WorldWideScience

Sample records for ug pgr pgt

  1. Analysis list: PGR [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available PGR Breast,Muscle,Uterus + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/PGR.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/PGR.5.tsv http://dbarchive.biosciencedb...c.jp/kyushu-u/hg19/target/PGR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/PGR.Breast.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/PGR.Muscle.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/PGR.Uterus.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Bre

  2. Genomic analysis of a novel gene conferring resistance to Ug99 stem rust in Triticum turgidum ssp. dicoccum

    Science.gov (United States)

    Wheat production is threatened by the disease stem rust, which is caused by the biotrophic fungal pathogen Puccinia graminis Pers.:Pers. f. sp. tritici (Pgt). Among all known Pgt races, TTKSK (Ug99) and TRTTF are significant threats to North American wheat production due to their virulence against f...

  3. Identification and characterization of Sr13, a tetraploid wheat gene that confers resistance to the Ug99 stem rust race group

    Science.gov (United States)

    The Puccinia graminis f. sp. tritici (Pgt) Ug99 race group is virulent to most stem rust resistance genes currently deployed in wheat and poses a serious threat to global wheat production. The durum wheat (Triticum turgidum ssp. durum) gene Sr13 confers resistance to Ug99 in addition to virulent rac...

  4. PGT: A Statistical Approach to Prediction and Mechanism Design

    Science.gov (United States)

    Wolpert, David H.; Bono, James W.

    One of the biggest challenges facing behavioral economics is the lack of a single theoretical framework that is capable of directly utilizing all types of behavioral data. One of the biggest challenges of game theory is the lack of a framework for making predictions and designing markets in a manner that is consistent with the axioms of decision theory. An approach in which solution concepts are distribution-valued rather than set-valued (i.e. equilibrium theory) has both capabilities. We call this approach Predictive Game Theory (or PGT). This paper outlines a general Bayesian approach to PGT. It also presents one simple example to illustrate the way in which this approach differs from equilibrium approaches in both prediction and mechanism design settings.

  5. Therapeutic Efficacy of Vectored PGT121 Gene Delivery in HIV-1-Infected Humanized Mice.

    Science.gov (United States)

    Badamchi-Zadeh, Alexander; Tartaglia, Lawrence J; Abbink, Peter; Bricault, Christine A; Liu, Po-Ting; Boyd, Michael; Kirilova, Marinela; Mercado, Noe B; Nanayakkara, Ovini S; Vrbanac, Vladimir D; Tager, Andrew M; Larocca, Rafael A; Seaman, Michael S; Barouch, Dan H

    2018-04-01

    Broadly neutralizing antibodies (bNAbs) are being explored for HIV-1 prevention and cure strategies. However, administration of purified bNAbs poses challenges in resource-poor settings, where the HIV-1 disease burden is greatest. In vivo vector-based production of bNAbs represents an alternative strategy. We investigated adenovirus serotype 5 (Ad5) and adeno-associated virus serotype 1 (AAV1) vectors to deliver the HIV-1-specific bNAb PGT121 in wild-type and immunocompromised C57BL/6 mice as well as in HIV-1-infected bone marrow-liver-thymus (BLT) humanized mice. Ad5.PGT121 and AAV1.PGT121 produced functional antibody in vivo Ad5.PGT121 produced PGT121 rapidly within 6 h, whereas AAV1.PGT121 produced detectable PGT121 in serum by 72 h. Serum PGT121 levels were rapidly reduced by the generation of anti-PGT121 antibodies in immunocompetent mice but were durably maintained in immunocompromised mice. In HIV-1-infected BLT humanized mice, Ad5.PGT121 resulted in a greater reduction of viral loads than did AAV1.PGT121. Ad5.PGT121 also led to more-sustained virologic control than purified PGT121 IgG. Ad5.PGT121 afforded more rapid, robust, and durable antiviral efficacy than AAV1.PGT121 and purified PGT121 IgG in HIV-1-infected humanized mice. Further evaluation of vector delivery of HIV-1 bNAbs is warranted, although approaches to prevent the generation of antiantibody responses may also be required. IMPORTANCE Broadly neutralizing antibodies (bNAbs) are being explored for HIV-1 prevention and cure strategies, but delivery of purified antibodies may prove challenging. We investigated adenovirus serotype 5 (Ad5) and adeno-associated virus serotype 1 (AAV1) vectors to deliver the HIV-1-specific bNAb PGT121. Ad5.PGT121 afforded more rapid, robust, and durable antiviral efficacy than AAV1.PGT121 and purified PGT121 IgG in HIV-1-infected humanized mice. Copyright © 2018 Badamchi-Zadeh et al.

  6. Nuclear Progestin Receptor (Pgr Knockouts in Zebrafish Demonstrate Role for Pgr in Ovulation But Not in Rapid Nongenomic Steroid Mediated Meiosis Resumption

    Directory of Open Access Journals (Sweden)

    Yong eZhu

    2015-03-01

    Full Text Available Progestins, progesterone derivatives, are the most critical signaling steroid for initiating final oocyte maturation (FOM and ovulation, in order to advance fully-grown immature oocytes to become fertilizable eggs in basal vertebrates. It is well-established that progestin induces FOM via an elusive membrane receptor and a nongenomic steroid signaling process, which precedes progestin triggered ovulation that is mediated through a nuclear progestin receptor (Pgr and genomic signaling pathway. To determine whether Pgr plays a role in a nongenomic signaling mechanism during FOM, we knocked out Pgr in zebrafish using transcription activator-like effector nucleases (TALENs and studied the oocyte maturation phenotypes of Pgr knockouts (Pgr-KOs. Three TALENs-induced mutant lines with different frame shift mutations were generated. Homozygous Pgr-KO female fish were all infertile while no fertility effects were evident in homozygous Pgr-KO males. Oocytes developed and underwent FOM normally in vivo in homozygous Pgr-KO female compared to the wildtype controls, but these mature oocytes were trapped within the follicular cells and failed to ovulate from the ovaries. These oocytes also underwent normal germinal vesicle breakdown (GVBD and FOM in vitro, but failed to ovulate even after treatment with human chronic gonadotropin (HCG or progestin (17alpha,20beta-dihydroxyprogesterone or DHP, which typically induce FOM and ovulation in wildtype oocytes. The results indicate that anovulation and infertility in homozygous Pgr-KO female fish was, at least in part, due to a lack of functional Pgr-mediated genomic progestin signaling in the follicular cells adjacent to the oocytes. Our study of Pgr-KO supports previous results that demonstrate a role for Pgr in steroid-dependent genomic signaling pathways leading to ovulation, and the first convincing evidence that Pgr is not essential for initiating nongenomic progestin signaling and triggering meiosis resumption.

  7. Mapping resistance to the Ug99 race group of the stem rust pathogen in a spring wheat landrace.

    Science.gov (United States)

    Babiker, E M; Gordon, T C; Chao, S; Newcomb, M; Rouse, M N; Jin, Y; Wanyera, R; Acevedo, M; Brown-Guedira, G; Williamson, S; Bonman, J M

    2015-04-01

    A new gene for Ug99 resistance from wheat landrace PI 374670 was detected on the long arm of chromosome 7A. Wheat landrace PI 374670 has seedling and field resistance to stem rust caused by Puccinia graminis f. sp tritici Eriks. & E. Henn (Pgt) race TTKSK. To elucidate the inheritance of resistance, 216 BC1F2 families, 192 double haploid (DH) lines, and 185 recombinant inbred lines (RILs) were developed by crossing PI 374670 and the susceptible line LMPG-6. The parents and progeny were evaluated for seedling resistance to Pgt races TTKSK, MCCFC, and TPMKC. The DH lines were tested in field stem rust nurseries in Kenya and Ethiopia. The DH lines were genotyped with the 90K wheat iSelect SNP genotyping platform. Goodness-of-fit tests indicated that a single dominant gene in PI 374670 conditioned seedling resistance to the three Pgt races. The seedling resistance locus mapped to the long arm of chromosome 7A and this result was verified in the RIL population screened with the flanking SNP markers using KASP assays. In the same region, a major QTL for field resistance was detected in a 7.7 cM interval and explained 34-54 and 29-36% of the variation in Kenya and Ethiopia, respectively. Results from tests with specific Pgt races and the csIH81 marker showed that the resistance was not due to Sr22. Thus, a new stem rust resistance gene or allele, either closely linked or allelic to Sr15, is responsible for the seedling and field resistance of PI 374670 to Ug99.

  8. Knockdown of Progesterone Receptor (PGR) in Macaque Granulosa Cells Disrupts Ovulation and Progesterone Production.

    Science.gov (United States)

    Bishop, Cecily V; Hennebold, Jon D; Kahl, Christoph A; Stouffer, Richard L

    2016-05-01

    Adenoviral vectors (vectors) expressing short-hairpin RNAs complementary to macaque nuclear progesterone (P) receptor PGR mRNA (shPGR) or a nontargeting scrambled control (shScram) were used to determine the role PGR plays in ovulation/luteinization in rhesus monkeys. Nonluteinized granulosa cells collected from monkeys (n = 4) undergoing controlled ovarian stimulation protocols were exposed to either shPGR, shScram, or no virus for 24 h; human chorionic gonadotropin (hCG) was then added to half of the wells to induce luteinization (luteinized granulosa cells [LGCs]; n = 4-6 wells/treatment/monkey). Cells/media were collected 48, 72, and 120 h postvector for evaluation of PGR mRNA and P levels. Addition of hCG increased (P < 0.05) PGR mRNA and medium P levels in controls. However, a time-dependent decline (P < 0.05) in PGR mRNA and P occurred in shPGR vector groups. Injection of shPGR, but not shScram, vector into the preovulatory follicle 20 h before hCG administration during controlled ovulation protocols prevented follicle rupture in five of six monkeys as determined by laparoscopic evaluation, with a trapped oocyte confirmed in three of four follicles of excised ovaries. Injection of shPGR also prevented the rise in serum P levels following the hCG bolus compared to shScram (P < 0.05). Nuclear PGR immunostaining was undetectable in granulosa cells from shPGR-injected follicles, compared to intense staining in shScram controls. Thus, the nuclear PGR appears to mediate P action in the dominant follicle promoting ovulation in primates. In vitro and in vivo effects of PGR knockdown in LGCs also support the hypothesis that P enhances its own synthesis in the primate corpus luteum by promoting luteinization. © 2016 by the Society for the Study of Reproduction, Inc.

  9. [Receptor status (ER and PgR) determined with histochemical and biochemical methods in breast carcinoma].

    Science.gov (United States)

    Simone, G; Paradiso, A; Cirillo, R; Mangia, A; Rella, G; Wiesel, S; Petroni, S; De Benedictis, G; De Lena, M

    1991-01-01

    Recently, a method similar to ER.ICA has been proposed for the progesterone receptor (PgR) using two monoclonal antibodies, JZB39 and KD68, specific for human PgR and characterized by a molecular weight of 95 and 120 Kd, respectively. A series of 73 breast cancer patients was studied with regards to ER and PgR using both immunocytochemical (ICA) and biochemical (DCC) assays. Results showed no substantial differences between the two methods when considering common clinical-pathological parameters. Overall agreement between ICA and DCC methods was found: 79% for PgR and 78% for ER. A slight quantitative correlation was also observed between the "score values" of the ICA method and the Fmol content of ER and PgR using the Brave-Pearson test (r = 0.49 for PgR; r = 0.43 for ER). Specificity of PgR.ICA method was 77% for PgR and 72% for ER; sensitivity was 82% and 83%, respectively. The ICA method is a reliable technique to assess PgR presence as well as ER. Further studies are necessary to evaluate the prognostic role of nuclear PgR.

  10. Somatic populations of PGT135-137 HIV-1-neutralizing antibodies identified by 454 pyrosequencing and bioinformatics

    Directory of Open Access Journals (Sweden)

    Jiang eZhu

    2012-09-01

    Full Text Available Select HIV-1-infected individuals develop sera capable of neutralizing diverse viral strains. The molecular basis of this neutralization is currently being deciphered by the isolation of HIV-1-neutralizing antibodies. In one infected donor, three neutralizing antibodies, PGT135-137, were identified by assessment of neutralization from individually sorted B cells and found to recognize an epitope containing an N-linked glycan at residue 332 on HIV-1 gp120. Here we use deep sequencing and bioinformatics methods to interrogate the B cell record of this donor to gain a more complete understanding of the humoral immune response. PGT135-137-gene family-specific primers were used to amplify heavy and light chain-variable domain sequences. 454 pyrosequencing produced 141,298 heavy-chain sequences of IGHV4-39 origin and 87,229 light-chain sequences of IGKV3-15 origin. A number of heavy and light chain sequences of ~90% identity to PGT137, several to PGT136, and none of high identity to PGT135 were identified. After expansion of these sequences to include close phylogenetic relatives, a total of 202 heavy-chain sequences and 72 light-chain sequences were identified. These sequences were clustered into populations of 95% identity comprising 15 for heavy chain and 10 for light chain, and a select sequence from each population was synthesized and reconstituted with a PGT137-partner chain. Reconstituted antibodies showed varied neutralization phenotypes for HIV-1 clade A and D isolates. Sequence diversity of the antibody population represented by these tested sequences was notably higher than observed with a 454 pyrosequencing-control analysis on 10 antibodies of defined sequence, suggesting that this diversity results primarily from somatic maturation. Our results thus provide an example of how pathogens like HIV-1 are opposed by a varied humoral immune response, derived from intrinsic mechanisms of antibody development, and embodied by somatic populations

  11. Deletion of Proton Gradient Regulation 5 (PGR5) and PGR5-Like 1 (PGRL1) proteins promote sustainable light-driven hydrogen production in Chlamydomonas reinhardtii due to increased PSII activity under sulfur deprivation.

    Science.gov (United States)

    Steinbeck, Janina; Nikolova, Denitsa; Weingarten, Robert; Johnson, Xenie; Richaud, Pierre; Peltier, Gilles; Hermann, Marita; Magneschi, Leonardo; Hippler, Michael

    2015-01-01

    Continuous hydrogen photo-production under sulfur deprivation was studied in the Chlamydomonas reinhardtii pgr5 pgrl1 double mutant and respective single mutants. Under medium light conditions, the pgr5 exhibited the highest performance and produced about eight times more hydrogen than the wild type, making pgr5 one of the most efficient hydrogen producer reported so far. The pgr5 pgrl1 double mutant showed an increased hydrogen burst at the beginning of sulfur deprivation under high light conditions, but in this case the overall amount of hydrogen produced by pgr5 pgrl1 as well as pgr5 was diminished due to photo-inhibition and increased degradation of PSI. In contrast, the pgrl1 was effective in hydrogen production in both high and low light. Blocking photosynthetic electron transfer by DCMU stopped hydrogen production almost completely in the mutant strains, indicating that the main pathway of electrons toward enhanced hydrogen production is via linear electron transport. Indeed, PSII remained more active and stable in the pgr mutant strains as compared to the wild type. Since transition to anaerobiosis was faster and could be maintained due to an increased oxygen consumption capacity, this likely preserves PSII from photo-oxidative damage in the pgr mutants. Hence, we conclude that increased hydrogen production under sulfur deprivation in the pgr5 and pgrl1 mutants is caused by an increased stability of PSII permitting sustainable light-driven hydrogen production in Chlamydomonas reinhardtii.

  12. 46 CFR 54.01-35 - Corrosion (modifies UG- 25).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Corrosion (modifies UG- 25). 54.01-35 Section 54.01-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING PRESSURE VESSELS General Requirements § 54.01-35 Corrosion (modifies UG- 25). (a) Vessels or portions of vessels subject to...

  13. Somatic recombination in wheat stem rust leads to virulence for Ug99-effective SR50 resistance

    Science.gov (United States)

    Race-specific resistance genes protect much of the global wheat crop from stem rust disease caused by Puccinia graminis f. sp. tritici (Pgt), but often break down due to evolution of new virulent pathogen races. To understand the molecular mechanisms of virulence evolution in Pgt we identified the p...

  14. Triple-negative (ER, PgR, HER-2/neu breast cancer in Indian women

    Directory of Open Access Journals (Sweden)

    Vinayak W Patil

    2011-03-01

    Full Text Available Vinayak W Patil1, Rajeev Singhai1, Amit V Patil2, Prakash D Gurav21Department of Biochemistry, Grant Medical College and Sir JJ Group of Hospitals, Mumbai, India; 2Department of Surgery, Government Medical College, Miraj, IndiaAbstract: The aim of our study was to analyze triple-negative (TN breast cancer, which is defined as being negative for the estrogen receptor (ER, the progesterone receptor (PgR, and the human epidermal growth factor receptor 2 (HER-2/neu and which represents a subset of breast cancer with different biologic behavior. We investigated the clinicopathological characteristics and prognostic indicators of lymph node-negative TN breast cancer. Medical records were reviewed from patients with node-negative breast cancer who underwent curative surgery at Grant Medical College and Sir JJ Group of Hospitals, Mumbai, India, from May 2007 to October 2010. Clinicopathological variables and clinical outcomes were evaluated. Among 683 patients included, 136 had TN breast cancer and 529 had non-TN breast cancer. TN breast cancer correlated with younger age (<35 years, P = 0.003 and a higher histopathologic and nuclear grade (P < 0.001. It also correlated with a molecular profile associated with biological aggressiveness: negative for Bcl-2 expression (P < 0.001, positive for the epidermal growth factor receptor (P = 0.003, and a high level of p53 (P < 0.001 and Ki-67 expression (P < 0.00. The relapse rates during the follow-up period (median 56.8 months were 14.7% for TN breast cancer and 6.6% for non-TN breast cancer (P = 0.004. Relapse-free survival (RFS was significantly shorter among patients with TN breast cancer compared with those with non-TN breast cancer: 3.5-year RFS rate 85.5% versus 94.2%, respectively; P = 0.001. On multivariate analysis, young age, close resection margin, and triple negativity were independent predictors of shorter RFS. TN breast cancer had a higher relapse rate and more aggressive clinicopathological

  15. Challenges to and proposals for underground gas storage (UGS business in China

    Directory of Open Access Journals (Sweden)

    Gangxiong Zhang

    2017-05-01

    Full Text Available Underground gas storage (UGS is one of the major storage and peak-shaving means in the world among numerous storage ways via gas fields, small-scale LNG, etc. With the rapid development of natural gas industry in China, the seasonal peak-shaving issues are increasingly prominent, so how to achieve sustainable development of UGS business has become a major problem at present. In view of this, we studied the present status and trend of UGS development abroad and analyzed the following challenges encountered by UGS in China. (1 UGS construction falls behind the world and peak-shaving capacity is insufficient. (2 There is lack of quality gas sources for storage and the complicated geological conditions make the cost of UGS construction high. (3 UGS construction is still at the preliminary stage, so experience is not enough in safety and scientific operation and management. (4 UGS construction, management and operation are not unified as a whole, so its maximum efficiency fails to be exerted. (5 The economic benefit of UGS is difficult to be shown without independent cost accounting. Based on the experience of other countries, some proposals were put forward on UGS development under the actual present situation: to strengthen strategic UGS layout, intensify storage site screening in key areas and steadily promote UGS construction; to establish professional UGS technical and management teams and intensify the research of key technologies; and to set up a complete and rationally-distributed UGS construction, operation and management system.

  16. U-Pb ages for PGR dykes, KFP, and adjacent older leucosomic PGRs from ONKALO underground research facility, Olkiluoto, Eurajoki, SW Finland

    International Nuclear Information System (INIS)

    Maenttaeri, I.; Engstroem, J.; Lahaye, Y.; Pere, T.

    2010-06-01

    Zircon LA-MC-ICP-MS and monazite TIMS ages have been determined for three PGR dykes (A2018, A2020, and A2070) and a KFP (A2022) from the ONKALO underground research facility, Olkiluoto, Eurajoki, SW Finland. For purposes of comparison, leucosomic PGRs (A2019, A2021, and A2023) crosscut by the PGR dykes and the KFP were also dated. Minimum ages for the PGR dykes and the A2022 KFP were determined by the monazite U-Pb ages. PGR dykes reveal partially overlapping ages of 1826 ± 7 Ma (A2018), 1811 ± 5 Ma (A2020), and 1817 ± 3 Ma (A2070). Monazite age of 1808 ± 6 Ma for the KFP is coeval with the youngest PGR dyke monazite. The ∼1.81-1.80 Ga ages for the supposed PGR dyke zircon agree within the error limits with the monazite ages. For the KFP, obvious co-magmatic zircon was not identified. The metamorphic zircon rims and domains found from the PGR dykes reveal multiphase overprinting, the ages ranging from 1.86 Ga to 1.80 Ga. Subsequently, the high-U PGR dyke zircon suffered major lead loss during the Rapakivi event at 1.58 Ga and finally, a few grains show early Devonian age of ∼400 Ma. In the KFP, many structurally homogeneous zircon domains and rims plot on a ∼1.80 Ga discordia line, while the concordant data are ∼1.83 Ga. Leucosomic PGRs A2019 and A2021 crosscut by the PGR dykes enclose 1.87-1.85 Ga zircon resembling and being contemporaneous with the tonalite zircon in the Olkiluoto area. The concordia ages of 1836 ± 13 Ma (A2019) and 1807 ± 11 Ma (A2021) for the metamorphic zircon domains in the leucosomes correlate perfectly with the supposed ages of the crosscutting PGR dykes. The youngest metamorphic zircon phases in leucosome A2023 are dated at 1.82-1.80 Ga. That is in good accordance with the monazite age 1808 ± 6 Ma from the KFP A2022 crosscutting the leucosome A2023. The samples contain also abundant older inherited zircon cores and grains. Archaean ages vary from 3.1 Ga to 2.7 Ga and the older Palaeoproterozoic between 2.1 Ga and 1.9 Ga. The

  17. ASDEX-UG. ASDEX upgrade project proposal. Phase 2

    International Nuclear Information System (INIS)

    1983-05-01

    The objective of ASDEX UG is to investigate the problems relating to tokamak divertor physics and the boundary layer of hot plasmas which cannot be covered otherwise by either ASDEX or other EUROPEAN tokamaks, including JET, but whose investigation is indispensable for NET and INTOR. The configuration of ASDEX UG is changed as compared with ASDEX due to the requirement that all poloidal field coils are located outside the toroidal field magnet. This leads to a highly elongated D-shaped plasma with an ''open'' divertor, which does not allow to close the divertor chamber by such simple means as in ASDEX. In section 2, the aims of ASDEX UG are repeated briefly and the essential features and parameters of the tokamak system are summarized. The summary includes an overview of the tokamak design, the time schedule of design and construction concluding with the estimated investment cost and manpower required. In section 3 the tokamak system components are treated. The circuits and energy supply for the different electrical components are described in section 4. Auxiliary heating requirements and methods are discussed in section 5. Section 6 presents a survey over the periphery of the tokamak system including preparation of the building and radiation shielding. Section 7 outlines the physical programme. Section 8 is devoted to diagnostics. Finally, the principal concepts for control, data acquisition and handling are outlined in section 9. (orig./AH)

  18. Changes in the ER, PgR, HER2, p53 and Ki-67 biological markers between primary and recurrent breast cancer: discordance rates and prognosis

    Directory of Open Access Journals (Sweden)

    Tashima Rumiko

    2011-10-01

    Full Text Available Abstract Background In breast cancer, ER/PgR, HER2, and Ki-67 are important biological markers for predicting prognosis and making effective treatment decisions. In addition, changes in markers due to relapse are also clinically experienced; however, the frequency and clinical significance are still not fully understood. Thus, changes in markers and their correlations with prognosis were investigated. Patients and Methods Out of the patients with relapse from 1997 to March 2011, there were 97 consecutive patients from whom the lesion was resected and evaluated by immunostaining. The biopsy sites were chest wall, lymph node, ipsilateral breast tumor recurrence, lungs, bones, ovaries and brain. The markers sought were ER, PgR, HER2, p53 and Ki-67. Results The hormone receptor positive rate from the primary tumor to recurrence decreased from 63.9% to 57.7% and from 56.7% to 43.3% for ER and PgR, respectively. Changes in the positive/negative evaluation were seen at the rate of 10.3% and 25.8% for ER and PgR, respectively. The Ki-67 index increased significantly from a mean of 29.1% at primary tumor to 36.3% at relapse. When divided into 2 groups ( Conclusion Estrogen receptor and PgR decreased while Ki-67 increased due to relapse; however, the rate of change was high for PgR and Ki-67. Change in the subtypes was seen in 25%. In addition, PgR at relapse and Ki-67 at primary tumor were significant factors for post-relapse prognosis while PgR becoming negative was a poor prognostic factor. These findings are important for making effective treatment decisions.

  19. Cascading electron and hole transfer dynamics in a CdS/CdTe core-shell sensitized with bromo-pyrogallol red (Br-PGR): slow charge recombination in type II regime.

    Science.gov (United States)

    Maity, Partha; Debnath, Tushar; Chopra, Uday; Ghosh, Hirendra Nath

    2015-02-14

    Ultrafast cascading hole and electron transfer dynamics have been demonstrated in a CdS/CdTe type II core-shell sensitized with Br-PGR using transient absorption spectroscopy and the charge recombination dynamics have been compared with those of CdS/Br-PGR composite materials. Steady state optical absorption studies suggest that Br-PGR forms strong charge transfer (CT) complexes with both the CdS QD and CdS/CdTe core-shell. Hole transfer from the photo-excited QD and QD core-shell to Br-PGR was confirmed by both steady state and time-resolved emission spectroscopy. Charge separation was also confirmed by detecting electrons in the conduction band of the QD and the cation radical of Br-PGR as measured from femtosecond transient absorption spectroscopy. Charge separation in the CdS/Br-PGR composite materials was found to take place in three different pathways, by transferring the photo-excited hole of CdS to Br-PGR, electron injection from the photo-excited Br-PGR to the CdS QD, and direct electron transfer from the HOMO of Br-PGR to the conduction band of the CdS QD. However, in the CdS/CdTe/Br-PGR system hole transfer from the photo-excited CdS to Br-PGR and electron injection from the photo-excited Br-PGR to CdS take place after cascading through the CdTe shell QD. Charge separation also takes place via direct electron transfer from the Br-PGR HOMO to the conduction band of CdS/CdTe. Charge recombination (CR) dynamics between the electron in the conduction band of the CdS QD and the Br-PGR cation radical were determined by monitoring the bleach recovery kinetics. The CR dynamics were found to be much slower in the CdS/CdTe/Br-PGR system than in the CdS/Br-PGR system. The formation of the strong CT complex and the separation of charges cascading through the CdTe shell help to slow down charge recombination in the type II regime.

  20. Noble magnetic barriers in the ASDEX UG tokamak

    Science.gov (United States)

    Ali, Halima; Punjabi, Alkesh; Vazquez, Justin

    2010-02-01

    The second-order perturbation method of creating invariant tori inside chaos in Hamiltonian systems (Ali, H.; Punjabi, A. Plasma Phys. Contr. F. 2007, 49, 1565-1582) is applied to the axially symmetric divertor experiment upgrade (ASDEX UG) tokamak to build noble irrational magnetic barriers inside chaos created by resonant magnetic perturbations (m, n)=(3, 2)+(4, 3), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation. The radial dependence of the Fourier modes is ignored. The modes are considered to be locked and have the same amplitude δ. A symplectic mathematical mapping in magnetic coordinates is used to integrate magnetic field line trajectories in the ASDEX UG. Tori with noble irrational rotational transform are the last ones to be destroyed by perturbation in Hamiltonian systems. For this reason, noble irrational magnetic barriers are built inside chaos, and the strongest noble irrational barrier is identified. Three candidate locations for the strongest noble barrier in ASDEX UG are selected. All three candidate locations are chosen to be roughly midway between the resonant rational surfaces ψ32 and ψ43. ψ is the magnetic coordinate of the flux surface. The three candidate surfaces are the noble irrational surfaces close to the surface with q value that is a mediant of q=3/2 and 4/3, q value of the physical midpoint of the two resonant surfaces, and the q value of the surface where the islands of the two perturbing modes just overlap. These q values of the candidate surfaces are denoted by q MED, q MID, and q OVERLAP. The strongest noble barrier close to q MED has the continued fraction representation (CFR) [1;2,2,1∞] and exists for δ≤2.6599×10-4; the strongest noble barrier close to q MID has CFR [1;2,2,2,1∞] and exists for δ≤4.6311×10-4; and the strongest noble barrier close to q OVERLAP has CFR [1;2,2,6,2,1∞] and exists for δ≤1.367770×10-4. From these results, the strongest

  1. Applications of Universal Grammar (UG) in the ESL/EFL Classroom

    Science.gov (United States)

    Kirkwold, Lorne O.

    2007-01-01

    The article proposes Stern's (1983) framework for classifying issues related to instruction in order to ascertain the relevance of Universal Grammar (UG) in the ESL/EFL classroom. Discussed in this article, particularly as UG pertains to them, are issues related to: (a) L1 transfer; (b) teaching rules and giving error correction versus presenting…

  2. Analytical Review of Universal Grammar (UG) Approach on Second Language Acquisition (SLA)

    Science.gov (United States)

    Irwandy

    2015-01-01

    The aim of this paper is to explore the analysis of Universal Grammar (UG) approach on Second Language Acquisition (SLA). This paper is significant as the sources for teacher or researcher of the second language since this elaboration is deeply focusing on the use of UG on SLA. The method used in this academic writing is inductive method of…

  3. 46 CFR 54.10-10 - Standard hydrostatic test (modifies UG-99).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Standard hydrostatic test (modifies UG-99). 54.10-10... PRESSURE VESSELS Inspection, Reports, and Stamping § 54.10-10 Standard hydrostatic test (modifies UG-99). (a) All pressure vessels shall satisfactorily pass the hydrostatic test prescribed by this section...

  4. Predictive value and clinical utility of centrally assessed ER, PgR, and Ki-67 to select adjuvant endocrine therapy for premenopausal women with hormone receptor-positive, HER2-negative early breast cancer: TEXT and SOFT trials.

    Science.gov (United States)

    Regan, Meredith M; Pagani, Olivia; Francis, Prudence A; Fleming, Gini F; Walley, Barbara A; Kammler, Roswitha; Dell'Orto, Patrizia; Russo, Leila; Szőke, János; Doimi, Franco; Villani, Laura; Pizzolitto, Stefano; Öhlschlegel, Christian; Sessa, Fausto; Peg Cámara, Vicente; Rodríguez Peralto, José Luis; MacGrogan, Gaëtan; Colleoni, Marco; Goldhirsch, Aron; Price, Karen N; Coates, Alan S; Gelber, Richard D; Viale, Giuseppe

    2015-11-01

    The SOFT and TEXT randomized phase III trials investigated adjuvant endocrine therapies for premenopausal women with hormone receptor-positive (HR+) early breast cancer. We investigated the prognostic and predictive value of centrally assessed levels of estrogen receptor (ER), progesterone receptor (PgR), and Ki-67 expression in women with HER2-negative disease. Of 5707 women enrolled, 4115 with HER2-negative (HR+/HER2-) disease had ER, PgR, and Ki-67 centrally assessed by immunohistochemistry. Breast cancer-free interval (BCFI) was defined from randomization to first invasive local, regional, or distant recurrence or contralateral breast cancer. The prognostic and predictive values of ER, PgR and Ki-67 expression levels were assessed using Cox modeling and STEPP methodology. In this HR+/HER2- population, the median ER, PgR, and Ki-67 expressions were 95, 90, and 18 % immunostained cells. As most patients had strongly ER-positive tumors, the predictive value of ER levels could not be investigated. Lower PgR and higher Ki-67 expression were associated with reduced BCFI. There was no consistent evidence of heterogeneity of the relative treatment effects according to PgR or Ki-67 expression levels, though there was a greater 5-year absolute benefit of exemestane + ovarian function suppression (OFS) versus tamoxifen with or without OFS at lower levels of PgR and higher levels of Ki-67. Women with poor prognostic features of low PgR and/or high Ki-67 have greater absolute benefit from exemestane + OFS versus tamoxifen + OFS or tamoxifen alone, but individually PgR and Ki-67 are of limited predictive value for selecting adjuvant endocrine therapy for premenopausal women with HR+/HER2- early breast cancer.

  5. Evaluating The Effect of Melatonin on HAS2, and PGR expression, as well as Cumulus Expansion, and Fertility Potential in Mice.

    Science.gov (United States)

    Ezzati, Maryam; Roshangar, Leila; Soleimani Rad, Jafar; Karimian, Nahid

    2018-04-01

    Infertility is a worldwide health problem which affects approximately 15% of sexually active couples. One of the factors influencing the fertility is melatonin. Also, protection of oocytes and embryos from oxidative stress inducing chemicals in the culture medium is important. The aim of the present study was to investigate if melatonin could regulate hyaluronan synthase-2 (HAS2) and Progesterone receptor (PGR) expressions in the cumulus cells of mice oocytes and provide an in vitro fertilization (IVF) approach. In this experimental study, for this purpose, 30 adult female mice and 15 adult male mice were used. The female mice were superovulated using 10 U of pregnant mare serum gonadotropin (PMSG) and 24 hours later, 10 U of human chorionic gonadotropin (hCG) were injected. Next, cumulus oocyte complexes (COCs) were collected from the oviducts of the female mice by using a matrix-flushing method. The cumulus cells were cultured with melatonin 10 μM for 6 hours and for real-time reverse transcription-polymerase chain reaction (RT-PCR) was used for evaluation of HAS2 and PGR expression levels. The fertilization rate was evaluated through IVF. All the data were analyzed using a t test. The results of this study showed that HAS2 and PGR expressions in the cumulus cells of the mice receiving melatonin increased in comparison to the control groups. Also, IVF results revealed an enhancement in fertilization rate in the experimental groups compared to the control groups. To improve the oocyte quality and provide new approaches for infertility treatment, administration of melatonin as an antioxidant, showed promising results. Thus, it is concluded that fertility outcomes can be improved by melatonin it enhances PGR. Copyright© by Royan Institute. All rights reserved.

  6. Partially dissecting the steady-state electron fluxes in Photosystem I in wild-type and pgr5 and ndh mutants of Arabidopsis

    Directory of Open Access Journals (Sweden)

    Jiancun eKou

    2015-09-01

    Full Text Available Cyclic electron flux (CEF around Photosystem I (PS I is difficult to quantify. We obtained the linear electron flux (LEFO2 through both photosystems and the total electron flux through PS I (ETR1 in Arabidopsis in CO2-enriched air. DeltaFlux = ETR1 – LEFO2 is an upper estimate of CEF, which consists of two components, an antimycin A-sensitive, PGR5 (proton gradient regulation 5 protein-dependent component and an insensitive component facilitated by a chloroplastic nicotinamide adenine dinucleotide dehydrogenase-like complex (NDH. Using wild type as well as pgr5 and ndh mutants, we observed that (1 40% of the absorbed light was partitioned to PS I; (2 at high irradiance a substantial antimycin A-sensitive CEF occurred in the wild type and the ndh mutant; (3 at low irradiance a sizable antimycin A-sensitive CEF occurred in the wild type but not in the ndh mutant, suggesting an enhancing effect of NDH in low light; and (4 in the pgr5 mutant, and the wild type and ndh mutant treated with antimycin A, a residual DeltaFlux existed at high irradiance, attributable to charge recombination and/or pseudo-cyclic electron flow. Therefore, in low-light-acclimated plants exposed to high light, DeltaFlux has contributions from various paths of electron flow through PS I.

  7. Expression of PGR, HBEGF, ITGAV, ITGB3 and SPP1 genes in eutopic endometrium of infertile women with endometriosis during the implantation window: a pilot study.

    Science.gov (United States)

    Broi, Michele G Da; Rocha, Carlos V; Meola, Juliana; Martins, Wellington P; Carvalho, Filomena M; Ferriani, Rui A; Navarro, Paula A

    2017-09-01

    Alterations in endometrial receptivity may be involved in the etiopathogenesis of endometriosis-related infertility. The literature has suggested that patients with endometriosis present progestin resistance, which could affect embryo implantation. We question the presence of alterations in the expression of the progesterone receptor gene (PGR) and the genes related to endometrium-embryo interaction regulated by progesterone. This pilot study compared the expression of PGR, HBEGF, ITGAV, ITGB3, and SPP1 genes in eutopic endometrium during the implantation window (IW) in infertile women with endometriosis with that observed in the endometrium of fertile and infertile controls. In this prospective case-control study, endometrial biopsies were performed during the IW in patients aged between 18 and 45 years old, with regular cycles and without endocrine/systemic dysfunctions, divided into endometriosis (END), infertile control (IC) and fertile control (FC) groups. Total RNA extraction, cDNA synthesis, and gene expression analysis by Real-Time PCR were performed. We assessed the size of the difference that our series was powered to detect. From the 687 patients who underwent diagnostic videolaparoscopy or tubal ligation at the University Hospital, 130 were eligible. Of these, 32 had endometrial samples collected, with 17 confirmed in the IW. Fifteen samples (5 END, 5 IC and 5 FC) were analyzed. There was no significant difference in the expression of any studied gene. Our sample size allowed us to identify or discard large differences (two standard deviations) among the groups. Endometriosis doesn't cause large changes in the endometrial expression of PGR, HBEGF, ITGAV, ITGB3 and SPP1 during the IW.

  8. Putting Ug99 on the map: An update on current and future monitoring

    DEFF Research Database (Denmark)

    Hodson, D P; Nazari, K; Park, R F

    2011-01-01

    Detection of stem rust race TTKSK (Ug99) from Uganda in 1998/99 highlighted not only the extremely high vulnerability of the global wheat crop to stem rust but also a lack of adequate global systems to monitor such a threat. Progress in the development and expansion of the Global Cereal Rust...... Monitoring System (GCRMS) is described. The current situation regarding the Ug99 lineage of races is outlined and the potential for expansion into important wheat areas is considered. The GCRMS has successfully tracked the spread and changes that are occurring within the Ug99 lineage and is now well...... capacity for race analysis is seen to be critical and integration of the Global Rust Reference Centre into the stem rust monitoring network is seen as a positive development. The current acute situation with severe epidemics of stripe rust in many countries indicates a clear need for more effective global...

  9. Creation of second order magnetic barrier inside chaos created by NTMs in the ASDEX UG

    Science.gov (United States)

    Ali, Halima; Punjabi, Alkesh

    2012-10-01

    Understanding and stabilization of neoclassical tearing modes (NTM) in tokamaks is an important problem. For low temperature plasmas, tearing modes are believed to be mainly driven by current density gradient. For collisionless plasmas, even when plasma is stable to classical tearing modes, helical reduction in bootstrap current in O-point of an island can destabilize NTMs when an initial island is seeded by other global MHD instabilities or when microturbulence triggers the transition from a linear to nonlinear instability. The onset of NTMs leads to the most serious beta limit in ASDEX UG tokamak [O. Gubner et al 2005 NF 39 1321]. The important NTMs in the ASDDEX UG are (m,n)=(3,2)+(4,3)+(1,1). Realistic parameterization of these NTMs and the safety factor in ASDEX UG are given in [O. Dumbrajs et al 2005 POP 12 1107004]. We use a symplectic map in magnetic coordinates for the ASDEX UG to integrate field lines in presence of the NTMs. We add a second order control term [H. Ali and A. Punjabi 2007 PPCF 49 1565] to this ASDEX UG field line Hamiltonian to create an invariant magnetic surface inside the chaos generated by the NTMs. The relative strength, robustness, and resilience of this barrier are studied to ascertain the most desirable noble barrier in the ASDEX UG with NTMs. We present preliminary results of this work, and discuss its implications with regard to magnetic transport barriers for increasing strength of magnetic perturbations. This work is supported by the grants DE-FG02-01ER54624 and DE-FG02-04ER54793.

  10. Targeted introgression of stem rust Ug99 resistance from wheatgrasses into pasta and bread wheat

    Science.gov (United States)

    In the past 50 years, a number of stem rust resistance (Sr) genes have been transferred from several wheat-related grasses into durum (i.e. pasta) and bread wheat through chromosome translocations and additions. To utilize these genes for controlling the Ug99 races of the stem rust pathogen, we ini...

  11. Resistance to stem rust Ug99 in six bread wheat cultivars maps to chromosome 6DS.

    Science.gov (United States)

    Lopez-Vera, Eric E; Nelson, Sarah; Singh, Ravi P; Basnet, Bhoja R; Haley, Scott D; Bhavani, Sridhar; Huerta-Espino, Julio; Xoconostle-Cazares, Beatriz G; Ruiz-Medrano, Roberto; Rouse, Matthew N; Singh, Sukhwinder

    2014-01-01

    Identified SSR markers ( Xcfd49 and Xbarc183 ) linked with stem rust resistance for efficient use in marker-assisted selection and stacking of resistance genes in wheat breeding programs. More than 80 % of the worldwide wheat (Triticum aestivum L.) area is currently sown with varieties susceptible to the Ug99 race group of stem rust fungus. However, wheat lines Niini, Tinkio, Coni, Pfunye, Blouk, and Ripper have demonstrated Ug99 resistance at the seedling and adult plant stages. We mapped stem rust resistance in populations derived from crosses of a susceptible parent with each of the resistant lines. The segregation of resistance in each population indicated the presence of a single gene. The resistance gene in Niini mapped to short arm of chromosome 6D and was flanked by SSR markers Xcfd49 at distances of 3.9 cM proximal and Xbarc183 8.4 cM distal, respectively. The chromosome location of this resistance was validated in three other populations: PBW343/Coni, PBW343/Tinkio, and Cacuke/Pfunye. Resistance initially postulated to be conferred by the SrTmp gene in Blouk and Ripper was also linked to Xcfd49 and Xbarc183 on 6DS, but it was mapped proximal to Xbarc183 at a similar position to previously mapped genes Sr42 and SrCad. Based on the variation in diagnostic marker alleles, it is possible that Niini and Pfunye may carry different resistance genes/alleles. Further studies are needed to determine the allelic relationships between various genes located on chromosome arm 6DS. Our results provide valuable molecular marker and genetic information for developing Ug99 resistant wheat varieties in diverse germplasm and using these markers to tag the resistance genes in wheat breeding.

  12. Geology of the U12n.07 UG-3 drill hole, area 12, Nevada Test Site

    International Nuclear Information System (INIS)

    Terry, S.S.; Cunningham, M.J.

    1975-11-01

    The U12n.07 UG-3 horizontal drill hole, located near the eastern edge of the center of Rainier Mesa, Nevada Test Site, was drilled to a total depth of 809 m (2,653 ft). This hole was drilled to further evaluate the tunnel-level stratigraph, and structure southwest of the U12n tunnel complex. The drill hole is collared in the middle of Tertiary tunnel bed 3A and penetrates upsection through tunnel beds 3 and 4 and terminates in subunit 4K, all of Tertiary age. Stratigraphy, structure, engineering geology, and physical properties and their relation to tunnel engineering are discussed

  13. Problems of Gas Pressure Build-up in Casing String of UGS and Gas Wells

    Directory of Open Access Journals (Sweden)

    Peter Sovius

    2006-10-01

    Full Text Available This paper consists of three basic parts. The opening part is a brief description of problems associated with the secondary untightness of UGS wells (Underground Gas Storages and gas wells generally.The main part of the paper is composed of some cases that we have met in our company. Solution proposals of various cases are also supplied in this part. Separate problem situations are described in terms of finding out an untight point and also a testing result and consequential removing of untightness.The conclusion includes knowledge summary that were taken by solution of complicatedsituations connected with well non-hermeticity.

  14. Hypermethylation pattern of ESR and PgR genes and lacking estrogen and progesterone receptors in human breast cancer tumors: ER/PR subtypes.

    Science.gov (United States)

    Pirouzpanah, Saeed; Taleban, Forough-Azam; Mehdipour, Parvin; Sabour, Siamak; Atri, Morteza

    2018-02-14

    The option of endocrine therapy in breast cancer remains conventionally promising. We aimed to investigate how accurately the pattern of hypermethylation at estrogen receptor (ESR) and progesterone receptor (PgR) genes may associate with relative expression and protein status of ER, PR and the combinative phenotype of ER/PR. In this consecutive case-series, we enrolled 139 primary diagnosed breast cancer. Methylation specific PCR was used to assess the methylation status (individual test). Tumor mRNA expression levels were evaluated using real-time RT-PCR. Immunohistochemistry data was used to present hormonal receptor status of a tumor (as test reference). Methylation at ESR1 was comparably frequent in ER-breast tumors (83.0%, PPR- conditions (Cramer's V= 0.44, PPR (77.1%, PPR expressions (55.6%, PPR- (64.4%, PPR-, the hypermethylation of PgRb seem another epigenetic signalling variable actively associate with methylated ESR1 to show lack of ER+/PR+ tumors in breast cancer.

  15. Prevalence of ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms in Brazilian breast cancer-unaffected women

    Energy Technology Data Exchange (ETDEWEB)

    Giacomazzi, J.; Aguiar, E. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil); Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Palmero, E.I. [International Agency for Research on Cancer (IARC), Lyon (France); Schmidt, A.V. [Departamento de Estatística, UFRGS, Porto Alegre, RS (Brazil); Skonieski, G.; Filho, D.D. [Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Bock, H. [Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Biologia Celular e Molecular, UFRGS, Porto Alegre, RS (Brazil); Saraiva-Pereira, M.L. [Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Biologia Celular e Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Bioquímica, UFRGS, Porto Alegre, RS (Brazil); Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Ewald, I.P. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil); Schuler-Faccini, L. [Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Genética, UFRGS, Porto Alegre, RS (Brazil); Camey, S.A. [Departamento de Estatística, Instituto de Matemática, UFRGS, Porto Alegre, RS (Brazil); Caleffi, M. [Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Giugliani, R. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Genética, UFRGS, Porto Alegre, RS (Brazil); Ashton-Prolla, P. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (BR); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (BR); Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (BR); Serviço de Genética Médica, HCPA, Porto Alegre, RS (BR); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (BR); Departamento de Genética, UFRGS, Porto Alegre, RS (BR)

    2012-05-18

    Polymorphisms of hormone receptor genes have been linked to modifications in reproductive factors and to an increased risk of breast cancer (BC). In the present study, we have determined the allelic and genotypic frequencies of the ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms and investigated their relationship with mammographic density, body mass index (BMI) and other risk factors for BC. A consecutive and unselected sample of 750 Brazilian BC-unaffected women enrolled in a mammography screening program was recruited. The distribution of PGR PROGINS genotypic frequencies was 72.5, 25.5 and 2.0% for A1A1, A1A2 and A2A2, respectively, which was equivalent to that encountered in other studies with healthy women. The distribution of ERα genotypes was: ERα-397 PvuII C/T: 32.3% TT, 47.5% TC, and 20.2% CC; ERα-351 XbaI A/G: 46.3% AA, 41.7% AG and 12.0% GG. ERα haplotypes were 53.5% PX, 14.3% Px, 0.3% pX, and 32.0% px. These were significantly different from most previously published reports worldwide (P < 0.05). Overall, the PGR PROGINS genotypes A2A2 and A1A2 were associated with fatty and moderately fatty breast tissue. The same genotypes were also associated with a high BMI in postmenopausal women. In addition, the ERα-351 XbaI GG genotype was associated with menarche ≥12 years (P = 0.02). ERα and PGR polymorphisms have a phenotypic effect and may play an important role in BC risk determination. Finally, if confirmed in BC patients, these associations could have important implications for mammographic screening and strategies and may be helpful to identify women at higher risk for the disease.

  16. Commentary: "An Evaluation of Universal Grammar and the Phonological Mind"-UG Is Still a Viable Hypothesis.

    Science.gov (United States)

    Berent, Iris

    2016-01-01

    Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett's concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett's logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett's arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett's arguments hardly undermine the viability of this hypothesis.

  17. Commentary: “An Evaluation of Universal Grammar and the Phonological Mind”—UG Is Still a Viable Hypothesis

    Science.gov (United States)

    Berent, Iris

    2016-01-01

    Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett’s concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett’s logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett’s arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett’s arguments hardly undermine the viability of this hypothesis. PMID:27471480

  18. An investigation into breast imaging as part of the undergraduate (UG) education of diagnostic radiography students in the UK

    International Nuclear Information System (INIS)

    Strudwick, R.M.; Taylor, K.

    2017-01-01

    Introduction: How mammography is incorporated into undergraduate (UG) radiography training may influence student perception of the speciality and its potential as a future career option. An overview is provided of the academic and clinical content of UG radiography courses relating to mammography across the UK. Methods: Using mixed methods and an iterative, inductive approach supplying quantitative and qualitative data, we identify any variations and discuss possible causes which may help influence future training strategies. A self-designed questionnaire containing open and closed questions was sent online using SurveyMonkey™ to course leaders of all Higher Education Institutions (HEIs) offering BSc (Hons) Diagnostic Radiography courses in the UK. Responses were analysed for trends which were further explored by semi structured telephone interviews. These were transcribed and evaluated using a thematic analysis, the themes being categorised and coded. Results: 19 of 24 (79%) HEIs responded to the questionnaire. Follow up telephone interviews were conducted with five course leaders to further explore themes. Academic teaching ranged from 3 to 25 h over the 3 year course. Compared to other specialities 10 (53%) HEIs spent less time on mammography with 12 (63%) citing HCPC standards as the reason. 11 (65%) HEIs sent students on mammography placements, 2 (12%) sent females only. Placement times ranged between 2 days and 2 weeks. Influences included availability of expert teaching and relationship with clinical departments. Conclusion: There is variation in undergraduate exposure to mammography. Students views should be sought to add validity to these findings - Highlights: • A summary of undergraduate (UG) breast imaging in the UK. • Themes around the delivery of UG breast imaging education in university and practice. • Opinions of UG course leaders and other stakeholders about UG breast imaging education. • There is a variation across UK universities in

  19. The strongest magnetic barrier in the DIII-D tokamak and comparison with the ASDEX UG

    Science.gov (United States)

    Ali, Halima; Punjabi, Alkesh

    2013-05-01

    Magnetic perturbations in tokamaks lead to the formation of magnetic islands, chaotic field lines, and the destruction of flux surfaces. Controlling or reducing transport along chaotic field lines is a key challenge in magnetically confined fusion plasmas. A local control method was proposed by Chandre et al. [Nucl. Fusion 46, 33-45 (2006)] to build barriers to magnetic field line diffusion by addition of a small second-order control term localized in the phase space to the field line Hamiltonian. Formation and existence of such magnetic barriers in Ohmically heated tokamaks (OHT), ASDEX UG and piecewise analytic DIII-D [Luxon, J.L.; Davis, L.E., Fusion Technol. 8, 441 (1985)] plasma equilibria was predicted by the authors [Ali, H.; Punjabi, A., Plasma Phys. Control. Fusion 49, 1565-1582 (2007)]. Very recently, this prediction for the DIII-D has been corroborated [Volpe, F.A., et al., Nucl. Fusion 52, 054017 (2012)] by field-line tracing calculations, using experimentally constrained Equilibrium Fit (EFIT) [Lao, et al., Nucl. Fusion 25, 1611 (1985)] DIII-D equilibria perturbed to include the vacuum field from the internal coils utilized in the experiments. This second-order approach is applied to the DIII-D tokamak to build noble irrational magnetic barriers inside the chaos created by the locked resonant magnetic perturbations (RMPs) (m, n)=(3, 1)+(4, 1), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation with amplitude δ. A piecewise, analytic, accurate, axisymmetric generating function for the trajectories of magnetic field lines in the DIII-D is constructed in magnetic coordinates from the experimental EFIT Grad-Shafranov solver [Lao, L, et al., Fusion Sci. Technol. 48, 968 (2005)] for the shot 115,467 at 3000 ms in the DIII-D. A symplectic mathematical map is used to integrate field lines in the DIII-D. A numerical algorithm [Ali, H., et al., Radiat. Eff. Def. Solids Inc. Plasma Sc. Plasma Tech. 165, 83

  20. Root cause analysis of the fatigue failures of the pulsation dampers of a large underground gas storage (UGS) system

    NARCIS (Netherlands)

    Eijk, A.; Lange, D. de; Maljaars, J.; Tenbrock-Ingenhorst, A.; Gottmer, A.

    2014-01-01

    Two large identical 6-cylinder Ariel JGB/6 reciprocating compressors each of 7.5 MW, are used for an underground gas storage system (UGS) plant of RWE Gasspeicher GmbH located in Epe, Germany. The system is in operation since 2005. In 2011 several internals parts (baffle plates and baffle choke

  1. Identification and validation of single nucleotide polymorphic markers linked to Ug99 stem rust resistance in spring wheat

    Science.gov (United States)

    Wheat stem rust (Puccinia graminis f. sp. tritici Eriks. and E. Henn.) is one of the most destructive diseases world-wide. Races belonging to Ug99 (or TTKSK) continue to cause crop losses in East Africa and threaten global wheat production. Developing and deploying wheat varieties with multiple race...

  2. Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows

    International Nuclear Information System (INIS)

    Osborne, P.E.

    2002-01-01

    The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of 233 U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF 6 and subsequent steam treatments of UO 2 F 2 . For each mole of UF 6 converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance

  3. Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows

    Energy Technology Data Exchange (ETDEWEB)

    Osborne, P.E.

