mRNA /cds=p(1,10302) /gb=N
1989-10-01
varying quantities of waste oils, recovered fuels, spent cleaners, jtrippers, and solvents. The Defense Reutilization and Marketing Office (DRMO) is...accumulate in ecosystems and has toxic effects in many vertebrates. DRMO: Defense Reutilization and Marketing Office DW: Deep well EC: Electrical...Concentration Comound ( ucg /liter) Comoound (ug/liter) chloromiethane 10 U 1,2-dichioropropane 5 U bromomethane 10 U cis-1,3-dichloropropene 5 U vinyl
Shutting Down Sensorimotor Interferences after Stroke: A Proof-of-Principle SMR Neurofeedback Study
Reichert, Johanna L.; Kober, Silvia E.; Schweiger, Daniela; Grieshofer, Peter; Neuper, Christa; Wood, Guilherme
2016-01-01
Introduction: Neurofeedback training aims at learning self-regulation of brain activity underlying cognitive, emotional or physiological functions. Despite of promising investigations on neurofeedback as a tool for cognitive rehabilitation in neurological diseases, such as after stroke, there is still a lack of research on feasibility and efficiency of neurofeedback in this field. Methods: The present study aimed at investigating behavioral and electrophysiological effects of 10 sessions of sensorimotor rhythm (SMR) neurofeedback in a 74-years-old stroke patient (UG20). Based on previous results in healthy young participants, we hypothesized that SMR neurofeedback leads to a decrease in sensorimotor interferences and improved stimulus processing, reflected by changes in event-related potentials (ERPs) and electrophysiological coherence. To assess whether UG20 benefited from the training as much as healthy persons of a similar age, a healthy control group of N = 10 elderly persons was trained as well. Before and after neurofeedback training, participants took part in a multichannel electroencephalography measurement conducted during a non-verbal and a verbal learning task. Results: Both UG20 and the healthy controls were able to regulate their SMR activity during neurofeedback training. Moreover, in a non-verbal learning task, changes in ERPs and coherence were observed after training: UG20 showed a better performance in the non-verbal learning task and a higher P3 amplitude after training than before, and coherence between central and parietal electrodes decreased after training. The control group also showed a behavioral improvement in the non-verbal learning task and tendencies for higher P3 amplitudes and decreased central-parietal coherence after training. Single-case analyses indicated that the changes observed in UG20 were not smaller than the changes in healthy controls. Conclusion: Neurofeedback can be successfully applied in a stroke patient and in healthy
Shutting down sensorimotor interferences after stroke: A proof-of-principle SMR neurofeedback study
Directory of Open Access Journals (Sweden)
Johanna Louise Reichert
2016-07-01
Full Text Available Introduction: Neurofeedback training aims at learning self-regulation of brain activity underlying cognitive, emotional or physiological functions. Despite of promising investigations on neurofeedback as a tool for cognitive rehabilitation in neurological diseases, such as after stroke, there is still a lack of research on feasibility and efficiency of neurofeedback in this field. Methods: The present study aimed at investigating behavioral and electrophysiological effects of 10 sessions of sensorimotor rhythm (SMR neurofeedback in a 74-year-old stroke patient (UG20. Based on previous results in healthy young participants, we hypothesized that SMR neurofeedback leads to a decrease in sensorimotor interferences and improved stimulus processing, reflected by changes in event-related potentials and electrophysiological coherence. To assess whether UG20 benefited from the training as much as healthy persons of a similar age, a healthy control group of N = 10 elderly persons was trained as well. Before and after neurofeedback training, participants took part in a multichannel EEG measurement conducted during a nonverbal and a verbal learning task. Results: Both UG20 and the healthy controls were able to regulate their SMR activity during neurofeedback training. Moreover, in a nonverbal learning task, changes in event-related potentials and coherence were observed after training: UG20 showed a better performance in the nonverbal learning task and a higher P3 amplitude after training than before, and coherence between central and parietal electrodes decreased after training. The control group also showed a behavioral improvement in the nonverbal learning task and tendencies for higher P3 amplitudes and decreased central-parietal coherence after training. Single-case analyses indicated that the changes observed in UG20 were not smaller than the changes in healthy controls. Conclusions: Neurofeedback can be successfully applied in a stroke patient and in
Gene : CBRC-MDOM-03-0050 [SEVENS
Lifescience Database Archive (English)
Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...ISLASFSNWLILTFKTLVSVSRLLILVFKFFSQLYSASLNFVLNCILSSSKACIHFSGISDLLFADPSPSVPFALCLLPVQKLSIVISFLLFCHLLIFTPSLLPIFVCALAPLTFLVLGFYVSLPSWSFDRKSLPTLWCWSLSFPVLWRLLIGLN ... ...04581 [Lodderomyces elongisporus NRRL YB-4239] 0.002 30% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona
Gene : CBRC-GGAL-02-0044 [SEVENS
Lifescience Database Archive (English)
Full Text Available e BLIP-II repeats protein (partial match) [Herminiimonas arsenicoxydans] emb|CAL62346.1| Putative BLIP-II re...peats protein (partial match) [Herminiimonas arsenicoxydans] 0.80 30% gnl|UG|Gga#S19183868 Gallus gallus cyc
Fractional activation of accumulation-mode particles in warm continental stratiform clouds
International Nuclear Information System (INIS)
Gillani, N.V.; Daum, P.H.; Schwartz, S.E.; Leaitch, W.R.; Strapp, J.W.; Isaac, G.A.