    2002-09-11

    The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of {sup 233}U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF{sub 6} and subsequent steam treatments of UO{sub 2}F{sub 2}. For each mole of UF{sub 6} converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance.

  4. The role of unattended ground sensors (UGS) in regional confidence building and arms control

    Energy Technology Data Exchange (ETDEWEB)

    Vannoni, M.; Duggan, R.

    1997-03-01

    Although the Cold War has ended, the world has not become more peaceful. Without the stability provided by an international system dominated by two super-powers, local conflicts are more likely to escalate. Agreements to counter destabilizing pressures in regional conflicts can benefit from the use of cooperative monitoring. Cooperative monitoring is the collecting, analyzing, and sharing of information among parties to an agreement. Ground sensor technologies can contribute to the collection of relevant information. If implemented with consideration for local conditions, cooperative monitoring can build confidence, strengthen existing agreements, and set the stage for continued progress. This presentation describes two examples: the Israeli-Egyptian Sinai agreements of the 1970s and a conceptual example for the contemporary Korean Peninsula. The Sinai was a precedent for the successful use of UGS within the context of cooperative monitoring. The Korean Peninsula is the world`s largest military confrontation. Future confidence building measures that address the security needs of both countries could decrease the danger of conflict and help create an environment for a peace agreement.

  5. Rachunek kosztów działańjako podstawa wyceny usług

    Directory of Open Access Journals (Sweden)

    Gertruda Krystyna Świderska

    2009-03-01

    Full Text Available Artykuł prezentuje wykorzystanie rachunku kosztów działań do wyceny usług na trzech rynkach podlegających centralnym regulacjom – rynku usług pocztowych, telekomunikacyjnych oraz świadczeń zdrowotnych. Doświadczenia krajów Unii Europejskiej (w tym Polski pokazują nowe obszary wykorzystania rachunku kosztów działań. Potwierdzają, że zastosowanie tego narzędzia pozwala na kontrolę kosztów ponoszonych przy świadczeniu usług oraz wycenę na podstawie rzeczywistego rachunku ekonomicznego. Takie podejście gwarantuje przejrzystość procesu wyceny na rynkach, na których odgrywa to szczególnie istotną rolę. W części pierwszej przedstawiono zarys koncepcji rachunku kosztów działań wykorzystanej w PPUP Poczta Polska. Scharakteryzowano zastosowane rozwiązanie dostosowane do specyfiki działań poczty, zawierające elementy obiektowego rachunku kosztów działań oraz rachunku kosztów działań sterowanego czasem. W części drugiej zaprezentowano zastosowanie koncepcji rachunku kosztów działań do wyceny świadczonych usług w British Telecom. Wykorzystanie właściwych nośników kosztów pozwala na prawidłowe przypisanie kosztów obiektom je generującym. W części trzeciej opisano doświadczenia krajów Unii Europejskiej w zakresie stosowania rachunku kosztów działań do wyceny świadczeń medycznych. Stanowią one przesłankę dla wdrożenia tej koncepcji do wyceny usług zdrowotnych na rynku polskim.

  6. The Development of “Eldo Ngano 1”: The World’s World’s First Ug99 Resistant Mutant Wheat Variety

    International Nuclear Information System (INIS)

    Forster, Brian P.

    2014-01-01

    The wheat black stem rust disease is a virulent race of fungus, Puccinia graminis, which affects wheat plants and is caused by a strain of fungus known as Ug99. Named for its place and year of origin, Ug99 was first discovered on wheat in Uganda in 1999. The spores of this plant disease are airborne and can be easily spread by wind. If not prevented, the disease can destroy 70 to 100 per cent of the yield of wheat crops. Annually on average 8.3 million tonnes of wheat grain is lost to this disease, costing US $1.23 billion per year. Ethiopia, Kenya and Uganda are hot spots for this disease. In 2009, growing international concern regarding the horrific impact of Ug99 on wheat led to the establishment of IAEA project INT/5/150, Responding to the Transboundary Threat of Wheat Black Stem Rust (Ug99). This project has involved over 18 countries and 5 national and international institutions, and examined possible mutation induction treatments to deal with the challenges posed by Ug99. Meetings and workshops to facilitate the project efforts have been held in Kenya and Turkey. Ug99 continues to spread globally and has now reached the Islamic Republic of Iran. There are also reports of suspected disease occurrences in Europe. It is essential that work continues on developing mutant lines for further crop protection that can be utilized worldwide to safeguard the wheat crop from this devastating disease

  7. Quantification of African cassava mosaic virus (ACMV) and East African cassava mosaic virus (EACMV-UG) in single and mixed infected Cassava (Manihot esculenta Crantz) using quantitative PCR.

    Science.gov (United States)

    Naseem, Saadia; Winter, Stephan

    2016-01-01

    The quantity of genomic DNA-A and DNA-B of African cassava mosaic virus (ACMV) and East African cassava mosaic virus Uganda (Uganda variant, EACMV-UG) was analysed using quantitative PCR to assess virus concentrations in plants from susceptible and tolerant cultivars. The concentrations of genome components in absolute and relative quantification experiments in single and mixed viral infections were determined. Virus concentration was much higher in symptomatic leaf tissues compared to non-symptomatic leaves and corresponded with the severity of disease symptoms. In general, higher titres were recorded for EACMV-UG Ca055 compared to ACMV DRC6. The quantitative assessment also showed that the distribution of both viruses in the moderately resistant cassava cv. TMS 30572 was not different from the highly susceptible cv. TME 117. Natural mixed infections with both viruses gave severe disease symptoms. Relative quantification of virus genomes in mixed infections showed higher concentrations of EACMV-UG DNA-A compared to ACMV DNA-A, but a marked reduction of EACMV-UG DNA-B. The higher concentrations of EACMV-UG DNA-B compared to EACMV DNA-A accumulation in single infections were consistent. Since DNA-B is implicated in virus cell-to-cell spread and systemic movement, the abundance of the EACMV-UG DNA-B may be an important factor driving cassava mosaic disease epidemic. Copyright © 2015 Elsevier B.V. All rights reserved.

  8. Discovery of a Novel Stem Rust Resistance Allele in Durum Wheat that Exhibits Differential Reactions to Ug99 Isolates

    Directory of Open Access Journals (Sweden)

    Jayaveeramuthu Nirmala

    2017-10-01

    Full Text Available Wheat stem rust, caused by Puccinia graminis f. sp. tritici Eriks. & E. Henn, can incur yield losses in susceptible cultivars of durum wheat, Triticum turgidum ssp. durum (Desf. Husnot. Although several durum cultivars possess the stem rust resistance gene Sr13, additional genes in durum wheat effective against emerging virulent races have not been described. Durum line 8155-B1 confers resistance against the P. graminis f. sp. tritici race TTKST, the variant race of the Ug99 race group with additional virulence to wheat stem rust resistance gene Sr24. However, 8155-B1 does not confer resistance to the first-described race in the Ug99 race group: TTKSK. We mapped a single gene conferring resistance in 8155-B1 against race TTKST, Sr8155B1, to chromosome arm 6AS by utilizing Rusty/8155-B1 and Rusty*2/8155-B1 populations and the 90K Infinium iSelect Custom bead chip supplemented by KASP assays. One marker, KASP_6AS_IWB10558, cosegregated with Sr8155B1 in both populations and correctly predicted Sr8155B1 presence or absence in 11 durum cultivars tested. We confirmed the presence of Sr8155B1 in cultivar Mountrail by mapping in the population Choteau/Mountrail. The marker developed in this study could be used to predict the presence of resistance to race TTKST in uncharacterized durum breeding lines, and also to combine Sr8155B1 with resistance genes effective to Ug99 such as Sr13. The map location of Sr8155B1 cannot rule out the possibility that this gene is an allele at the Sr8 locus. However, race specificity indicates that Sr8155B1 is different from the known alleles Sr8a and Sr8b.

  9. New Seeds are Resistant to Wheat Stem Rust (Ug99) Multinational Programme Supported by FAO and IAEA

    International Nuclear Information System (INIS)

    2013-01-01

    Full text: A multinational effort supported by the International Atomic Energy Agency and the U.N. Food and Agriculture Organization marked a key milestone this week when a Kenyan university debuted two new varieties of disease-resistant wheat to the nation's farmers. Over the past two days, thousands of Kenyan farmers have visited Eldoret University in western Kenya for a two-day agriculture fair highlighting the latest farming technologies. Supporting the development of the new varieties were the IAEA's Technical Cooperation Department and the Joint FAO/IAEA Programme of Nuclear Techniques in Food and Agriculture. They manage an interregional Technical Cooperation project to develop varieties of wheat that are resistant to a devastating type of fungus, causing a disease known as wheat stem rust. Wheat stem rust under control for over 30 years, but a resurgence of the disease was discovered in 1999 in Uganda that swiftly spread to neighbouring Kenya. The wheat stem rust, caused by the strain of the fungus known as Ug99, named after its place and year of origin, has since spread to Iran, Yemen and South Africa and threatens crops as far away as India as spores are carried by wind. Parasitic rusts threaten global wheat production, reducing plant growth and crop yields. The disease can destroy up to 70-100 percent of the yield of wheat crop if not prevented. 'Improving food security in developing countries through the use of nuclear techniques is an important priority of the IAEA', said IAEA Director General Yukiya Amano. 'I am pleased that we have been able to make an important contribution to fighting wheat rust'. 'Wheat rusts, particularly the Ug99 strain, are a major threat to food security because rust epidemics can result in devastating yield losses. This international project involving affected countries, plant scientists and breeders and international organizations is a major breakthrough. It clearly shows the benefits of FAO/IAEA collaboration and that

  10. Underground gas storage Uelsen: Findings from planning, building and commissioning the surface buildings and structures; Untertagegasspeicher (UGS) Uelsen: Erkenntnisse aus Planung, Bau und Inbetriebnahme der obertaegigen Anlagen

    Energy Technology Data Exchange (ETDEWEB)

    Focke, H.; Brueggmann, R.; Mende, F.; Steinkraus, D.; Wauer, R. [BEB Erdgas und Erdoel GmbH, Hannover (Germany)

    1998-12-31

    The article describes the concepts of the plants and equipment and the specific features of the underground storage at Uelsen. The underground storage will be purpose-built as an H-gas storage in a nearly depleted sandstone deposit. At a nominal deliverability of 250.000 cubic m/h (Vn) the storage at Uelsen has more potential for expansion. This potential was taken into account by designing appropriate pressure stages, capacities, performance characteristics and space. (orig.). [Deutsch] Die nachfolgende Veroeffentlichung stellt das anlagentechnische Grundkonzept und die spezifischen Besonderheiten des UGS Uelsen dar. Der im suedwestlichen Niedersachsen als H-Gasspeicher in einer nahezu ausgefoerderten Buntsandsteinlagerstaette eingerichtete UGS Uelsen wird in mehreren Ausbaustufen bedarfsgerecht fertiggestellt. Bei einer Nennentnahmekapazitaet von 450.000 m{sup 3}/h (Vn) und einer Nenninjektionsleistung von 250.000 m{sup 3}/h (Vn) weist der UGS Uelsen noch weiteres Potential fuer Erweiterungen auf. Dieses Ausbaupotential wurde bei der Planung und dem Bau der bestehenden Anlagen durch Festlegung entsprechender Druckstufen, Kapazitaeten, Leistungsgroessen und Platzanordnungen beruecksichtigt. (orig.)

  11. Creation of a magnetic barrier at a noble q close to physical midpoint between two resonant surfaces in the ASDEX UG tokamak

    Science.gov (United States)

    Vazquez, Justin; Ali, Halima; Punjabi, Alkesh

    2009-11-01

    Ciraolo, Vittot and Chandre method of building invariant manifolds inside chaos in Hamiltonian systems [Ali H. and Punjabi A, Plasma Phys. Control. Fusion, 49, 1565--1582 (2007)] is used in the ASDEX UG tokamak. In this method, a second order perturbation is added to the perturbed Hamiltonian [op cit]. It creates an invariant torus inside the chaos, and reduces the plasma transport. The perturbation that is added to the equilibrium Hamiltonian is at least an order of magnitude smaller than the perturbation that causes chaos. This additional term has a finite, limited number of Fourier modes. Resonant magnetic perturbations (m,n) = (3,2)+(4,3) are added to the field line Hamiltonian for the ASDEX UG. An area-preserving map for the field line trajectories in the ASDEX UG is used. The common amplitude δ of these modes that gives complete chaos between the resonant surfaces ψ43 and ψ32 is determined. A magnetic barrier is built at a surface with noble q that is very nearly equals to the q at the physical midpoint between the two resonant surfaces. The maximum amplitude of magnetic perturbation for which this barrier can be sustained is determined. This work is supported by US Department of Energy grants DE-FG02-07ER54937, DE-FG02-01ER54624 and DE-FG02-04ER54793.

  12. Advanced MicroObserver UGS integration with and cueing of the BattleHawk squad level loitering munition and UAV

    Science.gov (United States)

    Steadman, Bob; Finklea, John; Kershaw, James; Loughman, Cathy; Shaffner, Patti; Frost, Dean; Deller, Sean

    2014-06-01

    Textron's Advanced MicroObserver(R) is a next generation remote unattended ground sensor system (UGS) for border security, infrastructure protection, and small combat unit security. The original MicroObserver(R) is a sophisticated seismic sensor system with multi-node fusion that supports target tracking. This system has been deployed in combat theaters. The system's seismic sensor nodes are uniquely able to be completely buried (including antennas) for optimal covertness. The advanced version adds a wireless day/night Electro-Optic Infrared (EOIR) system, cued by seismic tracking, with sophisticated target discrimination and automatic frame capture features. Also new is a field deployable Gateway configurable with a variety of radio systems and flexible networking, an important upgrade that enabled the research described herein. BattleHawkTM is a small tube launched Unmanned Air Vehicle (UAV) with a warhead. Using transmitted video from its EOIR subsystem an operator can search for and acquire a target day or night, select a target for attack, and execute terminal dive to destroy the target. It is designed as a lightweight squad level asset carried by an individual infantryman. Although BattleHawk has the best loiter time in its class, it's still relatively short compared to large UAVs. Also it's a one-shot asset in its munition configuration. Therefore Textron Defense Systems conducted research, funded internally, to determine if there was military utility in having the highly persistent MicroObserver(R) system cue BattleHawk's launch and vector it to beyond visual range targets for engagement. This paper describes that research; the system configuration implemented, and the results of field testing that was performed on a government range early in 2013. On the integrated system that was implemented, MicroObserver(R) seismic detections activated that system's camera which then automatically captured images of the target. The geo-referenced and time-tagged Micro

  13. Emergence of virulence to SrTmp in the Ug99 race group of wheat stem rust, Puccinia graminis f. sp. tritici, in Africa

    DEFF Research Database (Denmark)

    Patpour, M.; Hovmøller, M. S.; Justesen, A. F.

    2016-01-01

    of wheat fields in Africa (Kenya, 9; Uganda, 28; Rwanda, 41; and Egypt, 6) were sent to the Global Rust Reference Center (GRRC, Denmark) for race analysis. Puccinia graminis f. sp. tritici (Pgt) samples were recovered on cv. Morocco, and resulting urediniospores of 53 single-pustule isolates were......Tmp) to confirm their virulence/avirulence combinations to Sr24, Sr31, Sr36, and SrTmp. Race TTKTK was also detected at two locations in Uganda (Rubaya and Muko in Kabale region) and at five locations in Rwanda (Kinigi, Rwerere, Rufungo, Gatebe, and Kamenyo). Three isolates derived from stem rust samples...

  14. Perswazyjność komunikatów reklamowych w Internecie na podstawie analizy usług finansowych SKOK-ów

    OpenAIRE

    Idzik, Beata

    2014-01-01

    Praca jest wynikiem kilkuletnich obserwacji praktycznej strony funkcjonowania reklamy w zakresie usług finansowych. Autorka starała się oddać wyraz swojemu zainteresowaniu psychologią konsumenta, marketingiem w sektorze finansowym a także fascynacji możliwościom, jakie stwarzają w tym zakresie nowe technologie oparte na Internecie. Praca ma charakter teoretyczno - badawczy. W założeniach metodologicznych sformułowano problem badawczy, cele oraz cztery hipotezy badawcze, które poddano wery...

  15. Wpływ informatyzacji Biblioteki Uniwersyteckiej w Poznaniu na zmiany organizacyjne i rozwój usług bibliotecznych

    Directory of Open Access Journals (Sweden)

    Piotr Karwasiński

    2015-12-01

    Full Text Available W artykule omówiono zagadnienia związane z procesami informatyzacji Biblioteki Uniwersyteckiej w Poznaniu. W celu dokładnego scharakteryzowania przemian, prócz rysu historycznego, przedstawiono obszary, które wyraźnie poprawiły jakość pracy personelu i obsługę czytelników oraz przyczyniły się do poznania, upowszechniania i wdrażania nowoczesnych rozwiązań technologicznych. Zaprezentowano proces zmian w zakresie funkcjonowania systemu biblioteczno-informacyjnego Horizon i współpracy z narodowym katalogiem centralnym NUKAT. Opisano etapy rozwoju elektronicznej przestrzeni informacyjnej, w tym budowania elektronicznych zasobów wiedzy i tworzenia narzędzi do ich obsługi i wykorzystania w procesach wyszukiwania źródeł informacji. Zaprezentowano Bibliotekę Uniwersytecką jako partnera w aranżowaniu instytucjonalnych platform cyfrowych do deponowania i udostępniania dorobku intelektualnego społeczności naukowej Uniwersytetu im. Adama Mickiewicza w Poznaniu. Wskazano także funkcjonalność zaprojektowanych i wdrożonych innowacyjnych usług wirtualnych pakietu Libsmart, optymalizujących funkcjonowanie Biblioteki Uniwersyteckiej.

  16. Molecular Cytogenetic Characterization of two Triticum-Secale-Thinopyrum Trigeneric Hybrids Exhibiting Superior Resistance to Fusarium Head Blight, Leaf Rust, and Stem Rust Race Ug99.

    Science.gov (United States)

    Dai, Yi; Duan, Yamei; Liu, Huiping; Chi, Dawn; Cao, Wenguang; Xue, Allen; Gao, Yong; Fedak, George; Chen, Jianmin

    2017-01-01

    Fusarium head blight (FHB), leaf rust, and stem rust are the most destructive fungal diseases in current world wheat production. The diploid wheatgrass, Thinopyrum elongatum (Host) Dewey (2 n = 2 x = 14, EE) is an excellent source of disease resistance genes. Two new Triticum-Secale-Thinopyrum trigeneric hybrids were derived from a cross between a hexaploid triticale (X Triticosecale Wittmack, 2 n = 6 x = 42, AABBRR) and a hexaploid Triticum trititrigia (2 n = 6 x = 42, AABBEE), were produced and analyzed using genomic in situ hybridization and molecular markers. The results indicated that line RE21 contained 14 A-chromosomes, 14 B-chromosomes, three pairs of R-chromosomes (4R, 6R, and 7R), and four pairs of E-chromosomes (1E, 2E, 3E, and 5E) for a total chromosome number of 2 n = 42. Line RE62 contained 14 A-chromosomes, 14 B-chromosomes, six pairs of R-chromosomes, and one pair of translocation chromosomes between chromosome 5R and 5E, for a total chromosome number of 2 n = 42. At the seedling and adult growth stages under greenhouse conditions, line RE21 showed high levels of resistance to FHB, leaf rust, and stem rust race Ug99, and line RE62 was highly resistant to leaf rust and stem rust race Ug99. These two lines (RE21 and RE62) display superior disease resistance characteristics and have the potential to be utilized as valuable germplasm sources for future wheat improvement.

  17. A novel Robertsonian translocation event leads to transfer of a stem rust resistance gene (Sr52) effective against race Ug99 from Dasypyrum villosum into bread wheat.

    Science.gov (United States)

    Qi, L L; Pumphrey, M O; Friebe, Bernd; Zhang, P; Qian, C; Bowden, R L; Rouse, M N; Jin, Y; Gill, B S

    2011-06-01

    Stem rust (Puccinia graminis f. sp. tritici Eriks. & E. Henn.) (the causal agent of wheat stem rust) race Ug99 (also designated TTKSK) and its derivatives have defeated several important stem rust resistance genes widely used in wheat (Triticum aestivum L.) production, rendering much of the worldwide wheat acreage susceptible. In order to identify new resistance sources, a large collection of wheat relatives and genetic stocks maintained at the Wheat Genetic and Genomic Resources Center was screened. The results revealed that most accessions of the diploid relative Dasypyrum villosum (L.) Candargy were highly resistant. The screening of a set of wheat-D. villosum chromosome addition lines revealed that the wheat-D. villosum disomic addition line DA6V#3 was moderately resistant to race Ug99. The objective of the present study was to produce and characterize compensating wheat-D. villosum whole arm Robertsonian translocations (RobTs) involving chromosomes 6D of wheat and 6V#3 of D. villosum through the mechanism of centric breakage-fusion. Seven 6V#3-specific EST-STS markers were developed for screening F(2) progeny derived from plants double-monosomic for chromosomes 6D and 6V#3. Surprisingly, although 6D was the target chromosome, all recovered RobTs involved chromosome 6A implying a novel mechanism for the origin of RobTs. Homozygous translocations (T6AS·6V#3L and T6AL·6V#3S) with good plant vigor and full fertility were selected from F(3) families. A stem rust resistance gene was mapped to the long arm 6V#3L in T6AS·6V#3L and was designated as Sr52. Sr52 is temperature-sensitive and is most effective at 16°C, partially effective at 24°C, and ineffective at 28°C. The T6AS·6V#3L stock is a new source of resistance to Ug99, is cytogenetically stable, and may be useful in wheat improvement.

  18. Repair of U/G and U/A in DNA by UNG2-associated repair complexes takes place predominantly by short-patch repair both in proliferating and growth-arrested cells

    DEFF Research Database (Denmark)

    Akbari, Mansour; Otterlei, Marit; Pena Diaz, Javier

    2004-01-01

    Nuclear uracil-DNA glycosylase UNG2 has an established role in repair of U/A pairs resulting from misincorporation of dUMP during replication. In antigen-stimulated B-lymphocytes UNG2 removes uracil from U/G mispairs as part of somatic hypermutation and class switch recombination processes. Using......, PCNA and DNA ligase, the latter detected as activity. Short-patch repair was the predominant mechanism both in extracts and UNG2-ARC from proliferating and less BER-proficient growth-arrested cells. Repair of U/G mispairs and U/A pairs was completely inhibited by neutralizing UNG...

  19. Zasady ujawniania aktywów biologicznychw sprawozdaniach finansowych jednostek rolniczychwedług Międzynarodowych StandardówSprawozdawczości Finansowej

    Directory of Open Access Journals (Sweden)

    Teresa Kiziukiewicz

    2009-03-01

    Full Text Available Charakterystycznym dla przedsiębiorstw rolniczych składnikiem aktywów są aktywa biologiczne. Wyróżnia je fakt podlegania przemianie biologicznej, wskutek której przekształcają się one w produkty rolnicze lub inne aktywa biologiczne. W związku z tą specyfiką powstaje problem odpowiedniej prezentacji informacji o nich. W artykule są przedstawione zasady i zakres ujawnień o aktywach biologicznych w sprawozdaniu finansowym i dołączanych do niego raportach szczegółowych, ze szczególnym uwzględnieniem problemów wyceny według wartości godziwej.

  20. Identification and mapping of Sr46 from Aegilops tauschii accession CIae 25 conferring resistance to race TTKSK (Ug99) of wheat stem rust pathogen.

    Science.gov (United States)

    Yu, Guotai; Zhang, Qijun; Friesen, Timothy L; Rouse, Matthew N; Jin, Yue; Zhong, Shaobin; Rasmussen, Jack B; Lagudah, Evans S; Xu, Steven S

    2015-03-01

    Mapping studies confirm that resistance to Ug99 race of stem rust pathogen in Aegilops tauschii accession Clae 25 is conditioned by Sr46 and markers linked to the gene were developed for marker-assisted selection. The race TTKSK (Ug99) of Puccinia graminis f. sp. tritici, the causal pathogen for wheat stem rust, is considered as a major threat to global wheat production. To address this threat, researchers across the world have been devoted to identifying TTKSK-resistant genes. Here, we report the identification and mapping of a stem rust resistance gene in Aegilops tauschii accession CIae 25 that confers resistance to TTKSK and the development of molecular markers for the gene. An F2 population of 710 plants from an Ae. tauschii cross CIae 25 × AL8/78 were first evaluated against race TPMKC. A set of 14 resistant and 116 susceptible F2:3 families from the F2 plants were then evaluated for their reactions to TTKSK. Based on the tests, 179 homozygous susceptible F2 plants were selected as the mapping population to identify the simple sequence repeat (SSR) and sequence tagged site (STS) markers linked to the gene by bulk segregant analysis. A dominant stem rust resistance gene was identified and mapped with 16 SSR and five new STS markers to the deletion bin 2DS5-0.47-1.00 of chromosome arm 2DS in which Sr46 was located. Molecular marker and stem rust tests on CIae 25 and two Ae. tauschii accessions carrying Sr46 confirmed that the gene in CIae 25 is Sr46. This study also demonstrated that Sr46 is temperature-sensitive being less effective at low temperatures. The marker validation indicated that two closely linked markers Xgwm210 and Xwmc111 can be used for marker-assisted selection of Sr46 in wheat breeding programs.

  1. Molecular Cytogenetic Characterization of two Triticum–Secale–Thinopyrum Trigeneric Hybrids Exhibiting Superior Resistance to Fusarium Head Blight, Leaf Rust, and Stem Rust Race Ug99

    Directory of Open Access Journals (Sweden)

    Yi Dai

    2017-05-01

    Full Text Available Fusarium head blight (FHB, leaf rust, and stem rust are the most destructive fungal diseases in current world wheat production. The diploid wheatgrass, Thinopyrum elongatum (Host Dewey (2n = 2x = 14, EE is an excellent source of disease resistance genes. Two new Triticum–Secale–Thinopyrum trigeneric hybrids were derived from a cross between a hexaploid triticale (X Triticosecale Wittmack, 2n = 6x = 42, AABBRR and a hexaploid Triticum trititrigia (2n = 6x = 42, AABBEE, were produced and analyzed using genomic in situ hybridization and molecular markers. The results indicated that line RE21 contained 14 A-chromosomes, 14 B-chromosomes, three pairs of R-chromosomes (4R, 6R, and 7R, and four pairs of E-chromosomes (1E, 2E, 3E, and 5E for a total chromosome number of 2n = 42. Line RE62 contained 14 A-chromosomes, 14 B-chromosomes, six pairs of R-chromosomes, and one pair of translocation chromosomes between chromosome 5R and 5E, for a total chromosome number of 2n = 42. At the seedling and adult growth stages under greenhouse conditions, line RE21 showed high levels of resistance to FHB, leaf rust, and stem rust race Ug99, and line RE62 was highly resistant to leaf rust and stem rust race Ug99. These two lines (RE21 and RE62 display superior disease resistance characteristics and have the potential to be utilized as valuable germplasm sources for future wheat improvement.

  2. ER, PgR, Ki67, p27Kip1, and histological grade as predictors of pathological complete response in patients with HER2-positive breast cancer receiving neoadjuvant chemotherapy using taxanes followed by fluorouracil, epirubicin, and cyclophosphamide concomitant with trastuzumab

    International Nuclear Information System (INIS)

    Kurozumi, Sasagu; Inoue, Kenichi; Takei, Hiroyuki; Matsumoto, Hiroshi; Kurosumi, Masafumi; Horiguchi, Jun; Takeyoshi, Izumi; Oyama, Tetsunari

    2015-01-01

    Neoadjuvant chemotherapy (NAC) with taxanes followed by fluorouracil, epirubicin, and cyclophosphamide (FEC), and concurrent trastuzumab is a potent regimen for HER2 over-expressing breast cancer. A high pathological complete response (pCR) rate has been achieved using this regimen; however, the predictive factors and prognostic effects of pCR currently remain unclear. In the present study, we determined whether pCR was related to histological grade (HG) and several biological factors including p27 Kip1 . We also assessed the prognosis of the pCR and non-pCR groups, and expected differences between those positive and negative for lymph node metastasis after chemotherapy. A total of 129 Japanese women with HER2-positive invasive breast cancer received either paclitaxel or docetaxel followed by FEC, with the concomitant administration of trastuzumab. The statuses of HG, ER, PgR, Ki67, and p27 Kip1 were evaluated to determine their relationship with pCR. Relapse-free survival (RFS) and overall survival (OS) were also analyzed for their relationship with pCR and pathological nodal involvement. pCR was obtained in 84 out of 129 patients and the pCR rate was 65.1 %. The pCR rates related to 5 factors were as follows: HG (grade 3, 70.0 % vs. grades 1–2, 36.8 %), ER (negative, 78.6 % vs. positive, 40.0 %), PgR (negative, 75.3 % vs. positive, 38.9 %), Ki67 (high, 72.0 % vs. low, 47.2 %), and p27 Kip1 (low, 71.0 % vs. high, 50.0 %). RFS was significantly better in the pCR group than in the non-pCR group (p = 0.018). Patients with remaining nodal disease in the pCR group had worse OS (p = 0.0002). High-HG, low-ER, low-PgR, high-Ki67, and low-p27 Kip1 were identified as predictive factors of pCR in NAC with trastuzumab, while pCR and negative nodes were predictive of better survivals. The online version of this article (doi:10.1186/s12885-015-1641-y) contains supplementary material, which is available to authorized users

  3. Technical validation of an RT-qPCR in vitro diagnostic test system for the determination of breast cancer molecular subtypes by quantification of ERBB2, ESR1, PGR and MKI67 mRNA levels from formalin-fixed paraffin-embedded breast tumor specimens.

    Science.gov (United States)

    Laible, Mark; Schlombs, Kornelia; Kaiser, Katharina; Veltrup, Elke; Herlein, Stefanie; Lakis, Sotiris; Stöhr, Robert; Eidt, Sebastian; Hartmann, Arndt; Wirtz, Ralph M; Sahin, Ugur

    2016-07-07

    MammaTyper is a novel CE-marked in vitro diagnostic RT-qPCR assay which assigns routinely processed breast cancer specimens into the molecular subtypes Luminal A-like, Luminal B-like (HER2 positive or negative), HER2 positive (non-luminal) and Triple negative (ductal) according to the mRNA expression of ERBB2, ESR1, PGR and MKI67 and the St Gallen consensus surrogate clinical definition. Until now and regarding formalin-fixed, paraffin-embedded material (FFPE), this has been a task mostly accomplished by immunohistochemistry (IHC). However the discrepancy rates of IHC for the four breast cancer biomarkers are frequently under debate, especially for Ki-67 which carries the highest degree of inter- and even intra-observer variability. Herein we describe a series of studies in FFPE specimens which aim to fully validate the analytical performance of the MammaTyper assay, including the site to site reproducibility of the individual marker measurements. Tumor RNA was extracted with the novel RNXtract RNA extraction kit. Synthetic RNA was used to assess the sensitivity of the RNXtract kit. DNA and RNA specific qPCR assays were used so as to determine analyte specificity of RNXtract. For the assessment of limit of blank, limit of detection, analytical measurement range and PCR efficiency of the MammaTyper kit serial dilutions of samples were used. Analytical precision studies of MammaTyper were built around two different real time PCR platforms and involved breast tumor samples belonging to different subtypes analyzed across multiple sites and under various stipulated conditions. The MammaTyper assay robustness was tested against RNA input variations, alternative extraction methods and tumor cell content. Individual assays were linear up to at least 32.33 and 33.56 Cqs (quantification cycles) for the two qPCR platforms tested. PCR efficiency ranged from 99 to 109 %. In qPCR platform 1, estimates for assay specific inter-site standard deviations (SD) were between 0.14 and

  4. Technical validation of an RT-qPCR in vitro diagnostic test system for the determination of breast cancer molecular subtypes by quantification of ERBB2, ESR1, PGR and MKI67 mRNA levels from formalin-fixed paraffin-embedded breast tumor specimens

    International Nuclear Information System (INIS)

    Laible, Mark; Schlombs, Kornelia; Kaiser, Katharina; Veltrup, Elke; Herlein, Stefanie; Lakis, Sotiris; Stöhr, Robert; Eidt, Sebastian; Hartmann, Arndt; Wirtz, Ralph M.; Sahin, Ugur

    2016-01-01

    MammaTyper is a novel CE-marked in vitro diagnostic RT-qPCR assay which assigns routinely processed breast cancer specimens into the molecular subtypes Luminal A-like, Luminal B-like (HER2 positive or negative), HER2 positive (non-luminal) and Triple negative (ductal) according to the mRNA expression of ERBB2, ESR1, PGR and MKI67 and the St Gallen consensus surrogate clinical definition. Until now and regarding formalin-fixed, paraffin-embedded material (FFPE), this has been a task mostly accomplished by immunohistochemistry (IHC). However the discrepancy rates of IHC for the four breast cancer biomarkers are frequently under debate, especially for Ki-67 which carries the highest degree of inter- and even intra-observer variability. Herein we describe a series of studies in FFPE specimens which aim to fully validate the analytical performance of the MammaTyper assay, including the site to site reproducibility of the individual marker measurements. Tumor RNA was extracted with the novel RNXtract RNA extraction kit. Synthetic RNA was used to assess the sensitivity of the RNXtract kit. DNA and RNA specific qPCR assays were used so as to determine analyte specificity of RNXtract. For the assessment of limit of blank, limit of detection, analytical measurement range and PCR efficiency of the MammaTyper kit serial dilutions of samples were used. Analytical precision studies of MammaTyper were built around two different real time PCR platforms and involved breast tumor samples belonging to different subtypes analyzed across multiple sites and under various stipulated conditions. The MammaTyper assay robustness was tested against RNA input variations, alternative extraction methods and tumor cell content. Individual assays were linear up to at least 32.33 and 33.56 Cqs (quantification cycles) for the two qPCR platforms tested. PCR efficiency ranged from 99 to 109 %. In qPCR platform 1, estimates for assay specific inter-site standard deviations (SD) were between 0.14 and 0

  5. Oil use of the effluent plant ETEO (Effluent Station of Oil Treatment) as combustible for generation of energy in the power plant UG-50Hz; Utulizacao de oleo da ETEO (Estacao de Tratamento de Efluentes Oleosos) para geracao de energia na UG-50Hz

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Jose Francisco de; Nascimento, Jose Maria do; Silva, Luiz Antonio da; Salazar, Marcos Vinicios; Baptista, Reinaldo Lopes; Barros, Sueli Aguiar [Companhia Siderurgica Nacional (CSN), Volta Redonda, RJ (Brazil)

    2009-11-01

    The areas of finishing products of CSN Steel Plant generate contaminated effluents with oil and grease , that are treated in ETEO (Effluent Station of Oil Treatment). In this plant, the oil is processed to be sold for the consuming market. However, some seasons of the year, the market does not absorb the oil, and CSN is obliged to defray the burning of this oil, to not interrupt the productive process and cause an environmental impact. Because of this situation, we search alternatives for the viable use of this oil inside CSN steel plant, taking care for the security of the processes and the impact to the environment. This paper describes the details of the work and the implantation of the burning of this oil of the ETEO with BPF oil (type of petrochemical oil) as combustible in the boiler 7 of the power plant UG 50 Hz. For the implantation of this project, operational contingencies of security for equipment was prepared . Moreover, the work included chemical analyses of the oil and the conditions of the boiler using this mixing of oils. The reached results demonstrate the total viability of this project and it was proved another alternative of the use of this residue, with reduction of the fuel costs , steam costs and the electric energy generated in the power plant of CSN. (author)

  6. Wybrane problemy koncentracji i centralizacji ziemi w PGR w Polsce

    OpenAIRE

    Ławniczak, Irena

    1988-01-01

    The subject-matter of the article is to present the process of concentration, déconcentration and centralization of land in the state sector of Polish agriculture in years 1950 - 1984. In turn, the purpose of the work is to find whether those processes were an objective phenomenon resulting from the level of development of production forces or — to the contrary — whether they were a consequence of administrative and political decisions made by central economic authorities and ...

  7. P.G.R. de Villiers Dedication – A tribute

    African Journals Online (AJOL)

    has been the Executive Director of the Centre for Christian Spirituality and Ethics since 1990 and has ... with Greek and Hebrew as majors, Philosophy, Psychology, Latin and .... Supervised master's and doctoral theses at the Universities of.

  8. Effect of high-dose ginsenoside complex (UG0712 supplementation on physical performance of healthy adults during a 12-week supervised exercise program: A randomized placebo-controlled clinical trial

    Directory of Open Access Journals (Sweden)

    Eon Sook Lee

    2018-04-01

    Full Text Available Background: Ginseng has been used as an ergogenic agent, although evidence for its effectiveness is weak. A randomized, double-blind, placebo-controlled clinical trial was conducted to evaluate the effect of a ginsenoside complex (UG0712 on changes in exercise performance. Methods: Sedentary individuals (n=117 were randomly assigned into one of three groups: low-dose ginsenoside supplementation (100 mg/d, n=39, high-dose ginsenoside supplementation (500 mg/d, n=39, or a placebo group (500 mg/d, n=39. All participants underwent a supervised 12-wk aerobic and resistance exercise training course. To assess the effects of supplementation on physical performance, maximal oxygen consumption (VO2max, anaerobic threshold (AT, lactic acid, and muscle strength of the dominant knee were measured at baseline, every visit, and after the training program. Results: Both ginsenoside groups showed significant increases in VO2max and muscular strength during exercise training. There were no definite changes in AT and lactic acid levels over time. After exercise training, there were definite differences in the VO2max (28.64.9 to 33.7±4.9 ml/kg/min in high-dose group vs. 30.4±6.7 to 32.8±6.6 ml/kg/min in placebo, p=0.029 and AT (19.3±4.2 to 20.9±3.5 ml/kg/min in high-dose group vs. 20.0±5.1 to 20.0±4.9 ml/kg/min in placebo, p=0.038 between the high-dose ginsenoside and placebo groups. However, there was no difference in VO2max between the low-dose ginsenoside and placebo groups (p=0.254. There were no differences in muscular strength during exercise training among the three groups. Conclusion: High-dose ginsenoside supplementation (UG0712 augmented the improvement of aerobic capacity by exercise training. Keywords: cardiopulmonary exercise test, ginsenoside, Panax ginseng, randomized controlled trial

  9. Porównywalność w czasie informacji o wynikach działalności społecznie odpowiedzialnej firm raportujących według zasad GRI

    Directory of Open Access Journals (Sweden)

    Halina Waniak-Michalak

    2017-06-01

    Full Text Available Porównywalność w czasie informacji o wynikach działalności społecznie odpowiedzialnej firm raportujących według zasad GRI The involvement of corporations in corporate social responsibility (CSR activities with respect for work- ers' rights and ethical principles brings tangible benefits to the enterprise. CSR activities can therefore be considered as an investment, the effects of which should be measured. CSR benefits derive from im- proved assessment of the corporation by the stakeholders and increased social trust. However, in order to achieve the desired results of CSR activities, it is necessary to provide adequate information to customers, employees and owners. Moreover, the measurement of CSR results is necessary to determine the effec- tiveness of the actions taken. The aim of the article was to answer the question if companies present the same measures in successive CSR reports and whether it is possible to compare the CSR activity results for successive years. Examination of 31 CSR reports for two consecutive editions of the reporting showed that companies change the number and type of disclosed measures.

  10. Dissection of the multigenic wheat stem rust resistance present in the Montenegrin spring wheat accession PI 362698

    Science.gov (United States)

    Research to identify and characterize stem rust resistance genes in common wheat, Triticum aestivum, has been stimulated by the emergence of Ug99-lineage races of the wheat stem rust pathogen, Puccinia graminis f. sp. tritici (Pgt), in Eastern Africa. The Montenegrin spring wheat landrace PI 362698 ...

  11. Mapping and characterization of wheat stem rust resistance genes SrTm5 and Sr60 from Triticum monococcum

    Science.gov (United States)

    The emergence and spread of new virulent races of the wheat stem rust pathogen (Puccinia graminis f. sp. tritici; Pgt), including the TTKSK (Ug99) race group, is a serious threat to global wheat production. In this study, we mapped and characterized two stem rust resistance genes from diploid wheat ...

  12. Molecular and cytogenetic characterization of wheat introgression lines carrying the stem rust resistance gene Sr39.

    Science.gov (United States)

    Stem rust, caused by Puccinia graminis Pers.:Pers. f.sp. tritici Eriks. and Henn., poses a serious threat to global wheat production because of the emergence of Pgt-TTKSK (Ug99). The TTKSK resistant gene Sr39 was derived from Aegilops speltoides through chromosome translocation. In this study, we ch...

  13. Language specific bootstraps for UG categories

    NARCIS (Netherlands)

    van Kampen, N.J.

    2005-01-01

    This paper argues that the universal categories N/V are not applied to content words before the grammatical markings for reference D(eterminers) and predication I(nflection) have been acquired (van Kampen, 1997, contra Pinker, 1984). Child grammar starts as proto-grammar with language-specific

  14. Email: pattuquayefio@ug.edu.gh

    African Journals Online (AJOL)

    Apusigah

    making. ... study, the article hints at possible implications of the co-optation of human ... shortage, health challenges such as the Human Immunodeficiency Virus (HIV), and the causes ... appropriate framework for considering such challenges.

  15. Op-Ug TD Optimizer Tool Based on Matlab Code to Find Transition Depth From Open Pit to Block Caving / Narzędzie Optymalizacyjne Oparte O Kod Matlab Wykorzystane Do Określania Głębokości Przejściowej Od Wydobycia Odkrywkowego Do Wybierania Komorami

    Science.gov (United States)

    Bakhtavar, E.

    2015-09-01

    In this study, transition from open pit to block caving has been considered as a challenging problem. For this purpose, the linear integer programing code of Matlab was initially developed on the basis of the binary integer model proposed by Bakhtavar et al (2012). Then a program based on graphical user interface (GUI) was set up and named "Op-Ug TD Optimizer". It is a beneficial tool for simple application of the model in all situations where open pit is considered together with block caving method for mining an ore deposit. Finally, Op-Ug TD Optimizer has been explained step by step through solving the transition from open pit to block caving problem of a case ore deposit. W pracy tej rozważano skomplikowane zagadnienie przejścia od wybierania odkrywkowego do komorowego. W tym celu opracowano kod programowania liniowego w środowisku MATLAB w oparciu o model liczb binarnych zaproponowany przez Bakhtavara (2012). Następnie opracowano program z wykorzystujący graficzny interfejs użytkownika o nazwie Optymalizator Op-Ug TD. Jest to niezwykle cenne narzędzie umożliwiające stosowanie modelu dla wszystkich warunków w sytuacjach gdy rozważamy prowadzenie wydobycia metodą odkrywkową oraz wydobycie komorowe przy eksploatacji złóż rud żelaza. W końcowej części pracy podano szczegółową instrukcję stosowanie programu Optymalizator na przedstawionym przykładzie przejścia od wydobycia rud żelaza metodami odkrywkowymi poprzez wydobycie komorami.

  16. Wpływy polskie w jidysz według "History of the Yiddish Language" Maxa Weinreicha – przegląd i próby weryfikacji

    Directory of Open Access Journals (Sweden)

    Michał Gajek

    2016-12-01

    Full Text Available Polish influence on Yiddish as described in Max Weinreich’s History of the Yiddish Language – overview and attempts at verification The Article concentrates on the findings regarding Slavic influence on Yiddish, described in the newest English-language edition of Max Weinreich’s History of the Yiddish Language – a canonical title for modern Yiddish studies. Its first task is to acquaint Polish readers with M. Weinreich’s propositions and findings on the general character of Polish-Yiddish and Slavic-Yiddish language contact. This will also be taken as an opportunity to briefly review the research on this subject conducted by Polish scholars. Additionally, the article will elaborate (albeit not exhaustively on the attempts to question and verify M. Weinreich’s theories which may prove interesting from the point of view of Slavic studies. Its second, equally important task is to describe chosen examples of the results of Slavic influence, in which Polish played a significant role, as they present themselves in the lexicon, morphology, word formation and syntax of Yiddish.   Wpływy polskie w jidysz według History of the Yiddish Language Maxa Weinreicha – przegląd i próby weryfikacji Artykuł skupia się na ustaleniach na temat wpływów słowiańskich w jidysz, zawartych w najnowszym, anglojęzycznym wydaniu pracy Maxa Weinreicha pt. History of the Yiddish Language, mającej status pozycji kanonicznej współczesnej jidyszystyki. Jego pierwszym celem jest przybliżenie polskiemu czytelnikowi tez i ustaleń M. Weinreicha, dotyczących ogólnego charakteru językowych kontaktów polsko- i słowiańsko-żydowskich. Przy tej okazji uwzględnione zostaną informacje na temat badań, jakie do tej pory poczynili w tej materii językoznawcy polscy. Ponadto (niewyczerpująco poruszona zostanie kwestia prób weryfikacji i podważenia jego twierdzeń, interesująca z punktu widzenia slawistyki. Drugim, nie mniej wa

  17. Estimation of PGR Induced Absolute Gravity Changes at Greenland GNET Stations

    DEFF Research Database (Denmark)

    Nielsen, Emil; Strykowski, Gabriel; Forsberg, René

    2011-01-01

    An important subject in the climate debate is the study of the major ice sheets mass balance. Knowledge of the mass balance provides understanding of changes in the relative sea-level (RSL). Several methods are used for mass balance studies but they are associated with large uncertainties. One re...

  18. Aplication Of PGR IAA And Kinetin On Rubber Clones To Accelarate Mature Tapping

    Directory of Open Access Journals (Sweden)

    Try Koryati

    2017-09-01

    Full Text Available This study aims to determine the most appropriate concentration of IAA hormones Kinetin on rubber clones to accelerate the mature tapping. Experiments have been carried out in Karang Inong Plantation PTP N I Langsa East Aceh. This study is arranged in two factors of Nested Design. Clones factor is consisted of 5 level and IAA hormon Kinetin factor has 7 levels. The results showed that the concentration of IAA hormones Kinetin is different to each clone to accelerate mature tapping. Application of IAA hormone Kinetin significantly affect the parameters of girth bark thickness number of latex vessels latex vessel diameter leaf area and the amount of chlorophyll. Application of IAA 600ppm Kinetin 60 ppm H6 show the largest increase on the girth. Clone treatment is also has significant effect on all parameters but the largest girth found in clones PB 330 and IRR 5. Combination of Clones with IAA hormone Kinetin significantly affects the bark thickness the number of latex vessels and latex vessel diameter. Application of IAA 400 ppm Kinetin 60 ppm has no significant effect on girth but able to accelerate the mature tapping particularly for clones PB 330 and IRR5 K2H4 and K5H4 as indicated by girth size namely 48.15 cm and 48.20 cm respectively at planting age 46 months.

  19. Language: UG or not to be, that is the question.

    Science.gov (United States)

    Bolhuis, Johan J; Tattersall, Ian; Chomsky, Noam; Berwick, Robert C

    2015-02-01

    Language is not the same as speech or communication; rather, it is a computational cognitive system. It has appeared very recently, consistent with a minimalist view of language's hierarchical syntactic structure.

  20. UG311, An Oncofetal Marker Lost with Prostate Cancer Progression

    Science.gov (United States)

    2001-04-01

    resulted in neonatal lethality and further exacerbation of the dwarfism to about 30% of control size [28]. By contrast, the overexpression of GH or IGF-1...inhibitory as retinoic acid (RA) treatment initiates rapid degradation of IGFBP-2 and an increased synthesis of IGF-2 [127]. As RA promotes cell growth both...upregulation of IGFBP-2 mRNA in response to low dose androgen treatment in the LNCaP human prostate cancer cell line. It is not clear 19 whether this is

  1. Stworzenie świata według Leibniza

    Directory of Open Access Journals (Sweden)

    Michał Heller

    2008-06-01

    Full Text Available Leibniz's idea of creation is best epitomized by a note written by him on the margin of his work entitled 'Dialogus'. The note reads:'When God thinks things through and calculates, the world is made'. Simple calculations are almost mechanical. The true mathematical thinking begins when one is confronted with a problem that has to be solved, when starting from the known mathematical structure one has to construct a new structure, to comprehend its intricacies, the ways of its functioning, and its connections with other mathematical structures. And when one successfully applies the new mathematical structure to a physical theory, the new world is made. This was Leibniz's experience when he was discovering calculus and tried to apply it to mechanical problems. Leibniz's doctrine that our world is the best of all possible words is often ridiculed, but this attitude is the result of a very superficial reading of Leibniz's texts. In fact, God's calculations to choose the best possible world are similar to solving the variational problem in mathematics. Leibniz claims that in mathematical reasoning if there is neither 'maximum' nor 'minimum' nothing can happen. Similarly, if there were no world better that other possible worlds, God's wisdom would have not been able to create anything. Some consequences of this doctrine, concerning the nature of space, time and causality, are also considered.

  2. Module Cluster: UG - 001.00 (GSC) Urban Geography.

    Science.gov (United States)

    Currier, Wade R.

    This is one of several module clusters developed for the Camden Teacher Corps project. This module cluster is designed to introduce students to urban studies through the application of a geographic approach. Although geography shares with other social sciences many concepts and methods, it has contributed a distinctive set of viewpoints and a…

  3. Language: UG or not to be, that is the question.

    Directory of Open Access Journals (Sweden)

    Johan J Bolhuis

    2015-02-01

    Full Text Available Language is not the same as speech or communication; rather, it is a computational cognitive system. It has appeared very recently, consistent with a minimalist view of language's hierarchical syntactic structure.

  4. Language : UG or not to be, that is the question

    NARCIS (Netherlands)

    Bolhuis, Johan J; Tattersall, Ian; Chomsky, Noam; Berwick, Robert C

    Language is not the same as speech or communication; rather, it is a computational cognitive system. It has appeared very recently, consistent with a minimalist view of language's hierarchical syntactic structure.

  5. Homocysteine-lowering effect of 500 ug folic acid every other day versus 250 ug/day

    NARCIS (Netherlands)

    Brouwer, I.A.; Rooij, van I.A.L.M.; Dusseldorp, van M.; Thomas, C.M.G.; Blom, H.J.; Hautvast, J.G.A.J.; Eskes, T.K.A.B.

    2000-01-01

    Elevated plasma total homocysteine (tHcy) concentrations are a risk factor for neural tube defects and vascular diseases. Supplementation with folic acid decreases tHcy. We investigated whether supplementation with 500 ?g folic acid every other day is as effective in lowering tHcy as 250 ?g folic

  6. Data summary report on short-term turbidity monitoring of pipeline river crossings in the Moyie River, Boundary County, Idaho: PGT-PG&E Pipeline Expansion Project

    Energy Technology Data Exchange (ETDEWEB)

    Gowdy, M.J.; Smits, M.P.; Wilkey, P.L.; Miller, S.F.

    1994-03-01

    A water-quality monitoring program was implemented for Bechtel Corporation to measure the short-term increases in turbidity in the Moyie River caused by construction activities of the Pacific Gas Transmission-Pacific Gas & Electric Pipeline Expansion Project. Construction of the buried, 42-in.-diameter, steel pipeline, during the summer of 1992, involved eight wet crossings of the Moyie River along the 13-mi section of pipeline immediately south of the Canadian-United States border in Boundary County, Idaho. This report summarizes the sampling and analysis protocol used and gives the results and observations for each of the eight crossings. The data obtained from this monitoring program, in addition to satisfying regulatory requirements for the Pipeline Expansion Project, will contribute to an ongoing long-term study of the Moyie River crossings being performed for the Gas Research Institute by Argonne National Laboratory. The purpose of this document is strictly limited to reporting the results of the monitoring program. Interpretation of the data is not within the scope of this report.

  7. Suppressive effects of Calendula micrantha essential oil and gibberelic acid (PGR) on repro ductive potential of the Mediterranean fruit fly Ceratitis capitata Wied. (Diptera: Tephritidae).

    Science.gov (United States)

    Hussein, Karam T

    2005-08-01

    The volatile oil of Calendula micrtantha plant was extracted and the components were identified by Gc/Ms. Adulticidal efficiency of the volatile oil and gibberelic acid "plant growth promoting hormone" as well as their mixture was assessed against the Mediterranean fruit fly Ceratitis capitata. The result showed that the two compounds capable have characteristic resembling to insect juvenile hormones and have suppressive effect on reproductive potential. They induced the significant disturbances in the ovarian protein fraction and the amino acids patterns.

  8. Rola negacji w opisie świata według arystotelesowskiej Metafizyki

    Directory of Open Access Journals (Sweden)

    Jan BIGAJ

    2012-12-01

    Full Text Available The notions of „being” and „non-being” have entered philosophical language, forming thebasis of ontology and meontology, as the counterparts of the Greek expressions to o]n and tomh o]n (nominalised forms, affirmative and negative, of the participle of the verb ei=nai.Originally, however, these expressions did not have any objectifying meaning, but played therole of meta-language names, representing the copula ei=nai in all its forms, most generallyin its affirmative and negative forms. The copula itself, which in later philosophy took on theexistential meaning, had functioned only as a semantically empty connective of predicates.Over time the participle o]n has been used as a universal name of all predicates.The above-mentioned expressions became central in Greek philosophical terminologythanks to the debates, initiated by Parmenides, on the role of negation in the description of theworld. Parmenides himself proposed a complete excision of negative sentences as describing byelimination, and created a positive-monistic system which abandoned multiplicity, divisibility,and variability. Later philosophers defended negation, fighting back against the paradoxesformulated by the Eleatics and later by the Sophists.Plato observed that without negation it is impossible to describe the multiplicity of things.He also distinguished a relative negation which does not eliminate anything but makes it possibleto confront some things with others. According to the atomists, the divisibility of physicalthings forces us to accept that they consist of a positive element in the form of an impenetrablebody, and of another element lacking any characteristics, i.e. the void. Finally, Aristotle, whenanalysing the process of change, justified the consistency of the statement that something comesout of “not being” and “being”, under the assumption that the former is understood as beingactual, and the latter as being potential. In all these conceptions there is nothing non-existent,there are only proposals of how to identify the aspects of reality whose explanation justifiesthe use of negation.The affirmative and negative forms of the above expressions have also provoked reflectionon the problem of truth and falsity. It has been observed that they are used in everyday language not only to state an agreement or disagreement with the actual facts of the matter, but also toaffirm or deny something.

  9. Gender Studies Course at UG/PG Levels and Gender Awareness Training to Teachers

    Science.gov (United States)

    Kuruvilla, Moly

    2014-01-01

    While the UGC is committed to the cause of promoting gender equity through higher education and is in the process of reviewing the existing arrangements in the campuses of higher learning to ensure the freedom, safety and security of girls and women, the proactive role of teachers in solving the problems of gender based violence and other…

  10. Inheritance of resistance to Ug99 stem rust pathogen in selected ...

    African Journals Online (AJOL)

    13 × 08-UT-86 (χ2 0.05 = 0.480, P ≥ 0.488), HKBL-1385-13 × 09-N2-19 (χ2 0.05 = 0.641, P ≥ 0.424), ND2649 × 09-AB-78 (χ2 0.05 = 1.05, P ≥ 0.309) and ND25882 × 09-AB-78 (χ2 0.05 = 3.599, P ≥ 0.058) exhibited Mendelian segregation ...

  11. Sequencing Ug99 and Other Stem Rust Races: Progress and Results

    Science.gov (United States)

    Over the last decade a number of different molecular methods have been used to characterize genetic diversity in Puccinia graminis. Multilocus DNA fingerprinting methods (AFLPs, RAPDs, SAMs and S-SAPs) have proven to be useful, but limited to phenotypic analysis due to the dikaryotic nature of rust ...

  12. Odnowa filozofii według Hilarego Putnama (Hilary Putnam's Renewal of Philosophy

    Directory of Open Access Journals (Sweden)

    Tadeusz Szubka

    2011-09-01

    Full Text Available Hilary Putnam is widely considered as one of the most distinguished and important philosophers in the analytic tradition of the last fifty years. However, in his most recent publications he has started to emphasize various shortcomings and limitations of that powerful tradition, connected especially with its scientism andnaturalism. He has also insisted that what we really need is a serious renewal and transformation of philosophy, drawing upon other philosophical traditions, including pragmatism. We should realize that although philosophy overlaps in some parts with science, it cannot be turned into a science. It is a humanistic enterprise havingtwo dimensions, theoretical and moral, and it is unfortunate when we tend to forget about either of them.

  13. Analytical study on U/G coal mine CPT and inferences

    Energy Technology Data Exchange (ETDEWEB)

    Dey, N.C.; Mukhopadhyay, S. [Bengal Engineering College, Howrath (India). Dept. of Mining and Geology

    1999-08-01

    The analytical aspects of underground CPT (coal mine cost per tonne), which varies from mine to mine due to the different weightages of various contributing factors, are described. The CPT is not only dictated by the increasing wages but also by the availability of man-hour and accountability of machine utilization. An optimal blend of labour-intensive and machine-intensive methods involving least investment and operating cost, is a challenge for the coal industry. Technology upgradation and implementation, higher skill and morale, excellence in planning and monitoring, optimization in capacity utilization, and better consumer acceptability of coal will consistently improve the financial health of the coal mining sector. Other factors which will help improve the financial health of coal mining industries are (1) cost propaganda like safety week celebration; (2) cost consciousness at all levels; (3) noticeboard comprising the cost of man-hour and machine- hour; (4) no idle time for men as well as machine; (5) care to increase the life of machines; (6) scope of target amendment in a year; (7) prior to introducing costly machines, due weightage to be given on coal grade, mine life, geo-mining conditions; and (8) award to most economic mine and punishment to others rated below the BEP (break- even point). 2 refs., 3 figs.

  14. Reliable discrimination of high explosive and chemical/biological artillery using acoustic UGS

    Science.gov (United States)

    Hohil, Myron E.; Desai, Sachi

    2005-10-01

    The Army is currently developing acoustic overwatch sensor systems that will provide extended range surveillance, detection, and identification for force protection and tactical security on the battlefield. A network of such sensors remotely deployed in conjunction with a central processing node (or gateway) will provide early warning and assessment of enemy threats, near real-time situational awareness to commanders, and may reduce potential hazards to the soldier. In contrast, the current detection of chemical/biological (CB) agents expelled into a battlefield environment is limited to the response of chemical sensors that must be located within close proximity to the CB agent. Since chemical sensors detect hazardous agents through contact, the sensor range to an airburst is the key-limiting factor in identifying a potential CB weapon attack. The associated sensor reporting latencies must be minimized to give sufficient preparation time to field commanders, who must assess if an attack is about to occur, has occurred, or if occurred, the type of agent that soldiers might be exposed to. The long-range propagation of acoustic blast waves from heavy artillery blasts, which are typical in a battlefield environment, introduces a feature for using acoustics and other disparate sensor technologies for the early detection and identification of CB threats. Employing disparate sensor technologies implies that warning of a potential CB attack can be provided to the solider more rapidly and from a safer distance when compared to that which conventional methods allow. This capability facilitates the necessity of classifying the types of rounds that have burst in a specified region in order to give both warning and provide identification of CB agents found in the area. In this paper, feature extraction methods based on the discrete wavelet transform (DWT) and multiresolution analysis facilitate the development of a robust classification algorithm that affords reliable discrimination between conventional and simulated chemical/biological artillery rounds using acoustic signals produced during detonation. Distinct characteristics arise within the different airburst signatures because high explosive warheads emphasize concussive and shrapnel effects, while chemical/biological warheads are designed to disperse their contents over large areas, therefore employing a slower burning, less intense explosive to mix and spread their contents. The ensuing blast waves are readily characterized by variations in the corresponding peak pressure and rise time of the blast, differences in the ratio of positive pressure amplitude to the negative amplitude, and variations in the overall duration of the resulting waveform. We show that, highly reliable discrimination (> 98%) between conventional and potentially chemical/biological artillery is achieved at ranges exceeding 3km. A feedforward neural network classifier, trained on a feature space derived from the distribution of wavelet coefficients found within different levels of the multiresolution decomposition yields.

  15. Remotely sensing the thickness of the bushveld complex UG2 platinum reef using borehole rada.

    CSIR Research Space (South Africa)

    Simmat, CM

    2006-03-01

    Full Text Available The planar, 80 cm thick, lousy dielectric reefs of the Bushveld are embedded in rocks that are almost transparent at ground penetrating radar frequencies of 10–125 MHz. Pothole sensing practices are based largely on using borehole radars to observe...

  16. Kontemplacja i ekspresja – Śakuntala Kalidasy według Jerzego Grotowskiego

    OpenAIRE

    Kołdrzak, Elżbieta

    2012-01-01

    Zrealizowana przez Jerzego Grotowskiego w Teatrze 13 Rzędów, już ponad 50 lat temu, Śakuntala Kalidasy przeszła do historii nie tylko jako kolejna z zachodnich scenicznych wersji tego słynnego dramatu indyjskiego, ale przede wszystkim jako wyznacznik poszukiwań teatralnych oraz poszukiwań nowego paradygmatu techniki aktorskiej prowadzonych przez zespół Grotowskiego. Zarówno sposób opracowania oryginalnego tekstu Kalidasy (Prolog zawierający mantry śiwaickie, redukcja akcji do w...

  17. Etiologia, objawy i leczenie infekcyjnego zapalenia wsierdzia według aktualnych wytycznych Europejskiego Towarzystwa Kardiologicznego

    Directory of Open Access Journals (Sweden)

    Anna Adamska-Wełnicka

    2013-04-01

    Full Text Available Infekcyjne zapalenie wsierdzia (IZW cechuje niejednorodny obraz kliniczny, z pogranicza przewlekłych, nie‑ sprecyzowanych chorób infekcyjnych, autoimmunologicznych, reumatologicznych oraz nowotworowych. Szybka diagnostyka i włączenie leczenia celowanego IZW są konieczne z uwagi na poważne rokowanie i bez‑ pośrednie zagrożenie życia pacjenta. W procesie IZW w obrębie zastawek serca tworzą się konglomeraty bak‑ terii, komórek zapalnych, płytek krwi i włóknika, zwane wegetacjami. Dotyczą najczęściej zastawek lewej strony serca. Wegetacje doprowadzają do miejscowej destrukcji wsierdzia oraz stanowią źródło zatorowości obwo‑ dowej. Najczęstszym objawem IZW jest gorączka, natomiast w badaniu przedmiotowym zwraca uwagę nowy szmer wysłuchiwany nad sercem, świadczący o uszkodzeniu zastawek lub nici ścięgnistych. Zdarza się, że pierwszym symptomem choroby są zaburzenia neurologiczne spowodowane udarem mózgu powstałym w mechanizmie zatorowym. W ostatnim czasie wzrasta liczba zachorowań na IZW związanych ze stosowa‑ nymi procedurami inwazyjnymi wewnątrzsercowymi z implantacją sztucznych zastawek oraz elektrod. Szczególną grupę chorych stanowią również narkomani, u których najczęściej dochodzi do zajęcia zastawek prawej strony serca. Głównym czynnikiem etiologicznym zapalenia wsierdzia są bakterie, wśród nich obecnie dominują zakażenia gronkowcowe. Rozpoznanie choroby opiera się na danych klinicznych, obrazie echokar‑ diograficznym oraz badaniach bakteriologicznych krwi. Leczeniem przyczynowym IZW jest antybiotykotera‑ pia wielolekowa prowadzona w warunkach szpitalnych. Konieczne jest ścisłe monitorowanie choroby i roz‑ ważenie wskazań do leczenia kardiochirurgicznego. Istotnym zagadnieniem są również metody zapobiegania zakażeniom wsierdzia. Zasady profilaktyki IZW na przestrzeni ostatnich lat uległy znacznym modyfikacjom. Infekcyjne zapalenie wsierdzia wciąż pozostaje chorobą o poważnym rokowaniu, niejednokrotnie kończącą się zgonem pacjenta, a podstawowa wiedza o tym schorzeniu wydaje się niezbędna dla każdego lekarza.

  18. Lr67/Yr46 confers adult plant resistance to stem rust and powdery mildew in wheat.

    Science.gov (United States)

    Herrera-Foessel, Sybil A; Singh, Ravi P; Lillemo, Morten; Huerta-Espino, Julio; Bhavani, Sridhar; Singh, Sukhwinder; Lan, Caixia; Calvo-Salazar, Violeta; Lagudah, Evans S

    2014-04-01

    We demonstrate that Lr67/Yr46 has pleiotropic effect on stem rust and powdery mildew resistance and is associated with leaf tip necrosis. Genes are designated as Sr55, Pm46 and Ltn3 , respectively. Wheat (Triticum aestivum) accession RL6077, known to carry the pleiotropic slow rusting leaf and yellow rust resistance genes Lr67/Yr46 in Thatcher background, displayed significantly lower stem rust (P. graminis tritici; Pgt) and powdery mildew (Blumeria graminis tritici; Bgt) severities in Kenya and in Norway, respectively, compared to its recurrent parent Thatcher. We investigated the resistance of RL6077 to stem rust and powdery mildew using Avocet × RL6077 F6 recombinant inbred lines (RILs) derived from two photoperiod-insensitive F3 families segregating for Lr67/Yr46. Greenhouse seedling tests were conducted with Mexican Pgt race RTR. Field evaluations were conducted under artificially initiated stem rust epidemics with Pgt races RTR and TTKST (Ug99 + Sr24) at Ciudad Obregon (Mexico) and Njoro (Kenya) during 2010-2011; and under natural powdery mildew epiphytotic in Norway at Ås and Hamar during 2011 and 2012. In Mexico, a mean reduction of 41 % on stem rust severity was obtained for RILs carrying Lr67/Yr46, compared to RILs that lacked the gene, whereas in Kenya the difference was smaller (16 %) but significant. In Norway, leaf tip necrosis was associated with Lr67/Yr46 and RILs carrying Lr67/Yr46 showed a 20 % reduction in mean powdery mildew severity at both sites across the 2 years of evaluation. Our study demonstrates that Lr67/Yr46 confers partial resistance to stem rust and powdery mildew and is associated with leaf tip necrosis. The corresponding pleiotropic, or tightly linked, genes, designated as Sr55, Pm46, and Ltn3, can be utilized to provide broad-spectrum durable disease resistance in wheat.

  19. Mapping and characterization of wheat stem rust resistance genes SrTm5 and Sr60 from Triticum monococcum.

    Science.gov (United States)

    Chen, Shisheng; Guo, Yan; Briggs, Jordan; Dubach, Felix; Chao, Shiaoman; Zhang, Wenjun; Rouse, Matthew N; Dubcovsky, Jorge

    2018-03-01

    The new stem rust resistance gene Sr60 was fine-mapped to the distal region of chromosome arm 5A m S, and the TTKSK-effective gene SrTm5 could be a new allele of Sr22. The emergence and spread of new virulent races of the wheat stem rust pathogen (Puccinia graminis f. sp. tritici; Pgt), including the Ug99 race group, is a serious threat to global wheat production. In this study, we mapped and characterized two stem rust resistance genes from diploid wheat Triticum monococcum accession PI 306540. We mapped SrTm5, a previously postulated gene effective to Ug99, on chromosome arm 7A m L, completely linked to Sr22. SrTm5 displayed a different race specificity compared to Sr22 indicating that they are distinct. Sequencing of the Sr22 homolog in PI 306540 revealed a novel haplotype. Characterization of the segregating populations with Pgt race QFCSC revealed an additional resistance gene on chromosome arm 5A m S that was assigned the official name Sr60. This gene was also effective against races QTHJC and SCCSC but not against TTKSK (a Ug99 group race). Using two large mapping populations (4046 gametes), we mapped Sr60 within a 0.44 cM interval flanked by sequenced-based markers GH724575 and CJ942731. These two markers delimit a 54.6-kb region in Brachypodium distachyon chromosome 4 and a 430-kb region in the Chinese Spring reference genome. Both regions include a leucine-rich repeat protein kinase (LRRK123.1) that represents a potential candidate gene. Three CC-NBS-LRR genes were found in the colinear Brachypodium region but not in the wheat genome. We are currently developing a Bacterial Artificial Chromosome library of PI 306540 to determine which of these candidate genes are present in the T. monococcum genome and to complete the cloning of Sr60.

  20. for indoor residuAl sprAying in rAkAi district, ugAndA

    African Journals Online (AJOL)

    2011-11-11

    Nov 11, 2011 ... for irs and factors associated with willingness to accept use of ddt. Results: ... system alone (1) accounting for 30 to 50 percent of outpatient ... 9 to 14 percent of inpatient deaths; making Uganda ... a long residual effect and has lower operational cost .... reasons for their decision: fear of health effects from.

  1. Handling the problem of the brine tubing bend on the basis of experiences gained during UGS - Mogilno construction

    International Nuclear Information System (INIS)

    Zola, P.; Skwarczynski, S.

    2005-01-01

    In the article problems of brine tubing bending and bent string cutting methods in the well conditions has been described. Implementation of safety joint in the brine string as an alternative solution that eliminates the need of cutting has been presented as well. (authors)

  2. Odmiany rozumu ludzkiego według Emila Ciorana [Types on human reason according to Emil Cioran

    Directory of Open Access Journals (Sweden)

    Paweł Wójs

    2014-12-01

    Full Text Available Scattered remarks on different types of reason can be found in Emil Cioran’s books. In the here presented essay it was shown that all the distinguished varieties of reason are connected to each other and it is possible to talk about emerging of another type from the previous one. These types are: naïve reason, rationalistic reason, negating reason, doubtful reason and expanded reason. Naïve reason is the one that serves life without self-consciousness. Rationalistic reason makes decrees on reality. In his critical remarks Cioran describes rationalistic reason as being dangerous. Two other types of reason are the negating and the doubtful one. Cioran proves that affirmation leads human beings to giving up themselves and that liberation always comes through constant fight for negation. Negating reason is always turned towards something external to itself. Doubtful reason goes much further by actually turning against itself, it is in constant struggle against itself. Cioran describes this process as separating the reason and standing face to face with yourself. Therefore he is aware that only the reason itself can become a judge of reason. The fifth type of reason which can be distinguished in Cioran’s philosophy might be called the extended reason as it is a demand for unfolding the reason. When one realizes that there is nothing permanent in the world and cognition can’t bring any permanent results either, the reason according to Cioran might become active again by turning back towards reality – however without any further dogma of objective truth – and by using “flowing” ideas it can unite with reality.

  3. Discovery of a novel stem rust resistance allele in durum wheat that exhibits differential reactions to Ug99 isolates

    Science.gov (United States)

    Wheat stem rust, caused by Puccinia graminis f. sp. tritici Erikss. & E. Henn, can incur yield losses on susceptible cultivars of durum wheat, Triticum turgidum ssp. durum (Desf.) Husnot. Though several durum cultivars possess the stem rust resistance gene Sr13, additional genes in durum wheat effec...

  4. Jakość usług sportowo-rekreacyjnych = The quality of sport-recreation services

    Directory of Open Access Journals (Sweden)

    Agnieszka Widawska-Stanisz

    2015-11-01

    Abstract There is a description of sport- recreation services and their quality presented in this article. The most important factors determining the high quality of providing services and the meaning of quality standards in the process of providing sport- recreation services are shown. There are some research results conducted among residents of Silesia province on the offers of sport – recreation companies and the qualities of their services.       Key words: the quality of services, sport- recreation services, purchaser.

  5. Filozofia informatyki – młoda dyscyplina z długą historią

    Directory of Open Access Journals (Sweden)

    Paweł Polak

    2016-12-01

    Full Text Available In this publication R. Murawski's anthology of philosophy of computing was reviewed. This review shows that this branch of philosophy is considered as quite new, but it has a long history. Murawski's book is a very good introduction to philosophy of computing - both for IT professionals and students of philosophy.

  6. 46 CFR 54.15-15 - Relief devices for unfired steam boilers, evaporators, and heat exchangers (modifies UG-126).

    Science.gov (United States)

    2010-10-01

    ... atmospheric type designed for vapor discharge direct to a distiller with no shutoff valve in the discharge line. The distiller connected to atmospheric evaporators shall be fitted with a vent to prevent a...

  7. Failure of post-natal ductus arteriosus closure in prostaglandin transporter-deficient mice

    Science.gov (United States)

    Chang, Hee-Yoon; Locker, Joseph; Lu, Run; Schuster, Victor L.

    2010-01-01

    Background Prostaglandin E2 (PGE2) plays a major role both in maintaining patency of the fetal ductus arteriosus (DA) and in closure of the DA after birth. The rate- limiting step in PGE2 signal termination is PGE2 uptake by the transporter PGT. Methods and results To determine the role of PGT in DA closure, we used a gene-targeting strategy to produce mice in which PGT exon 1 was flanked by loxP sites. Successful targeting was obtained since neither mice hypomorphic at the PGT allele (PGT Neo/Neo) nor global PGT knockout mice (PGT −/−) exhibited PGT protein expression; moreover, embryonic fibroblasts isolated from targeted mice failed to exhibit carrier-mediated PGE2 uptake. Although born in a normal Mendelian ratio, no PGT −/− mice survived past post-natal day 1, and no PGT Neo/Neo mice survived past post-natal day 2. Necropsy revealed patent DA with normal intimal thickening but with dilated cardiac chambers. Both PGT Neo/Neo and PGT −/− mice could be rescued through the post-natal period by giving the mother indomethacin before birth. Rescued mice grew normally and had no abnormalities by gross and microscopic post-mortem analysis. In accord with PGT’s known role in metabolizing PGE2, rescued adult PGT −/− mice had lower plasma PGE2 metabolite levels, and higher urinary PGE2 excretion rates, than wild type mice. Conclusions PGT plays a critical role in closure of the DA after birth by ensuring a reduction in local and/or circulating PGE2 concentrations. PMID:20083684

  8. Čeština známá i neznámá - zemče, čugárek, strboulí.

    Czech Academy of Sciences Publication Activity Database

    Ireinová, Martina

    Č. 10 (2017), s. 8-8 Institutional support: RVO:68378092 Keywords : Czech Linguistic Atlas * dialectology * Czech dialects * Dictionary of Czech Dialects Subject RIV: AI - Linguistics OBOR OECD: Linguistics www.brno-komín.cz/kominsky.zpravodaj

  9. Całościowa ocena przewlekłej obturacyjnej choroby płuc według raportu GOLD 2011

    Directory of Open Access Journals (Sweden)

    Iwona Grzelewska-Rzymowska

    2013-06-01

    Full Text Available Autorzy omawiają nowe podejście do przewlekłej obturacyjnej choroby płuc, przedstawione w raporcie GOLD 2011. Przewlekła obturacyjna choroba płuc jest ogólnoświatowym problemem zdrowotnym. Badanie BOLD ujawniło, że rozpowszechnienie choroby jest różne w poszczególnych krajach i będzie czwartą przy‑ czyną zgonów w 2030 roku. Główną przyczyną przewlekłej obturacyjnej choroby płuc jest nałóg palenia tytoniu. Raport GOLD 2011 zaleca, aby postawienie diagnozy rozważyć, jeśli pacjent prezentuje takie obja‑ wy, jak: duszność, kaszel i odkrztuszanie wydzieliny z ekspozycją na czynniki ryzyka oraz z obecnością obtu‑ racji potwierdzonej wartością FEV1/ FVC < 0,70. Wskaźnik FEV1 okazał się niedostatecznym deskryptorem wpływu przewlekłej obturacyjnej choroby płuc na pacjenta. Jest to choroba złożona i różnorodna, zbadanie jej wpływu na zdrowie pacjenta wymaga walidowanych testów, takich jak BODE, ADO, DOSE. Raport GOLD 2011 zaleca stosowanie dwóch walidowanych testów: mMRC i CAT. Wskaźniki wentylacyjne są skla‑ syfikowane jako GOLD 1 i 2 (zaburzenia łagodne i umiarkowane oraz GOLD 3 i 4 (zaburzenia ciężkie i bar‑ dzo ciężkie. Zaostrzenia przewlekłej obturacyjnej choroby płuc są ustalane na podstawie wywiadu lub war‑ tości FEV1. Ostatecznie pacjentów można zakwalifikować do kategorii A, B, C lub D. Leczenie farmakologiczne powinno być ustalane po dokonaniu zindywidualizowanej oceny.

  10. Gruźlica – od diagnostyki do leczenia według standardów dla krajów Unii Europejskiej

    Directory of Open Access Journals (Sweden)

    Iwona Grzelewska-Rzymowska

    2013-09-01

    Full Text Available Autorzy przedstawiają dane epidemiologiczne odnoszące się do gruźlicy w niektórych krajach, w tym w Polsce. Gruźlica ciągle pozostaje priorytetowym wyzwaniem dla zdrowia publicznego. Obecnie stosowana chemioterapia jest skuteczna, ale długotrwała i kompleksowa. Poważny problem stanowią szczepy Mycobacterium tuberculosis oporne na leki przeciwprątkowe, szczególnie szczepy oporne na wiele leków (MDR-TB i te o rozszerzonej opor‑ ności (XDR-TB, oraz zakażenia HIV wśród chorych na gruźlicę. W październiku 2011 roku zostały sfinalizowane standardy dotyczące gruźlicy dla krajów Unii Europejskiej (European Union Standards for Tuberculosis Care, ESTC. Dokument ten pozostaje w zgodzie z definicjami i rekomendacjami WHO. ESTC składają się z czterech sekcji: diagnozowanie, leczenie, HIV i choroby współistniejące, zdrowie publiczne, które korespondują z Między‑ narodowymi Standardami Opieki nad Chorymi na Gruźlicę (ISTC z 2009 roku. W 2013 roku zostały opubliko‑ wane polskie rekomendacje. Autorzy komentują wszystkie odnoszące się do gruźlicy rekomendacje. Przedstawio‑ no objawy kliniczne gruźlicy i wybrane problemy gruźlicy utajonej (latent tuberculosis. Próbki wydzieliny oskrzelowej powinny być poddane badaniu mikroskopowemu, hodowli i testom lekowraźliwości. WHO rekomen‑ duje szybki test molekularny, który należy wykonać w dniu bakteriologicznej diagnozy gruźlicy. Wszyscy chorzy (w tym osoby zakażone HIV, którzy nie byli wcześniej leczeni i u których nie występują czynniki ryzyka oporności na leki, powinni otrzymywać przez 2 miesiące izoniazyd, ryfampicynę, pirazynamid i etambutol, a przez 4 miesiące izoniazyd i ryfampicynę. Niektóre standardy odnoszą się do gruźlicy dziecięcej. Infekcja wywołana przez Mycobacterium tuberculosis powinna zostać wykryta za pomocą testu tuberkulinowego lub testu uwalniania interferonu gamma (IGRA. Dzieci poniżej 5. roku życia i osoby zakażone HIV, u których stwierdzono gruźlicę utajoną, należy leczyć izoniazydem, jeśli nie stwierdza się u nich aktywnej gruźlicy.

  11. Classification of agricultural assets on the international accounting standard 41 Agriculture Klasyfikacja aktywów pochodzenia rolniczego według MSR 41 Rolnictwo

    Directory of Open Access Journals (Sweden)

    Dorota Czerwińska-Kayzer

    2011-12-01

    Full Text Available Agricultural activity is characterised by dissimilarity and complexity of economic events. Therefore, the assets related to agricultural activity, should be properly classified, as it affects the method of valuation and the company assessment. In the article the classification of agricultural assets has been presented in respect of IAS/IFRS 41 Agriculture.

  12. Raportowanie banków na temat zrównoważonego rozwoju według standardów Global Reporting Initiative

    Directory of Open Access Journals (Sweden)

    Ana Novokmet

    2016-09-01

    Full Text Available Rachunkowość zrównoważonego rozwoju, z jej ostatecznym produktem – raportami społecznej odpo-wiedzialności, jest nową dziedziną rachunkowości i koncentruje się na ocenie i monitorowaniu działań w zakresie zarządzania firmą, ochrony środowiska i integracji społecznej oraz interakcji z otoczeniem. Wśród kilku standardowych ram, firmy na całym świecie często wybierają wytyczne Sustainability Re-porting Global Reporting Initiative (GRI. Od roku 2000 wytyczne GRI ewoluowały i obecnie jest do-stępna czwarta ich generacja. Celem tego artykułu jest ocena raportowania społecznego w ramach zinte-growanych raportów w sektorze bankowym na przykładzie UniCredit Group, która działa w 15 krajach. Raportowanie zrównoważonego rozwoju stanie się obowiązkowe w Unii Europejskiej dla dużych firm, notowanych na giełdach spółek i jednostek interesu publicznego (na przykład banków ze średnim za-trudnieniem co najmniej 500 pracowników, począwszy od roku 2018 (dla działalności w 2017 r.. Wniniejszym artykule skoncentrowano się na krytycznej analizie treści raportu społecznego banku.

  13. Informatics Tools and Methods to Enhance U.S. Cancer Surveillance Research, UG3/UH3 | Informatics Technology for Cancer Research (ITCR)

    Science.gov (United States)

    The goal of this Funding Opportunity Announcement (FOA) is to advance surveillance science by supporting the development of new and innovative tools and methods for more efficient, detailed, timely, and accurate data collection by cancer registries. Specifically, the FOA seeks applications for projects to develop, adapt, apply, scale-up, and validate tools and methods to improve the collection and integration cancer registry data and to expand the data items collected. Population-based central cancer registries (a partnership must involve at least two different registries).

  14. Badania wartości ekonomicznej usług biblioteczno-informacyjnych i ich wpływu na otoczenie

    Directory of Open Access Journals (Sweden)

    Ewa Głowacka

    2011-01-01

    Full Text Available Biblioteki pełnią różnorodne funkcje we współczesnym otoczeniu społecznym. Uczestniczą w tworzeniu kapitału intelektualnego i społecznego, wpływają na wzrost korzyści ekonomicznych użytkowników i całego społeczeństwa. W artykule omówiono główne podejścia i metody badawcze w zakresie oceny korzyści ekonomicznych płynących z funkcjonowania bibliotek. Skupiono się na metodzie analizy kosztów w stosunku do korzyści (ang. CBA – cost-benefit analysis, metodzie analizy warunkowej (ang. CVM – contigent valuation method, określaniu wartości dodanej dla użytkownika (ang. consumer surplus method i metodologii oceny stopy wzrostu z inwestycji (ang. ROI – return of investment. Przeanalizowano również różne projekty badań prowadzone na świecie w tym zakresie.

  15. Registration of 'Linkert' spring wheat with good straw strength and field resistance to the Ug99 family of stem rust races

    Science.gov (United States)

    Straw strength is one of the most important criteria for spring wheat cultivar selection in the north central U.S. ‘Linkert’ (PI 672164) hard red spring wheat was released by the University of Minnesota Agricultural Experiment Station in 2013 and has very good straw strength, high grain protein con...

  16. First Report of the Ug99 race group of Wheat Stem Rust, Puccinia graminis f. sp. tritici, in Egypt in 2014

    DEFF Research Database (Denmark)

    Patpour, Mehran; Hovmøller, Mogens; Shahin, Atef

    2016-01-01

    , Kenya, Ethiopia, Sudan, Tanzania, Eritrea, Rwanda, South Africa, Zimbabwe, Mozambique, Yemen, and Iran (Patpour et al. 2015). In the 2014 crop season, the presence of virulence to Sr31 in Egypt was suspected based on preliminary field observations of high infection on sources of Sr31 planted...

  17. https://drive.google.com/file/d/138qVlHQbLvtZ8WhmKIoUgBQATnzNXztg/view

    Directory of Open Access Journals (Sweden)

    Zenia Isabel Castro-Borunda

    2017-07-01

    Full Text Available The objective of this research was to know the viability of project investment evaluation using a simulation strategy for financial projection, which incorporates quantitative primary data to go through the evaluation process and extract financial indicators for decision making and give an opinion which serves for obtaining a credit; the recent investigation was applied to students of Mexico National Technological Institue (TecNM, specifically at the campus (ITLM, in Los Mochis, Sinaloa in the course of Formulation and Evaluation of Investment Projects which belongs to the bachelor’s Degree in Business Administration. For this effect it’s important to give feedback that at present any company that needs to use a bank and not bank source of financing requires an investment project; this is the importance of this topic, for its relevance and opportunity; the loan institutions demand formality and presentation in the project for obtaining a credit, combined with the innovative or important of the business idea, this turns out to be a highly positive binomial, allowing that the small and medium enterprises (SMEs participate for getting a financial source for their business; depending the case, the companies could be in the stage of growth or in the stage of maturity, but the needs will be the same: they require cash flow to correct some specific needs and it only will be able by obtaining a credit from a bank or a government institution, such as the “Fideicomiso de Riesgo Compratido FIRCO” (Shared Risk Trust, “Fideicomiso instituido en Relación a la Agricultura FIRA” (Institutional Trust Regarding Agriculture, “Secretaría de Economía SE” (Ministry of Economy, “Secretaría de Agricultura y Ganadería, Desarrollo Rural, Pesca y Alimentación SAGARPA” (Ministry of Agriculture and Livestock, Rural Development, Fishing and Feeding, among others; these institutions guide in their varied programs to these companies in the process of consolidation or growth, but they require that their participation can be taken to develop and evaluate an investment to know their viability.

  18. The Past, Present, and Future of Preimplantation Genetic Testing.

    Science.gov (United States)

    Imudia, Anthony N; Plosker, Shayne

    2016-06-01

    Preimplantation genetic testing (PGT) of oocytes and embryos is the earliest form of prenatal testing. PGT requires in vitro fertilization for embryo creation. In the past 25 years, the use of PGT has increased dramatically. The indications of PGT include identification of embryos harboring single-gene disorders, chromosomal structural abnormalities, chromosomal numeric abnormalities, and mitochondrial disorders; gender selection; and identifying unaffected, HLA-matched embryos to permit the creation of a savior sibling. PGT is not without risks, limitations, or ethical controversies. This review discusses the techniques and clinical applications of different forms of PGT and the debate surrounding its associated uncertainty and expanded use. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Deep ancestry of programmed genome rearrangement in lampreys.

    Science.gov (United States)

    Timoshevskiy, Vladimir A; Lampman, Ralph T; Hess, Jon E; Porter, Laurie L; Smith, Jeramiah J

    2017-09-01

    In most multicellular organisms, the structure and content of the genome is rigorously maintained over the course of development. However some species have evolved genome biologies that permit, or require, developmentally regulated changes in the physical structure and content of the genome (programmed genome rearrangement: PGR). Relatively few vertebrates are known to undergo PGR, although all agnathans surveyed to date (several hagfish and one lamprey: Petromyzon marinus) show evidence of large scale PGR. To further resolve the ancestry of PGR within vertebrates, we developed probes that allow simultaneous tracking of nearly all sequences eliminated by PGR in P. marinus and a second lamprey species (Entosphenus tridentatus). These comparative analyses reveal conserved subcellular structures (lagging chromatin and micronuclei) associated with PGR and provide the first comparative embryological evidence in support of the idea that PGR represents an ancient and evolutionarily stable strategy for regulating inherent developmental/genetic conflicts between germline and soma. Copyright © 2017 Elsevier Inc. All rights reserved.

  20. Diuron treatment reveals the different roles of two cyclic electron transfer pathways in photosystem II in Arabidopsis thaliana.

    Science.gov (United States)

    Jin, Yujian; Chen, Si; Fan, Xiaoji; Song, Hao; Li, Xingxing; Xu, Jiahui; Qian, Haifeng

    2017-04-01

    Three ecotypes of Arabidopsis thaliana, ecotype Columbia (Wild type, Wt) and two mutants (pgr5 and ndf4), were used to evaluate the effects of diuron on photosynthetic activity of A. thaliana. It was found that diuron adversely affected the fresh weight and chlorophyll content of the plants. Chlorophyll fluorescence studies determined that the pgr5 mutant was more sensitive to diuron than Wt and the ndf4 mutant. Gene expression analysis revealed different roles for the two cyclic electron transfer (CET) pathways, NAD(P)H dehydrogenase (NDH) and proton gradient regulation (PGR5) pathways, in the plant after diuron treatment. For example, a gene in the NDH pathway, lhca5, was activated in the low dose (LD) group in the pgr5 mutant, but was down-regulated in the moderate dose (MD) group, along with two other NDH-related genes (ppl2 and ndhH). In the PGR5 pathway, the pgr5 gene was functional under conditions of increased stress (MD group), and was up-regulated to a greater extent in the ndf4 mutant than that in the Wt and pgr5 mutant. Our results suggest that the PGR5 pathway in plants is more important than the NDH pathway during resistance to environmental stress. Deficiencies in the PGR5 pathway could not be counteracted by the NDH pathway, but deficiencies in the NDH pathway could be overcome by stimulating PGR5. Copyright © 2016 Elsevier B.V. All rights reserved.

  1. Identification of New Resistance Loci to African Stem Rust Race TTKSK in Tetraploid Wheats Based on Linkage and Genome-Wide Association Mapping.

    Science.gov (United States)

    Laidò, Giovanni; Panio, Giosuè; Marone, Daniela; Russo, Maria A; Ficco, Donatella B M; Giovanniello, Valentina; Cattivelli, Luigi; Steffenson, Brian; de Vita, Pasquale; Mastrangelo, Anna M

    2015-01-01

    Stem rust, caused by Puccinia graminis Pers. f. sp. tritici Eriks. and E. Henn. (Pgt), is one of the most destructive diseases of wheat. Races of the pathogen in the "Ug99 lineage" are of international concern due to their virulence for widely used stem rust resistance genes and their spread throughout Africa. Disease resistant cultivars provide one of the best means for controlling stem rust. To identify quantitative trait loci (QTL) conferring resistance to African stem rust race TTKSK at the seedling stage, we evaluated an association mapping (AM) panel consisting of 230 tetraploid wheat accessions under greenhouse conditions. A high level of phenotypic variation was observed in response to race TTKSK in the AM panel, allowing for genome-wide association mapping of resistance QTL in wild, landrace, and cultivated tetraploid wheats. Thirty-five resistance QTL were identified on all chromosomes, and seventeen are of particular interest as identified by multiple associations. Many of the identified resistance loci were coincident with previously identified rust resistance genes; however, nine on chromosomes 1AL, 2AL, 4AL, 5BL, and 7BS may be novel. To validate AM results, a biparental population of 146 recombinant inbred lines was also considered, which derived from a cross between the resistant cultivar "Cirillo" and susceptible "Neodur." The stem rust resistance of Cirillo was conferred by a single gene on the distal region of chromosome arm 6AL in an interval map coincident with the resistance gene Sr13, and confirmed one of the resistance loci identified by AM. A search for candidate resistance genes was carried out in the regions where QTL were identified, and many of them corresponded to NBS-LRR genes and protein kinases with LRR domains. The results obtained in the present study are of great interest as a high level of genetic variability for resistance to race TTKSK was described in a germplasm panel comprising most of the tetraploid wheat sub-species.

  2. Genome-Wide Association Mapping of Stem Rust Resistance in Hordeum vulgare subsp. spontaneum.

    Science.gov (United States)

    Sallam, Ahmad H; Tyagi, Priyanka; Brown-Guedira, Gina; Muehlbauer, Gary J; Hulse, Alex; Steffenson, Brian J

    2017-10-05

    Stem rust was one of the most devastating diseases of barley in North America. Through the deployment of cultivars with the resistance gene Rpg1 , losses to stem rust have been minimal over the past 70 yr. However, there exist both domestic (QCCJB) and foreign (TTKSK aka isolate Ug99) pathotypes with virulence for this important gene. To identify new sources of stem rust resistance for barley, we evaluated the Wild Barley Diversity Collection (WBDC) (314 ecogeographically diverse accessions of Hordeum vulgare subsp. spontaneum ) for seedling resistance to four pathotypes (TTKSK, QCCJB, MCCFC, and HKHJC) of the wheat stem rust pathogen ( Puccinia graminis f. sp. tritici , Pgt ) and one isolate (92-MN-90) of the rye stem rust pathogen ( P. graminis f. sp. secalis , Pgs ). Based on a coefficient of infection, the frequency of resistance in the WBDC was low ranging from 0.6% with HKHJC to 19.4% with 92-MN-90. None of the accessions was resistant to all five cultures of P. graminis A genome-wide association study (GWAS) was conducted to map stem rust resistance loci using 50,842 single-nucleotide polymorphic markers generated by genotype-by-sequencing and ordered using the new barley reference genome assembly. After proper accounting for genetic relatedness and structure among accessions, 45 quantitative trait loci were identified for resistance to P. graminis across all seven barley chromosomes. Three novel loci associated with resistance to TTKSK, QCCJB, MCCFC, and 92-MN-90 were identified on chromosomes 5H and 7H, and two novel loci associated with resistance to HKHJC were identified on chromosomes 1H and 3H. These novel alleles will enhance the diversity of resistance available for cultivated barley. Copyright © 2017 Sallam et al.

  3. Genetic mapping of stem rust resistance to Puccinia graminis f. sp. tritici race TRTTF in the Canadian wheat cultivar 'Harvest'

    Science.gov (United States)

    Stem rust, caused by Puccinia graminis Pers.:Pers. f. sp. tritici Eriks. & E. Henn.(Pgt), is a destructive disease of wheat that can be controlled by deploying effective stem rust resistance (Sr) genes. Highly virulent races of Pgt in Africa have been detected and characterized. These include race T...

  4. Sources of stem rust resistance in Ethiopian tetraploid wheat ...

    African Journals Online (AJOL)

    Stem or black rust of wheat caused by the fungus Puccinia graminis f. sp. tritici Ericks and Henn (Pgt) is an important disease on wheat worldwide. Pgt is an obligate biotroph, heteroceous in its life cycle and heterothallic in mating type. Seedlings of 41 emmer (Triticum dicoccum), 56 durum (T. durum) wheat accessions were ...

  5. Molecular Characterization of wheat stem rust races in Kenya

    Science.gov (United States)

    Stem or black rust caused by Puccinia graminis f. sp. tritici (Pgt) Erikss. & Henning causes severe losses to wheat (Triticum aestivum L.), historically threatening global wheat production. Characterizing prevalent isolates of Pgt would enhance the knowledge of population dynamics and evolution of t...

  6. Use of preimplantation genetic diagnosis and preimplantation genetic screening in the United States: a Society for Assisted Reproductive Technology Writing Group paper.

    Science.gov (United States)

    Ginsburg, Elizabeth S; Baker, Valerie L; Racowsky, Catherine; Wantman, Ethan; Goldfarb, James; Stern, Judy E

    2011-10-01

    To comprehensively report Society for Assisted Reproductive Technology (SART) member program usage of preimplantation genetic testing (PGT), preimplantation genetic diagnosis (PGD) for diagnosis of specific conditions, and preimplantation genetic screening for aneuploidy (PGS). Retrospective study. United States SART cohort data. Women undergoing a PGT cycle in which at least one embryo underwent biopsy. PGT. PGT use, indications, and delivery rates. Of 190,260 fresh, nondonor assisted reproductive technology (ART) cycles reported to SART CORS in 2007-2008, 8,337 included PGT. Of 6,971 cycles with a defined indication, 1,382 cycles were for genetic diagnosis, 3,645 for aneuploidy screening (PGS), 527 for translocation, and 1,417 for elective sex election. Although the total number of fresh, autologous cycles increased by 3.6% from 2007 to 2008, the percentage of cycles with PGT decreased by 5.8% (4,293 in 2007 and 4,044 in 2008). As a percentage of fresh, nondonor ART cycles, use dropped from 4.6% (4,293/93,433) in 2007 to 4.2% (4,044/96,827) in 2008. The primary indication for PGT was PGS: cycles performed for this indication decreased (-8.0%). PGD use for single-gene defects (+3.2%), elective sex selection (+5.3%), and translocation analysis (+0.5%) increased. PGT usage varied significantly by geographical region. PGT usage in the United States decreased between 2007 and 2008 owing to a decrease in PGS. Use of elective sex selection increased. High transfer cancellation rates correlated with reduced live-birth rates for some PGT indications. Copyright © 2011 American Society for Reproductive Medicine. Published by Elsevier Inc. All rights reserved.

  7. Regional Income Inequalities In Poland And Italy / Rozkład Nierówności Według Regionów w Polsce i We Włoszech

    Directory of Open Access Journals (Sweden)

    Jędrzejczak Alina

    2015-12-01

    Full Text Available Redukcja różnic między regionami Europy była głównym celem polityki “zrównoważonego rozwoju”, której założenia znalazły się już w tzw. Traktatach Rzymskich (1957. Postępujący proces integracji europejskiej tworzył wciąż nowe instrumenty i inicjatywy (tzw. mechanizmy solidarności, wyrażające dążenie do niwelowania ekonomicznej i społecznej nierównowagi między regionami. Okazało się jednak, że różnice między regionami biednymi i bogatymi w wielu krajach wcale się nie zmniejszają, a spowolnienie gospodarcze spowodowało odwrócenie pozytywnych tendencji nawet w krajach relatywnie najbardziej rozwiniętych.

  8. Zagraniczne kontakty oraz ich rola w podnoszeniu jakości usług i budowaniu wizerunku biblioteki akademickiej. Doświadczenia Biblioteki Głównej Uniwersytetu Pedagogicznego im. KEN w Krakowie w latach 2010-2016

    Directory of Open Access Journals (Sweden)

    Błach Marzena

    2017-06-01

    Full Text Available The aim of the article is to draw attention to the role of contacts with foreign institutions in the process of improving services and building the image of an academic library. Experiences of the Main Library of the Pedagogical University in Cracow show a positive influence of participation in the Erasmus programme on the professional activity (increased number of foreign interlibrary transactions and scientific studies (reports and articles, conference papers, seminars of librarians. The article discusses the cooperation of the PU Main Library with foreign institutions in the years 2010-2016, conducted within the framework of the Erasmus programme and Interlibrary Loan. Statistical data illustrate the intensity of Erasmus and interlibrary contacts. Also, based on the experience of a Main Library employee participating in the International Librarians Network, library networking forms are described.

  9. Wymagania informacyjne użytkowników bibliotek akademickich XXI wieku: LibQUAL+TM jako narzędzie pomiaru jakości usług bibliotecznych

    OpenAIRE

    Jankowska, Maria Anna

    2006-01-01

    Google Scholar, Amazon.com, Flickr, MySpace, social networking, open access, and easy retrieval of electronic resources and services create higher user expectations toward academic library collections and services. �In this competitive environment of content providers and users’ growing expectations, academic libraries face a difficult task in providing the most satisfying ways of delivering content and services to their patrons. To what extend should libraries recognize the users’ informatio...

  10. Idea państwa według minarchistów i anarchokapitalistów [Idea of the State from the Perspective of Minarchists and Anarcho-capitalists

    Directory of Open Access Journals (Sweden)

    Hubert Staskiewicz

    2013-03-01

    Full Text Available This scientific article treats of libertarianism. Its fundamental premises are: conception of self-ownership, non-aggression axiom, proprietorship, free market, ‘no victim,no crime’ rule, aversion to the state institutions. The existence of libertarianism itselfis the most prominent subject of dispute between its two currents: minarchism andanarcho-capitalism. The adherents of the doctrine of minimal statism were FriedrichA. von Hayek and Milton Friedman, while Murray N. Rothbard and Hans-HermannHoppe were the followers of the free-market anarchy. The traditional, one-dimensional division into the left and right wing is not sufficient for the libertarianism tofind its place on the political scene. It is multidimensionality that characterises thelibertarian thought.

  11. Adopting genetics: motivations and outcomes of personal genomic testing in adult adoptees.

    Science.gov (United States)

    Baptista, Natalie M; Christensen, Kurt D; Carere, Deanna Alexis; Broadley, Simon A; Roberts, J Scott; Green, Robert C

    2016-09-01

    American adult adoptees may possess limited information about their biological families and turn to direct-to-consumer personal genomic testing (PGT) for genealogical and medical information. We investigated the motivations and outcomes of adoptees undergoing PGT using data from the Impact of Personal Genomics (PGen) Study. The PGen Study surveyed new 23andMe and Pathway Genomics customers before and 6 months after receiving PGT results. Exploratory analyses compared adoptees' and nonadoptees' PGT attitudes, expectations, and experiences. We evaluated the association of adoption status with motivations for testing and postdisclosure actions using logistic regression models. Of 1,607 participants, 80 (5%) were adopted. As compared with nonadoptees, adoptees were more likely to cite limited knowledge of family health history (OR = 10.1; 95% CI = 5.7-19.5) and the opportunity to learn genetic disease risks (OR = 2.7; 95% CI = 1.6-4.8) as strong motivations for PGT. Of 922 participants who completed 6-month follow-up, there was no significant association between adoption status and PGT-motivated health-care utilization or health-behavior change. PGT allows adoptees to gain otherwise inaccessible information about their genetic disease risks and ancestry, helping them to fill the void of an incomplete family health history.Genet Med 18 9, 924-932.

  12. Conserved loci of leaf and stem rust fungi of wheat share synteny interrupted by lineage-specific influx of repeat elements

    Directory of Open Access Journals (Sweden)

    Fellers John P

    2013-01-01

    Full Text Available Abstract Background Wheat leaf rust (Puccinia triticina Eriks; Pt and stem rust fungi (P. graminis f.sp. tritici; Pgt are significant economic pathogens having similar host ranges and life cycles, but different alternate hosts. The Pt genome, currently estimated at 135 Mb, is significantly larger than Pgt, at 88 Mb, but the reason for the expansion is unknown. Three genomic loci of Pt conserved proteins were characterized to gain insight into gene content, genome complexity and expansion. Results A bacterial artificial chromosome (BAC library was made from P. triticina race 1, BBBD and probed with Pt homologs of genes encoding two predicted Pgt secreted effectors and a DNA marker mapping to a region of avirulence. Three BACs, 103 Kb, 112 Kb, and 166 Kb, were sequenced, assembled, and open reading frames were identified. Orthologous genes were identified in Pgt and local conservation of gene order (microsynteny was observed. Pairwise protein identities ranged from 26 to 99%. One Pt BAC, containing a RAD18 ortholog, shares syntenic regions with two Pgt scaffolds, which could represent both haplotypes of Pgt. Gene sequence is diverged between the species as well as within the two haplotypes. In all three BAC clones, gene order is locally conserved, however, gene shuffling has occurred relative to Pgt. These regions are further diverged by differing insertion loci of LTR-retrotransposon, Gypsy, Copia, Mutator, and Harbinger mobile elements. Uncharacterized Pt open reading frames were also found; these proteins are high in lysine and similar to multiple proteins in Pgt. Conclusions The three Pt loci are conserved in gene order, with a range of gene sequence divergence. Conservation of predicted haustoria expressed secreted protein genes between Pt and Pgt is extended to the more distant poplar rust, Melampsora larici-populina. The loci also reveal that genome expansion in Pt is in part due to higher occurrence of repeat-elements in this species.

  13. Pharmacokinetics of pioglitazone, a thiazolidinedione derivative, in male Naeini (Iranian fat-tailed) sheep

    DEFF Research Database (Denmark)

    Ghoreishi, Sayed Mehdi; Rajaian, H.; Sheykhzade, Majid

    2012-01-01

    /kg) was administered to five male sheep. Blood samples were collected at various time intervals, and PGT concentration was measured by a validated high-performance liquid chromatography method. The data obtained were best fitted into a two-compartment model for the IV route, and non-compartmental approach for oral...... on blood parameters but there is no published study with respect to the feeding of TZDs in ruminants till now. Therefore, the aim of this study was to determine the bioavailability and several other pharmacokinetic parameters of PGT in sheep. A single intravenous (IV) or oral dose of PGT (10 mg...

  14. Remodeling of the Cervix and Parturition in Mice Lacking the Progesterone Receptor B Isoform1

    Science.gov (United States)

    Yellon, Steven M.; Oshiro, Bryan T.; Chhaya, Tejas Y.; Lechuga, Thomas J.; Dias, Rejane M.; Burns, Alexandra E.; Force, Lindsey; Apostolakis, Ede M.

    2011-01-01

    Withdrawal of progestational support for pregnancy is part of the final common pathways for parturition, but the role of nuclear progesterone receptor (PGR) isoforms in this process is not known. To determine if the PGR-B isoform participates in cervical remodeling at term, cervices were obtained from mice lacking PGR-B (PGR-BKO) and from wild-type (WT) controls before or after birth. PGR-BKO mice gave birth to viable pups at the same time as WT controls during the early morning of Day 19 postbreeding. Morphological analyses indicated that by the day before birth, cervices from PGR-BKO and WT mice had increased in size, with fewer cell nuclei/area as well as diminished collagen content and structure, as evidenced by optical density of picrosirius red-stained sections, compared to cervices from nonpregnant mice. Moreover, increased numbers of resident macrophages, but not neutrophils, were found in the prepartum cervix of PGR-BKO compared to nonpregnant mice, parallel to findings in WT mice. These results suggest that PGR-B does not contribute to the growth or degradation of the extracellular matrix or proinflammatory processes associated with recruitment of macrophages in the cervix leading up to birth. Rather, other receptors may contribute to the progesterone-dependent mechanism that promotes remodeling of the cervix during pregnancy and in the proinflammatory process associated with ripening before parturition. PMID:21613631

  15. Glycaemic Response to some Commonly Eaten Fruits in Type 2 ...

    African Journals Online (AJOL)

    Background: It is not known which of the commonly consumed fruits in Nigeria are suitable for persons with diabetes mellitus especially with regards to the attendant plasma glucose response (PGR) to consumption of such fruits. Objectives: To determine and compare the PGR to commonly eaten fruits in patients with ...

  16. The GRIN-Global Information Management System – Public Interface Demonstration and Input Opportunity

    Science.gov (United States)

    The GRIN-Global (GG) Information Management System, under development for the past three years, provides the world's crop genebanks and plant genetic resource (PGR) users with a powerful, flexible, easy-to-use PGR information management system. Developed jointly by the USDA Agricultural Research Ser...

  17. The GRIN-Global Information Management System – A Preview and Opportunity for Public User Input

    Science.gov (United States)

    The GRIN-Global Information Management System, under development for the past two years, will provide the world's crop genebanks and plant genetic resource (PGR) users with a powerful, flexible, easy-to-use PGR information management system. Developed jointly by the USDA Agricultural Research Servi...