1991-07-01
The degree of activation of accumulation-mode particles (AMP) in clouds has been studied using continuous (1 second average) aircraft measurements of the number concentrations of cloud droplets (N cd , 2 to 35 μm diameter) and of unactivated AMP (N amp , 0.17 to 2.07 μm diameter) in cloud interstitial air. The magnitude and spatial variation of the activated fraction (F) of all measured particles (defined as F triple-bond N cd /N tot , where N tot = N cd + N amp ) are investigated, based on measurements made during ten aircraft flights in non-precipitating warm continental stratiform clouds near Syracuse NY in the fall of 1984. Based on instantaneous observations throughout the clouds, the spatial distribution of F was found to be quite nonuniform. In general, F was low in cloud edges and where total particle loading was high and/or cloud convective activity was low. In the interior of clouds, the value of F exceeded 0.9 for 36% of the data, but was below 0.6 for 28%. Factors influencing F the most were the total particle loading (N tot ) and the thermal stability of the cloud layer. The dependence of F on N tot in cloud interior was characterized by two distinct regimes. For N tot -3 , F was generally close to unity and relatively insensitive to N tot . For N tot > 800 cm -3 , F tended to decrease with increasing N tot . This decrease was greatest in a stable stratus deck embedded in a warm moist airmass. The results suggest that, in warm continental stratiform clouds, the process of particle activation becomes nonlinear and self-limiting at high particle loading. The degree of this nonlinearity depends on cloud convective activity (thermal instability)
Energy Technology Data Exchange (ETDEWEB)
Hernadi, L.; Pevzner, R.; Salanki, J.
1986-01-01
The ultrastructural alterations of the olfactory organs and taste buds of the bleak were studied with scanning electron microscopy following treatment with different concentrations of mercury and cadmium. The metals were administered to the lake-water in the forms of HgCl/sub 2/ and CdCl/sub 2/. The concentrations (100 ug/1 Hg/sup + +/ and Cd/sup + +/, as well as 300 ug/1 Hg/sup + +/ and Cd/sup + +/) were kept constant. Samples were taken after exposures of 1 day, 2 days, 1 week, 2 weeks. The olfactory organs proved to be more sensitive than the taste buds to both metals upon any applied concentration and exposure times. The receptor cells of the olfactory organ showed different alterations to the different metals. The mercury treatment evoked dramatic decreases in the number of receptor cells and ciliated epithelial cells, while cadmium only brought forth unusual deformation and destruction of the receptor cells, without affecting the ciliated epithelial cells. On the taste buds mercury treatment affected the microridge system on the epithelial cells as well as the microvilliar system of the supporting and receptor cells. The effects showed duration and concentration dependency. Cadmium effects on the taste buds showed no structural alteration, only the mucous secretion increased over the surface of the taste buds.