  18. GRIN-Global: An International Project to Develop a Global Plant Genebank Information Management System

    Science.gov (United States)

    The mission of the GRIN-Global Project is to create a new, scalable version of the Germplasm Resource Information System (GRIN) to provide the world’s crop genebanks with a powerful, flexible, easy-to-use plant genetic resource (PGR) information management system. The system will help safeguard PGR ...

  19. Role of plant growth regulators and a saprobic fungus in enhancement of metal phytoextraction potential and stress alleviation in pearl millet.

    Science.gov (United States)

    Firdaus-e-Bareen; Shafiq, Muhammad; Jamil, Sidra

    2012-10-30

    "Assisted phytoextraction" involving application of chemical additives such as plant growth regulators (PGRs) has become a trend in phytoremediation technology. This study identifies a cost-effective, naturally available crude PGR (PGR1) that produces the same effects as the commercial PGR (PGR2), increasing metal uptake by plants and the reduction of metal stress. Assisted phytoextraction by pearl millet (Pennisetum glaucum) from a multi-metal (Cd, Cr, Cu, Fe, Na and Zn) contaminated soil medium with tannery solid waste (TSW) soil amendments of 5 and 10%, was evaluated in a full-factorial pot trial with PGR1, PGR2 and Trichoderma pseudokoningii as factors. The effects of these phytoextraction assistants were measured through dry biomass production, heavy metal uptake, stress tolerance enzymes catalase (CAT) and superoxide dismutase (SOD), soluble protein content of plant, and phytoextraction efficiency. Dry biomass and multi-metal accumulation were the highest in the soil treatments with a combined application of PGR1, PGR2 and T. pseudokoningii and the lowest in the control. The soluble protein contents and the SOD and CAT values were the highest in the 10% TSW treatment provided with PGR2+T. pseudokoningii, while the lowest were in the control. Thus, application of crude PGR in combination with other phytoextraction assistants can increase biomass production as well as multi-metal accumulation in plants. However, the biochemical properties of the plant depend on the level of TSW stress in the soil treatment as well as the type of phytoextraction assistants. Copyright © 2012 Elsevier B.V. All rights reserved.

  20. Quantifying airborne dispersal routes of pathogens over continents to safeguard global wheat supply.

    Science.gov (United States)

    Meyer, M; Cox, J A; Hitchings, M D T; Burgin, L; Hort, M C; Hodson, D P; Gilligan, C A

    2017-10-01

    Infectious crop diseases spreading over large agricultural areas pose a threat to food security. Aggressive strains of the obligate pathogenic fungus Puccinia graminis f.sp. tritici (Pgt), causing the crop disease wheat stem rust, have been detected in East Africa and the Middle East, where they lead to substantial economic losses and threaten livelihoods of farmers. The majority of commercially grown wheat cultivars worldwide are susceptible to these emerging strains, which pose a risk to global wheat production, because the fungal spores transmitting the disease can be wind-dispersed over regions and even continents 1-11 . Targeted surveillance and control requires knowledge about airborne dispersal of pathogens, but the complex nature of long-distance dispersal poses significant challenges for quantitative research 12-14 . We combine international field surveys, global meteorological data, a Lagrangian dispersion model and high-performance computational resources to simulate a set of disease outbreak scenarios, tracing billions of stochastic trajectories of fungal spores over dynamically changing host and environmental landscapes for more than a decade. This provides the first quantitative assessment of spore transmission frequencies and amounts amongst all wheat producing countries in Southern/East Africa, the Middle East and Central/South Asia. We identify zones of high air-borne connectivity that geographically correspond with previously postulated wheat rust epidemiological zones (characterized by endemic disease and free movement of inoculum) 10,15 , and regions with genetic similarities in related pathogen populations 16,17 . We quantify the circumstances (routes, timing, outbreak sizes) under which virulent pathogen strains such as 'Ug99' 5,6 pose a threat from long-distance dispersal out of East Africa to the large wheat producing areas in Pakistan and India. Long-term mean spore dispersal trends (predominant direction, frequencies, amounts) are

  1. Uterine progesterone signaling is a target for metformin therapy in PCOS-like rats.

    Science.gov (United States)

    Hu, Min; Zhang, Yuehui; Feng, Jiaxing; Xu, Xue; Zhang, Jiao; Zhao, Wei; Guo, Xiaozhu; Li, Juan; Vestin, Edvin; Cui, Peng; Li, Xin; Wu, Xiao-Ke; Brännström, Mats; Shao, Linus R; Billig, Håkan

    2018-05-01

    Impaired progesterone (P4) signaling is linked to endometrial dysfunction and infertility in women with polycystic ovary syndrome (PCOS). Here, we report for the first time that elevated expression of progesterone receptor (PGR) isoforms A and B parallels increased estrogen receptor (ER) expression in PCOS-like rat uteri. The aberrant PGR-targeted gene expression in PCOS-like rats before and after implantation overlaps with dysregulated expression of Fkbp52 and Ncoa2 , two genes that contribute to the development of uterine P4 resistance. In vivo and in vitro studies of the effects of metformin on the regulation of the uterine P4 signaling pathway under PCOS conditions showed that metformin directly inhibits the expression of PGR and ER along with the regulation of several genes that are targeted dependently or independently of PGR-mediated uterine implantation. Functionally, metformin treatment corrected the abnormal expression of cell-specific PGR and ER and some PGR-target genes in PCOS-like rats with implantation. Additionally, we documented how metformin contributes to the regulation of the PGR-associated MAPK/ERK/p38 signaling pathway in the PCOS-like rat uterus. Our data provide novel insights into how metformin therapy regulates uterine P4 signaling molecules under PCOS conditions. © 2018 Society for Endocrinology.

  2. Influence of Plant Growth Retardants on Quality of Codonopsis Radix

    Directory of Open Access Journals (Sweden)

    Yinyin Liao

    2017-10-01

    Full Text Available Plant growth retardant (PGR refers to organics that can inhibit the cell division of plant stem tip sub-apical meristem cells or primordial meristem cell. They are widely used in the cultivation of rhizomatous functional plants; such as Codonopsis Radix, that is a famous Chinese traditional herb. However, it is still unclear whether PGR affects the medicinal quality of C. Radix. In the present study, amino acid analyses, targeted and non-targeted analyses by ultra-performance liquid chromatography combined with time-of-flight mass spectrometry (UPLC-TOF-MS and gas chromatography-MS were used to analyze and compare the composition of untreated C. Radix and C. Radix treated with PGR. The contents of two key bioactive compounds, lobetyolin and atractylenolide III, were not affected by PGR treatment. The amounts of polysaccharides and some internal volatiles were significantly decreased by PGR treatment; while the free amino acids content was generally increased. Fifteen metabolites whose abundance were affected by PGR treatment were identified by UPLC-TOF-MS. Five of the up-regulated compounds have been reported to show immune activity, which might contribute to the healing efficacy (“buqi” of C. Radix. The results of this study showed that treatment of C. Radix with PGR during cultivation has economic benefits and affected some main bioactive compounds in C. Radix.

  3. Mechanism of pyrogallol red oxidation induced by free radicals and reactive oxidant species. A kinetic and spectroelectrochemistry study.

    Science.gov (United States)

    Atala, E; Velásquez, G; Vergara, C; Mardones, C; Reyes, J; Tapia, R A; Quina, F; Mendes, M A; Speisky, H; Lissi, E; Ureta-Zañartu, M S; Aspée, A; López-Alarcón, C

    2013-05-02

    Pyrogallol red (PGR) presents high reactivity toward reactive (radical and nonradical) species (RS). This property of PGR, together with its characteristic spectroscopic absorption in the visible region, has allowed developing methodologies aimed at evaluating the antioxidant capacity of foods, beverages, and human fluids. These methods are based on the evaluation of the consumption of PGR induced by RS and its inhibition by antioxidants. However, at present, there are no reports regarding the degradation mechanism of PGR, limiting the extrapolation to how antioxidants behave in different systems comprising different RS. In the present study, we evaluate the kinetics of PGR consumption promoted by different RS (peroxyl radicals, peroxynitrite, nitrogen dioxide, and hypochlorite) using spectroscopic techniques and detection of product by HPLC mass spectrometry. The same pattern of oxidation and spectroscopic properties of the products is observed, independently of the RS employed. Mass analysis indicates the formation of only one product identified as a quinone derivative, excluding the formation of peroxides or hydroperoxides and/or chlorinated compounds, in agreement with FOX's assays and oxygen consumption experiments. Cyclic voltammetry, carried out at different pH's, shows an irreversible oxidation of PGR, indicating the initial formation of a phenoxy radical and a second charge transfer reaction generating an ortho-quinone derivative. Spectroelectrochemical oxidation of PGR shows oxidation products with identical UV-visible absorption properties to those observed in RS-induced oxidation.

  4. Coordinated Regulation Among Progesterone, Prostaglandins, and EGF-Like Factors in Human Ovulatory Follicles.

    Science.gov (United States)

    Choi, Yohan; Wilson, Kalin; Hannon, Patrick R; Rosewell, Katherine L; Brännström, Mats; Akin, James W; Curry, Thomas E; Jo, Misung

    2017-06-01

    In animal models, the luteinizing hormone surge increases progesterone (P4) and progesterone receptor (PGR), prostaglandins (PTGs), and epidermal growth factor (EGF)-like factors that play essential roles in ovulation. However, little is known about the expression, regulation, and function of these key ovulatory mediators in humans. To determine when and how these key ovulatory mediators are induced after the luteinizing hormone surge in human ovaries. Timed periovulatory follicles were obtained from cycling women. Granulosa/lutein cells were collected from in vitro fertilization patients. The in vivo and in vitro expression of PGR, PTG synthases and transporters, and EGF-like factors were examined at the level of messenger RNA and protein. PGR binding to specific genes was assessed. P4 and PTGs in conditioned media were measured. PGR, PTGS2, and AREG expressions dramatically increased in ovulatory follicles at 12 to 18 hours after human chorionic gonadotropin (hCG). In human granulosa/lutein cell cultures, hCG increased P4 and PTG production and the expression of PGR, specific PTG synthases and transporters, and EGF-like factors, mimicking in vivo expression patterns. Inhibitors for P4/PGR and EGF-signaling pathways reduced hCG-induced increases in PTG production and the expression of EGF-like factors. PGR bound to the PTGS2, PTGES, and SLCO2A1 genes. This report demonstrated the time-dependent induction of PGR, AREG, and PTGS2 in human periovulatory follicles. In vitro studies indicated that collaborative actions of P4/PGR and EGF signaling are required for hCG-induced increases in PTG production and potentiation of EGF signaling in human periovulatory granulosa cells. Copyright © 2017 Endocrine Society

  5. Sonography and CT findings in perigraft reactions after surgical implantation of vascular prostheses

    International Nuclear Information System (INIS)

    Scherer, G.; Roeren, T.; Paetz, B.; Hupp, T.; Kauffmann, G.W.

    1995-01-01

    Between January 1988 and January 1994, 24 patients with heterologeous vascular bypasses were examined with suspected diagnosis of a perigraft reaction (PGR). All patients were subjected to ultrasound and CT. PGR ist defined as a sterile inflammation along the course of a vascular prosthesis. The typical clinical presentation is a fluctuating tumour with a localised painless swelling. In all cases liquid formations could be confirmed by diagnostic imaging procedures; signs of infection could be excluded. The synopsis of the clinical presentation, the time interval after implantation of the prosthetic material and the signs of sonography and CT can reliably exclude infection of the prosthesis and confirm the diagnosis of a PGR. (orig.) [de

  6. Personal Genomic Testing for Cancer Risk: Results From the Impact of Personal Genomics Study.

    Science.gov (United States)

    Gray, Stacy W; Gollust, Sarah E; Carere, Deanna Alexis; Chen, Clara A; Cronin, Angel; Kalia, Sarah S; Rana, Huma Q; Ruffin, Mack T; Wang, Catharine; Roberts, J Scott; Green, Robert C

    2017-02-20

    Purpose Significant concerns exist regarding the potential for unwarranted behavior changes and the overuse of health care resources in response to direct-to-consumer personal genomic testing (PGT). However, little is known about customers' behaviors after PGT. Methods Longitudinal surveys were given to new customers of 23andMe (Mountain View, CA) and Pathway Genomics (San Diego, CA). Survey data were linked to individual-level PGT results through a secure data transfer process. Results Of the 1,042 customers who completed baseline and 6-month surveys (response rate, 71.2%), 762 had complete cancer-related data and were analyzed. Most customers reported that learning about their genetic risk of cancers was a motivation for testing (colorectal, 88%; prostate, 95%; breast, 94%). No customers tested positive for pathogenic mutations in highly penetrant cancer susceptibility genes. A minority of individuals received elevated single nucleotide polymorphism-based PGT cancer risk estimates (colorectal, 24%; prostate, 24%; breast, 12%). At 6 months, customers who received elevated PGT cancer risk estimates were not significantly more likely to change their diet, exercise, or advanced planning behaviors or engage in cancer screening, compared with individuals at average or reduced risk. Men who received elevated PGT prostate cancer risk estimates changed their vitamin and supplement use more than those at average or reduced risk (22% v 7.6%, respectively; adjusted odds ratio, 3.41; 95% CI, 1.44 to 8.18). Predictors of 6-month behavior include baseline behavior (exercise, vitamin or supplement use, and screening), worse health status (diet and vitamin or supplement use), and older age (advanced planning, screening). Conclusion Most adults receiving elevated direct-to-consumer PGT single nucleotide polymorphism-based cancer risk estimates did not significantly change their diet, exercise, advanced care planning, or cancer screening behaviors.

  7. Effect of benzylaminopurine (BAP) pulsing on in vitro shoot ...

    African Journals Online (AJOL)

    user

    2011-03-28

    Mar 28, 2011 ... Research Cluster, Faculty of Science, University Malaya, 50603 Kuala Lumpur, Malaysia. Accepted 12 ... number of bud formation in shoot cultures of Musa acuminata cv. ... In tissue culture, plant growth regulators (PGR) are.

  8. Estrogen receptor, progesterone receptor, HER-2, and response to postmastectomy radiotherapy in high-risk breast cancer: The Danish Breast Cancer Cooperative Group

    DEFF Research Database (Denmark)

    Kyndi, M.; Sorensen, F.B.; Overgaard, M.

    2008-01-01

    . End points were locoregional recurrence as isolated first event, distant metastases, and overall survival. For statistical analyses four subgroups were constructed from hormonal receptors (Rec). Rec+ was defined as ER+ and/or PgR+. Rec- as both ER- and PgR-. The four subgroups were Rec+/HER-2-, Rec......+/HER-2+, Rec-/HER-2- (triple negative), and Rec-/HER-2+. Results A significantly improved overall survival after PMRT was seen only among patients characterized by good prognostic markers such as hormonal receptor-positive and HER-2- patients (including the two Rec+ subtypes). No significant overall...... after PMRT were found for ER- and PgR- tumors compared with the ER+ and PgR+ tumors (P = .003 and 04, respectively), and for the triple-negative (P = .02), and the Rec-/HER-2+ subtypes (P = .003) compared with the Rec-/HER-2- subtype. Conclusion Hormonal receptor status, HER-2, and the constructed...

  9. Structural delineation of a quaternary, cleavage-dependent epitope at the gp41-gp120 interface on intact HIV-1 Env trimers.

    Science.gov (United States)

    Blattner, Claudia; Lee, Jeong Hyun; Sliepen, Kwinten; Derking, Ronald; Falkowska, Emilia; de la Peña, Alba Torrents; Cupo, Albert; Julien, Jean-Philippe; van Gils, Marit; Lee, Peter S; Peng, Wenjie; Paulson, James C; Poignard, Pascal; Burton, Dennis R; Moore, John P; Sanders, Rogier W; Wilson, Ian A; Ward, Andrew B

    2014-05-15

    All previously characterized broadly neutralizing antibodies to the HIV-1 envelope glycoprotein (Env) target one of four major sites of vulnerability. Here, we define and structurally characterize a unique epitope on Env that is recognized by a recently discovered family of human monoclonal antibodies (PGT151-PGT158). The PGT151 epitope is comprised of residues and glycans at the interface of gp41 and gp120 within a single protomer and glycans from both subunits of a second protomer and represents a neutralizing epitope that is dependent on both gp120 and gp41. Because PGT151 binds only to properly formed, cleaved trimers, this distinctive property, and its ability to stabilize Env trimers, has enabled the successful purification of mature, cleaved Env trimers from the cell surface as a complex with PGT151. Here we compare the structural and functional properties of membrane-extracted Env trimers from several clades with those of the soluble, cleaved SOSIP gp140 trimer. Copyright © 2014 Elsevier Inc. All rights reserved.

  10. The discourse around usefulness, morality, risk and trust: a focus group study on prenatal genetic testing.

    Science.gov (United States)

    Pivetti, Monica; Montali, Lorenzo; Simonetti, Giorgia

    2012-12-01

    This study explores the underlying values and beliefs that guide women's reasoning on prenatal genetic test (PGT) uptake, as framed by their own words, during a group discussion, in a Catholic country such as Italy. Women's reasoning was explored by means of five focus group consisting of seven pregnant women and 13 new mothers. The focus group material content was analysed using the Nudist software. The discourse around PGT was rooted into four frames of reference: The usefulness dimension was used to express the positions in favour of PGT, whereas morality, risk and trust were used to express negative evaluations on such a technology. Participants advocated for themselves the choice of being tested, besides giving some credit to the partner's opinion. Moreover, participants reported little knowledge on PGT. The research shed some light on the frames of reference used by participants to build their positions on PGT uptake, confirming the public's ability to translate scientific accounts into personally meaningful information. A more complete understanding of the reasons for decisions to test would help counsellors to better communicate with women and couples, and to better assist them to make a better informed testing decision. © 2012 John Wiley & Sons, Ltd.

  11. An Improved Path-Generating Regulator for Two-Wheeled Robots to Track the Circle/Arc Passage

    Directory of Open Access Journals (Sweden)

    Jun Dai

    2014-01-01

    Full Text Available The improved path-generating regulator (PGR is proposed to path track the circle/arc passage for two-wheeled robots. The PGR, which is a control method for robots so as to orient its heading toward the tangential direction of one of the curves belonging to the family of path functions, is applied to navigation problem originally. Driving environments for robots are usually roads, streets, paths, passages, and ridges. These tracks can be seen as they consist of straight lines and arcs. In the case of small interval, arc can be regarded as straight line approximately; therefore we extended the PGR to drive the robot move along circle/arc passage based on the theory that PGR to track the straight passage. In addition, the adjustable look-ahead method is proposed to improve the robot trajectory convergence property to the target circle/arc. The effectiveness is proved through MATLAB simulations on both the comparisons with the PGR and the improved PGR with adjustable look-ahead method. The results of numerical simulations show that the adjustable look-ahead method has better convergence property and stronger capacity of resisting disturbance.

  12. High rabbit abundance proves detrimental to the population growth rate in European rabbit (Oryctolagus cuniculus L. extensive breeding enclosures

    Directory of Open Access Journals (Sweden)

    L. Ruiz-Aizpurua

    2014-09-01

    Full Text Available The European rabbit (Oryctolagus cuniculus L. is a key prey species in Mediterranean ecosystems that has declined in its natural ranges as a result of diseases and loss of habitat. This situation has led to the production of wild rabbits in enclosures in which they can acclimate and breed. The efficiency of these enclosures as extensive breeding systems is defined by their population growth rate (PGR. The aim of this study is to analyse the effect of rabbit abundance on the PGR. This has been done by creating general linear models to explain autumn and spring PGR with the use of rabbit abundance estimates, enclosure size, aerial predation and previous PGR as possible explanatory variables. Rabbit abundance and enclosure size negatively affected the autumn PGR, while only rabbit abundance affected the spring PGR in the best-fit models. It is suggested that maintaining rabbit densities at fewer than 30 rabbits per hectare might help to optimise the efficiency inside enclosures.

  13. Gene : CBRC-MMUS-09-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-136 70% MIFTFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFSMIFTFLAI...FHVPQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRFSVILSFFNLSTACFSFSMIFSFLAIFHVLQWKFLYFPTFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISH...FSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFFRFFSDFVIFHVVKWMFLIFHDFHFSCHISCPKVCISHFQ ...

  14. Gene : CBRC-MMUS-09-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-103 84% MIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCHIPGPTVCISHFSRFSLILS...LFKLSTACFSFSMIFNFLAIFHVLQWKFLYFPTFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLLWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRNIPGPTVCISHFP ...

  15. Gene : CBRC-XTRO-01-2123 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available /gi=116487409 /ug=Str.18760 /len=4829 9e-15 26% MICISHIYCTSVRDPTGPPILLHPQTLGIMICISH...IYCTSVRGPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMICISH...IYCTSVRDPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMNSTAQMLWGRAWGGRENFPSFLRIKVFPLETGGRACESHVVPTEHLPQPQ ...

  16. Gene : CBRC-MMUS-09-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-121 83% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVISS...FFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPTFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFFMIFSFLAIFHVPQWTFLN...VPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRFSVIFSFFNLSTACFSFSMIFSFLAIFQVLQCAFLIFHVFQ ...

  17. Gene : CBRC-MMUS-09-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4152306 /ug=Mm.330279 /len=4633 1e-108 87% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVIS...SFFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFSMIFSFLAIFHVPQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRF ...

  18. Gene : CBRC-MMUS-23-0035 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 3e-71 52% MIFSFLAIFHVKQWTYLNVLSFSVFLVIFHVIKCIFLIFRDSQVSRHISGHRVCISHFSRFSVILSF...FKSSCGCFSFSKIFSFLAIFHVLQWTFLNSPHISVFLAIFHIIKCVFLIFRDFQFSRHIPGPTLCISHFPCFSVIHYIFIGLQCVSHFPRFSVFLTYSGSYSVCVSFS...TFFSLPAIFQILQCAYLIFQVSLNVPRHIPISTVCVPHFQIFLVFLPYSYAFHIFDVFHFSPHILGPTVCVCLLYHIFHHSCNIPGPTECISHLSIFFSASCHM ...

  19. Gene : CBRC-MMUS-09-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4152306 /ug=Mm.330279 /len=4633 1e-115 71% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVIS...SFFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLQWTFL...NFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFFRFFSDFVIFHVVKWMFLIFHDFHFSCHISCPKVCISHFQ ...

  20. Gene : CBRC-XTRO-01-1571 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available gi=74306002 /ug=Str.68514 /len=887 2e-11 37% MHLVLRHPVLRHPVLRHPVLRHPVLLHPVLRHPVLLHPVLLHLVLLHPVLLHLVLRHPV...LRHPVLRHPVLRHLVLLHLVLLHLVLRHPVLRHPVLRHLVLLHLVLLHLVLLHPVLLHPVLLHPVLRHLVLLHLVLLHLVLRHPVLRHPV...LRHLVLLHLVLLHLVLLHLVLLHPVLRHPVLLHLVLLHLVLWHPVLPCRSARGSVVRKLIHCCIYHKIALVM ...

  1. Gene : CBRC-PMAR-01-0559 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 9 /gi=114310048 /ug=Pma.7703 /len=689 1e-04 33% MSTSLLDFCMCWCGLSPLACLLHVFLCPNLHLPVCFTCLYGLSPLVCLLHVSLWPISTCL...PASRVSMAYLHLPACFTCLYGLSPLACLLHVFLWPISTCLPASRVSMAYLHLPACFTCLYGLISTCLPASRVSMAYLHLPACFTCLYGLSPLVCLLHVSLWPISTC...LPASRVSMSYLHLSACFTCLYGLISTCLPASRVSMGYLHLPACFTCLYCLIFTCLPASRVSMACLHLSACLPHLSV ...

  2. Gene : CBRC-CINT-01-0198 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available gi=24256529 /ug=Cin.19191 /len=800 2.9 30% MELDHIVLVLGNILQMVVEQPFLQLVRRCQRMELDHIV...LVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQLLQQLERRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILLMVVEQPFLQLVRRCQRMELDHI...VLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILLQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQRMELDHIVLVLGKCVSRWLWTNAFRGGITTSMQGSGENFLLGER ...

  3. Factors Associated with Redundant Sigmoid Colon at Mulago ...

    African Journals Online (AJOL)

    jen

    economic factors between 68 patients .... 50,000 Uganda shillings (Ug. Shs) compared to only 19.9% of the controls (1 US $ = Ug shs 1500). ... the majority of the affected patients in this study had a family income of below 50,000 Ug. shs per month.

  4. A Comparative Study of a Few Tests for Isomorphism in Planetary Gear Trains

    Directory of Open Access Journals (Sweden)

    Rajasri Reddy

    2013-04-01

    Full Text Available Graph theory and Matrix methods are widely used by various kinematicians for synthesis and analysis of PGTs. Characteristic polynomial coefficients are used to detect isomorphism in Planetary Gear Trains (PGT. With the Eigen values and Eigen vectors method multiple matrix calculations are required. In case of Hamming number method a single Hamming matrix is enough to detect isomorphism in two PGTs and also determine structural aspects like symmetry easily [1]. Further using the Hamming matrix for a PGT, the number of possible combinations of levels that can be assigned to a given PGT [2] is identified. A review and comparison of Characteristic polynomial, Eigen vectors and Eigen value and Hamming number methods is presented.

  5. Data on glycerol/tartaric acid-based copolymer containing ciprofloxacin for wound healing applications

    Directory of Open Access Journals (Sweden)

    E. De Giglio

    2016-06-01

    Full Text Available This data article is related to our recently published research paper “Exploiting a new glycerol-based copolymer as a route to wound healing: synthesis, characterization and biocompatibility assessment", De Giglio et al. (Colloids and Surfaces B: Biointerfaces 136 (2015 600–611 [1]. The latter described a new copolymer derived from glycerol and tartaric acid (PGT. Herein, an investigation about the PGT-ciprofloxacin (CIP interactions by means of Fourier Transform Infrared Spectroscopy (FT-IR acquired in Attenuated Total Reflectance (ATR mode and Differential Scanning Calorimetry (DSC was reported. Moreover, CIP release experiments on CIP-PGT patches were performed by High Performance Liquid Chromatography (HPLC at different pH values.

  6. Direct-to-Consumer Genetic Testing: User Motivations, Decision Making, and Perceived Utility of Results.

    Science.gov (United States)

    Roberts, J Scott; Gornick, Michele C; Carere, Deanna Alexis; Uhlmann, Wendy R; Ruffin, Mack T; Green, Robert C

    2017-01-01

    To describe the interests, decision making, and responses of consumers of direct-to-consumer personal genomic testing (DTC-PGT) services. Prior to 2013 regulatory restrictions on DTC-PGT services, 1,648 consumers from 2 leading companies completed Web surveys before and after receiving test results. Prior to testing, DTC-PGT consumers were as interested in ancestry (74% very interested) and trait information (72%) as they were in disease risks (72%). Among disease risks, heart disease (68% very interested), breast cancer (67%), and Alzheimer disease (66%) were of greatest interest prior to testing. Interest in disease risks was associated with female gender and poorer self-reported health (p decisions. © 2017 S. Karger AG, Basel.

  7. Outcomes important to burns patients during scar management and how they compare to the concepts captured in burn-specific patient reported outcome measures.

    Science.gov (United States)

    Jones, Laura L; Calvert, Melanie; Moiemen, Naiem; Deeks, Jonathan J; Bishop, Jonathan; Kinghorn, Philip; Mathers, Jonathan

    2017-12-01

    Pressure garment therapy (PGT) is an established treatment for the prevention and treatment of hypertrophic scarring; however, there is limited evidence for its effectiveness. Burn survivors often experience multiple issues many of which are not adequately captured in current PGT trial measures. To assess the effectiveness of PGT it is important to understand what outcomes matter to patients and to consider whether patient-reported outcome measures (PROMs) can be used to ascertain the effect of treatments on patients' health-related quality of life. This study aimed to (a) understand the priorities and perspectives of adult burns patients and the parents of burns patients who have experienced PGT via in-depth qualitative data, and (b) compare these with the concepts captured within burn-specific PROMs. We undertook 40 semi-structured interviews with adults and parents of paediatric and adolescent burns patients who had experienced PGT to explore their priorities and perspectives on scar management. Interviews were audio-recorded, transcribed and thematically analysed. The outcomes interpreted within the interview data were then mapped against the concepts captured within burn-specific PROMs currently in the literature. Eight core outcome domains were identified as important to adult patients and parents: (1) scar characteristics and appearance, (2) movement and function, (3) scar sensation, (4) psychological distress, adjustments and a sense of normality, (5) body image and confidence, (6) engagement in activities, (7) impact on relationships, and (8) treatment burden. The outcome domains presented reflect a complex holistic patient experience of scar management and treatments such as PGT. Some currently available PROMs do capture the concepts described here, although none assess psychological adjustments and attainment of a sense of normality following burn injury. The routine use of PROMs that represent patient experience and their relative contribution to trial

  8. Introducing Pharmacogenetics and Personalized Medicine via a Weblog

    Directory of Open Access Journals (Sweden)

    Kaitlin Bova

    2014-01-01

    Full Text Available Objectives: To evaluate a weblog (blog-based course introducing pharmacogenetics (PGt and personalized medicine (PM relative to freshmen pharmacy students' knowledge base. Methods: Incoming freshmen pharmacy students were invited by email to enroll in a one semester-hour, elective, on-line blog-based course entitled "Personal Genome Evaluation". The course was offered during the students' first semester in college. A topic list related to PGt and PM was developed by a group of faculty with topics being presented via the blog once or twice weekly through week 14 of the 15 week semester. A pre-course and post-course survey was sent to the students to compare their knowledge base relative to general information, drug response related to PGt, and PM. Results: Fifty-one freshmen pharmacy students enrolled in the course and completed the pre-course survey and 49 of the 51 students completed the post-course survey. There was an increase in the students' general, PGt and PM knowledge base as evidenced by a statistically significant higher number of correct responses for 17 of 21 questions on the post-course survey as compared to the pre-course survey. Notably, following the course, students had an increased knowledge base relative to "genetic privacy", drug dosing based on metabolizer phenotype, and the breadth of PM, among other specific points. Conclusions: The study indicated that introducing PGt and PM via a blog format was feasible, increasing the students' knowledge of these emerging areas. The blog format is easily transferable and can be adopted by colleges/schools to introduce PGt and PM.   Type: Case Study

  9. Knowledge and attitude of general pratictioners towards direct-to-consumer genomic tests: a survey conducted in Italy

    Directory of Open Access Journals (Sweden)

    Anna Baroncini

    2015-12-01

    Full Text Available Background: Personal genomic tests (PGT offered directly-to-consumers (DTC for complex disease risk assessment have raised several concerns regarding their potential adverse impact. To mitigate worries continuing professional education has been advocated and the central gatekeeper role of family physicians has been highlighted. Nevertheless, to date, only few studies have been published on awareness, involvement and attitudes of  primary healthcare providers on DTC marketing of PGT and, to the best of our knowledge, none in Italy.Methods: An exploratory survey to achieve information about knowledge and attitudes towards DTC-PGT of a selected group of family physicians participating to courses on predictive medicine and public health genomics was conducted. Results: A total amount of 114 partially or fully filled questionnaires was obtained. The majority of the primary care providers (68,4%  expressed that they are unaware that companies are selling genomic tests directly to consumers, while 31,6% was aware.  In terms of attitudes toward testing 61,1% of the aware respondents deemed the DTC-PGT for chronic complex diseases to be ‘‘not clinically useful.’’  The overwhelming majority of our respondents (95,6% felt unprepared to answer patients’ questions on DTC-PGT. If only aware respondents are considered this percentage results obviously  lower (86,1%, though still very high. Conclusion: The low percentage of aware respondents suggests that DTC advertising in the realm of genomic testing is still limited in Italy. Should DTC-PGT become more widely used, a comprehensive education program may be necessary to increase family physicians’ awareness and help them discuss testing with their patients. 

  10. Clinicopathologic Characteristics of Oestrogen Receptor-Positive/Progesterone Receptor-Negative/Her2-Negative Breast Cancer According to a Novel Definition of Negative Progesterone Receptor Status: A Large Population-Based Study from China.

    Directory of Open Access Journals (Sweden)

    An-qi Li

    Full Text Available A lack of progesterone receptor (PgR expression in oestrogen receptor-positive (ER+ tumours is associated with worse survival. PgR status is usually defined as positive or negative using 1% positive nuclei as a cut-off point. In this study, we aimed to assess the clinicopathologic characteristics of ER+/PgR-/HER2- tumours by comparing them with ER+/PgR+/HER2- tumours using a PgR cut-off point of 20% as a divisive criterion.We analysed 1,522 patients with primary breast cancer who had undergone surgery at the Cancer Center of Fudan University between 2012 and 2014. Age, grade, tumour size, lymph node status and lymphovascular invasion were assessed. Multinomial logistic regression, linear regression and chi-square test models were applied to assess associations between ER, PR and clinical features.ER+/PgR-/HER2- tumours showed poorer clinicopathologic characteristics relative to ER+/PgR+/HER2- tumours using a PgR threshold of 20% instead of 1%. The clinicopathologic characteristics did not differ between tumours with purely negative PgR expression and tumours with a PgR percentage ranging from 1% to 19%. The prognostic significance of PR expression appeared more pronounced in patients under a high Ki-67 status than those under a low Ki-67 status.Based on these findings, we propose the use of a novel threshold of 20% to define PgR status. Nevertheless, the impact of this new criterion on patient management and clinical treatment requires additional study.

  11. Green justice in the city

    DEFF Research Database (Denmark)

    Rutt, Rebecca Leigh; Gulsrud, Natalie Marie

    2016-01-01

    tIn this short communication, we discuss European urban green space (UGS) research from an environ-mental justice perspective. We show that European UGS scholarship primarily focuses on functionalvalues and managerial aspects of UGS, while paying less attention to equity in the enjoyment of andde...... of anddecision-making around UGS. On this basis we discuss potentials for European urban green space researchto take up a more explicit environmental justice framing to shed much-needed light on injustices inEuropean cities and inspire change in policy and practice.......tIn this short communication, we discuss European urban green space (UGS) research from an environ-mental justice perspective. We show that European UGS scholarship primarily focuses on functionalvalues and managerial aspects of UGS, while paying less attention to equity in the enjoyment...

  12. Application of instrumental neutron activation analysis to assess dietary intake of selenium in Korean adults from meat and eggs

    International Nuclear Information System (INIS)

    Moon, Jong-Hwa; Kim, Sun-Ha; Chung, Yong-Sam; Lee, Ok-Hee

    2013-01-01

    Selenium is a key constituent of enzyme in glutathione peroxidase, which is effective in decreasing various types of oxidative stress, Thus, the adequacy of selenium intake is very important in decreasing the risks of various degenerating diseases such as cardiovascular disease, or certain cancers. Lately, the intake of animal foods is increasing among Koreans owing to a dietary transition toward a western style. This study was conducted to measure the selenium content in meat and eggs, and then assessed the selenium intake from these foods. Forty frequently eaten items among meat and eggs were analyzed using an Instrumental Neutron Activation Analysis. The selenium content in 100g of raw meat and eggs ranged from 8.1ug to 50.9ug. In particular, 100g of beef contained 12.4ug to 50.9ug of selenium; pork, 11.2ug to 22.6ug chicken, 10.2ug to 13.7ug and eggs, 28.6ug to 43.0ug. Thus, beef viscera and chicken eggs contain the highest amounts of selenium among these groups. 100g of Pork belly, the most frequently eaten meat type among Koreans, contains 14.6ug of selenium. An evaluation of dietary selenium intake shows that the total selenium supply from meats and eggs was 28.4ug/day and 27.5 ug/day in adult men and women, respectively. These are over one-half of the Korean RNI (Recommended Daily Intake) of 55ug/day. (author)

  13. Blockage of progestin physiology disrupts ovarian differentiation in XX Nile tilapia (Oreochromis niloticus)

    International Nuclear Information System (INIS)

    Zhou, Linyan; Luo, Feng; Fang, Xuelian; Charkraborty, Tapas; Wu, Limin; Wei, Jing; Wang, Deshou

    2016-01-01

    Previous studies indicated that maturation inducing hormone, 17α, 20β-Dihydroxy-4-pregnen-3-one (DHP), probably through nuclear progestin receptor (Pgr), might be involved in spermatogenesis and oogenesis in fish. To further elucidate DHP actions in teleostean ovarian differentiation, we analyzed the expression of pgr in the ovary of Nile tilapia (Oreochromis niloticus), and performed RU486 (a synthetic Pgr antagonist) treatment in XX fish from 5 days after hatching (dah) to 120dah. Tilapia Pgr was abundantly expressed in the follicular cells surrounding oocytes at 30 and 90dah. Continuous RU486 treatment led to the blockage of oogenesis and masculinization of somatic cells in XX fish. Termination of RU486 treatment and maintenance in normal condition resulted in testicular differentiation, and estrogen compensation in RU486-treated XX fish successfully restored oogenesis. In RU486-treated XX fish, transcript levels of female dominant genes were significantly reduced, while male-biased genes were evidently augmented. Meanwhile, both germ cell mitotic and meiotic markers were substantially reduced. Consistently, estrogen production levels were significantly declined in RU486-treated XX fish. Taken together, our data further proved that DHP, possibly through Pgr, might be essential in the ovarian differentiation and estrogen production in fish. - Highlights: • DHP plays a critical role in early stage oogenesis of XX tilapia. • Blockage of DHP actions by RU486 treatment led to masculinization and/or sex reversal in XX tilapia. • Both DHP and estrogen are indispensable for ovarian differentiation.

  14. Plant Genetic Resources: Selected Issues from Genetic Erosion to Genetic Engineering

    Directory of Open Access Journals (Sweden)

    Karl Hammer

    2008-04-01

    Full Text Available Plant Genetic Resources (PGR continue to play an important role in the development of agriculture. The following aspects receive a special consideration:1. Definition. The term was coined in 1970. The genepool concept served as an important tool in the further development. Different approaches are discussed.2. Values of Genetic Resources. A short introduction is highlighting this problem and stressing the economic usfulness of PGR.3. Genetic Erosion. Already observed by E. Baur in 1914, this is now a key issue within PGR. The case studies cited include Ethiopia, Italy, China, S Korea, Greece and S. Africa. Modern approaches concentrate on allelic changes in varieties over time but neglect the landraces. The causes and consequences of genetic erosion are discussed.4. Genetic Resources Conservation. Because of genetic erosion there is a need for conservation. PGR should be consigned to the appropriate method of conservation (ex situ, in situ, on-farm according to the scientific basis of biodiversity (genetic diversity, species diversity, ecosystem diversity and the evolutionary status of plants (cultivated plants, weeds, related wild plants (crop wild relatives.5. GMO. The impact of genetically engineered plants on genetic diversity is discussed.6. The Conclusions and Recommendations stress the importance of PGR. Their conservation and use are urgent necessities for the present development and future survival of mankind.

  15. Blockage of progestin physiology disrupts ovarian differentiation in XX Nile tilapia (Oreochromis niloticus)

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Linyan; Luo, Feng; Fang, Xuelian [Key Laboratory of Freshwater Fish Reproduction and Development (Ministry of Education), Key Laboratory of Aquatic Science of Chongqing, School of Life Sciences, Southwest University, Chongqing, 400715 (China); Charkraborty, Tapas [South Ehime Fisheries Research Center, Ehime University, Ainan, 798-4206 (Japan); Wu, Limin; Wei, Jing [Key Laboratory of Freshwater Fish Reproduction and Development (Ministry of Education), Key Laboratory of Aquatic Science of Chongqing, School of Life Sciences, Southwest University, Chongqing, 400715 (China); Wang, Deshou, E-mail: wdeshou@swu.edu.cn [Key Laboratory of Freshwater Fish Reproduction and Development (Ministry of Education), Key Laboratory of Aquatic Science of Chongqing, School of Life Sciences, Southwest University, Chongqing, 400715 (China)

    2016-04-22

    Previous studies indicated that maturation inducing hormone, 17α, 20β-Dihydroxy-4-pregnen-3-one (DHP), probably through nuclear progestin receptor (Pgr), might be involved in spermatogenesis and oogenesis in fish. To further elucidate DHP actions in teleostean ovarian differentiation, we analyzed the expression of pgr in the ovary of Nile tilapia (Oreochromis niloticus), and performed RU486 (a synthetic Pgr antagonist) treatment in XX fish from 5 days after hatching (dah) to 120dah. Tilapia Pgr was abundantly expressed in the follicular cells surrounding oocytes at 30 and 90dah. Continuous RU486 treatment led to the blockage of oogenesis and masculinization of somatic cells in XX fish. Termination of RU486 treatment and maintenance in normal condition resulted in testicular differentiation, and estrogen compensation in RU486-treated XX fish successfully restored oogenesis. In RU486-treated XX fish, transcript levels of female dominant genes were significantly reduced, while male-biased genes were evidently augmented. Meanwhile, both germ cell mitotic and meiotic markers were substantially reduced. Consistently, estrogen production levels were significantly declined in RU486-treated XX fish. Taken together, our data further proved that DHP, possibly through Pgr, might be essential in the ovarian differentiation and estrogen production in fish. - Highlights: • DHP plays a critical role in early stage oogenesis of XX tilapia. • Blockage of DHP actions by RU486 treatment led to masculinization and/or sex reversal in XX tilapia. • Both DHP and estrogen are indispensable for ovarian differentiation.

  16. Distinct functions and regulation of epithelial progesterone receptor in the mouse cervix, vagina, and uterus.

    Science.gov (United States)

    Mehta, Fabiola F; Son, Jieun; Hewitt, Sylvia C; Jang, Eunjung; Lydon, John P; Korach, Kenneth S; Chung, Sang-Hyuk

    2016-04-05

    While the function of progesterone receptor (PR) has been studied in the mouse vagina and uterus, its regulation and function in the cervix has not been described. We selectively deleted epithelial PR in the female reproductive tracts using the Cre/LoxP recombination system. We found that epithelial PR was required for induction of apoptosis and suppression of cell proliferation by progesterone (P4) in the cervical and vaginal epithelium. We also found that epithelial PR was dispensable for P4 to suppress apoptosis and proliferation in the uterine epithelium. PR is encoded by the Pgr gene, which is regulated by estrogen receptor α (ERα) in the female reproductive tracts. Using knock-in mouse models expressing ERα mutants, we determined that the DNA-binding domain (DBD) and AF2 domain of ERα were required for upregulation of Pgr in the cervix and vagina as well as the uterine stroma. The ERα AF1 domain was required for upregulation of Pgr in the vaginal stroma and epithelium and cervical epithelium, but not in the uterine and cervical stroma. ERα DBD, AF1, and AF2 were required for suppression of Pgr in the uterine epithelium, which was mediated by stromal ERα. Epithelial ERα was responsible for upregulation of epithelial Pgr in the cervix and vagina. Our results indicate that regulation and functions of epithelial PR are different in the cervix, vagina, and uterus.

  17. Evaluación de la susceptibilidad antimicrobiana de cepas de Salmonella spp. aisladas del beneficio porcino en Colombia / Evaluation of antimicrobial susceptibility of Salmonella spp. strains isolated from pork carcasses on Colombia

    Directory of Open Access Journals (Sweden)

    Paula M. Bermúdez D

    2014-01-01

    Full Text Available Objetivo: el estudio buscó establecer patrones de resistencia antimicrobiana de 155 cepas de Salmonella spp., aisladas de la superficie de canales de cerdo, procedentes de plantas de beneficio en Colombia. Metodología: mediante el método de difusión en disco (Bauer et. Kirby, 1966 se evaluaron nueve antimicrobianos: Amoxicilina y ácido clavulánico (30 ug, Ampicilina (10 ug, Ceftiofur (30 ug, Ciprofloxacina (5 ug, Cloranfenicol (30 ug, Florfenicol (30 ug, Gentamicina (10 ug, Sulfadiazina y Trimetoprim (25 ug y Tetraciclina (30 ug. Resultados: los resultados confirmaron la presencia de cepas multiresistentes de Salmonella spp. de origen porcino, mostrando 30 patrones diferentes de multiresistencia; el más común fue Ampicilina, Amoxicilina, Cloranfenicol, Florfenicol y Tetraciclina en el 16,77% (n=26 de las cepas. Tetraciclina y Florfenicol fueron los antimicrobianos menos efectivos en el 94,84% (n=147 y 47,74% (n=74 de cepas resistentes, respectivamente. Discusión: se deben consolidar los sistemas de monitoreo, y de vigilancia y control de las resistencias antimicrobianas para prevenir, con un enfoque de cadena productiva, la diseminación de cepas multiresistentes en alimentos de origen animal, como parte integral del sistema de gestión de inocuidad de los alimentos en Colombia. - Objetivo: el estudio buscó establecer patrones de resistencia antimicrobiana de 155 cepas de Salmonella spp., aisladas de la superficie de canales de cerdo, procedentes de plantas de beneficio en Colombia. Metodología: mediante el método de difusión en disco (Bauer et. Kirby, 1966 se evaluaron nueve antimicrobianos: Amoxicilina y ácido clavulánico (30 ug, Ampicilina (10 ug, Ceftiofur (30 ug, Ciprofloxacina (5 ug, Cloranfenicol (30 ug, Florfenicol (30 ug, Gentamicina (10 ug, Sulfadiazina y Trimetoprim (25 ug y Tetraciclina (30 ug. Resultados: los resultados confirmaron la presencia de cepas multiresistentes de Salmonella spp. de origen porcino, mostrando

  18. Feasibility of an Assessment Tool for Children's Competence to Consent to Predictive Genetic Testing: a Pilot Study

    NARCIS (Netherlands)

    Hein, Irma M.; Troost, Pieter W.; Lindeboom, Robert; Christiaans, Imke; Grisso, Thomas; van Goudoever, Johannes B.; Lindauer, Ramón J. L.

    2015-01-01

    Knowledge on children's capacities to consent to medical treatment is limited. Also, age limits for asking children's consent vary considerably between countries. Decision-making on predictive genetic testing (PGT) is especially complicated, considering the ongoing ethical debate. In order to

  19. A Comparison of Intention and Pantomime Gesture Treatment for Noun Retrieval in People with Aphasia

    Science.gov (United States)

    Ferguson, Neina F.; Evans, Kelli; Raymer, Anastasia M.

    2012-01-01

    Purpose: The effects of intention gesture treatment (IGT) and pantomime gesture treatment (PGT) on word retrieval were compared in people with aphasia. Method: Four individuals with aphasia and word retrieval impairments subsequent to left-hemisphere stroke participated in a single-participant crossover treatment design. Each participant viewed…

  20. Reactive Energetic Plasticizers Utilizing Cu-Free Azide-Alkyne 1,3-Dipolar Cycloaddition for In-Situ Preparation of Poly(THF-co-GAP-Based Polyurethane Energetic Binders

    Directory of Open Access Journals (Sweden)

    Mingyang Ma

    2018-05-01

    Full Text Available Reactive energetic plasticizers (REPs coupled with hydroxy-telechelic poly(glycidyl azide-co-tetrahydrofuran (PGT-based energetic polyurethane (PU binders for use in solid propellants and plastic-bonded explosives (PBXs were investigated. The generation of gem-dinitro REPs along with a terminal alkyne stemmed from a series of finely designed approaches to not only satisfy common demands as conventional energetic plasticizers, but also to prevent the migration of plasticizers. The miscibility and rheological behavior of a binary mixture of PGT/REP with various REP fractions were quantitatively determined by differential scanning calorimetry (DSC and rheometer, respectively, highlighting the promising performance of REPs in the formulation process. The kinetics on the distinct reactivity of propargyl vs. 3-butynyl species of REPs towards the azide group of the PGT prepolymer in terms of Cu-free azide-alkyne 1,3-dipolar cycloaddition (1,3-DPCA was studied by monitoring 1H nuclear magnetic resonance spectroscopy and analyzing the activation energies (Ea obtained using DSC. The thermal stability of the finally cured energetic binders with the incorporation of REPs indicated that the thermal stability of the REP/PGT-based PUs was maintained independently of the REP content. The tensile strength and modulus of the PUs increased with an increase in the REP content. In addition, the energetic performance and sensitivity of REP and REP triazole species was predicted.

  1. Consumers report lower confidence in their genetics knowledge following direct-to-consumer personal genomic testing.

    Science.gov (United States)

    Carere, Deanna Alexis; Kraft, Peter; Kaphingst, Kimberly A; Roberts, J Scott; Green, Robert C

    2016-01-01

    The aim of this study was to measure changes to genetics knowledge and self-efficacy following personal genomic testing (PGT). New customers of 23andMe and Pathway Genomics completed a series of online surveys. We measured genetics knowledge (nine true/false items) and genetics self-efficacy (five Likert-scale items) before receipt of results and 6 months after results and used paired methods to evaluate change over time. Correlates of change (e.g., decision regret) were identified using linear regression. 998 PGT customers (59.9% female; 85.8% White; mean age 46.9 ± 15.5 years) were included in our analyses. Mean genetics knowledge score was 8.15 ± 0.95 (out of 9) at baseline and 8.25 ± 0.92 at 6 months (P = 0.0024). Mean self-efficacy score was 29.06 ± 5.59 (out of 35) at baseline and 27.7 ± 5.46 at 6 months (P reported lower self-efficacy following PGT. Change in self-efficacy was positively associated with health-care provider consultation (P = 0.0042), impact of PGT on perceived control over one's health (P consumers in response to receiving complex genetic information.Genet Med 18 1, 65-72.

  2. Inheritance and bulked segregant analysis of leaf rust and stem rust resistance genes in eight durum wheat genotypes

    Science.gov (United States)

    Leaf rust, caused by Puccinia triticina (Pt) and stem rust caused by Puccinia graminis f. sp. tritici (Pgt) are important diseases of durum wheat. This study determined the inheritance and genomic locations of leaf rust resistance (Lr) genes to Pt-race BBBQJ and stem rust resistance (Sr) genes to Pg...

  3. How Well Do Customers of Direct-to-Consumer Personal Genomic Testing Services Comprehend Genetic Test Results? Findings from the Impact of Personal Genomics Study.

    Science.gov (United States)

    Ostergren, Jenny E; Gornick, Michele C; Carere, Deanna Alexis; Kalia, Sarah S; Uhlmann, Wendy R; Ruffin, Mack T; Mountain, Joanna L; Green, Robert C; Roberts, J Scott

    2015-01-01

    To assess customer comprehension of health-related personal genomic testing (PGT) results. We presented sample reports of genetic results and examined responses to comprehension questions in 1,030 PGT customers (mean age: 46.7 years; 59.9% female; 79.0% college graduates; 14.9% non-White; 4.7% of Hispanic/Latino ethnicity). Sample reports presented a genetic risk for Alzheimer's disease and type 2 diabetes, carrier screening summary results for >30 conditions, results for phenylketonuria and cystic fibrosis, and drug response results for a statin drug. Logistic regression was used to identify correlates of participant comprehension. Participants exhibited high overall comprehension (mean score: 79.1% correct). The highest comprehension (range: 81.1-97.4% correct) was observed in the statin drug response and carrier screening summary results, and lower comprehension (range: 63.6-74.8% correct) on specific carrier screening results. Higher levels of numeracy, genetic knowledge, and education were significantly associated with greater comprehension. Older age (≥ 60 years) was associated with lower comprehension scores. Most customers accurately interpreted the health implications of PGT results; however, comprehension varied by demographic characteristics, numeracy and genetic knowledge, and types and format of the genetic information presented. Results suggest a need to tailor the presentation of PGT results by test type and customer characteristics. © 2015 S. Karger AG, Basel.

  4. The Brachypodium-Puccinia graminis system: Solving a puzzle to uncover the underlying mechanisms of non-host resistance and plant immunity

    Science.gov (United States)

    Brachypodium distachyon is regarded as non-host to the causal agent of stem rust in wheat and barley, P. graminis f. sp. tritici (Pgt), and a near-host to the pathogens of forage grasses, P. graminis f. sp. lolii (Pgl) and P. graminis f. sp. phlei-pratensis (Pgp). Given the devastating effect of ste...

  5. Thrombin-activatable fibrinolysis inhibitor is degraded by Salmonella enterica and Yersinia pestis.

    Science.gov (United States)

    Valls Serón, M; Haiko, J; DE Groot, P G; Korhonen, T K; Meijers, J C M

    2010-10-01

     Pathogenic bacteria modulate the host coagulation system to evade immune responses or to facilitate dissemination through extravascular tissues. In particular, the important bacterial pathogens Salmonella enterica and Yersinia pestis intervene with the plasminogen/fibrinolytic system. Thrombin-activatable fibrinolysis inhibitor (TAFI) has anti-fibrinolytic properties as the active enzyme (TAFIa) removes C-terminal lysine residues from fibrin, thereby attenuating accelerated plasmin formation.  Here, we demonstrate inactivation and cleavage of TAFI by homologous surface proteases, the omptins Pla of Y. pestis and PgtE of S. enterica. We show that omptin-expressing bacteria decrease TAFI activatability by thrombin-thrombomodulin and that the anti-fibrinolytic potential of TAFIa was reduced by recombinant Escherichia coli expressing Pla or PgtE. The functional impairment resulted from C-terminal cleavage of TAFI by the omptins.  Our results indicate that TAFI is degraded directly by the omptins PgtE of S. enterica and Pla of Y. pestis. This may contribute to the ability of PgtE and Pla to damage tissue barriers, such as fibrin, and thereby to enhance spread of S. enterica and Y. pestis during infection. © 2010 International Society on Thrombosis and Haemostasis.