1975-01-01
with approximately 3000 lb pull. Menzie, and Meek were assisted from the forward compartment and given pre- 11-21 cautionary recompression therapy . The...UG-36 floatation foam inside a polyethelene tube. This helps avoid entanglement of the FISH and aids maneuverability. Although the multiplex cable
Akgul, Ozgur; Uyarel, Huseyin; Pusuroglu, Hamdi; Gul, Mehmet; Isiksacan, Nilgun; Turen, Selahattin; Erturk, Mehmet; Surgit, Ozgur; Cetin, Mustafa; Bulut, Umit; Baycan, Omer F; Uslu, Nevzat
2013-10-01
The aim of this study was to evaluate the prognostic value of D-dimer in patients with STEMI undergoing primary percutaneous coronary intervention (PCI). The prognostic value of D-dimer has been documented in patients with acute coronary syndrome without ST-segment elevation. However, its value in acute ST-segment elevation myocardial infarction (STEMI) remains unclear. We prospectively enrolled 453 consecutive STEMI patients (mean age 55.6 ± 12.4 years, 364 male, 89 female) undergoing primary PCI. The study population was divided into tertiles based on admission D-dimer values. The high D-dimer group (n = 151) was defined as a value in the third tertile [>0.72 ug/ml fibrinogen equivalent units (FEU)], and the low D-dimer group (n = 302) included those patients with a value in the lower two tertiles (≤0.72 ug/ml FEU). Clinical characteristics, in-hospital and 6-month outcomes of primary PCI were analyzed. The patients of the high D-dimer group were older (mean age 60.1 ± 13.5 versus 52.4 ± 10.6, P 0.72 ug/ml FEU) was found to be a powerful independent predictor of 6-month all-cause mortality (odds ratio: 10.1, 95% confidence interval: 1.24-42.73, P = 0.03). These results suggest that a high admission D-dimer, level was associated with increased in-hospital cardiovascular mortality and 6-month all-cause mortality in patients with STEMI undergoing primary PCI.
Gene : CBRC-MDOM-09-0044 [SEVENS
Lifescience Database Archive (English)
Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...FFASSFSFFASSFISFASFSSWLILAFKTLFSVSRGLILVFKFLSQLSSASLSCVLNCILSSSKACVQFAGISILLLAYSCELFVLGLLPVQKLSIVISFFFFCCLFTFTPSLLFCCVCALAPLIFLVLRL ... ...04581 [Lodderomyces elongisporus NRRL YB-4239] 3e-06 37% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona
Gene : CBRC-AGAM-02-0138 [SEVENS
Lifescience Database Archive (English)
Full Text Available etical protein ACTODO_01217 [Actinomyces odontolyticus ATCC 17982] gb|EDN80763.1| hypothetical protein ACTODO_01217 [Actinomyces odon...tolyticus ATCC 17982] 8e-09 27% gnl|UG|Aga#S10993527 Single read from an extremity
banana juice as an alternative energy source for banana in vitro
African Journals Online (AJOL)
ACSS
2015-02-23
Feb 23, 2015 ... Corresponding author: sbmukasa@caes.mak.ac.ug, sbmukasa@yahoo.com ... However, the cost of tissue culture grade energy sources is high, thus making tissue ..... Treatment (banana juice from different Cvs at 50 ml l-1).
Energy Technology Data Exchange (ETDEWEB)
Clement, J.G.; Bailey, D.G.; Madill, H.D.; Spence, J.D.
1993-05-13
HI-6 was rapidly absorbed from an IM injection site. Maximum HI-6 plasma concentrations of 1.88, 4.96, 8.31 15.0 ug/ml were found 28-36 min after administration and maintained above 4 ug/ml concentration for 0, 39, 112 172.5 min following administration of 62.5, 125, 250 or 500 mg HI-6 + atropine (2 mg), respectively. The calculated half life of HI-6 was 78.2 min following 62.5 mg HI-6 + atropine dose and approximately 64-67 min following 125-500 mg HI-6 + atropine doses. Approximately 50 % of the total dose of HI-6 was eliminated unchanged in the urine. There were significant changes (p < 0.05) in AST, CPK, creatinine and gamma GT following the 500 mg HI-6 + atropine dose but they were not considered to be clinically significant. Urinalysis, hematology and semen analysis over the 24 hr observation period was uneventful. There were no clinically significant changes in heart rate or ECG trace, respiration or blood pressure, visual and mental acuity following HI-6 + atropine.
Energy Technology Data Exchange (ETDEWEB)
Ofulla, A V.O.
1995-01-01
The antimalarial activities of extracts of Albizia gummifera and Aspilia mossambicensis against culture adapted isolates of Plasmodium falciparum were evaluated using an in citro {sup 3}H-hypoxanthine uptake technique. Chloroquine was used as a standard antimalarial drug for comparison with the plant extracts. The plant extracts showed various levels of activities (expressed as 50% inhibitory concentration (IC{sub 50}s) in ug/ml of test culture) against P. falciparum in vitro, with Al gummifera showing the highest activity (eman IC{sub 50} of 5.98 {+-} 2.9 SD, n=6), followed by A. mossambicensis (mean IC{sub 50} 73.36 {+-} 59.3 SD, n=18). The mean antimalarial activity of chloroquine (in ug/ml) was 0.037 ({+-} 0.04 SD, n=10), far higher than that of the plant extracts. (author). 5 refs, 2 tabs.
2-Hydro-4-n-But oxypropiophenone Oxime as a spectrophotometric reagent for Fe (III)
International Nuclear Information System (INIS)
Purohit, K.; Desai, K.K.
2006-01-01
2-Hydro-4-n-But oxypropiophenone Oxime [Hipbone] has been synthesized and used for the spectrophotometric determination of Fe (III). The reagent gives purple coloured complex with Fe (III) in 50% alcoholic medium in pH range of 2.5-4.5. Beer's law is obeyed up to 23.1 ppm of Fe (III). Molar absorptivity and sandell's sensitivity at 500 nm of complex were found to be 7.062x 10 power2 lit.mol.cm and 0.079 ug of Fe (III)/cm respectively. Composition and stability constant have been determined. The reagent is successfully used for determination of Fe (III) in dolomite and in pharmaceutical sample. It is also used for the indirect determination of fluoride in tap water sample. (author)
Directory of Open Access Journals (Sweden)
Gustavo A.S. Pinto
2001-03-01
Full Text Available The aim of this work was to select strains of Aspergillus niger for tannase production. Growth of colonies in plates with tannic acid-containing medium indicated their ability to synthesize tannase. Tannase activity was also measured in solid-state fermentation. A. niger 11T25A5 was the best tannase producer (67.5 U.g-1/72 hours of fermentation.O objetivo deste trabalho foi selecionar linhagens de Aspergillus niger para síntese de tanase. O crescimento das colônias em meio contendo ácido tânico indicou capacidade de produção de tanase. A atividade enzimática foi determinada em fermentação semi-sólida. A. niger 11T25A5 foi o melhor produtor (67.5 U.g-1/72 horas de fermentação.
Gene : CBRC-DMEL-01-0061 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-01-0061 Novel 2L A Orphan receptors LSHR_RAT 2e-93 33% ref|NP_476702.1| rickets... CG8930-PA, isoform A [Drosophila melanogaster] ref|NP_599102.1| rickets CG8930-PB, isoform B [Drosoph...ila melanogaster] ref|NP_599103.1| rickets CG8930-PC, isoform C [Drosophila melanogaster] ref|NP_599104.1| rickets...ter] 0.0 88% gnl|UG|Dm#S13279502 Drosophila melanogaster rickets CG8930-RA, trans
Radar rainfall estimation of stratiform winter precipitation in the Belgian Ardennes
Hazenberg, P.; Leijnse, H.; Uijlenhoet, R.
2011-01-01
Radars are known for their ability to obtain a wealth of information about spatial storm field characteristics. Unfortunately, rainfall estimates obtained by this instrument are known to be affected by multiple sources of error. Especially for stratiform precipitation systems, the quality of radar
Proposers’ Economic Status Affects Behavioral and Neural Responses to Unfairness
Directory of Open Access Journals (Sweden)
Yijie Zheng
2017-05-01
Full Text Available Economic status played an important role in the modulation of economic decision making. The present fMRI study aimed at investigating how economic status modulated behavioral and neural responses to unfairness in a modified Ultimatum Game (UG. During scanning, participants played as responders in the UG, and they were informed of the economic status of proposers before receiving offers. At the behavioral level, higher rejection rates and lower fairness ratings were revealed when proposers were in high economic status than in low economic status. Besides, the most time-consuming decisions tended to occur at lower unfairness level when the proposers were in high (relative to low economic status. At the neural level, stronger activation of left thalamus was revealed when fair offers were proposed by proposers in high rather than in low economic status. Greater activation of right medial prefrontal cortex was revealed during acceptance to unfair offers in high economic status condition rather than in low economic status condition. Taken together, these findings shed light on the significance of proposers’ economic status in responders’ social decision making in UG.
Directory of Open Access Journals (Sweden)
Alejandro Gómez
2014-06-01
Full Text Available ACCESSIBILITY AND USE OF URBAN GREEN SPACES IN THE CITIES OF COIMBRA (PORTUGAL AND SALAMANCA (SPAIN. In a society that values more and more wellbeing, health and free time, the introduction of urban green spaces (UGS next to residential areas has become a citizen’s right and requirement. This paper analyses the distribution and accessibility of UGS in the cities of Coimbra and Salamanca and evaluates their influence on the needs of the resident populations, in terms of users’ age, frequency of usage, as well as of motivation and ways to enjoy the facilities. In Coimbra there is a concentration of UGS, whereas in Salamanca there is a dispersion of such spaces, which has resulted in the different usage that people make of them. In fact, although Coimbra offers more urban green space (per inhabitant, their usage is reduced as people go there mainly by car, contrary to what happens in Salamanca. Consequently, Coimbra’s inhabitants choose these green spaces because of the activities they can be used for, whereas Salamanca’s inhabitants choose them for their proximity.