  6. Novel technologies emerging for preimplantation genetic diagnosis and preimplantation genetic testing for aneuploidy.

    Science.gov (United States)

    Sermon, Karen

    2017-01-01

    Preimplantation genetic diagnosis (PGD) was introduced as an alternative to prenatal diagnosis: embryos cultured in vitro were analysed for a monogenic disease and only disease-free embryos were transferred to the mother, to avoid the termination of pregnancy with an affected foetus. It soon transpired that human embryos show a great deal of acquired chromosomal abnormalities, thought to explain the low success rate of IVF - hence preimplantation genetic testing for aneuploidy (PGT-A) was developed to select euploid embryos for transfer. Areas covered: PGD has followed the tremendous evolution in genetic analysis, with only a slight delay due to adaptations for diagnosis on small samples. Currently, next generation sequencing combining chromosome with single-base pair analysis is on the verge of becoming the golden standard in PGD and PGT-A. Papers highlighting the different steps in the evolution of PGD/PGT-A were selected. Expert commentary: Different methodologies used in PGD/PGT-A with their pros and cons are discussed.

  7. Stem rust seedling resistance genes in Ethiopian wheat cultivars ...

    African Journals Online (AJOL)

    Thirty durum wheat (19 commercial cultivars and 11 breeding lines) and 30 bread wheat (20 commercial cultivars and 10 breeding lines) were tested for gene postulation. Stem rust infection types produced on wheat cultivars and breeding lines by ten Pgt races was compared with infection types produced on 40 near ...

  8. Amplified fragment length polymorphism of Puccinia graminis f. sp ...

    African Journals Online (AJOL)

    The developed AFLP fingerprints for the Ethiopian Pgt isolates reported herein could support the breeding program to develop strategies for the deployment of resistance genes in its continued effort to minimize the impact of stem rust on wheat in Ethiopia. Keywords: AFLP, wheat, stem rust, genetic diversity, population ...

  9. Genomic dissection of nonhost resistance to wheat stem rust in Brachypodium distachyon

    Science.gov (United States)

    Wheat stem rust caused by the fungus Puccinia graminis f.sp. tritici (Pgt) is a devastating disease that has largely been controlled for decades by the deployment of resistance genes. However, new races of this pathogen have emerged that overcome many important wheat stem rust resistance genes used ...

  10. Wheat stem rust in South Africa: Current status and future research ...

    African Journals Online (AJOL)

    . In South Africa, stem rust caused by Puccinia graminis Pers. f. sp. tritici. Eriks. & E. Henn. (Pgt) is an important disease of wheat. Records of stem rust occurrence in South Africa date back to the late 1720's, when it was first discovered in the ...

  11. Diet and exercise changes following direct-to-consumer personal genomic testing.

    Science.gov (United States)

    Nielsen, Daiva Elena; Carere, Deanna Alexis; Wang, Catharine; Roberts, J Scott; Green, Robert C

    2017-05-02

    The impacts of direct-to-consumer personal genomic testing (PGT) on health behaviors such as diet and exercise are poorly understood. Our investigation aimed to evaluate diet and exercise changes following PGT and to determine if changes were associated with genetic test results obtained from PGT. Customers of 23andMe and Pathway Genomics completed a web-based survey prior to receiving PGT results (baseline) and 6 months post-results. Fruit and vegetable intake (servings/day), and light, vigorous and strength exercise frequency (days/week) were assessed. Changes in diet and exercise were examined using paired t-tests and linear regressions. Additional analyses examined whether outcomes differed by baseline self-reported health (SRH) or content of PGT results. Longitudinal data were available for 1,002 participants. Significant increases were observed for vegetable intake (mean Δ = 0.11 (95% CI = 0.05, 0.17), p = 0.0003) and strength exercise (Δ = 0.14 (0.03, 0.25), p = 0.0153). When stratified by SRH, significant increases were observed for all outcomes among lower SRH participants: fruit intake, Δ = 0.11 (0.02, 0.21), p = 0.0148; vegetable intake, Δ = 0.16 (0.07, 0.25), p = 0.0005; light exercise, Δ = 0.25 (0.03, 0.47), p = 0.0263; vigorous exercise, Δ = 0.23 (0.06, 0.41), p = 0.0097; strength exercise, Δ = 0.19 (0.01, 0.37), p = 0.0369. A significant change among higher SRH participants was only observed for light exercise, and in the opposite direction: Δ = -0.2468 (-0.06, -0.44), p = 0.0111. Genetic results were not consistently associated with any diet or exercise changes. The experience of PGT was associated with modest, mostly positive changes in diet and exercise. Associations were independent of genetic results from PGT.

  12. Five polymorphisms and breast cancer risk: results from the Breast Cancer Association Consortium

    DEFF Research Database (Denmark)

    Gaudet, Mia M; Milne, Roger L; Cox, Angela

    2009-01-01

    -study heterogeneity for associations with risk for single-nucleotide polymorphisms (SNP) in CASP10, PGR, and BID. Estimates were imprecise for women of Asian and African descent due to small numbers and lower minor allele frequencies (with the exception of BID SNP). The ORs for each copy of the minor allele were...... to invasive breast cancer risk overall in women of European descent: ECCR4 per-allele OR (95% CI) = 0.99 (0.97-1.02), minor allele frequency = 27.5%; TNF 1.00 (0.95-1.06), 5.0%; CASP10 1.02 (0.98-1.07), 6.5%; PGR 1.02 (0.99-1.06), 15.3%; and BID 0.98 (0.86-1.12), 1.7%. However, we observed significant between...... rs744154, TNF rs361525, CASP10 rs13010627, PGR rs1042838, and BID rs8190315 genotypes among women of European descent....

  13. An Epidemiologic Study of Genetic Variation in Hormonal Pathways in Relation to the Effect of Hormone Replacement Therapy on Breast Cancer Risk

    Science.gov (United States)

    2008-10-01

    PGR gene to be associated with breast cancer. Using long-range PCR techniques to sequence exons 1 and 2 of PGR, and a Solexa chip from Illumina...specific histologic types associated with single SNPs in PGR, AKR1C1, AKR1C2, AKR1C3, SRD5A1, SRD5A2 and CYP3A4 Breast caner overall Ductal Lobular...1.3 0.96 T/T 92 (9.1) 120 (9.6) 1.1 0.8 1.4 72 (9.5) 1.1 0.8 1.5 27 (9.7) 1.0 0.6 1.7 0.93 CYP3A4 rs12333983 T/T 791 (77.8) 985

  14. Hidden Lineage Complexity of Glycan-Dependent HIV-1 Broadly Neutralizing Antibodies Uncovered by Digital Panning and Native-Like gp140 Trimer

    Directory of Open Access Journals (Sweden)

    Linling He

    2017-08-01

    Full Text Available Germline precursors and intermediates of broadly neutralizing antibodies (bNAbs are essential to the understanding of humoral response to HIV-1 infection and B-cell lineage vaccine design. Using a native-like gp140 trimer probe, we examined antibody libraries constructed from donor-17, the source of glycan-dependent PGT121-class bNAbs recognizing the N332 supersite on the HIV-1 envelope glycoprotein. To facilitate this analysis, a digital panning method was devised that combines biopanning of phage-displayed antibody libraries, 900 bp long-read next-generation sequencing, and heavy/light (H/L-paired antibodyomics. In addition to single-chain variable fragments resembling the wild-type bNAbs, digital panning identified variants of PGT124 (a member of the PGT121 class with a unique insertion in the heavy chain complementarity-determining region 1, as well as intermediates of PGT124 exhibiting notable affinity for the native-like trimer and broad HIV-1 neutralization. In a competition assay, these bNAb intermediates could effectively compete with mouse sera induced by a scaffolded BG505 gp140.681 trimer for the N332 supersite. Our study thus reveals previously unrecognized lineage complexity of the PGT121-class bNAbs and provides an array of library-derived bNAb intermediates for evaluation of immunogens containing the N332 supersite. Digital panning may prove to be a valuable tool in future studies of bNAb diversity and lineage development.

  15. Hidden Lineage Complexity of Glycan-Dependent HIV-1 Broadly Neutralizing Antibodies Uncovered by Digital Panning and Native-Like gp140 Trimer.

    Science.gov (United States)

    He, Linling; Lin, Xiaohe; de Val, Natalia; Saye-Francisco, Karen L; Mann, Colin J; Augst, Ryan; Morris, Charles D; Azadnia, Parisa; Zhou, Bin; Sok, Devin; Ozorowski, Gabriel; Ward, Andrew B; Burton, Dennis R; Zhu, Jiang

    2017-01-01

    Germline precursors and intermediates of broadly neutralizing antibodies (bNAbs) are essential to the understanding of humoral response to HIV-1 infection and B-cell lineage vaccine design. Using a native-like gp140 trimer probe, we examined antibody libraries constructed from donor-17, the source of glycan-dependent PGT121-class bNAbs recognizing the N332 supersite on the HIV-1 envelope glycoprotein. To facilitate this analysis, a digital panning method was devised that combines biopanning of phage-displayed antibody libraries, 900 bp long-read next-generation sequencing, and heavy/light (H/L)-paired antibodyomics. In addition to single-chain variable fragments resembling the wild-type bNAbs, digital panning identified variants of PGT124 (a member of the PGT121 class) with a unique insertion in the heavy chain complementarity-determining region 1, as well as intermediates of PGT124 exhibiting notable affinity for the native-like trimer and broad HIV-1 neutralization. In a competition assay, these bNAb intermediates could effectively compete with mouse sera induced by a scaffolded BG505 gp140.681 trimer for the N332 supersite. Our study thus reveals previously unrecognized lineage complexity of the PGT121-class bNAbs and provides an array of library-derived bNAb intermediates for evaluation of immunogens containing the N332 supersite. Digital panning may prove to be a valuable tool in future studies of bNAb diversity and lineage development.

  16. Effect of two different plant growth regulators on production traits of sunflower

    Directory of Open Access Journals (Sweden)

    Dávid ERNST

    2016-12-01

    Full Text Available The plant growth regulators (PGR are an organic compounds that modify plant physiological processes. PGR applied to the field crops promotes photosynthesis, stimulates plant growth, improves flowering and protects plants against unfavourable year weather conditions. Listed is an assumption to the yield of high quality. The effects of year weather conditions, biological material (hybrids and foliar application of two different PGR (Terra-Sorb® Foliar – containing free amino acids and Unicum® – containing Abiestins® on the yield-forming parameters, seed yield and the oil content in seeds of three selected hybrids of sunflower (NK Brio, NK Neoma, NK Ferti were studied in this paper. The field poly-factorial experiments were realized during two growing seasons of 2012 and 2013. The experimental area is situated in the maize-growing region (climatic region: warm; climatic sub-region: mild dry or dry; climatic zone: warm and dry, with mild winter and long sunshine and soil is silt loam Haplic Luvisol. The climatic conditions in chosen experimental years were different in quantities and distribution of precipitation at main growth period of sunflower plants (June to August and allows evaluating the yield stability between used hybrids and foliar treatments. The results showed that the application of selected PGR has contributed to an increase of sunflower seed yield, mainly through increase the weight of thousand seeds (rp = 0.761; P < 0.001. Similarly, oil content in seeds was significantly higher in treatments with PGR, especially with preparation Terra-Sorb® Foliar containing free amino acids. The study describes the relationship between quality (oil content in seeds and quantity (seed yield of sunflower production (rp = ‒0.41; P < 0.01. Results showed that PGR can be an important rationalization tool of the sunflower cultivation technology.

  17. A cognitively plausible model for grammar induction

    Directory of Open Access Journals (Sweden)

    Roni Katzir

    2015-01-01

    Full Text Available This paper aims to bring theoretical linguistics and cognition-general theories of learning into closer contact. I argue that linguists' notions of rich UGs are well-founded, but that cognition-general learning approaches are viable as well and that the two can and should co-exist and support each other. Specifically, I use the observation that any theory of UG provides a learning criterion -- the total memory space used to store a grammar and its encoding of the input -- that supports learning according to the principle of Minimum Description-Length. This mapping from UGs to learners maintains a minimal ontological commitment: the learner for a particular UG uses only what is already required to account for linguistic competence in adults. I suggest that such learners should be our null hypothesis regarding the child's learning mechanism, and that furthermore, the mapping from theories of UG to learners provides a framework for comparing theories of UG.

  18. In Situ Bioremediation of Chlorinated Solvent Source Areas with Enhanced Mass Transfer

    Science.gov (United States)

    2008-09-01

    three-dimensional view with iso -surface of LIF counts • GMS support files needed to operate GMS (for example, bor, .map, .mat, .img, .mat, and .sol...DCE (ug/L) trans-DCE (ug/L) VC (ug/L) Ethane (ug/L) Ethene (ug/L) Chloride (ug/L) 5C2C43 11/9/2005 440 J,B,D 27000 D 0 540 D 4.0 J 8.6 J...0.43 J 0.64 J 2C2D21 7/18/2005 29000 D 2C2D22 7/19/2005 530 J, D 30000 B, D, E 0 0 0 0 2C2D22 7/19/2005 27000 D 2C2D23 7/20/2005 180 J

  19. Thermoelectric properties of unoxidized graphene/Bi{sub 2}Te{sub 2.7}Se{sub 0.3} composites synthesized by exfoliation/re-assembly method

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jin Il; Lee, Eun Sil; Kim, Jong-Young [Icheon Branch, Korea Institute of Ceramic Engineering and Technology, Gyeonggi-do (Korea, Republic of); Choi, Soon-Mok [School of Energy, Materials and Chemical Engineering, Korea University of Technology and Education, Cheonan (Korea, Republic of); Lee, Kyu Hyoung [Materials R and D Center, Samsung Advanced Institute of Technology, Yongin (Korea, Republic of); Seo, Won-Seon [Energy and Environmental Division, Korea Institute of Ceramic Engineering and Technology, Seoul (Korea, Republic of)

    2014-04-15

    Nanocomposites of n-type thermoelectric Bi{sub 2}Te{sub 2.7}Se{sub 0.3} (BTS) and unoxidized graphene (UG) were prepared from the exfoliated BTS and UG nanoplatelets. Polycrystalline BTS ingots were exfoliated into nanoscroll-type crystals by chemical exfoliation, and were re-assembled with UG nanoplatelets. The composites were chemically reduced by hydrazine hydrate and sintered by a spark-plasma-sintering method. The thermoelectric properties of the sintered composites were evaluated and exhibited decreased carrier concentration and increased thermal conductivity due to the embedded graphene. The peak ZT values for the UG/BTS-US and UG/BTS-EX composites were ∝0.8 at the UG concentration of 0.05 wt%. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  20. Bedrock displacements in Greenland manifest ice mass variations, climate cycles and climate change

    DEFF Research Database (Denmark)

    Bevis, Michael; Wahr, John; Khan, Shfaqat Abbas

    2012-01-01

    for by an annual oscillation superimposed on a sustained trend. The oscillation is driven by earth’s elastic response to seasonal variations in ice mass and air mass (i.e., atmospheric pressure). Observed vertical velocities are higher and often much higher than predicted rates of postglacial rebound (PGR......), implying that uplift is usually dominated by the solid earth’s instantaneous elastic response to contemporary losses in ice mass rather than PGR. Superimposed on longer-term trends, an anomalous ‘pulse’ of uplift accumulated at many GNET stations during an approximate six-month period in 2010...

  1. Expression of progesterone receptor protein in the ovine uterus during the estrous cycle: Effects of nutrition, arginine and FSH.

    Science.gov (United States)

    Grazul-Bilska, Anna T; Thammasiri, Jiratti; Kraisoon, Aree; Reyaz, Arshi; Bass, Casie S; Kaminski, Samantha L; Navanukraw, Chainarong; Redmer, Dale A

    2018-03-01

    To evaluate expression of progesterone receptor (PGR) AB in follicle stimulating hormone (FSH)-treated or non-treated sheep administered with arginine (Arg) or saline (Sal) fed a control (C), excess (O) or restricted (U) diet, uterine tissues were collected at the early, mid and/or late luteal phases. In exp. 1, ewes from each diet were randomly assigned to one of two treatments, Arg or Sal administration three times daily from day 0 of the first estrous cycle until uterine tissue collection. In exp. 2, ewes were injected twice daily with FSH on days 13-15 of the first estrous cycle. Uterine tissues were immunostained to detect PGR followed by image analysis. PGR were detected in luminal epithelium (LE), endometrial glands (EG), endometrial stroma (ES), myometrium (Myo), and endometrial and myometrial blood vessels. The percentage of PR-positive cells and/or intensity of staining were affected by phase of the estrous cycle, plane of nutrition, and/or FSH but not by Arg. In exp. 1, percentage of PGR-positive cells in LE and EG but not in ES and Myo was greater at the early and mid than late luteal phase, was not affected by plane of nutrition, and was similar in LE and EG. Intensity of staining was affected by phase of the estrous cycle and plane of nutrition in LE, EG and Myo, and was the greatest in LE, less in EG, and least in ES and Myo. In exp. 2, percentage of PGR-positive cells in LE, EG, ES and Myo was affected by phase of the estrous cycle, but not by plane of nutrition; was greater at the early than mid luteal phase; and was greatest in LE and EG, less in luminal (superficial) ES and Myo and least in deep ES. Intensity of staining was affected by phase of the estrous cycle and plane of nutrition in all compartments but ES, and was the greatest in LE and luminal EG, less in deep EG, and least in ES and Myo. Comparison of data for FSH (superovulated) and Sal-treated (non-superovulated) ewes demonstrated that FSH affected PR expression in all evaluated

  2. Next-generation Surface Enhanced Raman Scattering (SERS) Substrates for Hazard Detection

    Science.gov (United States)

    2012-09-01

    substrates at differing concentrations ranging from 0.05 ug/cm2 to 50 ug/cm2. These concentrations were independently validated by UV -Vis...standard Klarite substrates at a concentration of 5.0 ug/cm2. The concentration jetted was validated using a secondary UV -Vis technique.(20, 81) After... Spectros ., 994 (1997). [58] Alexander, T.A., Le, D.M., "Characterization of a commercialized SERS-active substrate and its application to the

  3. Metabolomic effects in HepG2 cells exposed to CeO2, SiO2 and CuO nanomaterials.

    Science.gov (United States)

    To better assess potential hepatotoxicity of nanomaterials, human liver HepG2 cells were exposed for three days to 5 different CeO2 (either 30 or 100 ug/ml), 3 SiO2 based (30 ug/ml) or 1 CuO (3 ug/ml) nanomaterials with dry primary particle sizes ranging from 15 to 213 nm. Metab...

  4. Gene : CBRC-AGAM-05-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 27560014 /ug=Aga.24572 /len=986 7e-09 22% MVANTFAIVAKRSAIVAKRSAIIANTFTIVANYSAVVAKSSAIDPKSSAIVGKTFAIVAKTFAIVA...KTFAIVANYSAVVANYSAIVAKSSAIVAKSSAIVANTFAIFANTFAIVANTFAIIAKTFAIVAKTFAIVAKTFAIVAKSSAIVAKSSAIVAKSSAIVANTFAIVAKSS...AIVAKSSAIITNTFTIVANYSAVVAKSSAIVPKNSAIVGKTFAIVAKTFAIVAKTFAIVANTFAIVANYSAVVANYSAIVA...KSSAIVAKSSAIVAKTFAIFANTFAIVANTFAIVANYSAIVAKSSAIVAKSFEIIVKTFAIFAKTFAIVANYSAIVAKTFAIVAINSEIVAKSSATVANTFAIVANTFAIVANTFAIVAKTFAIVANYSAIVA ...

  5. Gene : CBRC-MDOM-02-0490 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 35195 /gi=3928780 /ug=Mdm.251 /len=1699 0.001 30% MHVKHLRHTYMIYVHANTCTHIPLYTLAYIIHTYTYIHICPSIHPSIHPSTHPHIHTST...HLHIHPSIHPLIHSSTHPHIYTSTHLSIHPSTHPPIHPSIHPSIHPSIHPSIHLPIHTSTYPHIHPSTHPSIHTSIHPSIHTSTHPSIHLPIHTSTYPHIHPSTHPSIHTSIHPSIHTSTHPSIHLPIHTST...YPHIHPSTHPSIHTSTHPSIHTSTHPSIHLPIHTSTYPHIHPSTHPSIHTSTHPSIHTST...HPSIHPSIHPSIHPSIHPSTLPHIYLSTHPSTHPSIHPHIHSSIHPHIHTSTQPASQPATHTYIHPSIDPHIHPTIHPHIHPSTHPFIHPSIDPHIHPTIHPHIHPSTHPSIHPSIDPLIHPSTHPHIHPSTHTCTWNGGRSTC ...

  6. Gene : CBRC-PMAR-01-0324 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available d=5' /gb=EG024802 /gi=115341549 /ug=Pma.618 /len=652 2e-14 24% MFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFM...FCRCRCHWFFMFCRCRYHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFVFCRSRCHWFFM...FCRCRCHWFFMFCRCRFNWFFMFCRCRCHWFFMFCRSRCHWFFMFCRCRCHWFFVFCRSRCHWFFMFCRCRCHWFFVFCRSRCHWFFMFCRCRCHWFFMFYRCRCLNDAAVHKNKNTAIVHVCKVTP ...

  7. Gene : CBRC-OLAT-01-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available /clone_end=3' /gb=DC259951 /gi=141600100 /ug=Ola.17741 /len=827 1e-20 31% MVVCTAVCMAVCAAVCTAVCKEVCIAICTAICAVDCMAVFIAVCTDVLTAVCTAVC...VAVCTAVCTAICAVDCMAVCIAVCTDILTAVYTAVCTAVCTAVCTAICAVDCMAVCIAVCTDILTAVYTAVCTAVCMVVCTDVLTAVCKAVCMAVCKAICTAVCTAVCTAVCLYE ...

  8. Gene : CBRC-MMUS-23-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available LLKCVFVIYRDFHFSRHFPGPTVCISHFSRLLVNLSFFKSSSGCFSFSMIISFLSIFHVLQWRFLNFPPFSVFLAIFHILKCVLLIFWDFQFSCNIPGPTVCISHFSR...FSVISSFFKSSSGCFSFSMIFSFLAIFHVLQWILLYFPPFSVFLAIFHILKHVFLIFRDFQFSLNIPGPIVCISHFSCFSI...ISSSYFTSLTSLILFFRDFQFSRHIPGHTVCISHFSRFYCDIVIFQVVKWMFLIFHDFQFSCNIPCRTVDISKFFTFFSFPHHISRHKVCISHFP ... ... insert sequence /gb=AK156981 /gi=74152306 /ug=Mm.330279 /len=4633 1e-112 58% MIFSFLSIFHVLQWTFLNYLPFSVFLAIFH

  9. Gene : CBRC-XTRO-01-2729 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 559 /gi=71785299 /ug=Str.71415 /len=820 6e-19 35% MQPPVYTTRLFHAAPCISHWALPCSPLYIPLRSSMQPPVYPTALFHAAPCISH...CALPCSPLYIPLRSSMQPPVYTTALFHAAPCISHCALPCSPLYIPLGFSMQPPVYPTGLFHAAPCISHWALPCRPLYIPLGFSMQPPVYPTGLFHAAPCISH...CALPCSPLYIPLRSSMQPPVYPTALFHAAPCISHCALPCSPLYIPLGSSMQPPVYPTALFHAAPCISHWAFPCSPLYIPLGSSMKHRTTFMQKTSTDAPAVPHTRSLTSCKLSLMLLPGLPKPFYIGIPRPYSQ ...

  10. Gene : CBRC-MMUS-09-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available equence /gb=AK156981 /gi=74152306 /ug=Mm.330279 /len=4633 1e-120 79% MIFSFLAIFQVLQWTFPNFRPLSVFLAIFHVPKCVFLIFHDFQFPRHIPGPTVCISH...FSRFSVISSFFKTSSGCFSFFMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCHIPGPTVCISHFSRFSVILSFFN...LSTACFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFTFLAIFQVLQGHFSFFTFSVILSFSICQLHVSHFP ...

  11. Ultrasound-Guided Miniscalpel-Needle Release versus Dry Needling for Chronic Neck Pain: A Randomized Controlled Trial

    Directory of Open Access Journals (Sweden)

    Yongjun Zheng

    2014-01-01

    Full Text Available Objective. To compare ultrasound-guided miniscalpel-needle (UG-MSN release versus ultrasound-guided dry needling (UG-DN for chronic neck pain. Methods. A total of 169 patients with chronic neck pain were randomized to receive either UG-MSN release or UG-DN. Before treatment and at 3 and 6 months posttreatment, pain was measured using a 10-point visual analogue scale (VAS. Neck function was examined using the neck disability index. Health-related quality of life was examined using the physical component score (PCS and mental component score (MCS of the SF-36 health status scale. Results. Patients in the UG-MSN release had greater improvement on the VAS (by 2 points at 3 months and 0.9 points at 6 months versus in the UG-DN arm; (both P<0.0001. Patients receiving UG-MSN release also showed significantly lower scores on the adjusted neck disability index, as well as significantly lower PCS. No severe complications were observed. Conclusion. UG-MSN release was superior to UG-DN in reducing pain intensity and neck disability in patients with chronic neck pain and was not associated with severe complications. The procedural aspects in the two arms were identical; however, we did not verify the blinding success. As such, the results need to be interpreted with caution.

  12. Radiation sensitivity of two Ginger varieties (Zingiber officinale Rosc.) to gamma irradiation

    International Nuclear Information System (INIS)

    Nwachukwu, E.C.; Ene, L.S.O.; Mbanaso, E.N.A.

    1994-01-01

    The mutability and radiosensitivity of two local ginger varieties in Nigeria ''Tafin Giwa'' (UG 1) and ''Yatsun Biri'' (UG 2) were studied using gamma rays from a 60Co gamma source. There was a high frequency of chlorophyll mutations indicating a high mutability in ginger. GR 50 was obtained at 5.0 and 6.0 Gy in UG1, and UG2, respectively, while LD50 was obtained at 8.75 Gy in both varieties. The dose limitation range for ginger was estimated to be 5.0-9.0 Gy [es

  13. Gene : CBRC-OANA-01-1685 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available | PREDICTED: similar to vomeronasal V1r-type receptor V1rg7 [Ornithorhynchus anatinus] 1e-148 100% gnl|UG|Oa...LSIFQAITISPSTSWWAGRKTKLPKCILPSFVIFWILNMLIDFHTLIVVTGPHNARIHQDMKYCSLGNASARATLIFSVVLSLRDLFFVGLMSVASVYMVFVLYSHHR

  14. Gene : CBRC-FRUB-02-0753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available AB246172 /gi=115305877 /ug=Tru.3675 /len=5037 2e-47 41% MSNITTTTSATTSQTSSSTSTSPSTTSA...TTSSPTTSTTTSQTSSSTSTSPSTTSATTSSPTTSATTSQTSSSTATSPSTTSATTSSPTTSATTSQTSSSTSTSPSTTSATTSSPTTSATSSQTSSSTATSPSTTSETTSSPTTSA...TTSQTSSSTTSPSTSSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSKTSSSTDTNPSTTSATTSSPTTSA...TTSQTSSSTTTNPSTTSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSKKSSSTDTNPSTTSATTSSPTTSA...TSSQTSSSTSTSPSTTSTTTSSPTTSATTSQTSSSTSTSPSTSSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSQTSSSTTSPSTTSTTTSSPTTSA

  15. Gene : CBRC-DMEL-08-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 8016 /ug=Dm.1879 /len=6178 4e-22 26% MYCSCTGPVLVLYWSRSGPVLVPYWSRTGPVPGPVLVLGPVLDS...VLGSVLGSVLGSVLVLVLVPYWSRSGPVLVPYWSRTGPVLVPYSVPYSIPYWVQYSVPYSVPYSVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVL...VQYSVPYWSRTGRVLCSVLGSVLGPVLVPYWSRTGPVLVPYWSRTGPVLVPYSVPYSVPYSVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGP...VLSPVLSPVLVPYWSRTLFRTRFRTRSRTGPVLVPYWSRTGPVLVPYSVPYSVPYSVPYWSRTGPVLVPYWSRTGPVLVPYWSRTRSRTRSRTGP...VLVPYLSCTGPVLGHVLLLYWSRTGPILVPFWSRTGPVLVPYSVPYSYSVPYSIPYWVPYLVPYSVPYSFSYWFRTGPVLVPYWSRTGP

  16. Small battery operated unattended radar sensor for security systems

    Science.gov (United States)

    Plummer, Thomas J.; Brady, Stephen; Raines, Robert

    2013-06-01

    McQ has developed, tested, and is supplying to Unattended Ground Sensor (UGS) customers a new radar sensor. This radar sensor is designed for short range target detection and classification. The design emphasis was to have low power consumption, totally automated operation, a very high probability of detection coupled with a very low false alarm rate, be able to locate and track targets, and have a price compatible with the UGS market. The radar sensor complements traditional UGS sensors by providing solutions for scenarios that are difficult for UGS. The design of this radar sensor and the testing are presented in this paper.

  17. Gene : CBRC-MDOM-04-0140 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available /cds=p(1,2634) /gb=NM_001099531 /gi=156119554 /ug=Mdm.4760 /len=2634 0.33 30% MPNSLTSALLNLLIYELKDMNFPLTTALAASHRFCKDVSSLSFSSMKLLIISTI...CSLSNQFWRIVFFNFQLIFDLPLHVPLLIIIFIALLSEKVAFIISALLNLFGMFLC

  18. Associations between physical activity and characteristics of urban green space

    DEFF Research Database (Denmark)

    Schipperijn, Jasper; Bentsen, Peter; Troelsen, Jens

    2013-01-01

    of the nearest UGS, and the presence of certain features. However, the evidence to date is somewhat inconclusive, and dominated by studies from North America and Australia. There is a large variation in city structures, and recommendations for North American or Australian cities are not automatically valid...... was found. The amount and number of UGS within one kilometre revealed no association either. For PA in the nearest UGS positive associations with size, walking/cycling routes, wooded areas, water features, lights, pleasant views, bike rack, and parking lot were found. This indicates that PA in an UGS might...

  19. Gene : CBRC-PMAR-01-0595 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available =3' /gb=EE272592 /gi=111172325 /ug=Pma.6919 /len=680 2e-04 30% MRLEYLAAIHFNVMMSHFVMMSHFVMMSHFVMMSHVVMMS...YFVMMSHFVMMSHFVMSHVVMMSHFVMSHFVMMSHVVMMSHFVMMSHFVMMSHVVMMSHFVMMNHFVMMNHFVMMSHFVMMSHFVMMSHFVMSHVVMMS...HFVMMNHFVMMNHFVMMSHFVMMSHFVMMSHFVMMNHFVMMNHFVMMSHFVMMSHFVXXXXEPLRDDEPLRDDEPLRDDEPLRDDEPLRDDESLR

  20. Gene : CBRC-CINT-01-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 500 /gi=47795328 /ug=Cin.16042 /len=777 0.22 22% MCXXXXXXXXXXXXXXXXXIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKLSMLIYMMSMLIYMMSMLIYMMS...MLIYMMSMLIYMMSMLIYMMSMLIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKLSMLIYMMSMLIYMMS...MLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYMMS...MLIYMMSMLIYMMSMLIYRLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

  1. Gene : CBRC-MDOM-04-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 11) /gb=EF508680 /gi=145232584 /ug=Mdm.4709 /len=10011 0.055 29% MKLINYIYSSVWHFLINFINSS...VWHFLINFIYSSVWHFLINFINSSVWHFLINFIYSSVWHFLINFINSSVWHFLINFINSSVWHFLINFIYSSSLALFDQFHKLFSLALFDQFHILFSLALFDQFHKLFSLALFDQFHILFSLALFDQFHKLFSLALFDQFHILFSLALFDQFHKLFSLALFGQFHILFSLALFL ...

  2. Gene : CBRC-DRER-22-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 102920926 /ug=Dr.79541 /len=690 4e-72 87% MECAARSGDEKELENSKAGVVAARVLNSGVVARVLISCVVARVLSSGVVARVLISCVVAR...VLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVDARVLNSGVVARVLISCVVARVLNSGVVAR...VLISCVVARVLISCVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVVARVLNSGVVAGVLISCVVARVLNSGVVTRVLISCVVARVLISCVVAR...VLISCVDARVLNSGVVAGVLISCVVARVLNSGVVTRVLISCVVARVLISCVVARVLNSGVVSTLFRLMQT ...

  3. Gene : CBRC-CINT-01-0197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1561) /gb=AY895021 /gi=62903344 /ug=Cin.18201 /len=1561 1.4 25% MELDHIVLVLRNIFLMV...VDWPFLWSVRRCHRMELDHTVLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQRMELDHIVLVLGNTLLMVVEQPFLQLVRRYQRMELDHI...VLVLGNTLLIVVEQPFLQLVRRYQRMELDHIVLVLGNTLLIVVEQPFLQLVRRYQRMELDHIVLVLGNTLLMEQPFLQLVRRYQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQCMEQEQMKQVKE ...

  4. Gene : CBRC-XTRO-01-0146 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available d=5' /gb=ES686353 /gi=148865870 /ug=Str.75856 /len=769 6e-62 55% MYFSVFANEIRNFIANSCPM...LPVCAILCLPYAACMPYSACPMLPVCAILCLPYAACVCHTRPALCCLCVSYSACPMLPVCHILPALCCLCVLYFACPMLLVCVILDLPYAACVCHTLPALCCMCVPYSACPM...LPVCAILCLPYAACVPYSACPMLPVCAILCLPYAACVCHTLPALCCMCVPYSACPMLPVCAILCLPYAAGVCHTRPALCCLCVPYSACPMLPVFDIPCPYLPTVPLSVGQSQYLWHCPLSRIHC ...

  5. Gene : CBRC-XTRO-01-3375 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available d=5' /gb=ES686353 /gi=148865870 /ug=Str.75856 /len=769 8e-72 58% MLPVCHTLPALCCMCVPYSACPM...VPVCAILCLPYAACVFHTLPALCCLCVPYSACPMLPVCAILCLPYAACVFHTLPALCCLCVPYSACPMLPVCSILCLPYAACVFHTLPALCCLCVPYFPCPFLPVFHNLPVLCCLCVPYSACPM...LPVCPILCLPYAACVFHTLPALCCLCVPYSACPMLPVCSILCLPYAACVCHTLPALCCLCVPYSACPMLPVCSTLCLPYAACVCHTFPAFFCLCSIICLSYAACVFHTLPVLCCLCVPYSACPMLPVCATLCLPYAAYGR ...

  6. Gene : CBRC-MMUS-05-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 205) /gb=AB034730 /gi=7209718 /ug=Mm.329131 /len=3320 9e-14 24% MLLMCSMTMLLMRSAITLLICSATMLFMHSATM...LLMCSVNMLFMCSATMLFMGSATTLLMGSATMLLMGSANLLFMGSGTKLFKGSATMLFMGSATMLLMGSATMLLIGSATMLFKGSTNMLLMCSATMVFMGSGIMLFKGSATM...LFMHSSTMLHMGSGTKLFIGSATMLLMGSATMLFKGSATMLSMHSVTMLHMGSATMSFMGSATMLFNGSAAMSFMGSATMLRIPWRLGVEESLERLKEFSLTDLFSSGFMQG ...

  7. Gene : CBRC-RNOR-14-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ' /gb=CB805046 /gi=29921778 /ug=Rn.215427 /len=409 2e-13 100% MYHFLGFATLMLLMCSATM...MFMLSVNMLLMRSVNLLLTFSVHVLLICSVNTLPMCSVNMFMHSTIMLLMCSAIMLLMSSKVMLLMSSAIMLLMWSAILLRVRLATMLLMCSVITLFMGSATMLSMCPETMLITCSATTLSMCSATM...QSMGSATMQFMGSATMQFMHSANMLFMGSATMQFMHSSNMLFMGSATMQFMHSSNMLFMGSATMLFMGSATMQFMHSATMQVMGSATML...HMGSATTLFMGSATTLFMGPAIMLHMGSATTLFMGPAIMLHMGSATTLFMGPAIMLHMGSATMLFMGPAIMLHMGSATMLHMGSAIMLCMCPATM...LLMCSAIILYMGSATMLSMCSATMQFMGSATMQFMGSATMQFMGSATMLSMYSAIMQFMGSATMLSMCSATMQFMGSATMQFMHSATMQFMGSATMLSMCSATMQFMGSATMQFMGSATM ...

  8. The anger-infused Ultimatum Game: A reliable and valid paradigm to induce and assess anger.

    Science.gov (United States)

    Gilam, Gadi; Abend, Rany; Shani, Hagai; Ben-Zion, Ziv; Hendler, Talma

    2018-03-22

    The Ultimatum Game (UG) is a canonical social decision-making task whereby a proposer divides a sum of money between himself and a responder who accepts or rejects the offer. Studies consistently demonstrate that unfair offers induce anger, and that rejecting such offers relates to aggression. Nevertheless, the UG is limited in interpersonal provocations common to real-life experiences of anger. Moreover, the psychometric properties of the UG as an anger-induction paradigm have yet to be evaluated. Here, to induce a more intense and genuine anger experience, we implemented a modified UG whereby short written provocations congruent with unfairness levels accompanied each offer. We aimed to test whether this anger-infused UG led to more anger and aggressive responses relative to the standard UG and to establish the reliability and validity of both versions. Participants performed either the anger-infused UG or a standard version, repeated twice, a week apart. They also performed the Taylor Aggression Paradigm, a reactive aggression paradigm, and completed emotion ratings and a trait anger inventory. Results indicate similar decreases in acceptance rates with increase in offer unfairness, and increases in reported anger, across both UG versions. Both versions demonstrated strong test-retest reliability. However, the anger-infused UG led to significantly stronger relations with reactive aggression and trait anger compared to the standard UG, providing evidence for better validity. The development of the anger-infused UG as a reliable and valid paradigm is pivotal for the induction and assessment of interpersonal anger and its aggressive expression in basic and clinical research settings. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

  9. One World, One Standard for Burn Care: Nursing's Role in Global Health

    Directory of Open Access Journals (Sweden)

    Sheryl A Ramstad

    2017-06-01

    Full Text Available In 1978, a landmark United Nations conference in Alma-Ata declared the goal of health for all by the year 2000 (WHO, 1978. Yet, today significant disparities exist between the health care afforded individuals in resource-limited countries and those in the industrialized world. Nursing, as a global profession, can become a powerful force for change so that better health is universally achieved. Problem/Background: This project started with a partnership between a burn center in the United States and a pediatric burn center (Burn Center in Peru, a country in which it is estimated that 15,000 children endure burn injuries each year (Huby-Vidaurre, 2016. Most are under the age of five, and suffer scald burns from pots with hot liquids left to cool on the floors of their homes. Pressure garment therapy (PGT is a major treatment to reduce scarring for pediatric burn survivors in the United States since the early 1970s, but is unavailable in Peru. Strategy: The Doctor of Nursing Practice project leader worked with the Burn Center team to develop a plan to use PGT as an intervention to address disfiguring scarring among pediatric burn survivors, utilizing the twinning approach. Methods: This quality improvement project involved interdisciplinary collaboration and international partnerships between resource-rich and resource-challenged nations. Obtaining supplies needed to promote PGT in Peru required cultivating relationships with many people in the United States, including translators and interpreters to assist in overcoming language barriers among the participants, manufacturers and distributors of pressure garments to donate fabrics, and people regularly traveling to Peru who transported the donated PGT materials. It also involved working closely with the Burn Center team on developing a culture conducive to conforming to an international standard of practice. Results: Resources were successfully leveraged to build a sustainable PGT program for all

  10. Dioscorea trifida L.

    African Journals Online (AJOL)

    SAM

    2014-04-09

    Apr 9, 2014 ... Oxidation reached a similar level on medium S, T and ZR (2.17 - 2.40) while it was only 1.63 on medium. EBR. Well-developed shoots were ... pathogens, both in the field and during tuber storage, and viruses can accumulate .... Our objective was to study if these changes in. PGR content in the recovery ...

  11. A Gata2-Dependent Transcription Network Regulates Uterine Progesterone Responsiveness and Endometrial Function

    Directory of Open Access Journals (Sweden)

    Cory A. Rubel

    2016-10-01

    Full Text Available Altered progesterone responsiveness leads to female infertility and cancer, but underlying mechanisms remain unclear. Mice with uterine-specific ablation of GATA binding protein 2 (Gata2 are infertile, showing failures in embryo implantation, endometrial decidualization, and uninhibited estrogen signaling. Gata2 deficiency results in reduced progesterone receptor (PGR expression and attenuated progesterone signaling, as evidenced by genome-wide expression profiling and chromatin immunoprecipitation. GATA2 not only occupies at and promotes expression of the Pgr gene but also regulates downstream progesterone responsive genes in conjunction with the PGR. Additionally, Gata2 knockout uteri exhibit abnormal luminal epithelia with ectopic TRP63 expressing squamous cells and a cancer-related molecular profile in a progesterone-independent manner. Lastly, we found a conserved GATA2-PGR regulatory network in both human and mice based on gene signature and path analyses using gene expression profiles of human endometrial tissues. In conclusion, uterine Gata2 regulates a key regulatory network of gene expression for progesterone signaling at the early pregnancy stage.

  12. Experiment list: SRX735140 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX735140 hg19 TFs and others Epitope tags Uterus Endometrial stromal cells NA 4717...6648,92.9,11.2,8048 GSM1527529: PGR-B ChIPSeq; Homo sapiens; ChIP-Seq source_name=Endometrial stromal cells || cell type=Endometr

  13. Experiment list: SRX735139 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX735139 hg19 TFs and others Epitope tags Uterus Endometrial stromal cells NA 5046...8720,97.1,10.0,3809 GSM1527528: PGR-A ChIPSeq; Homo sapiens; ChIP-Seq source_name=Endometrial stromal cells || cell type=Endometr

  14. A mechanistic analysis of density dependence in algal population dynamics

    Directory of Open Access Journals (Sweden)

    Adrian eBorlestean

    2015-04-01

    Full Text Available Population density regulation is a fundamental principle in ecology, but the specific process underlying functional expression of density dependence remains to be fully elucidated. One view contends that patterns of density dependence are largely fixed across a species irrespective of environmental conditions, whereas another is that the strength and expression of density dependence are fundamentally variable depending on the nature of exogenous or endogenous constraints acting on the population. We conducted a study investigating the expression of density dependence in Chlamydomonas spp. grown under a gradient from low to high nutrient density. We predicted that the relationship between per capita growth rate (pgr and population density would vary from concave up to concave down as nutrient density became less limiting and populations experienced weaker density regulation. Contrary to prediction, we found that the relationship between pgr and density became increasingly concave-up as nutrient levels increased. We also found that variation in pgr increased, and pgr levels reached higher maxima in nutrient-limited environments. Most likely, these results are attributable to population growth suppression in environments with high intraspecific competition due to limited nutrient resources. Our results suggest that density regulation is strongly variable depending on exogenous and endogenous processes acting on the population, implying that expression of density dependence depends extensively on local conditions. Additional experimental work should reveal the mechanisms influencing how the expression of density dependence varies across populations through space and time.

  15. and C-terminus of

    Indian Academy of Sciences (India)

    amino acids 108–120) was expressed from Potato virus X (PVX)-based vector pGR106 as N- or C-terminal fusion with the PVX coat protein (PVX CP) in transgenic Nicotiana benthamiana plants. The fusion protein L2108-120-PVX CP was ...

  16. Strategies For Sustainable Conservation And Use Of Legume ...

    African Journals Online (AJOL)

    Strategies For Sustainable Conservation And Use Of Legume Genetic Resources In Ghana. ... Ghana Journal of Science ... Strategic development of conservation technologies in plant genetic resources (PGR) is the backbone for agricultural development, food security and sustainable livelihood, now and for the future.

  17. American Society of Clinical Oncology/College Of American Pathologists guideline recommendations for immunohistochemical testing of estrogen and progesterone receptors in breast cancer.

    NARCIS (Netherlands)

    Hammond, M.E.; Hayes, D.F.; Dowsett, M.; Allred, D.C.; Hagerty, K.L.; Badve, S.; Fitzgibbons, P.L.; Francis, G.; Goldstein, N.S.; Hayes, M.; Hicks, D.G.; Lester, S.; Love, R.; Mangu, P.B.; McShane, L.; Miller, K.; Osborne, C.K.; Paik, S.; Perlmutter, J.; Rhodes, A.; Sasano, H.; Schwartz, J.N.; Sweep, F.C.; Taube, S.; Torlakovic, E.E.; Valenstein, P.; Viale, G.; Visscher, D.; Wheeler, T.; Williams, R.B.; Wittliff, J.L.; Wolff, A.C.

    2010-01-01

    PURPOSE: To develop a guideline to improve the accuracy of immunohistochemical (IHC) estrogen receptor (ER) and progesterone receptor (PgR) testing in breast cancer and the utility of these receptors as predictive markers. METHODS: The American Society of Clinical Oncology and the College of

  18. American Society of Clinical Oncology/College of American Pathologists guideline recommendations for immunohistochemical testing of estrogen and progesterone receptors in breast cancer.

    NARCIS (Netherlands)

    Hammond, M.E.; Hayes, D.F.; Dowsett, M.; Allred, D.C.; Hagerty, K.L.; Badve, S.; Fitzgibbons, P.L.; Francis, G.; Goldstein, N.S.; Hayes, M.; Hicks, D.G.; Lester, S.; Love, R.; Mangu, P.B.; McShane, L.; Miller, K.; Osborne, C.K.; Paik, S.; Perlmutter, J.; Rhodes, A.; Sasano, H.; Schwartz, J.N.; Sweep, F.C.; Taube, S.; Torlakovic, E.E.; Valenstein, P.; Viale, G.; Visscher, D.; Wheeler, T.; Williams, R.B.; Wittliff, J.L.; Wolff, A.C.

    2010-01-01

    PURPOSE: To develop a guideline to improve the accuracy of immunohistochemical (IHC) estrogen receptor (ER) and progesterone receptor (PgR) testing in breast cancer and the utility of these receptors as predictive markers. METHODS: The American Society of Clinical Oncology and the College of

  19. American Society of Clinical Oncology/College of American Pathologists guideline recommendations for immunohistochemical testing of estrogen and progesterone receptors in breast cancer (unabridged version).

    NARCIS (Netherlands)

    Hammond, M.E.; Hayes, D.F.; Dowsett, M.; Allred, D.C.; Hagerty, K.L.; Badve, S.; Fitzgibbons, P.L.; Francis, G.; Goldstein, N.S.; Hayes, M.; Hicks, D.G.; Lester, S.; Love, R.; Mangu, P.B.; McShane, L.; Miller, K.; Osborne, C.K.; Paik, S.; Perlmutter, J.; Rhodes, A.; Sasano, H.; Schwartz, J.N.; Sweep, F.C.; Taube, S.; Torlakovic, E.E.; Valenstein, P.; Viale, G.; Visscher, D.; Wheeler, T.; Williams, R.B.; Wittliff, J.L.; Wolff, A.C.

    2010-01-01

    PURPOSE: To develop a guideline to improve the accuracy of immunohistochemical (IHC) estrogen receptor (ER) and progesterone receptor (PgR) testing in breast cancer and the utility of these receptors as predictive markers. METHODS: The American Society of Clinical Oncology and the College of

  20. Influence of Estradiol-17beta on Progesterone and Estrogen Receptor mRNA Expression in Porcine Follicular Granulosa Cells during Short-Term, In Vitro Real-Time Cell Proliferation

    Directory of Open Access Journals (Sweden)

    Sylwia Ciesiółka

    2016-01-01

    Full Text Available Progesterone (P4 and estradiol (E2 play a significant role in mammalian reproduction. Our study demonstrated that separated porcine cumulus cells (CCs and/or granulosa cells (GCs might proliferate in vitro during short-term, real-time primary culture. The GCs were analyzed according to gene expression of the progesterone receptor (nuclear form (pgr, progesterone receptor membrane component 1 (pgrmc1, and estrogen-related receptor beta 3 (esrrb3 in relation to two housekeeping genes: actb and pbgd. GCs were cultivated in medium with the E2. Both pgr/actb and pgr/pbgd revealed higher expression between 24 and 168 h of IVC of prolonged E2 treatment and at 48 h of IVC after acute E2 administration. The pgrmc1/actb and pgrmc1/pbgd displayed increased expression after prolonged E2 treatment between 24 and 120 h of IVC. The highest level of esrrb3/actb at 120 and 144 h, as well as esrrb3/pbgd at 120 h, in untreated controls as compared to the hormone-stimulated group, was observed. We suggest that E2 significantly influences the upregulation of pgr, pgrmc1, and esrrb3 expression in porcine GCs during real-time cell proliferation. Since esrrb3 expression is stimulated by E2 in both an acute and prolonged manner, estradiol may be recognized as a potential estrogen receptor agonist in GCs.

  1. 77 FR 6867 - Practice Guide for Proposed Trial Rules

    Science.gov (United States)

    2012-02-09

    ... new trial proceedings to be conducted by the Patent Trial and Appeal Board (Board) including inter... conducted by the Board including: (1) Inter partes review (IPR); (2) post-grant review (PGR); (3) a... response to the petition, including a simple statement that patent owner elects not to respond to the...

  2. Evaluation of estrogen receptor alpha and beta and progesterone receptor expression and correlation with clinicopathologic factors and proliferative marker Ki-67 in breast cancers

    DEFF Research Database (Denmark)

    Rosa, Fabíola E; Caldeira, José R F; Felipes, Joice

    2008-01-01

    To elucidate the molecular profile of hormonal steroid receptor status, we analyzed ER-alpha, ER-beta, and PGR mRNA and protein expression in 80 breast carcinomas using reverse transcriptase polymerase chain reaction (RT-PCR), quantitative RT-PCR, and immunohistochemical analysis. Qualitative ana...

  3. Evaluation of the ability of adjuvant tamoxifen-benefit gene signatures to predict outcome of hormone-naive estrogen receptor-positive breast cancer patients treated with tamoxifen in the advanced setting

    DEFF Research Database (Denmark)

    Sieuwerts, Anieta M; Lyng, Maria Bibi; Meijer-van Gelder, Marion E

    2014-01-01

    and NAT1 were significantly associated with a favorable PFS in multivariate analysis that included the traditional predictive factors: age, dominant relapse site, disease-free interval, ER and progesterone receptor (PGR), and adjuvant chemotherapy. This study shows that BCAR3, BCL2 and NAT1 in particular...

  4. Pengaruh Demihipo dan ZPT (Decamon® terhadap Mortalitas Telur dan Serangan Lalat Pengorok Daun, Liriomyza huidobrensis (Blanchard pada Tanaman Kentang

    Directory of Open Access Journals (Sweden)

    I Wayan Supartha

    2002-12-01

    Full Text Available Field experiment to determine the effectiveness of demihipo and Decamon® to induce the egg extrusion and reduce L. huidobrensis population larvae on potato was conducted in Pancasari, Buleleng (Bali from February to August 1999. The results indicated that application of Decamon to the plant was significantly able to increase egg-extrusion of L. huidobrensis from the leaf compared with the other treatments. While, weekly application of insecticide (demihipo was also significantly able to reduce the Larvae population on the plant. The application of the combination of both control measure (plant growth regulator or PGR and insecticide (demihipo was the most effective control to reduce the feeding or ovipositional-punctures of adult on the leaves. Therefore, the application of PGR and insecticide was the best to prevent and reduce the population development of L. huidobrensis in the field. In general, all control measures were able to increase the yield and advantage-added of the farmer. However, the highest increased of the yield and advantage-added in wet season were given by the plant treated with PGR (Decamon®, while in dry season given by the plant treated with the combination of PGR and demihipo.

  5. NCBI nr-aa BLAST: CBRC-BTAU-01-2489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2489 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  6. NCBI nr-aa BLAST: CBRC-RNOR-08-0112 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-08-0112 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  7. NCBI nr-aa BLAST: CBRC-RMAC-03-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-03-0034 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  8. NCBI nr-aa BLAST: CBRC-HSAP-07-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0022 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  9. NCBI nr-aa BLAST: CBRC-PABE-08-0027 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-08-0027 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  10. NCBI nr-aa BLAST: CBRC-PTRO-08-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-08-0021 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  11. NCBI nr-aa BLAST: CBRC-OGAR-01-0527 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0527 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  12. NCBI nr-aa BLAST: CBRC-CFAM-14-0061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-14-0061 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi... (G-protein coupled receptor for asthma susceptibility) (G-protein coupled receptor PGR14) gb|AAQ76966.1| GP

  13. Open reading frame ssr2016 is required for antimycin A-sensitive photosystem I-driven cyclic electron flow in the cyanobacterium Synechocystis sp. PCC 6803

    NARCIS (Netherlands)

    Yeremenko, Nataliya; Jeanjean, Robert; Prommeenate, Peerada; Krasikov, Vladimir; Nixon, Peter J.; Vermaas, Wim F. J.; Havaux, Michel; Matthijs, Hans C. P.