Total mercury of selected fish species from Laguna de Bay
International Nuclear Information System (INIS)
Relon, Milagros Lontoc
1996-01-01
Dalag Ophicephalus striatus Block, kanduli Arius thalassinus Ruppell, bia Amblygobius phalaena Cuvier et Valenciennes and tilapia Tilapia nilotica Linnnaeus collected from Laguna de Bay between Taguig and Binangonan area in August 1989 to July 1990 were analyzed for total mercury by atomic absorption spectrometry. The highest metal concentration in soft muscle tissue was observed in Dalag followed by kanduli, less in bia and least in tilapia with mean values of 0.021, 0.020, 0.013, and 0.008 ug/g, respectively. Analysis using two-way ANOVA showed a significant difference in the mean total mercury in ug/g in the difference fish samples, among the different months and the interaction between these two variables. Mean total mercury of the four fish samples were significantly higher in April than in October. The results show that the levels of total mercury in the fish samples are below the World Health Organization maximum tolerable consumption of mercury in food of 300 ug or 0.03 mg of total mercury per week. (author)
Directory of Open Access Journals (Sweden)
Mohammad A. Alajmi
2016-08-01
Full Text Available Based on the diffusion of innovation (DOI theory (Rogers, 2003, the uses and gratifications (U&G theory, and trust theory, this study investigated the factors that influence the use of Twitter among the Kuwaiti community. The study surveyed Twitter users in Kuwait. A structured online questionnaire was used to collect data, and 463 respondents who provided complete answers participated. Multiple regression analysis was used to examine the effect of three theoretical perspectives on Twitter usage. The result of the analysis showed that Twitter usage is better explained by DOI constructs than by U&G constructs. The findings indicated that the perceived relative advantage from DOI, and the need for information, need to pass time, and need for interpersonal utility from the U&G approach, have a direct positive significant effect on the use of Twitter. None of the trust theory constructs was found to be significant in predicting the general use of Twitter. The study results help Twitter providers and users in individual or organizational contexts to understand what factors generally affect the usage of the Twitter service.
Directory of Open Access Journals (Sweden)
Jorge Alberto Vieira Costa
2007-09-01
Full Text Available Amyloglucosidase (AMG and exo-polygalacturonase (exo-PG were simultaneously produced by two different strains of Aspergillus niger in solid-state fermentation (SSF using defatted rice-bran as substrate. The effect of Aspergillus niger strain (t0005/007-2 and/or CCT 3312, inoculum type (spore suspension or fermented bran and addition of inducers (pectin and/or starch to the culture media was studied using a 3² x 2¹ factorial experimental design. The production of AMG and exo-PG was significantly affected by fungal strain and inoculum type but inducers had no effect. The maximum yields obtained were 1310 U/g dm for AMG using a spore suspension of A. niger CCT 3312 and 50.2 U/g dm for exo-PG production, using A. niger t0005/007-2 and fermented bran as inoculum. The yields obtained represented acceptable values in comparison with data available in the literature and indicated that defatted rice-bran was a good nutrient source.As enzimas amiloglicosidase (AMG e exo-poligalacturonase (exo-PG foram produzidas simultaneamente por duas cepas de Aspergillus niger, através de fermentação em estado sólido usando farelo de arroz desengordurado como substrato. Foram avaliados os efeitos da cepa de Aspergillus niger, tipo de inóculo e adição de indutores no meio de cultura, utilizando-se um planejamento experimental fracionário 3² x 2¹. O máximo rendimento obtido foi 1310 U/g ms para a produção de AMG e 50,2 U/g ms para a exo-PG. Comparando-se estes resultados com dados da literatura pode-se dizer que os rendimentos obtidos foram aceitáveis e indicam que o farelo de arroz desengordurado é uma boa fonte de nutrientes. A produção de AMG e exo-PG foi significativamente afetada pelas variáveis cepa de A. niger e tipo de inóculo, enquanto a variável indutor não apresentou influência significativa na produção destas enzimas.
International Nuclear Information System (INIS)
Thomas, Asha B.; Nanda, Rabindra K.; Kothapalli, Lata P.; Deshpande, Avinash D.
2011-01-01
A series of isonicotinyl hydrazones and their 4-thiazolidinones have been synthesized by condensation of isonicotinic acid hydrazide with various aromatic aldehydes to yield Schiff's bases, followed by the cyclocondensation of Schiff's bases with 2-mercaptoacetic acid to yield their 4-thiazolidinones. The synthesized compounds have been characterized by their elemental, analytical and spectral studies. All these compounds were evaluated for their in vitro antimicrobial activity against a spectrum of non-resistant and resistant microbial organisms. These studies proved that compounds 5e,i against B. subtilis; 5e,f,h against B. anthracis; 5g,i against S. aureus showed good activity at lower concentrations. Compounds 5d-5i displayed significant activity against resistant strain of K. pneumonia with minimum inhibitory potency in the concentration range of 2-16 ug/ml
Potentiometric determination of trace amounts of volatile thiols in natural gas
International Nuclear Information System (INIS)
Farroha, S.M.; Habboush, A.E.; Kurthab, S.Y.
1986-01-01
A potentiometric titration method was developed for the determination of volatile thiols in natural gas. An apparatus was devised for the quantitative absorption of volatile thiols. The measurements were performed in an ethanolic ammonium buffer solution containing a known amount of silver nitrate as supporting electrolyte. The excess silver was precipitated by a known amount of potassium iodide. The excess of iodide was back titrated potentiometrically with a standard solution of silver nitrate. The direct titration of the excess silver ions with a standard solution of potassium iodide gave a poor accuracy compared with the back titration method. Iodide selective electrode was employed as an indicator electrode and a silver-silver chloride electrode as reference electrode. The accuracy and reproducibility of the method were established by preparing several synthetic samples in which ethanthiol containing from 346.61 to 12.11 μUg mercaptan sulfur was taken as standard nitrogen as carrier gas with an optimum flow rate of 31.5 L/hr. The results obtained expressed in the form of Grans plot showed an error ranging from 0.16 to 2.39% by weight and the relative standard deviation did not exceed 2.20%. The amount of mercaptan sulfur determined in Iraqi natural gas taken directly in a cylinder from Dora refinery, Baghdad, Iraq, and after six months of storage we 23.15 Ug/L and 21.25 Ug/L respectively with a relative standard deviation not exceeded 1%. The interferences of hydrogen sulfide could be eliminated by absorption in cadimium acetate containing solution. Other sulfur containing compounds e.g. disulfides, sulfoxides which may be present in natural gas do not interfere with the analysis
Subchronic effects of methylmercury on plasma and organ biochemistries in great egret nestlings
Hoffman, D.J.; Spalding, M.G.; Frederick, P.C.
2005-01-01
In recent years, high concentrations of mercury have been found in wading birds in Florida, USA. Great egret (Ardea alba) chicks (2 weeks old) were dosed orally daily with the equivalent of 0, 0.5, or 5 ug/g Hg as methylmercury chloride in the diet for up to 12 weeks. Weakness of the legs or paralysis occurred in all high-dosed birds. Geometric mean blood Hg concentrations were 0.17, 10.3, and 78.5 ug/g (wet wt), respectively. Mercury concentrations for organs (ug/g wet wt), including brain (0.22, 3.4, and 35, respectively), liver (0.34, 15.1, 138, respectively), and kidney (0.28, 8.1, and 120, respectively), increased in a dose-dependent manner. Total glutathione (GSH) peroxidase activity was significantly lower in the plasma, brain, liver, and kidney of the high-dosed group. Plasma aspartate aminotransferase activity increased with mercury treatment, whereas lactate dehydrogenase activity decreased. Four other plasma chemistries were decreased significantly in the high-dosed group and included uric acid, total protein, albumin, and inorganic phosphorus. Lipid peroxidation increased in liver (low and high dose) and brain (high dose). Tissue changes in concentrations of reduced thiols included decreased total thiols and protein-bound thiols in liver, decreased protein-bound thiols in kidney, and increased GSH in kidney and brain. Activities of GSH S-transferase and oxidized glutathione reductase increased in liver. In kidney, GSH S-transferase and glucose-6-phosphate dehydrogenase activities increased with mercury dose. These findings, including apparent compensatory changes, are compared to other Hg studies where oxidative stress was reported in egrets, herons, and diving ducks in the field and mallards in the laboratory.