    2005-01-01

    Open reading frame ssr2016 encodes a protein with substantial sequence similarities to PGR5 identified as a component of the antimycin A-sensitive ferredoxin:plastoquinone reductase (FQR) in PSI cyclic photophosphorylation in Arabidopsis thaliana. We studied cyclic electron flow in Synechocystis sp.

  14. Utilisation of nuclear energy and coal

    International Nuclear Information System (INIS)

    1982-01-01

    Following the views and experiences presented at an International Energy Conference held in November 1980 in Lisbon under the title ''Energy - A challenge for undertakings'', the Energy Commission of the International Chamber of Commerce has prepared a document which details the most important conclusions and makes recommendations. The costs and advantages are evaluated of nuclear energy and of coal. (P.G.R.)

  15. Responses of yield and N use of spring sown crops to N fertilization, with special reference to the use of plant growth regulators

    Directory of Open Access Journals (Sweden)

    L. PIETOLA

    2008-12-01

    Full Text Available The role of plant growth regulators (PGR in nitrogen (N fertilization of spring wheat and oats (CCC, fodder barley (etephon/mepiquat and oilseed rape (etephone in crop rotation was studied in 1993–1996 on loamy clay soil. Carry over effect of the N fertilization rates (0–180 kg ha-1 was evaluated in 1997. N fertilization rate for the best grain/seed yield (120–150 kg ha-1 was not affected by PGRs. The seed and N yields of oilseed rape were improved most frequently by recommended use of PGR. The yields of oats were increased in 1995–96. Even though PGR effectively shortened the plant height of spring wheat, the grain yield increased only in 1995. N yield of wheat grains was not increased. Response of fodder barley to PGR was insignificant or even negative in 1995. The data suggest that PGRs may decrease some N leaching at high N rates by improving N uptake by grain/seeds, if the yield is improved. The carryover study showed that in soils with no N fertilization, as well as in soils of high N rates, N uptake was higher than in soils with moderate N fertilization (60–90 kg ha-1 , independent of PGRs. According to soil mineral N contents, N leaching risk is significant (15–35 kg ha-1 only after dry and warm late seasons. After a favourable season of high yields, the N rates did not significantly affect soil mineral N contents. ;

  16. Status of sex steroid hormone receptors in large bowel cancer

    NARCIS (Netherlands)

    Meggouh, F.; Lointier, P.; Pezet, D.; Saez, S.

    1991-01-01

    To determine the potential role of sex steroid hormones in the development of colorectal tumors in humans, specific androgen (AR), estrogen (ER), and progesterone (PGR) receptors were investigated in normal mucosa (NM) and in tumor (T) paired biopsy specimens from 94 patients. Androgen receptors

  17. GRIN-Global: An International Project to Develop a Global Plant Genebank and Information Management System

    Science.gov (United States)

    Many of the world's national genebanks, responsible for the safeguarding and availability of their country's Plant Genetic Resource (PGR) collections, have lacked access to high quality IT needed to document and manage their collections electronically. The Germplasm Resource Information System (GRI...

  18. Antioxidant activity characterization, phytochemical screening, and proximate analysis of Cermela Hutan (Phyllanthus gomphocarpus Hook. F) roots and leaves.

    Science.gov (United States)

    Bahari, Ebby-Anuar; Zaaba, Nur Eleza; Haron, Norhisham; Dasiman, Razif; Amom, Zulkhairi

    2014-11-07

    Roots and leaves of the Cermela Hutan (Phyllanthus gomphocarpus Hook. F) plant were studied to determine antioxidant activity, phytochemical compounds, proportion of carbohydrate, crude protein, moisture, ash, fat, total phenolic content (TPC), and total flavonoid content (TFC). Ten percent (10%) aqueous extract from both Phyllanthus gomphocarpus roots (PGR) and leaves (PGL) were used in this study. Antioxidant activity characterization by TPC, TFC, Ferric Reducing Antioxidant Power (FRAP), 1,1-diphenyl-2-picrylhydrazyl (DPPH) scavenging activity, and phytochemical screening, as well as proximate analysis from both extracts were analyzed in this study. Phyllanthus gomphocarpus roots (PGR) and leaves (PGL) tested positive for flavonoid, saponin, tannins, and terpenoids, but PGR showed negative result for anthraquinones. In average weight of 100.0 g dry sample, the carbohydrates, protein, moisture, ash, fat, and energy content in PGR and PGL were 80.9%, 5.5%, 7.8%, 3.4%, 2.4%, and 367 Kcal/100g, and 66.5%, 14.8%, 10.7%, 6.5%, 1.5%, and 399 Kcal/100 g, respectively. Antioxidant assessments using FRAP and DPPH assay showed that PGL extracts possessed higher antioxidant capacity by reducing the ferric ion-TPTZ complex by 0.14 mg/ml ±0.0018 and higher scavenging activity, 83.83% ±0.54 as compared to PGR, 0.07 mg/ml ±0.0035 for FRAP and 62.87% ±1.33 for DPPH, respectively. The total phenolics content was significantly higher in PGL (208.77 mg GAE/g ±3.79) as compared to PGR (27.53 mg GAE/g ±0.42). However, there was no significant different in the total flavonoid contents for PGR (34.8 mg QE/g ±3.12) and PGL (32.43 mg QE/g ±3.92). Further investigations are suggested to isolate and characterize the other active constituents from this plant in combatting diseases.

  19. Biochemistry and Chemotherapy of Malaria and Leishmaniasis

    Science.gov (United States)

    1993-12-06

    ethanol plant extracts including; nutmeg (Myristicaceae sp.), ginger ( Zingiber officinale ), goldenseal root (Hydrastis canadensis), garlic (Allium...scorodoprasum (elephant garlic), Ailium sativum (garlic), Zingiber officinale ,ginger), Myristicaceae sp. (nutmeg), Hydrastis canadensis (goldenseal...They were Glycyrrhiza glabra (IC25: 6 ug protein/ml)(Fig.7), Zingiber officinale (IC25: 14 ug protein/ ml), and ethanol extracts of Myristacea sp

  20. Unigene BLAST: CBRC-ATHA-03-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-03-0010 gnl|UG|At#S11719378 Arabidopsis thaliana ATARP9 (ACTIN-RELATED PR...OTEIN 9); protein binding (ATARP9) mRNA, complete cds /cds=p(235,2025) /gb=NM_123716 /gi=30694311 /ug=At.26311 /len=2187 0.47 36% ...

  1. Decision Making on Allocating Urban Green Spaces Based upon Spatially-Varying Relationships between Urban Green Spaces and Urban Compaction Degree

    Directory of Open Access Journals (Sweden)

    Hsueh-Sheng Chang

    2015-09-01

    Full Text Available The compact city is becoming a prevailing paradigm in the world to control urban sprawl and achieve a pattern of sustainable urban development. However, discussions of the area's overcrowded neighborhoods, its health problems, and the destruction of its green areas have inspired self-examination with respect to the compact city paradigm. High population density attracts even more residents and frequently renders the existing urban green space (UGS insufficient for use as part of a living environment. Due to the unique benefits that these qualities confer, UGS allocation is now considered a significant contributing factor to urban livability. In addition, the UGS allocation may be different due to the presence of many spatial non-stationarity processes. Therefore, this study employs geographically-weighted regression (GWR to explore the unique and spatially-explicit relationships between the degree of urban compaction and UGS within the Taipei metropolitan area. Maps summarizing the GWR results demonstrate that there is significantly insufficient UGS allocation in the central area, which consists mainly of Taipei City. Townships with higher parameters contain UGS levels that better meet the needs of their residents. Overall, the exploration of conceptualizing spatial heterogeneity of relationships between the degree of urban compaction and UGS can provide insightful analyses for decision-making on allocating UGS.

  2. Unigene BLAST: CBRC-GGAL-02-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-02-0038 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 4e-30 25% ...

  3. Unigene BLAST: CBRC-GGAL-12-0011 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-12-0011 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 5e-38 44% ...

  4. Unigene BLAST: CBRC-GGAL-26-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-26-0008 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 8e-82 44% ...

  5. Unigene BLAST: CBRC-GGAL-19-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 0.0 100% ... ...CBRC-GGAL-19-0006 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  6. Unigene BLAST: CBRC-HSAP-23-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0072 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 100% ...

  7. Unigene BLAST: CBRC-GGAL-04-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-30 26% ... ...CBRC-GGAL-04-0034 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  8. Unigene BLAST: CBRC-GGAL-06-0012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 2e-85 49% ... ...CBRC-GGAL-06-0012 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  9. Unigene BLAST: CBRC-GGAL-05-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 4e-09 24% ... ...CBRC-GGAL-05-0037 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  10. Unigene BLAST: CBRC-HSAP-07-0070 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0070 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 1e-80 43% ...

  11. Unigene BLAST: CBRC-GGAL-04-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 6e-24 29% ... ...CBRC-GGAL-04-0026 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  12. Unigene BLAST: CBRC-MMUS-20-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-20-0033 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 5e-78 42% ...

  13. Unigene BLAST: CBRC-GGAL-06-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 5e-36 29% ... ...CBRC-GGAL-06-0000 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  14. Unigene BLAST: CBRC-GGAL-03-0043 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 6e-26 26% ... ...CBRC-GGAL-03-0043 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  15. Unigene BLAST: CBRC-HSAP-10-0031 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-10-0031 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 4e-34 27% ...

  16. Unigene BLAST: CBRC-GGAL-04-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 1e-25 28% ... ...CBRC-GGAL-04-0026 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  17. Unigene BLAST: CBRC-HSAP-01-0117 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-01-0117 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 9e-33 31% ...

  18. Unigene BLAST: CBRC-HSAP-07-0070 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0070 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 0.0 100% ...

  19. Unigene BLAST: CBRC-GGAL-26-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 9e-84 48% ... ...CBRC-GGAL-26-0008 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  20. Unigene BLAST: CBRC-HSAP-23-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0073 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 100% ...

  1. Unigene BLAST: CBRC-HSAP-10-0031 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-10-0031 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-32 28% ...

  2. Unigene BLAST: CBRC-HSAP-23-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0072 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-80 43% ...

  3. Unigene BLAST: CBRC-GGAL-03-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 8e-27 32% ... ...CBRC-GGAL-03-0015 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  4. Unigene BLAST: CBRC-GGAL-01-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 5e-43 30% ... ...CBRC-GGAL-01-0052 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  5. Unigene BLAST: CBRC-GGAL-06-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 8e-21 24% ... ...CBRC-GGAL-06-0001 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  6. Unigene BLAST: CBRC-MMUS-01-0101 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-01-0101 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 3e-33 28% ...

  7. Unigene BLAST: CBRC-HSAP-23-0071 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0071 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 95% ...

  8. Unigene BLAST: CBRC-GGAL-19-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-87 50% ... ...CBRC-GGAL-19-0006 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  9. Unigene BLAST: CBRC-MMUS-17-0171 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-17-0171 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-22 22% ...

  10. Unigene BLAST: CBRC-GGAL-12-0011 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-32 30% ... ...CBRC-GGAL-12-0011 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  11. Unigene BLAST: CBRC-GGAL-03-0043 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 8e-29 26% ... ...CBRC-GGAL-03-0043 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  12. Unigene BLAST: CBRC-HSAP-04-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-04-0044 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 2e-34 27% ...

  13. Unigene BLAST: CBRC-HSAP-04-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-04-0044 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 5e-23 25% ...

  14. Unigene BLAST: CBRC-GGAL-03-0047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 3e-24 24% ... ...CBRC-GGAL-03-0047 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  15. Hedonic pricing analysis of the influence of urban green spaces onto residential prices : the case of Leipzig, Germany

    NARCIS (Netherlands)

    Liebelt, Veronika; Bartke, Stephan; Schwarz, Nina

    2018-01-01

    In the light of global urbanization and biodiversity loss, ecosystem services provided by urban green spaces (UGS) are becoming increasingly important, not least as a recovery and recreation opportunity for citizens. The valuation of UGS is significant for urban planners, who make decisions on the

  16. Evidence for the Fundamental Difference Hypothesis or Not?: Island Constraints Revisited

    Science.gov (United States)

    Belikova, Alyona; White, Lydia

    2009-01-01

    This article examines how changes in linguistic theory affect the debate between the fundamental difference hypothesis and the access-to-Universal Grammar (UG) approach to SLA. With a focus on subjacency (Chomsky, 1973), a principle of UG that places constraints on "wh"-movement and that has frequently been taken as a test case for verifying…

  17. Unigene BLAST: CBRC-MMUS-14-0020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-14-0020 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 9e-37 29% ...

  18. Unigene BLAST: CBRC-HSAP-23-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0073 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-80 43% ...

  19. Unigene BLAST: CBRC-MMUS-03-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-03-0073 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-27 27% ...

  20. Unigene BLAST: CBRC-GGAL-03-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 3e-50 34% ... ...CBRC-GGAL-03-0016 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  1. Unigene BLAST: CBRC-MDOM-06-0030 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ed neurotrophic factor (BDNF), mRNA /cds=p(1,786) /gb=XM_001368353 /gi=126332213 /ug=Mdm.339 /len=786 0.026 33% ... ...CBRC-MDOM-06-0030 gnl|UG|Mdm#S37377868 PREDICTED: Monodelphis domestica brain-deriv

  2. Blood Lead Levels And Potental Environmental Exposures Among ...

    African Journals Online (AJOL)

    p = 0.439). Low risk parental occupation (p = 0.001) and. Kales sourced from the market/kiosks (p = 0.001) were significantly associated with BLL ≥ 10ug/dl. Soil lead levels (Soil Pb) ranged from 3,000 to 90,000ug/kg, which was very high ...

  3. Geomechanical Assessments of Simultaneous Operation in the Case of Transition from Open Pit to Underground Mine in Vietnam

    Science.gov (United States)

    Niedbalski, Zbigniew; Nguyen, Phu Minh Vuong; Widzyk-Capehart, Eleonora

    2018-03-01

    Nowadays, for a number of reasons, many open pit mines are considering a transition from Open Pit (OP) to Underground (UG) to remain competitive. In OP-UG transition, UG operation is operated simultaneously with the OP operation for a certain period of time. Guidelines for the simultaneous operation of OP and UG are very difficult to establish, as there are very few case studies available. Yet, because of the OP-UG interactions; the operation has a higher safety, technical and management requirements than the OP or UG methods when considered separately. In Vietnam, Cao Son is one of many OP mines, which decided to change the operational system from OP to UG. Simultaneous operation started in 2015 and will be conducted until 2030 when the OP mine Cao Son ends its mining activities. In this paper, selected geomechanical considerations of the simultaneous operation are presented. A number of numerical modelling calculations using finitedifference software with code FLAC were carried out for calibration process, slope stability analysis and the OP-UG interaction analysis for the Cao Son - Khe Cham II-IV mine. Based on the results obtained from numerical modelling, the geomechanical assessments of simultaneous operation Cao Son - Khe Cham II-IV are discussed in this paper.

  4. Characterization of oils from Duranta repens leaf and seed

    Directory of Open Access Journals (Sweden)

    Agomuo Emmanuel

    2017-11-01

    Full Text Available The knowledge of the chemical composition of unpopular sources of edible oils has become paramount to supplement the usage of widely known vegetable oils. In this study, the gas chromatographic quantification of fatty acids and phytochemicals was carried out, and the physicochemical and micronutrient composition of Duranta repens leaf and seed oil were evaluated using standard methods. The leaf oils contained significantly higher (p  oleic > myristic > stearic > capric > linoleic > lauric > palmitoleic for the seed oil, while for the leaf oil linoleic > palmitoleic > oleic > stearic > palmitic > myristic > capric > lauric > myristoleic. The major phytochemical constituents of the seed oils were catechin (68.12 ug/ml, saponin (44.03 ug/ml, rutin (32.89 ug/ml, linamarin (22.66 ug/ml and tannins (19.62 ug/ml, while kaempherol (84.05 ug/ml, rutin (62.26 ug/ml and saponins (45.63 ug/ml were mostly predominant in the leaf oil. Spartein, anthocyanins and phytates were among the least phytochemicals in composition, for both samples. These chemical properties evaluated, suggest that Duranta repens seed oil is more suitable for industrial and therapeutic purposes.

  5. Unigene BLAST: CBRC-TGUT-37-0238 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available egment Chr 11 Brigham & Women's Genetics 0434 expressed variant 2-like mRNA, complete sequence /gb=DQ215253 /gi=76158658 /ug=Tgu.7189 /len=654 1.4 27% ... ...CBRC-TGUT-37-0238 gnl|UG|Tgu#S33942003 Taeniopygia guttata clone 0058P0013A02 DNA s

  6. Biodiversity in the city: key challenges for urban green space management

    Science.gov (United States)

    Myla F.J. Aronson; Christopher A. Lepczyk; Karl L. Evans; Mark A. Goddard; Susannah B. Lerman; J. Scott MacIvor; Charles H. Nilon; Timothy. Vargo

    2017-01-01

    Cities play important roles in the conservation of global biodiversity, particularly through the planning and management of urban green spaces (UGS). However, UGS management is subject to a complex assortment of interacting social, cultural, and economic factors, including governance, economics, social networks, multiple stakeholders, individual preferences, and social...

  7. report general | 1-Overview | 5-Publications | Indian Academy of ...

    Indian Academy of Sciences (India)

    In this process, the advantages offered by distance education methods should also be exploited. ... The U.G. course should be solid and broad based, providing a good ... Thus all U.G. students should take some common courses in physics, ...

  8. Unigene BLAST: CBRC-TGUT-29-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-29-0000 gnl|UG|Tgu#S36163076 Taeniopygia guttata clone 0057P0006B02 megalencephalic leukoencephalo...pathy with subcortical cysts 1-like mRNA, complete sequence /gb=EF191703 /gi=120431699 /ug=Tgu.3485 /len=1532 1.8 21% ...

  9. Unigene BLAST: CBRC-CFAM-23-0020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-23-0020 gnl|UG|Cfa#S19198630 ip04e12.g1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip04e12, mRNA sequence /clone=ip04e12 /gb=CN002408 /gi=45766087 /ug=Cfa.29570 /len=708 8e-08 38% ...

  10. Unigene BLAST: CBRC-CFAM-28-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-28-0014 gnl|UG|Cfa#S19200361 ip42h12.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip42h12, mRNA sequence /clone=ip42h12 /gb=CK995838 /gi=45759518 /ug=Cfa.10205 /len=413 4e-05 37% ...

  11. Unigene BLAST: CBRC-CFAM-35-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-35-0003 gnl|UG|Cfa#S19200945 ip12b05.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip12b05, mRNA sequence /clone=ip12b05 /gb=CK996905 /gi=45760585 /ug=Cfa.32635 /len=996 1.5 24% ...

  12. Unigene BLAST: CBRC-CFAM-33-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-33-0021 gnl|UG|Cfa#S19197038 ip37b10.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip37b10, mRNA sequence /clone=ip37b10 /gb=CK998901 /gi=45762581 /ug=Cfa.4074 /len=820 2e-18 79% ...

  13. Unigene BLAST: CBRC-CFAM-01-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-01-0041 gnl|UG|Cfa#S19200707 ip06d09.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip06d09, mRNA sequence /clone=ip06d09 /gb=CK996471 /gi=45760151 /ug=Cfa.45094 /len=754 7e-17 70% ...

  14. Unigene BLAST: CBRC-ATHA-05-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-05-0034 gnl|UG|At#S11736431 Arabidopsis thaliana ATMPK19 (Arabidopsis tha...liana MAP kinase 19); MAP kinase (ATMPK19) mRNA, complete cds /cds=p(1,1761) /gb=NM_112333 /gi=30683276 /ug=At.8069 /len=1897 6.9 42% ...

  15. Unigene BLAST: CBRC-FRUB-02-0691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0691 gnl|UG|Tru#S21434263 AL836416 EFRd Takifugu rubripes cDNA clone EFRd031apc...G19, mRNA sequence /clone=EFRd031apcG19 /gb=AL836416 /gi=21878378 /ug=Tru.2410 /len=418 0.24 31% ...

  16. Unigene BLAST: CBRC-FRUB-02-0424 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0424 gnl|UG|Tru#S21433401 AL835449 EFRb Takifugu rubripes cDNA clone EFRb017apc...D5, mRNA sequence /clone=EFRb017apcD5 /gb=AL835449 /gi=21877411 /ug=Tru.1107 /len=522 8.4 39% ...

  17. Unigene BLAST: CBRC-FRUB-02-0750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0750 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 1.9 26% ...

  18. Unigene BLAST: CBRC-FRUB-02-0743 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0743 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 1.4 26% ...

  19. Unigene BLAST: CBRC-FRUB-02-0642 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0642 gnl|UG|Tru#S21434581 AL836626 EFRe Takifugu rubripes cDNA clone EFRe005apc...A11, mRNA sequence /clone=EFRe005apcA11 /gb=AL836626 /gi=21878588 /ug=Tru.118 /len=378 3.6 33% ...

  20. Unigene BLAST: CBRC-FRUB-02-0924 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0924 gnl|UG|Tru#S21434557 AL836584 EFRe Takifugu rubripes cDNA clone EFRe005apc...K15, mRNA sequence /clone=EFRe005apcK15 /gb=AL836584 /gi=21878546 /ug=Tru.1833 /len=509 7.4 31% ...

  1. Unigene BLAST: CBRC-FRUB-02-0627 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0627 gnl|UG|Tru#S21434842 AL836687 EFRe Takifugu rubripes cDNA clone EFRe005apc...N22, mRNA sequence /clone=EFRe005apcN22 /gb=AL836687 /gi=21878649 /ug=Tru.3747 /len=363 1.4 48% ...

  2. Unigene BLAST: CBRC-FRUB-02-0118 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0118 gnl|UG|Tru#S21435395 AL837361 EFRh Takifugu rubripes cDNA clone EFRh101apc...A11, mRNA sequence /clone=EFRh101apcA11 /gb=AL837361 /gi=21879323 /ug=Tru.2111 /len=407 2.4 33% ...

  3. Unigene BLAST: CBRC-FRUB-02-0587 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0587 gnl|UG|Tru#S21435116 AL837106 EFRf Takifugu rubripes cDNA clone EFRf030apc...H13, mRNA sequence /clone=EFRf030apcH13 /gb=AL837106 /gi=21879068 /ug=Tru.387 /len=294 4.9 35% ...

  4. Unigene BLAST: CBRC-FRUB-02-0677 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0677 gnl|UG|Tru#S21435495 AL837483 EFRj Takifugu rubripes cDNA clone EFRj028apc...P21, mRNA sequence /clone=EFRj028apcP21 /gb=AL837483 /gi=21879445 /ug=Tru.1777 /len=323 7.9 50% ...

  5. Unigene BLAST: CBRC-FRUB-02-0784 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0784 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 2.0 26% ...

  6. Unigene BLAST: CBRC-FRUB-02-0299 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0299 gnl|UG|Tru#S21434159 AL836234 EFRd Takifugu rubripes cDNA clone EFRd007apc...O23, mRNA sequence /clone=EFRd007apcO23 /gb=AL836234 /gi=21878196 /ug=Tru.1814 /len=463 0.63 32% ...

  7. Unigene BLAST: CBRC-FRUB-02-0473 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0473 gnl|UG|Tru#S21435395 AL837361 EFRh Takifugu rubripes cDNA clone EFRh101apc...A11, mRNA sequence /clone=EFRh101apcA11 /gb=AL837361 /gi=21879323 /ug=Tru.2111 /len=407 0.47 28% ...

  8. Unigene BLAST: CBRC-FRUB-02-0104 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0104 gnl|UG|Tru#S21435233 AL837260 EFRg Takifugu rubripes cDNA clone EFRg101apc...H6, mRNA sequence /clone=EFRg101apcH6 /gb=AL837260 /gi=21879222 /ug=Tru.2053 /len=465 3.3 30% ...

  9. Unigene BLAST: CBRC-FRUB-02-0391 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0391 gnl|UG|Tru#S21434264 AL836417 EFRd Takifugu rubripes cDNA clone EFRd031apc...K15, mRNA sequence /clone=EFRd031apcK15 /gb=AL836417 /gi=21878379 /ug=Tru.1810 /len=428 0.75 34% ...

  10. Unigene BLAST: CBRC-FRUB-02-0702 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0702 gnl|UG|Tru#S21434160 AL836235 EFRd Takifugu rubripes cDNA clone EFRd007apc...K11, mRNA sequence /clone=EFRd007apcK11 /gb=AL836235 /gi=21878197 /ug=Tru.2312 /len=411 6.4 28% ...

  11. Pramana – Journal of Physics | News

    Indian Academy of Sciences (India)

    A novel pedagogical technique is presented that can be used in the undergraduate (UG) class to formulate a relativistically extended kinetic theory of gases and thermal speed distribution, while assuming the basic thermal symmetry arguments of the famous Maxwell–Boltzmann distribution as presented at the UG level.

  12. A new multiplicity formula for the Weyl modules of type A

    International Nuclear Information System (INIS)

    Ye Jiachen; Zhou Zhongguo

    2003-08-01

    A monomial basis and a filtration of subalgebras for the universal enveloping algebra U(g) of a complex simple Lie algebra g l of type A I is given in this note. In particular, a new multiplicity formula for the Weyl module V(λ) of U(g l ) is obtained in this note. (author)

  13. The polygenic risk for bipolar disorder influences brain regional function relating to visual and default state processing of emotional information.

    Science.gov (United States)

    Dima, Danai; de Jong, Simone; Breen, Gerome; Frangou, Sophia

    2016-01-01

    Genome-wise association studies have identified a number of common single-nucleotide polymorphisms (SNPs), each of small effect, associated with risk to bipolar disorder (BD). Several risk-conferring SNPs have been individually shown to influence regional brain activation thus linking genetic risk for BD to altered brain function. The current study examined whether the polygenic risk score method, which models the cumulative load of all known risk-conferring SNPs, may be useful in the identification of brain regions whose function may be related to the polygenic architecture of BD. We calculated the individual polygenic risk score for BD (PGR-BD) in forty-one patients with the disorder, twenty-five unaffected first-degree relatives and forty-six unrelated healthy controls using the most recent Psychiatric Genomics Consortium data. Functional magnetic resonance imaging was used to define task-related brain activation patterns in response to facial affect and working memory processing. We found significant effects of the PGR-BD score on task-related activation irrespective of diagnostic group. There was a negative association between the PGR-BD score and activation in the visual association cortex during facial affect processing. In contrast, the PGR-BD score was associated with failure to deactivate the ventromedial prefrontal region of the default mode network during working memory processing. These results are consistent with the threshold-liability model of BD, and demonstrate the usefulness of the PGR-BD score in identifying brain functional alternations associated with vulnerability to BD. Additionally, our findings suggest that the polygenic architecture of BD is not regionally confined but impacts on the task-dependent recruitment of multiple brain regions.

  14. Optimization of extraction parameters for recovery of a-amylase from the fermented bran of Bacillus circulans GRS313

    Directory of Open Access Journals (Sweden)

    Palit Soumen

    2001-01-01

    Full Text Available The extraction of alpha-amylase in the solid state fermentation of wheat bran by Bacillus circulans GRS313 was optimized. Among various solvents tested, maximum extraction was achieved when 2.5% (v/v glycerol was added. The optimum conditions for extraction were 2.5 hrs soaking time at 30° C under recirculation and agitated condition, which yielded 590 U/g bran of enzyme activity. Whereas under stationary soaking condition the activity of the enzyme was 439.58U/g bran. With repeated wash under the above optimum conditions showed that 600 U/g and 184.2 U/g of enzyme extracted in the 1st and 2nd washes respectively and only 36.84 U/g was recovered in the 3rd wash

  15. The Development of Theory of Mind and Positive and Negative Reciprocity in Preschool Children.

    Science.gov (United States)

    Schug, Joanna; Takagishi, Haruto; Benech, Catalina; Okada, Hiroyuki

    2016-01-01

    This study examined the relation between the acquisition of false-beliefs theory of mind (ToM) and reciprocity in preschoolers. Preschool-aged children completed a task assessing the understanding of false beliefs, and played an Ultimatum Game (UG) with another child in a face-to-face setting. Negative reciprocity was assessed by examining the rejection of unfair offers made by another child in the UG, while positive reciprocity was assessed by examining allocations made by participants in a Dictator Game (DG) following the UG. The results indicated that children who had passed a task assessing first-order false beliefs were more likely to make generous offers in a DG following a fair offer made by their partner in a proceeding UG, but that false beliefs ToM was unrelated to the rejection of unfair offers in the UG.

  16. Geophysical Data (Gravity and Magnetic) from the Area Between Adana, Kahramanmaras and Hatay in the Eastern Mediterranean Region: Tectonic Implications

    Science.gov (United States)

    Over, Semir; Akin, Ugur; Sen, Rahime

    2018-01-01

    The gravity and magnetic maps of the area between Adana-Kahramanmaras-Hatay provinces were produced from a compilation of data gathered during the period between 1973 and 1989. Reduced to the pole (RTP) and pseudo-gravity transformation (PGT) methods were applied to the magnetic data, while derivative ratio (DR) processing was applied to both gravity and magnetic data, respectively. Bouguer, RTP and PGT maps show the image of a buried structure corresponding to ophiolites under undifferentiated Quaternary deposits in the Adana depression and Iskenderun Gulf. DR maps show two important faults which reflect the tectonic framework in the study area: (1) the Karatas-Osmaniye Fault extending from Osmaniye to Karatas in the south between Adana and Iskenderun depressions and (2) Amanos Fault (southern part of East Anatolian Fault) in the Hatay region running southward from Turkoglu to Amik Basin along Amanos Mountain forming the actual plate boundary between the Anatolian block (part of Eurasian plate) and Arabian plate.

  17. Configuration Synthesis of Novel Series-Parallel Hybrid Transmission Systems with Eight-Bar Mechanisms

    Directory of Open Access Journals (Sweden)

    Ngoc-Tan Hoang

    2017-07-01

    Full Text Available This paper presents a design approach for the configuration synthesis of series-parallel hybrid transmissions with eight-bar mechanisms. The final design consists of 54 mechanisms with eight members and twelve joints including a simple planetary gear train (PGT and a double planet PGT. Then, by using the techniques of power and clutch arrangements, new series-parallel hybrid transmissions are synthesized. The power arrangement process generates 97 clutchless hybrid systems. The clutch arrangement process generates 100 corresponding series-parallel transmissions. To demonstrate the feasibility of the synthesized configurations, a new hybrid transmission is selected as an example to analyze the working principle with operation modes and power flow paths.

  18. Connection dynamics of a gauge theory of gravity coupled with matter

    International Nuclear Information System (INIS)

    Yang, Jian; Banerjee, Kinjal; Ma, Yongge

    2013-01-01

    We study the coupling of the gravitational action, which is a linear combination of the Hilbert–Palatini term and the quadratic torsion term, to the action of Dirac fermions. The system possesses local Poincare invariance and hence belongs to Poincare gauge theory (PGT) with matter. The complete Hamiltonian analysis of the theory is carried out without gauge fixing but under certain ansatz on the coupling parameters, which leads to a consistent connection dynamics with second-class constraints and torsion. After performing a partial gauge fixing, all second-class constraints can be solved, and a SU(2)-connection dynamical formalism of the theory can be obtained. Hence, the techniques of loop quantum gravity (LQG) can be employed to quantize this PGT with non-zero torsion. Moreover, the Barbero–Immirzi parameter in LQG acquires its physical meaning as the coupling parameter between the Hilbert–Palatini term and the quadratic torsion term in this gauge theory of gravity. (paper)

  19. Concentraciones de yodo en orina y en sal de consumo en mujeres entre 12 a 49 años del Perú

    Directory of Open Access Journals (Sweden)

    Carolina Tarqui-Mamani

    Full Text Available Objetivos. Determinar las concentraciones de yodo en orina y sal de consumo en mujeres entre 12 a 49 años en Perú. Materiales y métodos. Se realizó un estudio observacional y transversal. Durante el 2012 y 2013, se incluyó mujeres entre 12 a 49 años residentes en los hogares peruanos seleccionadas mediante un muestreo probabilístico, estratificado y multietápico. La determinación de yodo en orina se realizó por espectrofotometría basada en la reacción de Sandell-Kolthoff. La evaluación cualitativa de yodo en sal se realizó por yoditest y la cuantitativa por volumetría. El procesamiento se realizó mediante muestras complejas con ponderaciones. Se obtuvo medianas, rango intercuartílico y percentiles. Resultados. La mediana de yoduria en las participantes fue 250,4 ug/L; los departamentos con medianas de yoduria elevadas fueron: Moquegua (389,3 ug/L; Tacna (320,5 ug/L; Madre de Dios (319,8 ug/L, y Ucayali (306,0 ug/L; mientras que Puno (192,9 ug/L; Piura (188,1 ug/L y Tumbes (180,5 ug/L tuvieron medianas dentro de lo recomendado por la OMS. La mediana de yoduria en gestantes fue 274,6 ug/L (RIQ: 283 ug/L. El 82,5% de las muestras de sal tuvieron yodo ≥30 ppm y 1,9% tuvo valores de 0 ppm. Conclusiones. La mediana de yoduria en las mujeres peruanas está por encima de lo recomendado por la OMS y la mayoría de las muestras de sal tuvieron concentraciones adecuadas de yodo según la OMS

  20. Ugonin U stimulates NLRP3 inflammasome activation and enhances inflammasome-mediated pathogen clearance

    Directory of Open Access Journals (Sweden)

    Chun-Yu Chen

    2017-04-01

    Full Text Available The NOD-like receptor pyrin domain 3 (NLRP3 inflammasome contains Nod-like receptors, a subclass of pattern recognition receptors, suggesting that this complex has a prominent role in host defenses. Various structurally diverse stimulators activate the NLRP3 inflammasome through different signaling pathways. We previously reported that ugonin U (UgU, a natural flavonoid isolated from Helminthostachys zeylanica (L Hook, directly stimulates phospholipase C (PLC and triggers superoxide release in human neutrophils. In the present study, we showed that UgU induced NLRP3 inflammasome assembly and subsequent caspase-1 and interleukin (IL-1β processing in lipopolysaccharide-primed human monocytes. Moreover, UgU elicited mitochondrial superoxide generation in a dose-dependent manner, and a specific scavenger of mitochondrial reactive oxygen species (ROS diminished UgU-induced IL-1β and caspase-1 activation. UgU induced Ca2+ mobilization, which was inhibited by treatment with inhibitors of PLC or inositol triphosphate receptor (IP3R. Blocking Ca2+ mobilization, PLC, or IP3R diminished UgU-induced IL-1β release, caspase-1 activation, and mitochondrial ROS generation. These data demonstrated that UgU activated the NLPR3 inflammasome activation through Ca2+ mobilization and the production of mitochondrial ROS. We also demonstrated that UgU-dependent NLRP3 inflammasome activation enhanced the bactericidal function of human monocytes. The ability of UgU to stimulate human neutrophils and monocytes, both of which are professional phagocytes, and its capacity to activate the NLRP3 inflammasome, which is a promising molecular target for developing anti-infective medicine, indicate that UgU treatment should be considered as a possible novel therapy for treating infectious diseases.

  1. SUSCEPTIBILIDAD ANTIMICROBIANA DE AISLAMIENTOS DE Salmonella enterica PROVENIENTES DE PISOS, EQUIPOS, UTENSILIOS Y PRODUCTO TERMINADO EN PLANTAS DE BENEFICIO PORCINO EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    P. M. Bermúdez

    2016-01-01

    Full Text Available La diseminación de Salmonella spp. resistente a antimicrobianos en las cadenas productivas de alimentos de origen animal es una preocupación de salud pública de carácter mundial. Este estudio describe los patrones de resistencia antimicrobiana de 283 aislamientos de Salmonella enterica procedentes de plantas de beneficio porcino en Colombia. Se evaluó la susceptibilidad antimicrobiana frente a diez antimicrobianos mediante el método de difusión en disco: amoxacilina-ácido clavulánico (30 ug, ampicilina (10 ug, ceftiofur (30 ug, ciprofloxacina (5 ug, cloranfenicol (30 ug, florfenicol (30 ug, gentamicina (10 ug, sulfadiazina/trimetroprim (25 ug, tetraciclina (30 ug y tilmicosina (15 ug. Los resultados evidenciaron la presencia de 279 aislamientos multirresistentes de Salmonella enterica de origen porcino provenientes del ambiente y del producto terminado en las plantas de beneficio evaluadas (46,64% n: 132. Se detectaron 52 patrones de multiresistencia: el más común fue ceftiofur-tetraciclina-tilmicosina en el 9,89% (n: 28 de los aislamientos. Con referencia a estos antimicrobianos, 96,82% (n: 274 de los aislamientos fueron resistentes a tetraciclina, 73,14% (n: 207 a tilmicosina y 28,27% (n: 80 a ceftiofur. De especial interés fue la alta proporción de aislamientos resistentes a ceftiofur, debido a una posible resistencia cruzada con ceftriaxona. Los resultados obtenidos demuestran la necesidad de promover el diseño e implementación de un Programa oficial Integrado de Vigilancia de la Resistencia Antimicrobiana, además de sistemas de monitoreo voluntario en cada eslabón de la cadena productiva porcina, para contribuir a la prevención y control de la transmisión de microorganismos resistentes de origen alimentario en el marco del sistema de gestión de inocuidad alimentaria en Colombia.

  2. Postgraduate education for Chinese medicine practitioners: a Hong Kong perspective

    Directory of Open Access Journals (Sweden)

    Mercer Stewart W

    2009-02-01

    Full Text Available Abstract Background Despite Hong Kong government's official commitment to the development of traditional Chinese medicine (TCM over the last ten years, there appears to have been limited progress in public sector initiated career development and postgraduate training (PGT for public university trained TCM practitioners. Instead, the private TCM sector is expected to play a major role in nurturing the next generation of TCM practitioners. In the present study we evaluated TCM graduates' perspectives on their career prospects and their views regarding PGT. Method Three focus group discussions with 19 local TCM graduates who had worked full time in a clinical setting for fewer than 5 years. Results Graduates were generally uncertain about how to develop their career pathways in Hong Kong with few postgraduate development opportunities; because of this some were planning to leave the profession altogether. Despite their expressed needs, they were dissatisfied with the current quality of local PGT and suggested various ways for improvement including supervised practice-based learning, competency-based training, and accreditation of training with trainee involvement in design and evaluation. In addition they identified educational needs beyond TCM, in particular a better understanding of western medicine and team working so that primary care provision might be more integrated in the future. Conclusion TCM graduates in Hong Kong feel let down by the lack of public PGT opportunities which is hindering career development. To develop a new generation of TCM practitioners with the capacity to provide quality and comprehensive care, a stronger role for the government, including sufficient public funding, in promoting TCM graduates' careers and training development is suggested. Recent British and Australian experiences in prevocational western medicine training reform may serve as a source of references when relevant program for TCM graduates is planned in

  3. Comparative Analysis Highlights Variable Genome Content of Wheat Rusts and Divergence of the Mating Loci

    Directory of Open Access Journals (Sweden)

    Christina A. Cuomo

    2017-02-01

    Full Text Available Three members of the Puccinia genus, Puccinia triticina (Pt, P. striiformis f.sp. tritici (Pst, and P. graminis f.sp. tritici (Pgt, cause the most common and often most significant foliar diseases of wheat. While similar in biology and life cycle, each species is uniquely adapted and specialized. The genomes of Pt and Pst were sequenced and compared to that of Pgt to identify common and distinguishing gene content, to determine gene variation among wheat rust pathogens, other rust fungi, and basidiomycetes, and to identify genes of significance for infection. Pt had the largest genome of the three, estimated at 135 Mb with expansion due to mobile elements and repeats encompassing 50.9% of contig bases; in comparison, repeats occupy 31.5% for Pst and 36.5% for Pgt. We find all three genomes are highly heterozygous, with Pst [5.97 single nucleotide polymorphisms (SNPs/kb] nearly twice the level detected in Pt (2.57 SNPs/kb and that previously reported for Pgt. Of 1358 predicted effectors in Pt, 784 were found expressed across diverse life cycle stages including the sexual stage. Comparison to related fungi highlighted the expansion of gene families involved in transcriptional regulation and nucleotide binding, protein modification, and carbohydrate degradation enzymes. Two allelic homeodomain pairs, HD1 and HD2, were identified in each dikaryotic Puccinia species along with three pheromone receptor (STE3 mating-type genes, two of which are likely representing allelic specificities. The HD proteins were active in a heterologous Ustilago maydis mating assay and host-induced gene silencing (HIGS of the HD and STE3 alleles reduced wheat host infection.

  4. ''Push-pull'' gastrostomy: a new technique for percutaneous gastrostomy tube insertion in the neonate and young infant

    International Nuclear Information System (INIS)

    Cahill, A.M.; Kaye, R.D.; Fitz, C.R.; Towbin, R.B.

    2001-01-01

    Objective. To evaluate a newly developed method combining antegrade and retrograde techniques for percutaneous gastrostomy tube (PGT) insertion in the neonate and young infant. Materials and methods. From January 1994 to December 2000, 85 children (47 male, 38 female), mean age 4.5 months (range 0.44-9.13 months) underwent PGT insertion using the ''push-pull'' technique. With the addition, 57 children had a jejunostomy tube placed as well at or within 24 h of the PGT procedure. The mean weight was 3.74 kg, range 1.5-7.0 kg. The indications for the procedure included failure to thrive in 40 patients (25 %), static encephalopathy in 21 (25 %), neurological/congenital abnormalities in 12 (14 %), aspiration in 7 (8 %), and cardiac problems in 5 (6 %). Results. Eighty-five PGTs were successfully inserted in 85 children. One procedure was initially unsuccessful due to failed conscious sedation and was completed under general anesthesia. Four of 85 patients initially had attempted antegrade placement that failed, and the procedure was successfully completed using the ''push-pull'' method. One major complication occurred: a gastrocolic fistula at day 5 post-procedure, which was surgically repaired without sequelae. Tube-related problems included; tube dislodgement (n = 1) and procedure-related stomal infection (n = 3). Conclusion. The ''push-pull'' gastrostomy technique is a safe, effective method of percutaneous gastrostomy tube placement in neonates. It facilitates successful placement of the PGT in patients in whom the classic antegrade method is not possible. It has become the procedure of choice in this group. (orig.)

  5. Fibrinolytic and procoagulant activities of Yersinia pestis and Salmonella enterica.

    Science.gov (United States)

    Korhonen, T K

    2015-06-01

    Pla of the plague bacterium Yersinia pestis and PgtE of the enteropathogen Salmonella enterica are surface-exposed, transmembrane β-barrel proteases of the omptin family that exhibit a complex array of interactions with the hemostatic systems in vitro, and both proteases are established virulence factors. Pla favors fibrinolysis by direct activation of plasminogen, inactivation of the serpins plasminogen activator inhibitor-1 and α2-antiplasmin, inactivation of the thrombin-activable fibrinolysis inhibitor, and activation of single-chain urokinase. PgtE is structurally very similar but exhibits partially different functions and differ in expression control. PgtE proteolysis targets control aspects of fibrinolysis, and mimicry of matrix metalloproteinases enhances cell migration that should favor the intracellular spread of the bacterium. Enzymatic activity of both proteases is strongly influenced by the environment-induced variations in lipopolysaccharide that binds to the β-barrel. Both proteases cleave the tissue factor pathway inhibitor and thus also express procoagulant activity. © 2015 International Society on Thrombosis and Haemostasis.

  6. Association between HIV-1 coreceptor usage and resistance to broadly neutralizing antibodies.

    Science.gov (United States)

    Pfeifer, Nico; Walter, Hauke; Lengauer, Thomas

    2014-10-01

    Recently discovered broadly neutralizing antibodies have revitalized hopes of developing a universal vaccine against HIV-1. Mainly responsible for new infections are variants only using CCR5 for cell entry, whereas CXCR4-using variants can become dominant in later infection stages. We performed a statistical analysis on two different previously published data sets. The first data set was a panel of 199 diverse HIV-1 isolates for which IC50 neutralization titers were determined for the broadly neutralizing antibodies VRC01, VRC-PG04, PG9, and PG16. The second data set contained env sequences of viral variants extracted from HIV-1-infected humanized mice treated with the antibody PGT128 and from untreated control mice. For the panel of 199 diverse HIV-1 isolates, we found a statistically significant association between viral resistance to PG9 and PG16 and CXCR4 coreceptor usage (P = 0.0011 and P = 0.0010, respectively). Our analysis of viral variants from HIV-1-infected humanized mice under treatment with the broadly neutralizing antibody PGT128 indicated that certain antibodies might drive a viral population toward developing CXCR4 coreceptor usage capability (P = 0.0011 for the comparison between PGT128 and control measurement). These analyses highlight the importance of accounting for a possible coreceptor usage bias pertaining to the effectiveness of an HIV vaccine and to passive antibody transfer as therapeutic approach.

  7. Structure Prediction of Outer Membrane Protease Protein of Salmonella typhimurium Using Computational Techniques

    Directory of Open Access Journals (Sweden)

    Rozina Tabassum

    2016-03-01

    Full Text Available Salmonella typhimurium, a facultative gram-negative intracellular pathogen belonging to family Enterobacteriaceae, is the most frequent cause of human gastroenteritis worldwide. PgtE gene product, outer membrane protease emerges important in the intracellular phases of salmonellosis. The pgtE gene product of S. typhimurium was predicted to be capable of proteolyzing T7 RNA polymerase and localize in the outer membrane of these gram negative bacteria. PgtE product of S. enterica and OmpT of E. coli, having high sequence similarity have been revealed to degrade macrophages, causing salmonellosis and other diseases. The three-dimensional structure of the protein was not available through Protein Data Bank (PDB creating lack of structural information about E protein. In our study, by performing Comparative model building, the three dimensional structure of outer membrane protease protein was generated using the backbone of the crystal structure of Pla of Yersinia pestis, retrieved from PDB, with MODELLER (9v8. Quality of the model was assessed by validation tool PROCHECK, web servers like ERRAT and ProSA are used to certify the reliability of the predicted model. This information might offer clues for better understanding of E protein and consequently for developmet of better therapeutic treatment against pathogenic role of this protein in salmonellosis and other diseases.

  8. Regional tectonic framework of the Pranhita Godavari basin, India

    Science.gov (United States)

    Biswas, S. K.

    2003-03-01

    The Pranhita-Godavari Gondwana rift (PGR) has a co-genetic relationship with Permo-Triassic reactivation of the Narmada-Son Geofracture (NSG). The Satpura Gondwana basin represents the terminal depocentre against the NSG, which restricted the northwestward propagation of the PGR. The NE-SW tensional stress responsible for the NW-SE trending PGR could not propagate beyond the ramp formed by uplift along the NSG and transformed kinetically into an ENE directed horizontal shear along the NSG, inducing large scale strike-slip movements. The latter dynamics were responsible for ENE extension of the Satpura rift as a pull-apart basin. The PGR extends up to the present east coast of India, where it is apparently terminated by the NE-SW trending Bapatla ridge along the Eastern Ghat Rift (EGR). The subsurface data, however, shows that the PGR extends across the Bapatla ridge and continues beneath the Cretaceous-Tertiary sediments of the Krishna-Godavari basin (KG) in the EGR. Thus, the Permo-Triassic PGR appears to have continued in the Indo-Antarctic plate before the Cretaceous break up. The EGR, during break up of the continents, cuts across the PGR and the KG basin was superimposed on it. The PGR site is located on a paleo-suture between the Dharwar and Bastar proto-cratons. The master faults developed bordering the rift, and the intra-rift higher order faults followed the pre-existing fabric. The transverse transfer zones manifested as basement ridges, divide the rift into segments of tectono-sedimentary domains. The major domains are the Chintalapudi, Godavari, and Chandrapur sub-basins, each of which subsided differentially. The central Godavari sub-basin subsided most and shows maximum structural complexity and sediment accommodation. The rifting started with initial half-graben faulting along the northeastern master fault and expanded by successive half graben faulting. This gave rise to intra-basinal horsts and grabens, which exercised control on the syn

  9. Simultaneous determination of sulphaquinoxaline and amprolium in veterinary mixture by HPLC and first derivative ultraviolet spectrophotometry

    International Nuclear Information System (INIS)

    El-Sattar, Osama Abd

    2002-01-01

    Two simple and reliable methods are described for the determination of sulphaquinoxaline (SQX) and amprolium (AMP) combined in veterinary powder. The first method depends on high performance liquid chromatography on a reversed phase column (Bondapak-C18) using mobile phase consisting of acetonitrile-methanol-water-phosphoric acid (30: 5: 55: 0.7, by volumes) at a flow rate of 1 ml min with UV detection at 254 nm. The detection limits were 0.2 ug ml and 0.35 ug ml and linearity ranges were 2-20 ug ml and 4-40ug ml for SQX and AMP, respectively. The second one deals with the first derivative (D) spectrophotometry with zero-crossing measurement at 253 nm and 226 nm for SQX and AMP respectively. The detection limits were 0.3 ug ml and linearity ranges were 1-18 ug ml and 4-32 ug-ml for SQX and AMP respectively. The proposed procedures were successfully applied to the determination of these drugs in laboratory prepared mixtures with mean percentage recovery ranged from 98.50 to 99.75 and in commercial preparation ranged from 103.85 to 104.85. (author)

  10. Mineralogic sources of metals in leachates from the weathering of sedex, massive sulfide, and vein deposit mining wastes

    Science.gov (United States)

    Diehl, S.F.; Hageman, P.L.; Seal, R.R.; Piatak, N.M.; Lowers, H.

    2011-01-01

    Weathered mine waste consists of oxidized primary minerals and chemically unstable secondary phases that can be sources of readily soluble metals and acid rock drainage. Elevated concentrations of metals such as Cd, Cu, Fe, Mn, Ni, Pb, and Zn are observed in deionized water-based leachate solutions derived from complex sedex and Cu-Pb-Zn mine wastes. Leachate (USGS FLT) from the Elizabeth mine, a massive sulfide deposit, has a pH of 3.4 and high concentrations of Al (16700 ug/L), Cu (440 ug/L), and Zn (8620 ug/L). Leachate from the sedex Faro mine has a pH of 3.5 and high concentrations of Al (2040 ug/L), Cu (1930 ug/L), Pb (2080 ug/L), and Zn (52900 ug/L). In contrast, higher-pH leachates produced from tailings of polymetallic vein deposits have order of magnitude lower metal concentrations. These data indicate that highly soluble secondary mineral phases exist at the surface of waste material where the samples were collected. Sulfide minerals from all sites exhibit differential degrees of weathering, from dissolution etched grain rims, to rinds of secondary minerals, to skeletal remnants. These microscale mineral-dissolution textures enhance weathering and metal teachability of waste material. Besides the formation of secondary minerals, sulfide grains from dried tailings samples may be coated by amorphous Fe-Al-Si minerals that also adsorb metals such as Cu, Ni, and Zn.

  11. Power to punish norm violations affects the neural processes of fairness-related decision making

    Directory of Open Access Journals (Sweden)

    Xuemei eCheng

    2015-12-01

    Full Text Available Punishing norm violations is considered an important motive during rejection of unfair offers in the Ultimatum Game (UG. The present study investigates the impact of the power to punish norm violations on people’s responses to unfairness and associated neural correlates. In the UG condition participants had the power to punish norm violations, while an alternate condition, the Impunity Game (IG, was presented where participants had no power to punish norm violations since rejection only reduced the responder’s income to zero. Results showed that unfair offers were rejected more often in UG compared to IG. At the neural level, anterior insula and dorsal anterior cingulate cortex were more active when participants received and rejected unfair offers in both UG and IG. Moreover, greater dorsolateral prefrontal cortex activity was observed when participants rejected than accepted unfair offers in UG but not in IG. Ventromedial prefrontal cortex activation was higher in UG than IG when unfair offers were accepted as well as when rejecting unfair offers in IG as opposed to UG. Taken together, our results demonstrate that the power to punish norm violations affects not only people’s behavioral responses to unfairness but also the neural correlates of the fairness-related social decision-making process.