Directory of Open Access Journals (Sweden)
Alvaro J. ldrovo
2001-06-01
Full Text Available La minería aurífera en la región de la Orinoquia colombiana ha tenido un importante crecimiento en los últimos 15 años. Esta actividad se ha convertido en un importante problema de salud pública debido a varios factores como el uso de mercurio durante el proceso de amalgamación del oro, la contaminación del ecosistema y la exposición de la población de la región. El objetivo del presente trabajo fue determinar los niveles de mercurio en cabello y sangre en una población minera del departamento del Guainía y la percepción que tiene dicha población del riesgo de usar este elemento. Para tal fin, se encuestaron 78 residentes de la región, de los cuales se obtuvieron 59 muestras de sangre y 61 de cabello. Los resultados indican un precario ambiente laboral y una falta de conocimiento del riesgo ecológico, lo cual permite la contaminación del ecosistema de la Orinoquia. Los individuos perciben la exposición al mercurio como nociva para la salud, aunque sus conocimientos al respecto son inadecuados. Los valores de mercurio en sangre entre los mineros oscilaron entre 6,9 y 168,0 ug/l (promedio=59,16 y entre los individuos indirectamente expuestos fluctuó entre 17,7 y 100,8 ug/l (promedio=53,5. Las concentraciones de mercurio total en cabello oscilaron entre 3,0 y 89,2 ug/g (promedio=26,93 en el grupo de mineros y entre 2,8 y 48,7 ug/g (promedio=22,86 entre los expuestos indirectamente. No se encontraron diferencias significativas en los niveles de mercurio entre los dos grupos estudiados. Se sugieren medidas preventivas y de control de la situación generada por el uso de mercurio en las labores de mineria aurífera de la región.
Unigene BLAST: CBRC-XTRO-01-0001 [SEVENS
Lifescience Database Archive (English)
Full Text Available or protein (peptidase nexin-2, Alzheimer disease), mRNA (cDNA clone MGC:88882 IMAGE:6998307), complete cds /cds=p(99,2351) /gb=BC075266 /gi=49522953 /ug=Str.67411 /len=3137 5e-07 41% ...
Lightner, Aaron D; Barclay, Pat; Hagen, Edward H
2017-12-01
Many studies have documented framing effects in economic games. These studies, however, have tended to use minimal framing cues (e.g. a single sentence labelling the frame), and the frames did not involve unambiguous offer expectations. Results often did not differ substantially from those in the unframed games. Here we test the hypothesis that, in contrast to the modal offer in the unframed ultimatum game (UG) (e.g. 60% to the proposer and 40% to the responder), offers in a UG explicitly framed either as a currency exchange or a windfall will closely conform to expectations for the frame and diverge substantially from the modal offer. Participants recruited from MTurk were randomized into one of two conditions. In the control condition, participants played a standard UG. In the treatment conditions, players were provided a vignette explicitly describing the frame with their roles: some were customers and bankers in a currency exchange, and others were in a windfall scenario. We predicted (i) that modal offers in the currency exchange would involve an asymmetric split where greater than 80% went to customers and less than 20% went to bankers, and (ii) that variation in windfall offers would converge onto a 50-50 split with significantly less variation than the control condition. Our first prediction was confirmed with substantial effect sizes ( d = 1.09 and d = -2.04), whereas we found no evidence for our second prediction. The first result provides further evidence that it is difficult to draw firm conclusions about economic decision-making from decontextualized games.
2011-02-01
KIRKWOOD FORMATION) (MANASQUAN FORMATION) (VINCENTOWN FORMATION) MONITORING WELL MONITORING WELL MONITORING WELL CHAIN LINK FENCE TREELINE INTERMITTENT...VINCENTOWN FORMATION) MONITORING WELL MONITORING WELL MONITORING WELL CHAIN LINK FENCE TREELINE INTERMITTENT STREAM INTERVAL (ug/L) LEGEND: MAG-201 LOOP 1
Gene : CBRC-MMUS-23-0035 [SEVENS
Lifescience Database Archive (English)
Full Text Available 152306 /ug=Mm.330279 /len=4633 3e-71 52% MIFSFLAIFHVKQWTYLNVLSFSVFLVIFHVIKCIFLIFRDSQVSRHISGHRVCISHFSRFSVILSF...FKSSCGCFSFSKIFSFLAIFHVLQWTFLNSPHISVFLAIFHIIKCVFLIFRDFQFSRHIPGPTLCISHFPCFSVIHYIFIGLQCVSHFPRFSVFLTYSGSYSVCVSFS...TFFSLPAIFQILQCAYLIFQVSLNVPRHIPISTVCVPHFQIFLVFLPYSYAFHIFDVFHFSPHILGPTVCVCLLYHIFHHSCNIPGPTECISHLSIFFSASCHM ...