  12. The utility of pharmacogenetic testing to support the treatment of bipolar disorder

    Directory of Open Access Journals (Sweden)

    Ielmini M

    2018-03-01

    Full Text Available Marta Ielmini,1 Nicola Poloni,1 Ivano Caselli,1 Jordi Espadaler,2 Miquel Tuson,2 Alessandro Grecchi,3 Camilla Callegari1 1Department of Medicine and Surgery, Division of Psychiatry, University of Insubria, Varese, Italy; 2AB-BIOTICS S.A, R&D Unit, Sant Cugat del Valles, Barcelona, Spain; 3ASST Santi Paolo e Carlo Borromeo, Division of Psychiatry, Milan, Italy Background: Bipolar disorder (BD is a frequent cause of disability, health care costs, and risk of suicide. Pharmacogenetic tests (PGTs could help clinicians to identify those patients predisposed to the occurrence of adverse events (AEs improving the understanding of the correlation between genetic variants and drug response.Materials and methods: The study evaluated 30 patients affected by BD type I or II (according to Diagnostic and Statistical Manual of Mental Disorders, version 5 who underwent the PGT Neurofarmagen® (AB-BIOTICS SA, Barcelona, Spain between March 2016 and March 2017. The primary aim of this study was to identify if the treatment prescribed by the psychiatrists was consistent with the treatment suggested by the PGT at T0 (corresponding to the test report communication. As a secondary aim, we wanted to assess if clinicians had changed the treatment (in case of discordance at T1 (3-month follow-up visit according to the results of the PGT.Results: At T0, only 4 patients (13% had an optimal therapy in line with the PGT suggestions. At 3-month follow-up, 13 patients (40% had received a change of therapy consistent to the test, showing a significant statistical improvement in the Clinical Global Impression item Severity (CGI-S score over time compared to those not having changes consistent with the test. Regarding AEs, at baseline 9 out of 10 (90% of the patients who received a therapy modification according to the test presented AEs, and a significant within-group reduction was observed after 3 months (p = 0.031.Conclusion: Despite the small sample size, the study shows

  13. Characterization of the microbunch time structure of proton pencil beams at a clinical treatment facility.

    Science.gov (United States)

    Petzoldt, J; Roemer, K E; Enghardt, W; Fiedler, F; Golnik, C; Hueso-González, F; Helmbrecht, S; Kormoll, T; Rohling, H; Smeets, J; Werner, T; Pausch, G

    2016-03-21

    Proton therapy is an advantageous treatment modality compared to conventional radiotherapy. In contrast to photons, charged particles have a finite range and can thus spare organs at risk. Additionally, the increased ionization density in the so-called Bragg peak close to the particle range can be utilized for maximum dose deposition in the tumour volume. Unfortunately, the accuracy of the therapy can be affected by range uncertainties, which have to be covered by additional safety margins around the treatment volume. A real-time range and dose verification is therefore highly desired and would be key to exploit the major advantages of proton therapy. Prompt gamma rays, produced in nuclear reactions between projectile and target nuclei, can be used to measure the proton's range. The prompt gamma-ray timing (PGT) method aims at obtaining this information by determining the gamma-ray emission time along the proton path using a conventional time-of-flight detector setup. First tests at a clinical accelerator have shown the feasibility to observe range shifts of about 5 mm at clinically relevant doses. However, PGT spectra are smeared out by the bunch time spread. Additionally, accelerator related proton bunch drifts against the radio frequency have been detected, preventing a potential range verification. At OncoRay, first experiments using a proton bunch monitor (PBM) at a clinical pencil beam have been conducted. Elastic proton scattering at a hydrogen-containing foil could be utilized to create a coincident proton-proton signal in two identical PBMs. The selection of coincident events helped to suppress uncorrelated background. The PBM setup was used as time reference for a PGT detector to correct for potential bunch drifts. Furthermore, the corrected PGT data were used to image an inhomogeneous phantom. In a further systematic measurement campaign, the bunch time spread and the proton transmission rate were measured for several beam energies between 69 and 225 Me

  14. Changing the game: using integrative genomics to probe virulence mechanisms of the stem rust pathogen Puccinia graminis f. sp. tritici

    Directory of Open Access Journals (Sweden)

    Melania eFigueroa

    2016-02-01

    Full Text Available The recent resurgence of wheat stem rust caused by new virulent races of Puccinia graminis f. sp. tritici (Pgt poses a threat to food security. These concerns have catalyzed an extensive global effort towards controlling this disease. Substantial research and breeding programs target the identification and introduction of new stem rust resistance (Sr genes in cultivars for genetic protection against the disease. Such resistance genes typically encode immune receptor proteins that recognize specific components of the pathogen, known as avirulence (Avr proteins. A significant drawback to deploying cultivars with single Sr genes is that they are often overcome by evolution of the pathogen to escape recognition through alterations in Avr genes. Thus, a key element in achieving durable rust control is the deployment of multiple effective Sr genes in combination, either through conventional breeding or transgenic approaches, to minimize the risk of resistance breakdown. In this situation, evolution of pathogen virulence would require simultaneous changes in multiple Avr genes in order to bypass recognition. However, choosing the optimal Sr gene combinations to deploy is a challenge that requires detailed knowledge of the pathogen Avr genes with which they interact and the virulence phenotypes of Pgt existing in nature. Identifying specific Avr genes from Pgt will provide screening tools to enhance pathogen virulence monitoring, assess heterozygosity and propensity for mutation in pathogen populations, and confirm individual Sr gene functions in crop varieties carrying multiple effective resistance genes. Towards this goal, much progress has been made in assembling a high quality reference genome sequence for Pgt, as well as a Pan-genome encompassing variation between multiple field isolates with diverse virulence spectra. In turn this has allowed prediction of Pgt effector gene candidates based on known features of Avr genes in other plant pathogens

  15. Changing the Game: Using Integrative Genomics to Probe Virulence Mechanisms of the Stem Rust Pathogen Puccinia graminis f. sp. tritici.

    Science.gov (United States)

    Figueroa, Melania; Upadhyaya, Narayana M; Sperschneider, Jana; Park, Robert F; Szabo, Les J; Steffenson, Brian; Ellis, Jeff G; Dodds, Peter N

    2016-01-01

    The recent resurgence of wheat stem rust caused by new virulent races of Puccinia graminis f. sp. tritici (Pgt) poses a threat to food security. These concerns have catalyzed an extensive global effort toward controlling this disease. Substantial research and breeding programs target the identification and introduction of new stem rust resistance (Sr) genes in cultivars for genetic protection against the disease. Such resistance genes typically encode immune receptor proteins that recognize specific components of the pathogen, known as avirulence (Avr) proteins. A significant drawback to deploying cultivars with single Sr genes is that they are often overcome by evolution of the pathogen to escape recognition through alterations in Avr genes. Thus, a key element in achieving durable rust control is the deployment of multiple effective Sr genes in combination, either through conventional breeding or transgenic approaches, to minimize the risk of resistance breakdown. In this situation, evolution of pathogen virulence would require changes in multiple Avr genes in order to bypass recognition. However, choosing the optimal Sr gene combinations to deploy is a challenge that requires detailed knowledge of the pathogen Avr genes with which they interact and the virulence phenotypes of Pgt existing in nature. Identifying specific Avr genes from Pgt will provide screening tools to enhance pathogen virulence monitoring, assess heterozygosity and propensity for mutation in pathogen populations, and confirm individual Sr gene functions in crop varieties carrying multiple effective resistance genes. Toward this goal, much progress has been made in assembling a high quality reference genome sequence for Pgt, as well as a Pan-genome encompassing variation between multiple field isolates with diverse virulence spectra. In turn this has allowed prediction of Pgt effector gene candidates based on known features of Avr genes in other plant pathogens, including the related flax rust

  16. PHASE BEHAVIOR OF LIGHT GASES IN HYDROCARBON AND AQUEOUS SOLVENTS

    Energy Technology Data Exchange (ETDEWEB)

    KHALED A.M. GASEM; ROBERT L. ROBINSON, JR.

    1998-08-31

    Under previous support from the Department of Energy, an experimental facility has been established and operated to measure valuable vapor-liquid equilibrium data for systems of interest in the production and processing of coal fluids. To facilitate the development and testing of models for prediction of the phase behavior for such systems, we have acquired substantial amounts of data on the equilibrium phase compositions for binary mixtures of heavy hydrocarbon solvents with a variety of supercritical solutes, including hydrogen, methane, ethane, carbon monoxide, and carbon dioxide. The present project focuses on measuring the phase behavior of light gases and water in Fischer-Tropsch (F-T) type solvents at conditions encountered in indirect liquefaction processes and evaluating and developing theoretically-based correlating frameworks to predict the phase behavior of such systems. Specific goals of the proposed work include (a) developing a state-of-the-art experimental facility to permit highly accurate measurements of equilibrium phase compositions (solubilities) of challenging F-T systems, (b) measuring these properties for systematically-selected binary, ternary and molten F-T wax mixtures to provide critically needed input data for correlation development, (c) developing and testing models suitable for describing the phase behavior of such mixtures, and (d) presenting the modeling results in generalized, practical formats suitable for use in process engineering calculations. During the present period, the Park-Gasem-Robinson (PGR) equation of state (EOS) has been modified to improve its volumetric and equilibrium predictions. Specifically, the attractive term of the PGR equation was modified to enhance the flexibility of the model, and a new expression was developed for the temperature dependence of the attractive term in this segment-segment interaction model. The predictive capability of the modified PGR EOS for vapor pressure, and saturated liquid and

  17. Urinary continence following repair of intermediate and high urogenital sinus in CAH. Experience with 55 cases.

    Directory of Open Access Journals (Sweden)

    Maria Marcela Bailez

    2014-07-01

    Full Text Available Aim :Evaluate postoperative urinary continence in patients withcongenital adrenal hyperplasia(CAHwith intermediate (ITand high urogenital sinus (UGS who underwent a UGS mobilization maneuver .Methods: We called IT to those that although needing an aggressive dissection to get to the vagina, still have enough urethra proximal to the vaginal confluence. Very low variants are excluded from this analysis. Dissection always started in the posterior wall of the UGS with an aggressive separation from the anterior rectal wall. If the wide portion of the vagina was reached dissection stopped and the UGS opened ventrally widening to the introitus. Nineteen patients were treated using this maneuver (Group1. When more dissection was required the anterior wall of the UGS was dissected and carefully freed from the low retropubic space. Then the UGS was opened either ventrally or dorsally. Thirty three patients required this approach (Group 2 .Combined procedures were used in 3 patients with high UGS (Group 3. Results : Mean age at the time of the repair and length of the UGS were 12.2 years (4 months to 18 years and 3.75 cm (3 -8 cmfor G 1; 8 years (5 months to 17 years and 6.34 cm ( 4-12 cm in G2 and 8,3 years (2 -14 y and 11.5cm (11-12cm in G3. All patients had been regularly followed. Mean age at last follow up of 14.3y, 17y and 9.9y for groups 1, 2 and 3 respectively. All patients continue to void normally and are continent. All patients have 2 separate visible orifices in the vulva. Only 3 are sexually active.Conclusion: UGS mobilization for vaginoplasty in girls with CAH does not compromise voiding function or urinary continence,

  18. Promotion of hepatic preneoplastic lesions in male B6C3F1 mice by unleaded gasoline.

    Science.gov (United States)

    Standeven, A M; Wolf, D C; Goldsworthy, T L

    1995-01-01

    In previous studies, unleaded gasoline (UG) vapor was found to be a liver tumor promoter and hepatocarcinogen in female mice, but UG was not a hepatocarcinogen in male mice. However, UG vapor had similar transient mitogenic effects in nonlesioned liver of both male and female mice under the conditions of the cancer bioassay. We used an initiation-promotion protocol to determine whether UG vapor acts as a liver tumor promoter in male mice and to examine proliferative effects that may be critical to tumor development. Twelve-day-old male B6C3F1 mice were injected with N-nitrosodiethylamine (DEN; 5 mg/kg, intraperitoneally) or vehicle. Starting at 5-7 weeks of age, mice were exposed by inhalation 6 hr/day, 5 days/week for 16 weeks to 0 or 2046 ppm of PS-6 blend UG. UG treatment caused a significant 2.3-fold increase in the number of macroscopic hepatic masses in DEN-initiated mice, whereas no macroscopic masses were observed in non-initiated mice. Altered hepatic foci (AHF), which were predominantly basophilic in phenotype, were found almost exclusively in DEN-initiated mice. UG treatment significantly increased both the mean volume (threefold) and the volume fraction (twofold) of the AHF without increasing the number of AHF per unit area. UG also induced hepatic pentoxyresorufin-O-dealkylase (PROD) activity, a marker of CYP2B, by more than 12-fold over control with or without DEN cotreatment. To study hepatocyte proliferative effects of UG, we treated mice with 5-bromo-2'-deoxyuridine (BrdU) via osmotic pump for 3 days before necropsy and measured hepatocyte BrdU labeling index (LI) in AHF and nonlesioned liver.(ABSTRACT TRUNCATED AT 250 WORDS) Images Figure 1. PMID:7588481

  19. Addition of Aegilops U and M Chromosomes Affects Protein and Dietary Fiber Content of Wholemeal Wheat Flour

    Directory of Open Access Journals (Sweden)

    Marianna Rakszegi

    2017-09-01

    Full Text Available Cereal grain fiber is an important health-promoting component in the human diet. One option to improve dietary fiber content and composition in wheat is to introduce genes from its wild relatives Aegilops biuncialis and Aegilops geniculata. This study showed that the addition of chromosomes 2Ug, 4Ug, 5Ug, 7Ug, 2Mg, 5Mg, and 7Mg of Ae. geniculata and 3Ub, 2Mb, 3Mb, and 7Mb of Ae. biuncialis into bread wheat increased the seed protein content. Chromosomes 1Ug and 1Mg increased the proportion of polymeric glutenin proteins, while the addition of chromosomes 1Ub and 6Ub led to its decrease. Both Aegilops species had higher proportions of β-glucan compared to arabinoxylan (AX than wheat lines, and elevated β-glucan content was also observed in wheat chromosome addition lines 5U, 7U, and 7M. The AX content in wheat was increased by the addition of chromosomes 5Ug, 7Ug, and 1Ub while water-soluble AX was increased by the addition of chromosomes 5U, 5M, and 7M, and to a lesser extent by chromosomes 3, 4, 6Ug, and 2Mb. Chromosomes 5Ug and 7Mb also affected the structure of wheat AX, as shown by the pattern of oligosaccharides released by digestion with endoxylanase. These results will help to map genomic regions responsible for edible fiber content in Aegilops and will contribute to the efficient transfer of wild alleles in introgression breeding programs to obtain wheat varieties with improved health benefits.Key Message: Addition of Aegilops U- and M-genome chromosomes 5 and 7 improves seed protein and fiber content and composition in wheat.

  20. Effect of anti-inflamentation extracts from Korean traditional medicinal herb

    Directory of Open Access Journals (Sweden)

    Zhang Xiaowan

    2014-09-01

    Full Text Available Five Mix Plant Extracts according to different extraction solvents were assessed for its cell viability and anti-inflammatory activity by in vitro methods. The single plant extract was extracted with 70% ethanol(EtOH and the mix plants(C.kousa, R.multiflora, T.nucifera, M.basjoo and S.glabra were extracted with EtOH 30%, 70%; Butylene Glycol(BG 30%, 70%; Propylene Glycol(PG 30%, 70%; Distilled Water(D.W. Cell viability was measured using the Micro culture tetrazolium (MTT assay method and Human fibroblast cells, CCD 1102 KERTr were used. The plant extracts with the maximum concentration that none toxic to the cells were evaluated for anti-inflammatory activity. Anti-inflammatory activity was evaluated using lipoxygenase inhibition assay method. A dose response curve was plotted to determine the IC50 values. Results showed that, at the 5 kinds of single plant extracts by 70% EtOH extraction solvent, it showed the IC50 was 280ug/ml of S1, 370ug/ml of S2, 380ug/ml of S3, 170ug/ml of S4 and 190ug/ml of S5. At the mix plant extracts by 7 kinds of extraction solvents (70%, 30% EtOH; 70%, 30% BG; 70%, 30% PG; D.W, it showed the IC50 was 140ug/ml of M E70, 140ug/ml of M E30, 120ug/ml of M BG70, 110ug/ml of M BG30, 120ug/ml of M PG70, 136ug/ml of M PG30 and 120ug/ml of M D.W. From the results, it is concluded that when these five plants mixed before extraction, it will extract more active ingredients with anti-inflammatory effects. Further study we will analyzing plants effective single compound using high performance liquid chromatography (HPLC profiling and progressing the experiments in vivo.

  1. Lipase production by Penicillium restrictum using solid waste of industrial babassu oil production as substrate.

    Science.gov (United States)

    Palma, M B; Pinto, A L; Gombert, A K; Seitz, K H; Kivatinitz, S C; Castilho, L R; Freire, D M

    2000-01-01

    Lipase, protease, and amylase production by Penicillium restrictum in solid-state fermentation was investigated. The basal medium was an industrial waste of babassu oil (Orbignya oleifera) production. It was enriched with peptone, olive oil, and Tween-80. The supplementation positively influenced both enzyme production and fungal growth. Media enriched with Tween-80 provided the highest protease activity (8.6 U/g), whereas those enriched with peptone and olive oil led to the highest lipase (27.8 U/g) and amylase (31.8 U/g) activities, respectively.

  2. Does reduced movement restrictions and use of assistive devices affect rehabilitation outcome after total hip replacement? A non-randomized, controlled study in 365 patients with six week follow up

    DEFF Research Database (Denmark)

    Mikkelsen, Lone Ramer; Petersen, Annemette Krintel; Søballe, Kjeld

    (primary outcome, HOOS), anxiety (HADS), working status and patient satisfaction were administered before THR, 3 and 6 weeks after. Findings / Results HOOS function score at the 3 measurement times were (mean ± SD); UG: 46±17 - 76±9 - 83±14 compared to RG: 43±16 – 81±14 - 83±13, (difference between groups...... over time, p=0.004). For return to work 6 weeks post THR, UG compared to RG: 53% versus 32% (p=0.045). No significant differences between groups in anxiety, hip dislocations and patient satisfaction. Conclusions No clinically relevant difference between UG and RG on patient evaluated function was found...

  3. Identifying online user reputation in terms of user preference

    Science.gov (United States)

    Dai, Lu; Guo, Qiang; Liu, Xiao-Lu; Liu, Jian-Guo; Zhang, Yi-Cheng

    2018-03-01

    Identifying online user reputation is significant for online social systems. In this paper, taking into account the preference physics of online user collective behaviors, we present an improved group-based rating method for ranking online user reputation based on the user preference (PGR). All the ratings given by each specific user are mapped to the same rating criteria. By grouping users according to their mapped ratings, the online user reputation is calculated based on the corresponding group sizes. Results for MovieLens and Netflix data sets show that the AUC values of the PGR method can reach 0.9842 (0.9493) and 0.9995 (0.9987) for malicious (random) spammers, respectively, outperforming the results generated by the traditional group-based method, which indicates that the online preference plays an important role for measuring user reputation.

  4. Current insights into hormonal regulation of microspore embryogenesis

    Directory of Open Access Journals (Sweden)

    Iwona eŻur

    2015-06-01

    Full Text Available Plant growth regulator (PGR crosstalk and interaction with the plant’s genotype and environmental factors play a crucial role in microspore embryogenesis (ME, controlling microspore-derived embryo differentiation and development as well as haploid/doubled haploid plant regeneration. The complexity of the PGR network which could exist at the level of biosynthesis, distribution, gene expression or signaling pathways, renders the creation of an integrated model of ME-control crosstalk impossible at present. However, the analysis of the published data together with the results received recently with the use of modern analytical techniques brings new insights into hormonal regulation of this process. This review presents a short historical overview of the most important milestones in the recognition of hormonal requirements for effective ME in the most important crop plant species and complements it with new concepts that evolved over the last decade of ME studies.

  5. Progesterone receptor variation and risk of ovarian cancer is limited to the invasive endometrioid subtype: results from the Ovarian Cancer Association Consortium pooled analysis

    DEFF Research Database (Denmark)

    Pearce, C.L.; Wu, A.H.; Gayther, S.A.

    2008-01-01

    There is evidence that progesterone plays a role in the aetiology of invasive epithelial ovarian cancer. Therefore, genes involved in pathways that regulate progesterone may be candidates for susceptibility to this disease. Previous studies have suggested that genetic variants in the progesterone...... receptor gene (PGR) may be associated with ovarian cancer risk, although results have been inconsistent. We have established an international consortium to pool resources and data from many ovarian cancer case-control studies in an effort to identify variants that influence risk. In this study, three PGR...... single nucleotide polymorphisms (SNPs), for which previous data have suggested they affect ovarian cancer risk, were examined. These were +331 C/T (rs10895068), PROGINS (rs1042838), and a 3' variant (rs608995). A total of 4788 ovarian cancer cases and 7614 controls from 12 case-control studies were...

  6. Information afternoons for BKW personnel

    International Nuclear Information System (INIS)

    Meichle, A.

    1983-01-01

    The management of Bernische Kraftwerke AG organise afternoon meetings for the staff each limited to 70/80 people. Brief details of the information afternoons are given, the main aims of which include updating knowledge on energy policy matters and the need for nuclear power, explaining company policy, improving staff motivation, considering the results of the poll on the standing of BKW with its customers, screening a company film and discussing matters raised by employees. (P.G.R.)

  7. Conveyor belt nuclear weighing machine

    International Nuclear Information System (INIS)

    Anon.

    1977-01-01

    In many industries the flow of materials on conveyor belts must be measured and controlled. Electromechanical weighing devices have high accuracy but are complicated and expensive to install and maintain. For many applications the nuclear weighing machine has sufficient accuracy but is considerably simpler, cheaper and more robust and is easier to maintain. The rating and performance of a gamma ray balance on the mar ket are detailed. (P.G.R.)

  8. Mexico: The Accidental Narco?

    Science.gov (United States)

    2011-06-30

    9 Gonzales, Maria de la Luz (2009-03-25). "Suman 10 mil 475 ejecuciones en esta administracion : PGR" (in Spanish). El Universal. http...the Sinaloa cartel, Ignacio Coronel was killed in 2010. The leader of La Familia, Nazario Moreno Gonzalez, could not escape the reach of Mexican...cartel, La Familia, had proposed truces with the government and promised a reduction in violence if the government focuses more on targeting its

  9. Convergence of glycogen synthase kinase 3β and GR signaling in response to fluoxetine treatment in chronically stressed female and male rats.

    Science.gov (United States)

    Mitic, Milos; Brkic, Zeljka; Lukic, Iva; Adzic, Miroslav

    2017-08-30

    Accumulating evidence strongly suggest that impaired glucocorticoid receptor (GR) signaling is involved in stress-related mood disorders, and nominate GR as a potential target for antidepressants (ADs). It is known that different classes of ADs affects the GR action via modifying its phosphorylation, while the mechanism through which ADs alter GR phosphorylation targeted by GSK3β, a kinase modulated via serotonin neurotransmission, are unclear. On this basis, we investigated whether GSK3β-GR signaling could be a convergence point of fluoxetine action on brain function and behavior, by examining its effect on GSK3β targeted-GR phosphorylation on threonine 171 (pGR171), and expression of GR-regulated genes in the hippocampus of female and male rats exposed to chronic isolation stress. Stress induced sex-specific GSK3β-targeted phosphorylation of pGR171 in the nucleus of the hippocampus of stressed animals. Namely, while in females stress triggered coupled action of GSK3β-pGR171 signaling, in males changes in pGR171 levels did not correspond to GSK3β activity. On the other hand, fluoxetine managed to up-regulate this pathway in sex-unbiased manner. Furthermore, fluoxetine reverted stress-induced changes in most of the analyzed genes in males, CRH, 5-HT1a and p11, while in females its effect was limited to CRH. These data further suggest that pGR171 signaling affects cellular localization of GR in response to chronic stress and fluoxetine in both sexes. Collectively, our results describe a novel convergence point between GR signaling and GSK3β pathway in rat hippocampus in response to stress and fluoxetine in both sexes and its involvement in fluoxetine-regulated brain function in males. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Bern Power Station Co

    International Nuclear Information System (INIS)

    1981-01-01

    The Bernische Kraftwerke electricity generation/supply company supplies about one eighth of the Swiss electrical energy demand with about one sixth of the Swiss generating capacity. Directly or indirectly one million inhabitants are supplied, a substantial contribution to the Swiss economy. Data given on BKW includes: historical background, structure, organisation, operations, generating plant, transmission/distribution equipment, electricity generated, supplied, exported and imported, financial aspects, accounting practice and cooperation arrangements with other utilities. (P.G.R.)

  11. Mexico-U.S. Relations: Issues for Congress

    Science.gov (United States)

    2008-12-18

    Mexico adopted a series of economic, political, and foreign policy reforms. It opened its economy to trade and investment, adopted electoral ...institutions and election agency. The Federal Election Institute (IFE) and Federal Electoral Tribunal (TEPJF) were well-regarded going into the 2006...Investiga PGR Crímenes Cometidos durante Conflicto en Oaxaca,” Notimex, January 4, 2007; Gerardo Soriano and Paulina I. Valencia, “Asegura APPO que

  12. Resistance within hemodialysis shunts predicts patency.

    Science.gov (United States)

    Bui, Trung D; Gordon, Ian L; Parashar, Amish; Vo, David; Wilson, Samuel E

    2006-01-01

    The authors examined the relationship between patency after thrombectomy of clotted dialysis grafts and intraoperative measurements of flow (Q), pressure gradient (PGR), and longitudinal resistance (RL). Eighteen thrombosed arteriovenous (AV) grafts underwent 21 thrombectomies. Pressures at arterial (P1) and venous (P2) ends of the AV grafts were determined with 22-gauge catheters and standard transducers; flow was measured with transit-time probes; arithmetic averaging of waveforms was used to compute mean Q, PGR, and RL. Kaplan-Meier patency curves were analyzed by using log rank methods. Mean patency for all grafts was 164 +/-152 days. For each variable, the 21 measurements were split and the patency curve for the grafts with the 11 lowest value grafts was compared to the curve representing the 10 highest value grafts. The difference between high RL versus low RL patency curves was significant with high-resistance grafts having a median patency of 55 days and low-resistance grafts having a median patency greater than 151 days (p = 0.0089). In contrast, the high Q group median patency was 151 days versus 174 days for the low Q group (p = 0.86). Median patency for the low PGR group was 115 days compared to 62 days for the high PGR group (p = 0.162). Longitudinal resistance within AV grafts, but not flow or pressure gradient, showed a significant correlation with patency after thrombectomy. Increased resistance to flow within AV grafts appears to be an important factor affecting the propensity of dialysis grafts to thrombose.

  13. Why do we build nuclear power stations

    International Nuclear Information System (INIS)

    Keppler, E.

    1984-01-01

    The author discusses some aspects of interest in the context of opposition to nuclear power in Switzerland. The part played and to be played by nuclear power in Switzerland is discussed, criticisms and objections are countered, the implications of power generation without further nuclear contribution are examined, and requests in certain quarters for a tax on power generation except from alternative sources are rejected. (P.G.R.)

  14. Determinants of import demand for non-renewable energy (petroleum) products: Empirical evidence from Nigeria

    International Nuclear Information System (INIS)

    Adewuyi, Adeolu O.

    2016-01-01

    This study estimated determinants of import demand for refined petroleum products in Nigeria for the period 1984–2013. It employed the autoregressive distributed lag (ARDL) bounds test cointegration method and analysed both long-run and short-run determinants of import demand for total and specific petroleum products. In the long-run, aggregate and sectoral incomes are significant determinants of import of refined kerosene. Further, real effective exchange rate (REER), aggregate income (GDP), manufacturing sector's income, domestic energy production (DEP) and population growth rate (PGR) are drivers of import of refined motor spirit Moreover, REER, DEP and manufacturing sector's income are propellers of import of refined distillate fuel. Also, REER and total output of petroleum products are major drivers of total import of refined petroleum products. Short-run results show that previous period GDP, PGR and manufacturing and service sectors' incomes are determinants of import demand for refined kerosene. Moreover, REER, GDP, previous PGR and manufacturing sector's income exert significant effects on the import of refined motor spirit. Further, significant effects of REER, DEP, previous PGR, domestic output of the product and manufacturing and service sectors' incomes on the import demand for distillate fuel were found. Policy implications of the foregoing are articulated in the paper. - Highlights: •Long-run and short-run drivers of import demand for petroleum products were estimated. •kerosene import is income elastic, gasoline import is income and relative price inelastic. •Exchange rate policies may have diverse effects on import of various petroleum product. •Expanding market size has implication for import demand for petroleum product varieties. •Import demand for petroleum products responds differently to various sectoral incomes.

  15. Five Polymorphisms and Breast Cancer Risk: Results from the Breast Cancer Association Consortium

    Science.gov (United States)

    Gaudet, Mia M.; Milne, Roger L.; Cox, Angela; Camp, Nicola J.; Goode, Ellen L.; Humphreys, Manjeet K.; Dunning, Alison M.; Morrison, Jonathan; Giles, Graham G.; Severi, Gianluca; Baglietto, Laura; English, Dallas R.; Couch, Fergus J.; Olson, Janet E.; Wang, Xianshu; Chang-Claude, Jenny; Flesch-Janys, Dieter; Abbas, Sascha; Salazar, Ramona; Mannermaa, Arto; Kataja, Vesa; Kosma, Veli-Matti; Lindblom, Annika; Margolin, Sara; Heikkinen, Tuomas; Kämpjärvi, Kati; Aaltonen, Kirsimari; Nevanlinna, Heli; Bogdanova, Natalia; Coinac, Irina; Schürmann, Peter; Dörk, Thilo; Bartram, Claus R.; Schmutzler, Rita K.; Tchatchou, Sandrine; Burwinkel, Barbara; Brauch, Hiltrud; Torres, Diana; Hamann, Ute; Justenhoven, Christina; Ribas, Gloria; Arias, José I.; Benitez, Javier; Bojesen, Stig E.; Nordestgaard, Børge G.; Flyger, Henrik L.; Peto, Julian; Fletcher, Olivia; Johnson, Nichola; Silva, Isabel dos Santos; Fasching, Peter A.; Beckmann, Matthias W.; Strick, Reiner; Ekici, Arif B.; Broeks, Annegien; Schmidt, Marjanka K.; van Leeuwen, Flora E.; Van’t Veer, Laura J.; Southey, Melissa C.; Hopper, John L.; Apicella, Carmel; Haiman, Christopher A.; Henderson, Brian E.; Le Marchand, Loic; Kolonel, Laurence N.; Kristensen, Vessela; Alnæs, Grethe Grenaker; Hunter, David J.; Kraft, Peter; Cox, David G.; Hankinson, Susan E.; Seynaeve, Caroline; Vreeswijk, Maaike P.G.; Tollenaar, Rob A.E.M.; Devilee, Peter; Chanock, Stephen; Lissowska, Jolanta; Brinton, Louise; Peplonska, Beata; Czene, Kamila; Hall, Per; Li, Yuqing; Liu, Jianjun; Balasubramanian, Sabapathy; Rafii, Saeed; Reed, Malcolm W.R.; Pooley, Karen A.; Conroy, Don; Baynes, Caroline; Kang, Daehee; Yoo, Keun-Young; Noh, Dong-Young; Ahn, Sei-Hyun; Shen, Chen-Yang; Wang, Hui-Chun; Yu, Jyh-Cherng; Wu, Pei-Ei; Anton-Culver, Hoda; Ziogoas, Argyrios; Egan, Kathleen; Newcomb, Polly; Titus-Ernstoff, Linda; Dietz, Amy Trentham; Sigurdson, Alice J.; Alexander, Bruce H.; Bhatti, Parveen; Allen-Brady, Kristina; Cannon-Albright, Lisa A.; Wong, Jathine; Chenevix-Trench, Georgia; Spurdle, Amanda B.; Beesley, Jonathan; Pharoah, Paul D.P.; Easton, Doug F.; Garcia-Closas, Montserrat

    2009-01-01

    Previous studies have suggested that minor alleles for ERCC4 rs744154, TNF rs361525, CASP10 rs13010627, PGR rs1042838, and BID rs8190315 may influence breast cancer risk, but the evidence is inconclusive due to their small sample size. These polymorphisms were genotyped in more than 30,000 breast cancer cases and 30,000 controls, primarily of European descent, from 30 studies in the Breast Cancer Association Consortium. We calculated odds ratios (OR) and 95% confidence intervals (95% CI) as a measure of association. We found that the minor alleles for these polymorphisms were not related to invasive breast cancer risk overall in women of European descent: ECCR4 per-allele OR (95% CI) = 0.99 (0.97–1.02), minor allele frequency = 27.5%; TNF 1.00 (0.95–1.06), 5.0%; CASP10 1.02 (0.98–1.07), 6.5%; PGR 1.02 (0.99–1.06), 15.3%; and BID 0.98 (0.86–1.12), 1.7%. However, we observed significant between-study heterogeneity for associations with risk for single-nucleotide polymorphisms (SNP) in CASP10, PGR, and BID. Estimates were imprecise for women of Asian and African descent due to small numbers and lower minor allele frequencies (with the exception of BID SNP). The ORs for each copy of the minor allele were not significantly different by estrogen or progesterone receptor status, nor were any significant interactions found between the polymorphisms and age or family history of breast cancer. In conclusion, our data provide persuasive evidence against an overall association between invasive breast cancer risk and ERCC4 rs744154, TNF rs361525, CASP10 rs13010627, PGR rs1042838, and BID rs8190315 genotypes among women of European descent. PMID:19423537

  16. Cartel Car Bombings in Mexico

    Science.gov (United States)

    2013-08-01

    Security OSINT Open Source Intelligence UXO Unexploded Ordnance PAN National Action Party (Partido Acción Nacional) PGR Office of the...infor- 35 mation beyond that provided by open source intelligence ( OSINT ). Such information, and the military intelligence process behind it that...required to be at the unclassified, yet limited distribution/sensitive and non-restric- tion on use OSINT levels for law enforcement utilization

  17. Effects of OK-432 (picibanil) on the estrogen receptors of MCF-7 cells and potentiation of antiproliferative effects of tamoxifen in combination with OK-432.

    Science.gov (United States)

    Aoyagi, H; Iino, Y; Takeo, T; Horii, Y; Morishita, Y; Horiuchi, R

    1997-01-01

    OK-432 (picibanil), a streptococcal preparation, has a strong biological response modifier (BRM) function and is expected to produce clinical improvement and prolongation of survival in treated cancer patients in Japan. We were interested in whether OK-432 augments estrogen receptor (ER) levels in breast cancer. To investigate the effect of the BRMs on cellular growth and the characteristics of ER and progesterone receptors (PgR) in the human breast cancer cell line MCF-7, we used OK-432, Krestin (PSK), a protein-bound polysaccharide extracted from Coriolus versicolor, and lentinan, a fungal branched (1...3)-beta-D-glycan. OK432 and PSK dose dependently inhibited DNA synthesis of MCF-7 cells, and the 50% inhibitory concentrations of OK-432 and PSK were 1.2 KE (klinische Einheit, clinical unit)/ml and 200 micrograms/ml, respectively. Lentinan showed no direct anticancer effect in vitro. We found that OK-432 induced a 2-fold increase in ER levels in MCF-7 cells at 0.005 KE/ml, but not in PgR. Lentinan and low-dose PSK did not change ER or PgR levels, but high-dose PSK decreased ER and PgR. We also studied the combined effect of OK-432 and antiestrogens, tamoxifen (TAM) and DP-TAT-59. The combined treatment with OK-432 and TAM showed an additive inhibitory effect on MCF-7 cells. These results suggest that OK-432 may augment the therapeutic effect of TAM in breast cancer.

  18. Preoperative core needle biopsy is accurate in determining molecular subtypes in invasive breast cancer

    International Nuclear Information System (INIS)

    Chen, Xiaosong; Yuan, Ying; Fei, Xiaochun; Jin, Xiaolong; Shen, Kunwei; Sun, Long; Mao, Yan; Zhu, Siji; Wu, Jiayi; Huang, Ou; Li, Yafen; Chen, Weiguo; Wang, Jianhua

    2013-01-01

    Estrogen receptor (ER), progesterone receptor (PgR), HER2, and Ki67 have been increasingly evaluated by core needle biopsy (CNB) and are recommended for classifying breast cancer into molecular subtypes. However, the concordance rate between CNB and open excision biopsy (OEB) has not been well documented. Patients with paired CNB and OEB samples from Oct. 2009 to Feb. 2012 in Ruijin Hospital were included. ER, PgR, HER2, and Ki67 were determined by immunohistochemistry (IHC). Patients with HER2 IHC 2+ were further examined by FISH. Cutoff value for Ki67 high expression was 14%. Molecular subtypes were constructed as follows: Luminal A, Luminal B, Triple Negative, and HER2 positive. There were 298 invasive breast cancer patients analyzed. Concordance rates for ER, PgR, and HER2 were 93.6%, 85.9%, and 96.3%, respectively. Ki67 expression was slightly higher in OEB than in CNB samples (29.3% vs. 26.8%, P = 0.046). Good agreement (κ = 0.658) was demonstrated in evaluating molecular subtypes between CNB and OEB, with a concordance rate of 77.2%. We also used a different Ki67 cutoff value (20%) for determining Luminal A and B subtypes in HR (hormone receptor) +/HER2- diseases and the overall concordance rate was 79.2%. However, using a cut-point of Ki67 either 14% or 20% for both specimens, there will be about 14% of HR+/HER2- specimens that are called Luminal A on CNB and Luminal B on OEB. CNB was accurate in determining ER, PgR, and HER2 status as well as non-Luminal molecular subtypes in invasive breast cancer. Ki67 should be retested on OEB samples in HR+/HER2- patients to accurately distinguish Luminal A from B tumors

  19. Immobilization of Aspergillus niger. beta. -D-glucosidase on aminated chitin and alumina/alginate

    Energy Technology Data Exchange (ETDEWEB)

    Bon, E.; Freire, D.; Mendes, M.F.; Soares. V.F.

    1986-01-01

    The immobilization of ..beta..-glucosidase was studied by (a) covalent coupling to aminated chitin (IME-C) and (b) adsorption onto alumina followed by gel entrapment of the suspension with calcium alginate (IME-A). The levels of catalytic activity determined against salicin at 50 C were 23.0 U/g and 0.2 U/g for the IME-C and IMA-A respectively. The first system was shown to be quite stable with a loss of only 2% of the initial activity over 14 days. The IME-A system had a half life of 14 days. The activity of IME-C was studied using cellobiose and enzymatic hydrolysates of sugar cane bagasse at several cellobiose concentrations. The activities obtained with cellobiose were 104.0 U/g and 72.0 U/g respectively. 13 references.

  20. Gene : CBRC-PMAR-01-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available o Petromyzon marinus cDNA 3', mRNA sequence /clone_end=3' /gb=EE272683 /gi=111169662 /ug=Pma.1613 /len=663 1e-08 26% MEVGIS...IMEVAISIMEVDISIMEVDISIMEVGISIMEVGISIMEVGISIMEVDISIMEVGISIMEVAISIMEVAISIMEVGISITEVRISIMEVGIS...IMEVGISITEVGISITEVGISIMEVGISIMEVGISITEVGISITEVGISITEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGIS...ITEVGISIMEVGISITEVRISIMEVGFTITASSTSSLSSLTQARLLHLFPSTLQRTTSSCLMLSSSLSAMNNPLLDENLSTPPPLIILQIRHPSIHPHGGRPLSDAFRPWAAALFLVSAIGHRPSLAVTTRPDKAQISSGAV ...

  1. no es nada it is nothing simbonile we saw himjher

    African Journals Online (AJOL)

    Universal Grammar (UG) to applied linguistics and language teaching. In particular I am ... input in which subjects are sometimes physically present and .... in complex sentences than simple sentences, and I have found .... Present tense perf.

  2. Gene : CBRC-DRER-07-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available C572172), mRNA /cds=p(17,10813) /gb=XM_695856 /gi=125855624 /ug=Dr.88794 /len=10813 0.0 37% TTTTASVTTTTEHTSTTEPSTTTTVPVTTTTEHTST...TEQSTTTTVPVTTTTEHTSTTELSTTTTAPVTTTTEHTSTTEPSTTTTAPVTTTTEHTSTTELSTTTTAPVTTTTEHTST...TELSTTTTAPVTTTTTEHTSTTEPSTTTTTPVTTTEHTSTTEPSTTTTAPVTTTEHTSTTEPSTTTTAPVTTTTEHTSTTEPPTTTTGPVTTTTTEHTST...TEQSTTTTTPVTTTEHTSTTEPSTTTTAPVTTTTEHTSTTEQSTTTTAPVTTTEHTSTTEPPTTTTKPITTTTEHTSTTEPSTTTTVPVTTTTEHTSTTEPSTTTTASVTTTTEHTST...TELSTTTTAPETTTTEHTSTTEPSTTTTAPVTTTTEHTSTTEPSTTTTAPVTTTQHTSTTEQSTTTTAPVTTTTEHTST

  3. Methanol Extract of Codonopsis pilosula Inhibits Inducible Nitric ...

    African Journals Online (AJOL)

    HP

    Department of Pharmacology and Toxicology, School of Dentistry, Kyung Hee University, .... triton X-100, 0.5 % NP-40, 1 ug/ml leupetin, and .... oxidative stress like smoking, ultraviolet rays, ... thereby disturbing the normal protein structure.

  4. Personnel and Vehicle Data Collection at Aberdeen Proving Ground (APG) and its Distribution for Research

    Science.gov (United States)

    2015-10-01

    28 Magnetometer Applied Physics Model 1540-digital 3-axis fluxgate 5 Amplifiers Alligator Technologies USBPGF-S1 programmable instrumentation...Acoustic, Seismic, magnetic, footstep, vehicle, magnetometer , geophone, unattended ground sensor (UGS) 16. SECURITY CLASSIFICATION OF: 17. LIMITATION

  5. Effects of visibility and types of the ground surface on the muscle activities of the vastus medialis oblique and vastus lateralis

    Science.gov (United States)

    Park, Jeong-ki; Lee, Dong-yeop; Kim, Jin-Seop; Hong, Ji-Heon; You, Jae-Ho; Park, In-mo

    2015-01-01

    [Purpose] The purpose of this study was to compare the effects of visibility and types of ground surface (stable and unstable) during the performance of squats on the muscle activities of the vastus medialis oblique (VMO) and vastus lateralis (VL). [Subjects and Methods] The subjects were 25 healthy adults in their 20s. They performed squats under four conditions: stable ground surface (SGS) with vision-allowed; unstable ground surface (UGS) with vision-allowed; SGS with vision-blocked; and UGS with vision-blocked. The different conditions were performed on different days. Surface electromyogram (EMG) values were recorded. [Results] The most significant difference in the activity of the VMO and VL was observed when the subjects performed squats on the UGS, with their vision blocked. [Conclusion] For the selective activation of the VMO, performing squats on an UGS was effective, and it was more effective when subjects’ vision was blocked. PMID:26356407

  6. Gene : CBRC-PMAR-01-0569 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available romyzon marinus cDNA, mRNA sequence /gb=CO548425 /gi=51796737 /ug=Pma.8609 /len=962 3e-06 21% MCCIGIADTLALLLHWHCCCIGIAATLA...LLLHWHCCYIGIVATLALLLRWHCCCIGIVDTLALLLHWHCCFIGIVAALALLLHWHCCCIGIVAALALLLHWHCCYIGIVATLA...LLLHWHCCYIRIAATLALLLHWHCCCIGIAAALALLLHWHCCCIGIVDTLALLLHWHCCYIGIAATLALLLHWHCCCIGIVATLALLLHWHCCYIGIAATLA...LLLHWHCCYIGIAATLALLLHWHCCCIGIAATLTLLLHCHSCTVRAPAVADTLGLRPSPNLYKEFTFRG ...

  7. Persistence of 14C maneb in lettuce plants an soil

    International Nuclear Information System (INIS)

    Bennaceur, M.; Sennaoui, Z.; Meguenni, H.

    1992-10-01

    Maneb residue is studied on lettuce plant and soil after spraying on greenhouse with 14C maneb. The residues declined with time. After 37 days from the application, 14C maneb residues in water extracts declined to 1,5. 10-2ug/g from 5,8. 10-1ug/g of the zero day sample in lettuce plants and 4,6. 10-3ug/g from 1,73. 10-1ug/g in soil. The 14C internals residues in lettuce and soil increase respectively till 16 days and 24 days, then decrease to 88% and 4,05% after 37 days. ETU was present in lettuce plant after 8 days then decreases with time. Two metabolites were identified by TLC (EU,ETU)

  8. Gene : CBRC-RNOR-10-0236 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available lete cds /cds=p(41,1927) /gb=AY325173 /gi=33086523 /ug=Rn.6897 /len=1933 1e-73 64% MVATITQDNRVNNNSSSSNNNSSSDHNKSNNSSNSSNSNNSSNSNNSS...NSNNSSNSSNSNNSSNSSNSSNSSNNSNSNNSSNSSNSSNSSNSNNNNSNSNNSSNSNNSSNINNSSNSNNSNSNNSS...NINNSSNSNNSNSNNSSNSNNSSNSNNSSNSNNSNSNNSNSNNSSNSNNSSNINNSSNSNNSNSNNSSNINNSSNSNNSNSNNSSNSNNSSNSNNSNSNNSSNINNSS...NSNNSNSNNSSNSNNSSNSNNSSNSSNSSNSSNNSNSNNSSKATTAVTATTAATATTAVTATTATATTAAKQQQQGWQCSSLVPGNRRQRQADPLS ...

  9. Gene : CBRC-RNOR-07-0266 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 5 (LOC685755), mRNA /gb=XR_006286 /gi=109471595 /ug=Rn.197700 /len=1496 4e-65 64% MNGKKIIKLRAEINRNNNNNSSSSNSNNSSSSSNNNNSSSNSNNNSS...SNSNNNSSSSNSNNNSNNNSNSSNNSSSNNNSSSSNSNNSSNSNNSNNNSNSSNNNSNNSSSNSNNSNNNSS...SNSNNSNNNSNSNNSNSSNNNSNNNNSSSNSNNNNNNNSSNNNSSNNNNNSNNIKTTAATTTTATTTTAANAIIETKSWFLEKISKIDKPLFNIKVERKLNQINQPRKERRGV ...

  10. Gene : CBRC-PMAR-01-0249 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available nt subunit NF-180 mRNA, complete cds /cds=p(122,3454) /gb=U19361 /gi=632548 /ug=Pma.4811 /len=3763 8e-43 41% MRSSNSSSSRSSSNNSSSNSSNSS...RSSSNNSSSSNNSSRSSSNSSSSNRSSSNRSSSSSNSNSSSSSSSNRSRSSSNRSSSNRSSSNSSNSSNSSSSSNSS...SNSNSSNSRSNSSNSSNSRNSNSSSNSSSNSSNSNRRNSSNSSNSRSNNSSNSSNSSSNSSNSNSSSNSSSNSSNSNSSSNSSRSNNSSSSNSSNRSSNSSNNSSNSSSNSS...NSSNSSSNNSSNSSSSNSSNNNSSNSSNNNSSNSSNSSNNSNSSSNNNSNSSRSNSGFWLSHRTKSVAVTKPRGAFGLRFRGRLERCSLPT ...

  11. Gene : CBRC-RNOR-01-0770 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available pothetical protein LOC685755 (LOC685755), mRNA /gb=XR_006286 /gi=109471595 /ug=Rn.197700 /len=1496 6e-64 70% MFKPQYNYNNNSS...SSNNYNSNNNNSNSSSNNNSNSSSSNNNSNSSNNNSNSNNSNNSNNNSNSSSNNNSNSSNSNSSSNNNSNSSNNYNSNNNSSSSNSS...SNNSNNNNNNSNNNNSNNNSSNSSNSSSNNNSNSSNNNSSNNNSNSNSSNSNSNSSNSNSSSNNSNNNNSNSSNNNNNSSSNNSNNNNSSSNNNNSNSSNNNNNSS...SNNSNNNNNSNNNSNSSNSNSSSNNNNSNSSSNNSNNNNNSNSNSSNSNNNNSNNSNSNSSNNNSNNNNNSNSSNNNSNSNNSNSSNSSSNNSNSSSNNSNNNNNSNNSNSNSS...NSNNNNNSNNSNSNSSNSNSSNNNSNNNNSNSSNSNNNNSNSSNSNSNNSNSNSSNSNSNNSNNSSNSSSSNNNSNSNSS

  12. Gene : CBRC-RNOR-08-0111 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available complete cds /cds=p(41,1927) /gb=AY325173 /gi=33086523 /ug=Rn.6897 /len=1933 1e-76 65% MDDRSQKMNSYNNSSSNNNNNSSKNSNNSNSSSNNNSSNNNSNNSS...NNNSNSNNSKNSSSNNSSNSSNNSNSNNSNNSNSNNSSNNNSSNNNSNSNNSNNSSSNNSSNSNNNSSSNNSNNSNSNNSS...NSSSNNSSNSNNSSSSNNSSNSNNNSSSNNSNSNNSSNNSSNSNNSSSSNNSNSNSNNSNNSSNNSNNSSSNNSNNSNSNNSNSSSRNSNNSSNNSSNSNNSS...SSNNSNSSSSNSNNSSNSNNSKRLSLFRLTKLEIEENYLTYACGGSGVHDGSYIPSEDVCLGIPGDLKGVIVTLSDDGHLQCSYLGTD

  13. Gene : CBRC-CINT-01-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available v425e13 /clone_end=3' /gb=BW467001 /gi=48602865 /ug=Cin.16926 /len=835 3e-11 23% TNTNNRTTHNNKITTHNNSS...TNTNNSSTNTTNSSTVTYNSTTLNNKNTTHNNSSTNTNNSSTVTHNGTTLNNKNTKHNNSFTNTNNSFTNTNISSTNTNNSSTITNNSFTNTNNSSTNTNNSS...TNTNNSVTNTNNSFTNTNDSTTHNNKITTHNNSSTNTNNSFTNTNISSTNTNNSSTNTNNSSTNTNNSSTINNNSSTITNNSSTNTNNSSTITNNSFTNTNNSSTNTNNSS...TNTNNSVTNTNNSFTNTNDSTTHNNKITTHNNSSTNTNNSFTNTNISSTNTNNSSTNTNNSSTNTNNSSTINNNSSTITNNSS...TNTNNSSTITNNSSTVTYNSSTNTNNSTTPNDNAINNNNYIKPMFMKSYAHACITIPTTRLVYFVYNFTITVVFKLLFITLFIF ...

  14. Gene : CBRC-MMUS-19-0101 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available protein (Dspp), mRNA /cds=p(77,2914) /gb=NM_010080 /gi=111120321 /ug=Mm.319832 /len=4431 3e-34 34% MDSRLCLNNRSNSSSSNNSRNNSS...SSSSSRNSRNNNNSNINNINTNSSRNNSSSRNNSNNSSWNSSNNSSSNNSSSNNSNTSKNNNSSNINYSNNSSSRSNSNNSS...SRNNSNNNNNKSSNHSSNNNSNNSSSSNSSNKSSSSNNNNNNSNNHSSNSNSNSSSSRINSNNNISNNNINNNSSSNNNSSNHSSNNNSNSSSSNNNSSSNNSHNSSSNNNNNQKQNQKQPKKSR ...

  15. BIOACTIVITIES AND MECHANISM OF SPIRO ENOL ETHER ANALOGUES AGAINST PIERIS RAPAE

    Institute of Scientific and Technical Information of China (English)

    Zhi-xiangZhang; Dong-meiCheng; Han-hongXu; Yu-linWu; andJun-faFan

    2004-01-01

    Nineteen kinds of spiro enol ether analogues were screened with larvae of Pieris rapae for antifeedant activity. The results showed that the antifeedant activity of compounds No.20 and No.12 was higher than others. In non-choice test, AFC50 values within 24 h of compounds No.20 and No.12 against 3rd instar larvae of P. rapae were 226.93ug/mL and 370.00ug/mL, and that in choice test against 4th larvae were 280.54 ug/mL and 398.88 ug/mL, respectively. Compd. No.20 could prolong the eggs hatch time and reduce the haemolymph content and the protein content in haemolymph of 4th instar larvae obviously. Compd. No.20 could protect tested leaves and control larvae of P. rapae effectively.

  16. 2512-IJBCS-Article-Okot Okumu

    African Journals Online (AJOL)

    hp

    heterophyllus and Moringa oleifera for treatment of community drinking water, Uganda ... *Auteur correspondant, E-mail: jokotokumu@caes.mak.ac.ug, jokotokumu@yahoo.com, ..... low, medium and high turbidity water by Jack fruit seed ...

  17. properties of extrudates from sorghum varieties abstract résumé

    African Journals Online (AJOL)

    ACSS

    Corresponding author: ybbyaru@yahoo.com, ybbyaruhanga@caes.mak.ac.ug. ABSTRACT. Extrusion cooking is a modern high-temperature short-time (HTST) processing technology, which is ... moisture contents and viscosities are treated,.

  18. banana juice as an alternative energy source for banana in vitro

    African Journals Online (AJOL)

    ACSS

    2015-02-23

    Feb 23, 2015 ... Corresponding author: sbmukasa@caes.mak.ac.ug, sbmukasa@yahoo.com ... However, the cost of tissue culture grade energy sources is high, thus making tissue ..... Treatment (banana juice from different Cvs at 50 ml l-1).

  19. Underground gas storage Lobodice geological model development based on 3D seismic interpretation

    International Nuclear Information System (INIS)

    Kopal, L.

    2015-01-01

    Aquifer type underground gas storage (UGS) Lobodice was developed in the Central Moravian part of Carpathian foredeep in Czech Republic 50 years ago. In order to improve knowledge about UGS geological structure 3D seismic survey was performed in 2009. Reservoir is rather shallow (400 - 500 m below surface) it is located in complicated locality so limitations for field acquisition phase were abundant. This article describes process work flow from 3D seismic field data acquisition to geological model creation. The outcomes of this work flow define geometry of UGS reservoir, its tectonics, structure spill point, cap rock and sealing features of the structure. Improving of geological knowledge about the reservoir enables less risky new well localization for UGS withdrawal rate increasing. (authors)

  20. Disease: H01588 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available estlessness or agitation. Headaches often recur at the same time each day during the cluster period, which c...ug) ... AUTHORS ... VanderPluym J ... TITLE ... Cluster Headache: Special Considerations for Treatment of Female P

  1. An Advanced VHF/UHF Short Range, Groundwave Propagation Model for Paths With Near-Earth Antennas

    National Research Council Canada - National Science Library

    Cross, Marshall W; Fung, Tat Y

    2006-01-01

    ... the earth such as: Unattended Ground Sensors (UGS) and Intelligent Munitions Systems (IMS), are attenuated above free space values by the lossy earth itself and any obstructions between a transmitter and receiver pair...