Leaves of roadside plants as bioindicator of traffic related lead ...
African Journals Online (AJOL)
JUDITH
Plants are important bioindicators of heavy metal environmental pollution. ... is 421.43 ± 1 9.30 and 429.37 ± 14.49 ug g-1 respectively and lowest at the control site (rural site) 69.57 ± ... as primary sources of atmospheric metallic nuisance.
Leczenie skojarzone astmy wziewnymi glikokortykosteroidami i β2-agonistami
Directory of Open Access Journals (Sweden)
Iwona Grzelewska-Rzymowska
2009-09-01
Full Text Available Dokonany w tym artykule przegląd badań ocenia dowody dotyczące leczenia astmy kombinacją wziewnych glikokortykosteroidów (wGKS i długo działających β2-agonistów (LAβA. Za leki pierwszego wyboru w astmie uznaje się wGKS. Integralną częścią leczenia astmy są β2-agoniści, najsilniejsze leki rozszerzające oskrzela. Obecnie dostępne są dwa leki z grupy długo działających β2-agonistów – formoterol i salmeterol. W kilku badaniach klinicznych udowodniono, że kombinacja wGKS i LAβA stanowi skuteczną i bezpieczną opcję w leczeniu astmy. Raporty GINA zalecają dodanie LAβA do małych i średnich dawek wGKS, co pozwala na uzyskanie kontroli astmy. Także z badań klinicznych uzyskaliśmy wiedzę, że kombinacja wGKS i LAβA daje większe korzyści w kontroli objawów astmy niż dwukrotnie większa dawka wGKS. Astma jest przewlekłą chorobą zapalną z rozwojem nadreaktywności oskrzeli. Przebieg kliniczny astmy jest zazwyczaj inny u różnych chorych, a nawet u tej samej osoby. W praktyce klinicznej choremu zaleca się podawanie stałych dawek wGKS, odpowiednich do stopnia ciężkości astmy, lub kombinacji wGKS i LAβA dwa razy dziennie i dodatkowo krótko działającego β2-agonisty „według potrzeby” (lub „na żądanie” dla złagodzenia objawów astmy. Ostatnio wprowadzono nowy model stosowania kombinacji wGKS i LAβA (budezonid/formoterol – tzw. SMART (Single Maintenance and Reliever Therapy. Jest to połączenie leków według koncepcji SMART stosowane zarówno w leczeniu przewlekłym dwa razy dziennie, jak i „według potrzeby” dla złagodzenia objawów bez dodatkowego stosowania leków tylko przynoszących ulgę. Badania kliniczne wykazały, że metoda SMART zmniejsza ryzyko ostrych zaostrzeń i jest dobrze tolerowana. Metoda ta ma korzystne działanie u pacjentów, u których utrzymują się objawy astmy pomimo leczenia kombinacją leków stosowanych tylko w leczeniu przewlekłym.
Zhang, Damao; Wang, Zhien; Luo, Tao; Yin, Yan; Flynn, Connor
2017-03-01
Ice particle formation in slightly supercooled stratiform clouds is not well documented or understood. In this study, 4 years of combined lidar depolarization and radar reflectivity (Ze) measurements are analyzed to distinguish between cold drizzle and ice crystal formations in slightly supercooled Arctic stratiform clouds over the Atmospheric Radiation Measurement Program Climate Research Facility North Slope of Alaska Utqiaġvik ("Barrow") site. Ice particles are detected and statistically shown to be responsible for the strong precipitation in slightly supercooled Arctic stratiform clouds at cloud top temperatures as high as -4°C. For ice precipitating Arctic stratiform clouds, the lidar particulate linear depolarization ratio (δpar_lin) correlates well with radar Ze at each temperature range, but the δpar_lin-Ze relationship varies with temperature ranges. In addition, lidar depolarization and radar Ze observations of ice generation characteristics in Arctic stratiform clouds are consistent with laboratory-measured temperature-dependent ice growth habits.
Isolation and characterization of a PUF-domain of pumilio gene from ...
African Journals Online (AJOL)
STORAGESEVER
2009-03-20
Mar 20, 2009 ... study, a partial pumilio gene with complete PUF-domain in Bombyx mori has been ... Key words: Bombyx mori, pumilio, PUF-domain, RACE, germline stem cell. .... The first-strand cDNA was synthesized from 2 ug of total. RNA.