  2. Gene : CBRC-CINT-01-0032 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available :cieg003b01, full insert sequence /gb=AK116512 /gi=23589081 /ug=Cin.12858 /len=2519 0.027 32% MISCLLLNSPVCLMTICILLNLQVRLMMS...SVLLNSPVCLMMSCRLLNSPVRLMMSCLLNSPVRLMISCLLLNSPVRLMMSCILLNSPVRLMMSSVLLNSAVCLMMSCRLLNSPVRLMMS...CRLLNSPVRLMMSSVLLNSPVCLMMSCRLLNSPVRFIMSCLLPNSPVCLMTICILLNSQVRLMISSLLNSPVCLMMSSALLNSPVRLMMSSRLLNSPVRLMMSCRLLNSPVRLMMSCVLLNSPVRLMMSCLLLNSPVCLMMSCSF ...

  3. Gene : CBRC-CINT-01-0076 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ntestinalis cDNA, clone:cieg003b01, full insert sequence /gb=AK116512 /gi=23589081 /ug=Cin.12858 /len=2519 5e-04 29% MMSCLLLNLPVRLMMS...CLLLNSPVCLMMSCRLLNSPVRLMISCLLLNSPVCLMMSCLLLNSPVRLMMSCLLLNSPVRLMMSCLLLNSPVCLMMS...CLLLNSPVRLMMSCLLLNSPVRLMISCLLLNSPVRLMISCLLLNPPVRLMMSCVLLNLPVRLMMICILSNSPVCLVISCLLLNSPVRLMISCLLLNSPVCLMMS...CVLPNSPVRLMMSCLLLNSPVRLMMSCLLLNLPVRLMMSCLLLNSPVCLMMSCLILNSPVRLMICCLLLNSPVCLMTICILLNSTVRLMICCLLLNPPVRLMISCLLNPPVRLMMSCVLLNSPVRLMTSRFRLELMYVRCLTIFKKFLL ...

  4. Publications | Page 62 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 611 - 620 of 6389 ... IDRC works with developing-country researchers and institutions to ... sp. strain UCD-UG_FMILLET was isolated from the roots of the Afro-. ... and men that perpetuate gender and inequality and power imbalances.

  5. Gene : CBRC-XTRO-01-3152 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Neu108f03 /clone_end=3' /gb=BX693382 /gi=38342502 /ti=474115996 /ug=Str.40529 /len=838 3e-17 39% MPLAFAPS...PLAFAPSPLAFAPSPLAFAPSPLAFAPSPLAFPPSPLAFAPSPLAFPPSPLAFAPSPLAFAPSPLAFAPSPLAFPPSPLAFAPS...PLAFVPSLLAFPPSPHAFAPLPLAFAPSPLAFAPSPLAFAPSPLAFPPSPLPLLLCSLPFLLGPLPLLLCPFPLLLHPLSLLLCPLPLLLGPLPLLFCPFPWLLRPLPLLLCPLPLLLRPLSLLLCPFPLLLRPLPLLLRPLPLLLDPGHYTKRWALDVNTAITRP ...

  6. Gene : CBRC-DRER-26-0137 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cDNA clone 3384097, mRNA sequence /clone=3384097 /gb=EB959993 /gi=102920926 /ug=Dr.79541 /len=690 4e-71 84% MECAARSGDEKELQNSKAGVVAR...VLISCVVARVLISCVVAQVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVAR...VLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLISCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVAR...VLNSGVVARVLNSGVVARVLNSGVVARVLNSGVVARVLISGVVARVLISCVVARVLNSCVVARVLIXXXXXXXXXXXXXXXXXXX

  7. Gene : CBRC-DRER-08-0063 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 3384097, mRNA sequence /clone=3384097 /gb=EB959993 /gi=102920926 /ug=Dr.79541 /len=690 3e-61 79% MECAARRGDEKELENPKAGVVAARVLNSGVVAR...VLISCVVVRVLISCVVAARVLNSGVVARVLISCVVVRVLISCVVAARVLNSSVVARVLISCVVARVLISCVVAARVLNSSVVAR...VLISCVVARVLISCVVAARVLNSGVVARVLISCVVARVLISCVVAARVLNSSVVARVLISCVVAARVLNSGVVARVLISCVVARVLISCVVARVVISCVVAR...VLKSGVVARVLISCVVARVLNSGVVARVLISGVVARVLISCVVARVLISCVVARVLISCVVARTE ...

  8. Gene : CBRC-DRER-26-0260 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 3384097, mRNA sequence /clone=3384097 /gb=EB959993 /gi=102920926 /ug=Dr.79541 /len=690 2e-68 82% MECAARSGDEKELENSKAGVVATRVLNSGVVAR...VLISCVVARVLNSGVVARVLISCVVARALISCVVARVLNSSVVARVLINSVVARVLISCVVARVLNSGVVARVLISCVVAR...VLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARFLISCVVARVLNSGVVSTLFRLMQT ...

  9. The concentration of cadmium in hepatoma among Filipinos

    International Nuclear Information System (INIS)

    Alejandrino, A.L.; Goze, C.B.; Paradero, R.R.

    1977-08-01

    The concentration of cadmium in liver hepatoma and in normal liver in Filipinos was determined by atomic absorption spectrophotometry. Using NBS Bovine Liver (SRM1577) as reference material, a value of 0.28+-0.025 ug/g dry weight was obtained for cadmium which is close to the certified NBS value of 0.27+-0.04 ug/g. The mean percentage recovery for cadmium determination by AAS was 98.38%. A mean value of 2.14+-1.58 ug Cd/g liver hepatoma was observed for the 12 cases investigated, showing decreased cadmium levels in the cancerous liver compared to the mean value of 12.62 ug Cd/g observed for normal liver obtained from 10 cases of accidental deaths. The values are expressed on a dry weight basis

  10. Aryl hydrocarbon receptors in urogenital sinus mesenchyme mediate the inhibition of prostatic epithelial bud formation by 2,3,7,8-tetrachlorodibenzo-p-dioxin

    International Nuclear Information System (INIS)

    Ko, Kinarm; Moore, Robert W.; Peterson, Richard E.

    2004-01-01

    In utero exposure of male C57BL/6 mice to 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) prevents prostatic epithelial buds from forming in the ventral region of the urogenital sinus (UGS) and reduces the number of buds that form in the dorsolateral region. This inhibition of budding is aryl hydrocarbon receptor (AHR) dependent and appears to be the primary cause of lobe-specific prostate abnormalities in TCDD-exposed mice. TCDD can inhibit prostatic epithelial bud formation by acting directly on the UGS in vitro, but whether it does so via AHR in UGS mesenchyme, epithelium, or both was unknown. To address this issue, UGS mesenchyme and epithelium from gestation day (GD) 15 wild-type C57BL/6J male mice were isolated, recombined, and cultured in vitro for 5 days with 10 -8 M 5α-dihydrotestosterone (DHT) and either 10 -9 M TCDD or vehicle. Prostatic epithelial buds were viewed by light microscopy after removal of mesenchyme. Effects depended greatly on which portions of the mesenchyme were used: TCDD had little if any effect when whole UGS epithelium (UGE) was recombined with ventral plus dorsolateral mesenchyme, tended to reduce bud numbers in recombinants made with UGE and dorsolateral mesenchyme, and severely reduced bud numbers in recombinants made with UGE and ventral mesenchyme (VM). [VM + UGE] recombinants prepared from wild-type and AHR knockout (Ahr -/- ) mice were then cultured with DHT to determine the site of action of TCDD. AHR null mutation alone had no effect on budding. TCDD severely inhibited prostatic epithelial bud formation in recombinants that contained mesenchymal AHR, whereas bud formation was not inhibited by TCDD in recombinants lacking mesenchymal AHR, regardless of epithelial AHR status. These results demonstrate that UGS mesenchyme and not UGS epithelium is the site of action of TCDD. Therefore, the initial events responsible for abnormal UGS (and ultimately prostate) development occur within the UGS mesenchyme, and changes in gene expression

  11. Heavy Metal Contents of Municipal and Rural Dumpsite Soils and Rate of Accumulation by Carica papaya and Talinum triangulare in Uyo, Nigeria

    Directory of Open Access Journals (Sweden)

    G. A. Ebong

    2008-01-01

    Full Text Available Dumpsites in Uyo and most cities in Nigeria are used nutrients rich soils for cultivating fruits and vegetables without regards to the risk of toxic metal pollution by the wastes. This development necessitated the research on the assessment of the impact of municipal and rural dumpsites on the metal levels of the underlying soils, the relationship between the dumpsite- soil metal content and the rate of bio-accumulation by plants, the effect of plant specie and plant part on the rate of metal uptake. Atomic absorption spectrophotometer was employed for the analysis of the samples and results obtained from municipal dumpsite soil indicated the following mean concentrations: Fe, 1711.20 μg/g; Pb, 43.28 ug/g; Zn, 88.34 ug/g; Ni, 12.18 ug/g; Cd, 14.10 ug/g and Cu, 56.33 ug/g. These concentrations were relatively higher than the following concentrations: Fe, 1016.98 ug/g; Pb, 18.57 ug/g; Zn, 57.90 ug/g; Ni, 7.98 ug/g; Cd, 9.25 ug/g and Cu, 33.70 ug/g recorded for the rural dumpsite soil. Consequently, plants grown on municipal dumpsites soil accumulated higher concentrations of the metals than those on rural dumpsites. Results obtained from this study also revealed that plants grown on dumpsite soils bio-accumulated higher metal concentrations than their counterparts obtained from normal agricultural soils. The ability of plants to bioaccumulate these metals were also observed as being different from one plant to the other and from one plant parts to the other. And apart from Fe and Zn which recorded higher concentrations in the leaves of the plants studied, other metals recorded higher concentrations in the roots. The general results obtained revealed that the levels of Cd in dumpsite-soil were above the standard while the levels of Cd and Pb in plants were also above the recommended levels in plants. The implications of these high concentrations of these metals in soil and plants have been discussed. Some useful recommendations on the proper

  12. [Identification of candidate genes and expression profiles, as doping biomarkers].

    Science.gov (United States)

    Paparini, A; Impagnatiello, F; Pistilli, A; Rinaldi, M; Gianfranceschi, G; Signori, E; Stabile, A M; Fazio, V; Rende, M; Romano Spica, V

    2007-01-01

    Administration of prohibited substances to enhance athletic performance represents an emerging medical, social, ethical and legal issue. Traditional controls are based on direct detection of substances or their catabolites. However out-of-competition doping may not be easily revealed by standard analytical methods. Alternative indirect control strategies are based on the evaluation of mid- and long-term effects of doping in tissues. Drug-induced long-lasting changes of gene expression may be taken as effective indicators of doping exposure. To validate this approach, we used real-time PCR to monitor the expression pattern of selected genes in human haematopoietic cells exposed to nandrolone, insulin-like growth factor I (IGF-I) or growth hormone (GH). Some candidate genes were found significantly and consistently modulated by treatments. Nandrolone up-regulated AR, ESR2 and PGR in K562 cells, and SRD5A1, PPARA and JAK2 in Jurkat cells; IGF-I up-regulated EPOR and PGR in HL60 cells, and SRD5A1 in Jurkat; GH up-regulated SRD5A1 and GHR in K562. GATA1 expression was down-regulated in IGF-1-treated HL60, ESR2 was down-regulated in nandrolone-treated Jurkat, and AR and PGR were down-regulated in GH-treated Jurkat. This pilot study shows the potential of molecular biology-based strategies in anti-doping controls.

  13. Nuclear progesterone receptors are up-regulated by estrogens in neurons and radial glial progenitors in the brain of zebrafish.

    Directory of Open Access Journals (Sweden)

    Nicolas Diotel

    Full Text Available In rodents, there is increasing evidence that nuclear progesterone receptors are transiently expressed in many regions of the developing brain, notably outside the hypothalamus. This suggests that progesterone and/or its metabolites could be involved in functions not related to reproduction, particularly in neurodevelopment. In this context, the adult fish brain is of particular interest, as it exhibits constant growth and high neurogenic activity that is supported by radial glia progenitors. However, although synthesis of neuroprogestagens has been documented recently in the brain of zebrafish, information on the presence of progesterone receptors is very limited. In zebrafish, a single nuclear progesterone receptor (pgr has been cloned and characterized. Here, we demonstrate that this pgr is widely distributed in all regions of the zebrafish brain. Interestingly, we show that Pgr is strongly expressed in radial glial cells and more weakly in neurons. Finally, we present evidence, based on quantitative PCR and immunohistochemistry, that nuclear progesterone receptor mRNA and proteins are upregulated by estrogens in the brain of adult zebrafish. These data document for the first time the finding that radial glial cells are preferential targets for peripheral progestagens and/or neuroprogestagens. Given the crucial roles of radial glial cells in adult neurogenesis, the potential effects of progestagens on their activity and the fate of daughter cells require thorough investigation.

  14. Major Gravitational Phenomena Explained by the Micro-Quanta Paradigm

    Directory of Open Access Journals (Sweden)

    Michelini M.

    2010-01-01

    Full Text Available Some major problems of physics, which remained unsolved within classical and relativistic gravitation theories, are explained adopting the quantum gravity interaction descending from the micro-quanta paradigm. The energy source of the gravitational power $P_{gr}$, which heats and contracts the Bok's gas globules harbouring the future stars, is identified and defined as well as the gravitational power generated on the solid/fluid planets. Calculations are carried out to make the comparison between $P_{gr}$ predicted for the solar giant planets and the measured infrared radiation power $P_{int}$ coming from the interior. The case of planets with solid crust (Earth, etc. requires a particular attention due to the threat to stability produced by the thermal dilatation. An analysis is done of the Earth's planetary equilibrium which may be attained eliminating the temperature rise through the migration of hot internal magma across the crust fractured by earthquakes. The temperatures observed up to 420,000 years ago in Antartica through Vostok and Epica ice cores suggest the possibility that the Earth gravitational power $P_{gr}$ may be radiated in space through these temperature cycles (Glacial Eras. In this general frame the Earth's high seismicity and the dynamics of Plate tectonics may find their origin.

  15. Estrogen receptor, progesterone receptor, HER-2, and response to postmastectomy radiotherapy in high-risk breast cancer: the Danish Breast Cancer Cooperative Group

    DEFF Research Database (Denmark)

    Kyndi, Marianne; Sørensen, Flemming Brandt; Knudsen, Helle

    2008-01-01

    . End points were locoregional recurrence as isolated first event, distant metastases, and overall survival. For statistical analyses four subgroups were constructed from hormonal receptors (Rec). Rec+ was defined as ER+ and/or PgR+. Rec-as both ER-and PgR-. The four subgroups were Rec+/HER-2-, Rec......+/HER-2+, Rec-/HER-2-(triple negative), and Rec-/HER-2+. RESULTS: A significantly improved overall survival after PMRT was seen only among patients characterized by good prognostic markers such as hormonal receptor-positive and HER-2- patients (including the two Rec+ subtypes). No significant overall...... after PMRT were found for ER-and PgR-tumors compared with the ER+ and PgR+ tumors (P = .003 and .04, respectively), and for the triple-negative (P = .02), and the Rec-/HER-2+ subtypes (P = .003) compared with the Rec+/HER-2-subtype. CONCLUSION: Hormonal receptor status, HER-2, and the constructed...

  16. Potential of plant growth regulator and chlormequat chloride on alfalfa seed components

    International Nuclear Information System (INIS)

    Chen, J. S.; Lin, H.; Han, W.

    2016-01-01

    The use of plant growth regulators (PGRs) has opened new prospects for increased seed production in grasses and legumes, but little information is available on the effects of PGRs combination with chlormequat chloride (CCC) on alfalfa (Medicago sativa L.) seed yield components. This study was conducted to evaluate the effects of applying chlormequat chloride in combination with three PGRs (Naphthylacetic acid (NAA), gibberellic acid 3 (GA), and brassinolide (BR)) on seed yield, aboveground biomass, plant height, lodging, yield components. CCC was applied annually at the stooling stage while three PGRs were applied twice each year at the stages of flower bud formation and peak flowering. Results provides evidence that: (i) each PGR consistently increased seed yields, and the numbers of seeds per stem compared to untreated plants; (ii) CCC treatment reduced plant height and lodging, but also significantly decreased seed yield and did not affect aboveground biomass. (iii) effectiveness of CCC application depends on climatic conditions, especially in North-east China. (iiii) the optimum combination of CCC with a PGR to increase alfalfa seed production was failed to identify. (iiiii) no interactions between PGRs and CCC on seed yield were observed and neither the PGRs nor the CCC. But alfalfa seed yield could be improved by combining a PGR such as NAA. Our Results suggest that these PGRs could be used in alfalfa breeding to increase seed yield while maintaining high seed quality. (author)

  17. Peroxidase activity as a marker for estrogenicity

    International Nuclear Information System (INIS)

    Levy, J.; Liel, Y.; Glick, S.M.

    1981-01-01

    We examined the possibility that peroxidase activity might be a marker for estrogen activity in established estrogen-dependent tissues: dimethylbenz[a]anthracene (DMBA)-induced rat mammary tumours and human breast cancer. In DMBA-induced tumours undergoing regression after ovariectomy or tamoxifen treatment, tumour size decreased by 50%, estradiol receptors (ER) and progesterone receptors (PgR) decreased by 25 and 20%, respectively, but peroxidase activity paradoxically increased six- to sevenfold. In DMBA tumours stimulated by estradiol treatment or by the cessation of tamoxifen administration in intact rats, tumour size increased threefold. ER and PgR increased two- and threefold, respectively, while peroxidase activity decreased 50%. These data indicate an inverse relation between tumour growth, ER and PgR on the one hand, and peroxidase activity on the other. In the human breast cancers there was a singificant negative relation between the presence of ER and peroxidase activity. By using a calibrated Sephadex G-100 column it was shown that uterine peroxidase differs in molecular weight from the peroxidase of rat mammary tumours and that of human breast cancer. (author)

  18. Undernutrition and laterality of the corpus luteum affects gene expression in oviduct and uterus of pregnant ewes

    Directory of Open Access Journals (Sweden)

    V. de Brun

    2013-11-01

    Full Text Available The effect of undernutrition on gene expression of progesterone and oestrogen receptors (PGR and ESR1, and insulin-like growth factors 1 and 2 (IGF1 and IGF2 in the uterus and oviducts of ewes on day 5 after oestrus was investigated. The effect of the side of the uterus/oviduct regarding the ovary bearing a corpus luteum (CL (ipsi vs. contralateral was also analyzed. Fourteen oestrous synchronized ewes were fed either 1.5 (C, n=7 or 0.5 (L, n=7 times their maintenance requirements from the onset of the hormonal treatment (day -14, till slaughter on day 5 post-oestrus. Oviducts and samples of uterus were collected and their gene expression studied by real time RT-PCR. Undernourished ewes had greater PGR expression in the oviduct than control ewes, but lower expression of IGF1 in uterus and of IGF2 in oviducts. The ipsilateral oviduct presented lower expression of PGR, ESR1 and IGF2 mRNA than the contralateral one, but this did not occur in the uterus. In conclusion, there is an effect of undernutrition on gene expression that is transcript and organ dependent (uterus/oviduct. This work reports for the first time that growth factors and sex steroid receptor expression on day 5 after oestrus vary depending on the side of the CL-bearing ovary and the region of the reproductive tract.

  19. Assessment of exchange of crop in view of change climate and International Treaties.

    Science.gov (United States)

    Singh, Anil Kumar; Pedapati, Annitaa; Manibhushan

    2015-01-01

    To meet the UN millennium development goal of reducing the number of hungry people to half by 2015, there is utmost need to breed potentially high yielding varieties to match up the requirement along with corrective measures to bridge the gap between the potential yield and yield harvested by farmers. The scenario has changed from free access to limited access of plant genetic resources (PGR) and therefore, it is important to understand the issues in view of national and international agreements, intellectual property rights (IPR'S), climate change conditions and expanded scope of breeders and farmers rights for developed genotypes. For efficient management of PGR, developing countries need to understand the implications of PGR related IPR'S as stronger IPR'S in developed countries could have harmful effects by reduced exchange of genetic resources from developed countries. Keeping in view the existing realities every possible effort should be taken for enrichment of crop gene pool by introducing them from each and every corner of the globe. Keeping these facts in view this paper describes the priorities for introduction and exchange of important crop groups/crops along with some of their potential wild and weedy relatives and thrust has been given to generate awareness among the workers engaged in the breeders/crop improvement works. Information provided in this presentation can be utilized by prospective crop improvement works to plan to meet out the nationalfood security.

  20. Breast Tissue Composition and Immunophenotype and Its Relationship with Mammographic Density in Women at High Risk of Breast Cancer.

    Directory of Open Access Journals (Sweden)

    Jia-Min B Pang

    Full Text Available To investigate the cellular and immunophenotypic basis of mammographic density in women at high risk of breast cancer.Mammograms and targeted breast biopsies were accrued from 24 women at high risk of breast cancer. Mammographic density was classified into Wolfe categories and ranked by increasing density. The histological composition and immunophenotypic profile were quantified from digitized haematoxylin and eosin-stained and immunohistochemically-stained (ERα, ERβ, PgR, HER2, Ki-67, and CD31 slides and correlated to mammographic density.Increasing mammographic density was significantly correlated with increased fibrous stroma proportion (rs (22 = 0.5226, p = 0.0088 and significantly inversely associated with adipose tissue proportion (rs (22 = -0.5409, p = 0.0064. Contrary to previous reports, stromal expression of ERα was common (19/20 cases, 95%. There was significantly higher stromal PgR expression in mammographically-dense breasts (p=0.026.The proportion of stroma and fat underlies mammographic density in women at high risk of breast cancer. Increased expression of PgR in the stroma of mammographically dense breasts and frequent and unexpected presence of stromal ERα expression raises the possibility that hormone receptor expression in breast stroma may have a role in mediating the effects of exogenous hormonal therapy on mammographic density.

  1. Planar algebra of the subgroup-subfactor

    Indian Academy of Sciences (India)

    We think of R α G as the II1-factor (R ∪{ug: g ∈ G}) ⊂ L(L2(R)), where ug(ˆx) ..... define a global trace on P, where for 0± the trace for P0± ∼= C is the obvious identity .... function for strings is either a local maximum or a local minimum. ..... In order to understand how the inclusion tangles act on the subgroup-subfactor planar.

  2. Asian Dust Observed During the KORUS Air Quality Mission Creates Significant Super-Micron NO3-, NH4+, and SO42- Aerosols.

    Science.gov (United States)

    Heim, E. W.; Dibb, J. E.; Scheuer, E. M.

    2017-12-01

    The KORUS mission was a collaborative effort between the Korean Institute of Environmental Research and NASA. KORUS provided a comprehensive assessment of air quality in Korea during early 2016. The intensive sampling campaign was timed to assess local photochemistry during increasing solar insolation and biogenic emissions; after the April peak in outflow of pollution and dust from central China. Chinese outflow is well characterized by Silica-Calcium rich dust. Despite the effort to avoid the period with strongest dust outflow, Ca2+ was well represented in all bulk (particle diameters up to 4.5 micron) aerosol filter samples filter measurements and submicron measurements of NH4+, SO42, and NO3- made by AMS indicates substantial super-micron fractions of these anthropogenic ions at times during KORUS-AQ. During the dustiest samples (Ca2+ > 1.5ug/m3) we see marked increases in super-micron concentration of NH4+, SO42-, and NO3-, m = 1.113 ug/m3 , 2.621 ug/m3 , 4.413 ug/m3, with the super-micron contribution to total concentration averaging 47%, 45%, and 81% respectively. In contrast, low dust days (Ca2+ < 0.2ug/m3) the super-micron concentrations averaged 0.262 ug/m3, 0.510 ug/m3, -0.029 ug/m3, respectively and accounted for just 20%, 14%, and 8% of total mass. During the dust events, samples that have trajectories passing over industrial centers in eastern China approached equivalence balance between Ca2++ NH4+ and SO42-+NO3-. In contrast dusty samples that did not pass over these industrial centers during transport to the West Sea and Korea maintained excess cations, dominantly Ca2+. This suggests that dust can act as an important carrier of Chinese pollution to Korea when this saturated dust reaches the peninsula.

  3. On star-critical and upper size Ramsey numbers

    NARCIS (Netherlands)

    Zhang, Yanbo; Broersma, Haitze J.; Chen, Yaojun

    2016-01-01

    In this paper, we study the upper size Ramsey number u(G1,G2)u(G1,G2), defined by Erdős and Faudree, as well as the star-critical Ramsey number r∗(G1,G2)r∗(G1,G2), defined by Hook and Isaak. We define Ramsey-full graphs and size Ramsey good graphs, and perform a detailed study on these graphs. We

  4. Effect of gamma-irradiation on the natural occurence of Fusarium mycotoxins in wheat, flour and bread

    International Nuclear Information System (INIS)

    Aziz, N.H.; Attia, E.-S.A.; Farag, S.A.

    1997-01-01

    A survey was carried out to obtain data on the occurence of Fusarium mycotoxin in wheat and flour samples collected from local markets in Egypt and to study the influence of gamma-irradiation on controlling the occurrence of thesemycotoxins in wheat, flour and bread. Deoxynivalenol (DON) was detected in five samples of wheat at levels ranging from 103 to 287 ug/kg and one sample each of flour and bread concentrations 188 and 170 ug/kg. Zearaleone (ZEN) was detected in ten samples of wheat at levels from 28 to 42 ug/kg and four samples each of flour and bread at concentrations of 95 and 34 ug/kg, respectively. T-2 toxin was detected only in one sample each of wheat, flour and bread at concentrations of 2.9, 2.2, and 2.3 ug/kg, respectively. Gamma-irradiation at dose level of 6 kGy completely eliminated fungal flora in flour and wheat. DON, ZEN and T-2 toxin concentrations are reduced to 85, 20 and 2.0 ug/kg for wheat and to 125, 45, and 1.0 ug/kg for flour after 4 kGy exposure and a sharp drop in Fusarium toxin levels occured at 6 kGy and was eliminated at 8 kGy. Bread prepared from 6 kGy was contaminate4d with Fusarium toxin at levels below 5 ug/kg. It was noticed that gamme-irradiation reduce greatly the natural occurrence of Fusarium mycotoxins in bread

  5. Unigene BLAST: CBRC-DRER-15-0112 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0112 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-49 71% ...

  6. Unigene BLAST: CBRC-DRER-15-0109 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0109 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 4e-51 71% ...

  7. Unigene BLAST: CBRC-DRER-15-0107 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0107 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-59 84% ...

  8. Unigene BLAST: CBRC-DRER-15-0115 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0115 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 1e-41 67% ...

  9. Unigene BLAST: CBRC-DRER-15-0111 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0111 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 4e-48 73% ...

  10. Unigene BLAST: CBRC-DRER-15-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0105 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 9e-35 69% ...

  11. Unigene BLAST: CBRC-DRER-15-0102 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0102 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-30 54% ...

  12. Unigene BLAST: CBRC-DRER-15-0103 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0103 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 6e-32 56% ...

  13. Unigene BLAST: CBRC-DRER-15-0101 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0101 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-47 77% ...

  14. Unigene BLAST: CBRC-DRER-15-0113 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0113 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-51 73% ...

  15. Unigene BLAST: CBRC-DRER-15-0114 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0114 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 1e-38 62% ...

  16. Unigene BLAST: CBRC-DRER-15-0108 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0108 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-53 74% ...

  17. Unigene BLAST: CBRC-DRER-15-0100 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0100 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-52 75% ...

  18. Unigene BLAST: CBRC-DRER-15-0106 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0106 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-51 75% ...

  19. Unigene BLAST: CBRC-DRER-15-0110 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0110 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-71 99% ...

  20. Unigene BLAST: CBRC-DRER-15-0104 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0104 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 5e-58 79% ...

  1. Uropygial gland volatiles may code for olfactory information about sex, individual, and species in Bengalese finches Lonchura striata

    Directory of Open Access Journals (Sweden)

    Jian-Xu ZHANG et al.

    2009-10-01

    Full Text Available Over-shadowed by eye-catching vocal and visual signals, chemical communication has long been overlooked in birds. This study aimed at exploring whether volatile composition of the uropygial gland secretion (UGS of birds was associated with the information about sex, individual and species. By using dichloromethane extraction and gas chromatography-mass spectrometry (GC-MS, we analyzed the UGS volatiles of domesticated Bengalese finches (Lonchura striata, Estrildiea which is also known as white-rumped munias. We characterized 16 volatile molecules from the UGS, including eight n-alkanols, five diesters, an ester, an aldehyde and a fatty acid, and quantified them in terms of GC peak area percentages (relative abundances. Among these compounds, hexadecanol and octadecanol were major components in both sexes. The former was richer in males than females and the latter richer in females than males, suggesting that they might be male and female pheromone candidates, respectively. The high inter-individual variations, in relative abundance, of the UGS volatiles implied that they might carry information about individuality. The similarity between GC profiles of the UGS and wing feather from same individuals indicates that the birds might preen the secretion to their feathers to transmit chemical cues. Additionally, by comparing with three sympatric passerine species,i.e., zebra finches Taeniopygia guttata, yellow-bowed buntings Emberiza chrysophrys and rooks Corvus frugilegus, we found that the composition of C13-C18 alkanols in the UGS might contain information about species. Our study also show that quantitative differences (degree of same UGS volatiles might be the key for the Bengalese finch to code for information about sex and individuality whereas both the kind and degree of UGS constituents could be utilized to code for information about species [Current Zoology 55 (5:–2009].

  2. Wastewater/Storm Water Characterization and Toxicity Identification Evaluation, Sheppard Air Force Base, Texas

    Science.gov (United States)

    1991-12-01

    support the NPDES permit renewal appl ication. the studies should collect sufficient data to characterize waste streams, including wastewater and WINTP...26Apr 1 30Apr I 1May I 2May Arsenic I uiI ᝺ ᝺i ᝺  ᝺! ᝺ Barium I ug l I i  . 4001 SWot 1000 " 2600 Beryllium J ug 1 ᝺ <o 0 <o

  3. Environmental and occupational exposures to mercury among indigenous people in Dunkwa-On-Offin, a small scale gold mining area in the South-West of Ghana.

    Science.gov (United States)

    Kwaansa-Ansah, E E; Basu, N; Nriagu, J O

    2010-11-01

    Total mercury concentrations in human hair and urine samples were determined to ascertain the extent of environmental and occupational mercury exposure in Dunkwa-On-Offin, a small scale gold mining area of the central-west region of Ghana. In all ninety-four (94) hair and urine samples comprising of forty (40) small scale miners and fifty-four (54) farmers were collected and analyzed for their total mercury levels using the cold vapour atomic absorption spectrometry. The hair total mercury concentrations ranged from 0.63 to 7.19 ug/g with a mean of 2.35 ± 1.58 ug/g for the farmers and 0.57-6.07 ug/g with a mean of 2.14 ± 1.53 ug/g for the small scale gold miners. There was no significant correlation between the total mercury concentration and the average weekly fish diet. The total mercury concentrations in urine of the miners were higher than those of the farmers and ranged from 0.32 to 3.62 ug/L with a mean of 1.23 ± 0.86 ug/L. The urine concentrations of farmers ranged from 0.075 to 2.31 ug/L with a mean of 0.69 ± 0.39 ug/L. Although the results indicate elevated internal dose of mercury the current levels of exposures do not appear to pose a significant health threat to the people.

  4. Establishment of Uropygial Gland Growth Curves for White, Three-Way Crossed Mule Ducklings

    Directory of Open Access Journals (Sweden)

    YH Chen

    2015-06-01

    Full Text Available Growth curves for the uropygial gland (UG of white, 3-way crossed mule ducklings were established using the Gompertz function. In total, 144 ducklings were fed in 12 floor pens with 12 birds in each pen. Each pen contained an equal number of animals of each sex. Feed and water were supplied ad libitumthroughout the entire experimental period. The weekly change in UG weight was recorded in males and females from hatch to 8 weeks of age. The weight and length of the UG, the width of the lobus glandulae uropygialis, the length and width of the pluma of the circulus uropygialis, and the index of the papilla uropygialis were measured once a week in individual ducklings in one pen. The average UG weight gain observed in white, 3-way crossed drakes was significantly higher than that of ducks of 21-56 days of age (P< 0.05. The UG length was 1.64-2.23 times the width of the left or right lobe, and the development of the UG was delayed from 3-4 weeks of age. The morphology of the UG changed from elliptical to elongated-elliptical with age. The right and left lobus glandulae uropygialis were symmetrical. The Gompertz growth functions of the UG in drakes and ducks were W=5.49e-e-0.675(t-1.955 and W=4.76e-e-0.685(t-1.936, respectively, where t represents age in weeks. These equations indicated that the maximum growth rate for drakes occurred at 14.1 days of age and for ducks at 13.6 days of age.

  5. Unattended Ground Sensors for Expeditionary Force 21 Intelligence Collections

    Science.gov (United States)

    2015-06-01

    little impact on modern intelligence collections. This thesis analyzes and compares the units and individual Marine skillsets that employ UGS, and the...the sensor employment planning cycle, and the socialization of this plan through the proper chain-of-command [4]. Figure 8 depicts the Sensor...the use of newly developed cellphone based technologies and emerging UGS capabilities to assist in Listening Post/ Observation Post (LP/OP

  6. Unigene BLAST: CBRC-DMEL-03-0012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0012 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 0.64 34% ...

  7. Unigene BLAST: CBRC-DMEL-01-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0039 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 4e-11 25% ...

  8. Unigene BLAST: CBRC-DMEL-04-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0014 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 1e-37 49% ...

  9. Unigene BLAST: CBRC-DMEL-01-0065 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0065 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 2e-11 29% ...

  10. Unigene BLAST: CBRC-DMEL-03-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0057 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 6e-13 25% ...

  11. Unigene BLAST: CBRC-DMEL-01-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0038 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 4e-84 95% ...

  12. Unigene BLAST: CBRC-DMEL-03-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0039 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 7e-31 40% ...

  13. Unigene BLAST: CBRC-DMEL-02-0074 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0074 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 4e-09 28% ...

  14. Unigene BLAST: CBRC-DMEL-01-0066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0066 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 3e-14 34% ...

  15. Unigene BLAST: CBRC-DMEL-02-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0056 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-11 26% ...

  16. Unigene BLAST: CBRC-DMEL-06-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-06-0041 gnl|UG|Dm#S40592667 DMG1A.1_1.E02.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.6.106.a, mRNA sequence /clone=DMG1-chr2L.6.106.a /gb=EW712706 /gi=156141512 /ug=Dm.26303 /len=1270 0.17 28% ...

  17. Unigene BLAST: CBRC-DMEL-08-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-08-0015 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 4e-07 35% ...

  18. Unigene BLAST: CBRC-DMEL-03-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0045 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 1e-23 38% ...

  19. Unigene BLAST: CBRC-DMEL-02-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0034 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 8e-12 25% ...

  20. Unigene BLAST: CBRC-DMEL-04-0013 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0013 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 7e-29 43% ...

  1. Unigene BLAST: CBRC-DMEL-08-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-08-0038 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 6e-10 32% ...

  2. Unigene BLAST: CBRC-DMEL-08-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-08-0039 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 4e-07 39% ...

  3. Unigene BLAST: CBRC-DMEL-04-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0037 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-04 26% ...

  4. Unigene BLAST: CBRC-DMEL-04-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0005 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-06 20% ...

  5. Unigene BLAST: CBRC-DMEL-03-0071 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0071 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 3e-07 47% ...

  6. Unigene BLAST: CBRC-DMEL-02-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0008 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 3e-12 22% ...

  7. Unigene BLAST: CBRC-DMEL-08-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-08-0057 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 2e-06 22% ...

  8. Unigene BLAST: CBRC-DMEL-02-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0075 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 4e-66 93% ...

  9. Unigene BLAST: CBRC-DMEL-02-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0037 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-12 26% ...

  10. Unigene BLAST: CBRC-DMEL-04-0058 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0058 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 9e-26 32% ...

  11. Unigene BLAST: CBRC-DMEL-02-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0018 gnl|UG|Dm#S40592688 DMG1A.1_1.C09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3L.19.066.a, mRNA sequence /clone=DMG1-chr3L.19.066.a /gb=EW712727 /gi=156141533 /ug=Dm.35847 /len=1518 1.4 35% ...

  12. Unigene BLAST: CBRC-DMEL-04-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0021 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-16 32% ...

  13. Unigene BLAST: CBRC-DMEL-01-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0040 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 2e-05 30% ...

  14. Unigene BLAST: CBRC-DMEL-04-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0006 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 0.048 17% ...

  15. Unigene BLAST: CBRC-DMEL-01-0067 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0067 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 2e-10 31% ...

  16. Unigene BLAST: CBRC-DMEL-04-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0010 gnl|UG|Dm#S40593089 DMG1C.2_1.B05.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3L.17.035.a, mRNA sequence /clone=DMG1-chr3L.17.035.a /gb=EW713128 /gi=156142082 /ug=Dm.15247 /len=1404 1.8 29% ...

  17. Unigene BLAST: CBRC-DMEL-04-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0015 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 9e-82 98% ...

  18. Enhanced technologies for unattended ground sensor systems

    Science.gov (United States)

    Hartup, David C.

    2010-04-01

    Progress in several technical areas is being leveraged to advantage in Unattended Ground Sensor (UGS) systems. This paper discusses advanced technologies that are appropriate for use in UGS systems. While some technologies provide evolutionary improvements, other technologies result in revolutionary performance advancements for UGS systems. Some specific technologies discussed include wireless cameras and viewers, commercial PDA-based system programmers and monitors, new materials and techniques for packaging improvements, low power cueing sensor radios, advanced long-haul terrestrial and SATCOM radios, and networked communications. Other technologies covered include advanced target detection algorithms, high pixel count cameras for license plate and facial recognition, small cameras that provide large stand-off distances, video transmissions of target activity instead of still images, sensor fusion algorithms, and control center hardware. The impact of each technology on the overall UGS system architecture is discussed, along with the advantages provided to UGS system users. Areas of analysis include required camera parameters as a function of stand-off distance for license plate and facial recognition applications, power consumption for wireless cameras and viewers, sensor fusion communication requirements, and requirements to practically implement video transmission through UGS systems. Examples of devices that have already been fielded using technology from several of these areas are given.

  19. Azobenzene dye-coupled quadruply hydrogen-bonding modules as colorimetric indicators for supramolecular interactions

    Directory of Open Access Journals (Sweden)

    Yagang Zhang

    2012-04-01

    Full Text Available The facile coupling of azobenzene dyes to the quadruply hydrogen-bonding modules 2,7-diamido-1,8-naphthyridine (DAN and 7-deazaguanine urea (DeUG is described. The coupling of azobenzene dye 2 to mono-amido DAN units 4, 7, and 9 was effected by classic 4-(dimethylaminopyridine (DMAP-catalyzed peptide synthesis with N-(3-dimethylaminopropyl-N’-ethyl carbodiimide hydrochloride (EDC as activating agent, affording the respective amide products 5, 8, and 10 in 60–71% yield. The amide linkage was formed through either the aliphatic or aromatic ester group of 2, allowing both the flexibility and absorption maximum to be tuned. Azobenzene dye 1 was coupled to the DeUG unit 11 by Steglich esterification to afford the product amide 12 in 35% yield. Alternatively, azobenzene dye 16 underwent a room-temperature copper-catalyzed azide–alkyne Huisgen cycloaddition with DeUG alkyne 17 to give triazole 18 in 71% yield. Azobenzene coupled DAN modules 5, 8, and 10 are bright orange–red in color, and azobenzene coupled DeUG modules 12 and 18 are orange–yellow in color. Azobenzene coupled DAN and DeUG modules were successfully used as colorimetric indicators for specific DAN–DeUG and DAN–UPy (2-ureido-4(1H-pyrimidone quadruply hydrogen-bonding interactions.

  20. List of Participants

    Science.gov (United States)

    2011-08-01

    Abigail Alvarez OlarteCINVESTAV Alba Leticia Carrillo MonteverdeDCI-UG Alberto CarramiñanaINAOE Aldo MorselliFERMI Alejandro CastillaDCI-UG Alejandro IbarraTechnical University of Munich Alma D Rojas PachecoFCFM-BUAP Alma Xochitl Gonzalez MoralesInstituto de Ciencias Nucleares, UNAM Andrew Walcott BeckwithAmerican Institute of Beam Energy Physics Ariadna Montiel ArenasDepartamento de Física, CINVESTAV Arnulfo ZepedaCinvestav Arturo Alvarez CruzInstituto de Fisica, UNAM Axel de la MacorraUNAM, IAC Azar MustafayevUniversity of Minnesota Benjamin JaramilloDCI-UG Vincent BertinCPPM-Marseille Carlos Alberto Vaquera-AraujoDCI-UG Carlos MuñozMadrid Autonoma U. & Madrid, IFT Carmine PagliaroneINFN, FNAL Carolina Lujan PeschardDCI-UG Christiane Frigerio MartinsUniversidade Federal do ABC-São Paulo Csaba BalazsMonash University David DelepineDCI-UG David G CerdenoUniversidad Autonoma de Madrid & Instituto de Fisica Teorica Debasish MajumdarSaha Institute of Nuclear Physics, Kolkata, India Dibyendu PanigrahiKandi Raj College, Kandi, Murshidabad, INDIA-742137 Dupret Alberto Santana BejaranoUniversidad de Sonora Departamento de Investigacion en Fisica Ernest MaRiverside U.C. Esteban Alejandro Reyes Pírez MontañezInstituto de Física, UNAM Federico Ortiz TrejoINSTITUTO DE ASTRONOMÍA - UNAM Francisco José de Anda NavarroUniversidad de Guadalajara González Alvarez Francisco JavierCINVESTAV-Depto. Física Gustavo Medina TancoICN-UNAM Hernando Efrain Caicedo OrtizInstituto Politecnico Nacional - IPN J D VergadosCERN & Ioannina U. James R BoyceJefferson Lab Jason SteffenFERMILAB Javier Montaño DomínguezDCI-UG Jeevan SolankiMandsaur Institue of Technology MP India Joe SatoSaitama University Jorge Luis Navarro EstradaUNAM-ICN and Universidad del Atlantico (B/quilla-Col.) Jose A R CembranosUniversity of Minnesota José DíazIFIC Jose Didino Garcia AguilarDepto. de Fisica. Cinvestav Keith OliveUniversity of Minnesota Konstantia BalasiUniversity of Ioannina, Greece Lilian Prado

  1. ANTIBACTERIAL PROPERTIES OF PHARMACEUTICAL COMPOSITION OF HEPATOPROTECTORS

    Directory of Open Access Journals (Sweden)

    Aslanian MA

    2016-12-01

    Full Text Available Pathology problemof hepatobiliary system (HBS of contagious origin becomes relevant with the increase of disturbance and complications of lipid metabolism and bile pigments among young people. Leading role in prophylaxis and treatment in the context of this pathology belongs to antibacterialc hemotherapeutic agents. However, along with antimicrobial activity, numerous side effects can be observed during treatment with antibacterial agents. According to the recent study on hepatobiliary system (HBS, therapeutic effect can be seen only while using herbal medicine with choleretic action as well as their various compositions.Amountof medicine with the appropriate effect is insufficient, that is why the study was conducted towards finding effective combinations of plant substances of different groups for the purpose of creatingan effective medicine for treatment of hepatobiliary system (HBS of contagious origin. Aim of the work The purpose of study was to examine antibacterial properties of different combinations with flamin and lavender oil in combined medicine during the course of treatment of cholecystitis and cholangitis. Materials and methods. It the result of study 61 microbial strains were distinguished and identified from the pathological material taken from 53 patients with cholecystitis and cholangitis. All distinguished clinical microbial strains taken from the patients were tested for sensitivity to combined medicine in the form of tablets with flamin and lavender oil. Minimal inhibitory concentration for S. aureus АТСС 25923 amounted to 250-350 ug/ml, for E. coli АТСС 25922 - 350±50,0 ug/ml, for P. aeruginosa АТСС 27853 750±100,0 ug/ml, for Р. vulgaris АТСС 4636 - 850±100,0 ug/ml, minimal inhibitory concentration to the tablets № 2 та № 3 amounted to > 1000 мкг/мл. Minimal inhibitory concentration for B. subtilis АТСС 6633 amounted to 250±50,0 ug/ml, for C. albicans ATCC 885/653 300±50,0 ug

  2. Ku-mediated coupling of DNA cleavage and repair during programmed genome rearrangements in the ciliate Paramecium tetraurelia.

    Directory of Open Access Journals (Sweden)

    Antoine Marmignon

    2014-08-01

    Full Text Available During somatic differentiation, physiological DNA double-strand breaks (DSB can drive programmed genome rearrangements (PGR, during which DSB repair pathways are mobilized to safeguard genome integrity. Because of their unique nuclear dimorphism, ciliates are powerful unicellular eukaryotic models to study the mechanisms involved in PGR. At each sexual cycle, the germline nucleus is transmitted to the progeny, but the somatic nucleus, essential for gene expression, is destroyed and a new somatic nucleus differentiates from a copy of the germline nucleus. In Paramecium tetraurelia, the development of the somatic nucleus involves massive PGR, including the precise elimination of at least 45,000 germline sequences (Internal Eliminated Sequences, IES. IES excision proceeds through a cut-and-close mechanism: a domesticated transposase, PiggyMac, is essential for DNA cleavage, and DSB repair at excision sites involves the Ligase IV, a specific component of the non-homologous end-joining (NHEJ pathway. At the genome-wide level, a huge number of programmed DSBs must be repaired during this process to allow the assembly of functional somatic chromosomes. To understand how DNA cleavage and DSB repair are coordinated during PGR, we have focused on Ku, the earliest actor of NHEJ-mediated repair. Two Ku70 and three Ku80 paralogs are encoded in the genome of P. tetraurelia: Ku70a and Ku80c are produced during sexual processes and localize specifically in the developing new somatic nucleus. Using RNA interference, we show that the development-specific Ku70/Ku80c heterodimer is essential for the recovery of a functional somatic nucleus. Strikingly, at the molecular level, PiggyMac-dependent DNA cleavage is abolished at IES boundaries in cells depleted for Ku80c, resulting in IES retention in the somatic genome. PiggyMac and Ku70a/Ku80c co-purify as a complex when overproduced in a heterologous system. We conclude that Ku has been integrated in the Paramecium

  3. Sorption of cesium in intact rock

    International Nuclear Information System (INIS)

    Puukko, E.

    2014-04-01

    The mass distribution coefficient K d is used in performance assessment (PA) to describe sorption of a radionuclide on rock. The R d is determined using crushed rock which causes uncertainty in converting the R d values to K d values for intact rock. This work describes a method to determine the equilibrium of sorption on intact rock. The rock types of the planned Olkiluoto waste disposal site were T-series mica gneiss (T-MGN), T-series tonalite granodiorite granite gneiss (T-TGG), P-series tonalite granodiorite granite gneiss (P-TGG) and pegmatitic granite (PGR). These rocks contain different amount of biotite which is the main sorbing mineral. The sorption of cesium on intact rock slices was studied by applying an electrical field to speed up migration of cesium into the rock. Cesium is in the solution as a noncomplex cation Cs + and it is sorbed by ion exchange. The tracer used in the experiments was 134 Cs. The experimental sorption on the intact rock is compared with values calculated using the in house cation exchange sorption model (HYRL model) in PHREEQC program. The observed sorption on T-MGN and T-TGG rocks was close to the calculated values. Two PGR samples were from a depth of 70 m and three samples were from a depth of 150 m. Cesium sorbed more than predicted on the two 70 m PGR samples. The sorption of Cs on the three 150 m PGR samples was small which was consistent with the calculations. The pegmatitic granite PGR has the smallest content of biotite of the four rock types. In the case of P-TGG rock the observed values of sorption were only half of the calculated values. Two kind of slices were cut from P-TGG drill core. The slices were against and to the direction of the foliation of the biotite rims. The sorption of cesium on P-TGG rock was same in both cases. The results indicated that there was no effect of the directions of the electric field and the foliation of biotite in the P-TGG rock. (orig.)

  4. Transition from blastomere to trophectoderm biopsy: comparing two preimplantation genetic testing for aneuploidies strategies.

    Science.gov (United States)

    Coll, Lluc; Parriego, Mònica; Boada, Montserrat; Devesa, Marta; Arroyo, Gemma; Rodríguez, Ignacio; Coroleu, Bonaventura; Vidal, Francesca; Veiga, Anna

    2018-05-25

    SummaryShortly after the implementation of comprehensive chromosome screening (CCS) techniques for preimplantation genetic testing for aneuploidies (PGT-A), the discussion about the transition from day 3 to blastocyst stage biopsy was initiated. Trophectoderm biopsy with CCS is meant to overcome the limitations of cleavage-stage biopsy and single-cell analysis. The aim of this study was to assess the results obtained in our PGT-A programme after the implementation of this new strategy. Comparisons between the results obtained in 179 PGT-A cycles with day 3 biopsy (D+3) and fresh embryo transfer, and 204 cycles with trophectoderm biopsy and deferred (frozen-thawed) embryo transfer were established. Fewer embryos were biopsied and a higher euploidy rate was observed in the trophectoderm biopsy group. No differences in implantation (50.3% vs. 61.4%) and clinical pregnancy rate per transfer (56.1% vs. 65.3%) were found. Although the mean number of euploid embryos per cycle did not differ between groups (1.5 ± 1.7 vs. 1.7 ± 1.8), the final number of euploid blastocysts available for transfer per cycle was significantly higher in the trophectoderm biopsy group (1.1 ± 1.3 vs. 1.7 ± 1.8). This factor led to an increased cumulative live birth rate in this last group (34.1% vs. 44.6%). Although both strategies can offer good results, trophectoderm biopsy offers a more robust diagnosis and the intervention is less harmful for the embryos so more euploid blastocysts are finally available for transfer and/or vitrification.

  5. Intracrine prostaglandin E2 pro-tumoral actions in prostate epithelial cells originate from non-canonical pathways.

    Science.gov (United States)

    Madrigal-Martínez, Antonio; Fernández-Martínez, Ana B; Lucio Cazaña, Francisco J

    2018-04-01

    Prostaglandin E 2 (PGE 2 ) increases cell proliferation and stimulates migratory and angiogenic abilities in prostate cancer cells. However, the effects of PGE 2 on non-transformed prostate epithelial cells are unknown, despite the fact that PGE 2 overproduction has been found in benign hyperplastic prostates. In the present work we studied the effects of PGE 2 in immortalized, non-malignant prostate epithelial RWPE-1 cells and found that PGE 2 increased cell proliferation, cell migration, and production of vascular endothelial growth factor-A, and activated in vitro angiogenesis. These actions involved a non-canonic intracrine mechanism in which the actual effector was intracellular PGE 2 (iPGE 2 ) instead of extracellular PGE 2 : inhibition of the prostaglandin uptake transporter (PGT) or antagonism of EP receptors prevented the effects of PGE 2 , which indicated that PGE 2 activity depended on its carrier-mediated translocation from the outside to the inside of cells and that EP receptors located intracellularly (iEP) mediated the effects of PGE 2 . iPGE 2 acted through transactivation of epidermal growth factor-receptor (EGFR) by iEP, leading to increased expression and activity of hypoxia-inducible factor-1α (HIF-1α). Interestingly, iPGE 2 also mediates the effects of PGE 2 on prostate cancer PC3 cells through the axis iPGE 2 -iEP receptors-EGFR-HIF-1α. Thus, this axis might be responsible for the growth-stimulating effects of PGE 2 on prostate epithelial cells, thereby contributing to prostate proliferative diseases associated with chronic inflammation. Since this PGT-dependent non-canonic intracrine mechanism of PGE 2 action operates in both benign and malignant prostate epithelial cells, PGT inhibitors should be tested as a novel therapeutic modality to treat prostate proliferative disease. © 2017 Wiley Periodicals, Inc.

  6. U-Pb ages for two tonalitic gneisses, pegmatitic granites, and K-feldspar porphyries, Olkiluoto study site, Eurajoki, SW Finland

    International Nuclear Information System (INIS)

    Maenttaeri, I.; Lindberg, A.; Aaltonen, I.

    2007-08-01

    Secondary ion microprobe zircon U-Pb ages have been determined for two tonalitic gneisses, two pegmatitic granites, and two potassium feldspar porphyry samples from the Olkiluoto study site, Eurajoki, S-W Finland. Moreover, monazites from the Kfeldspar porphyries were dated using TIMS U-Pb method. The tonalitic gneiss A1879 TTG 1 reveals bimodal zircon population and for A1880 TTG it is homogeneous. The samples yield similar overlapping concordia ages of 1851 ± 5 Ma and 1856 ± 5 Ma, respectively. The pegmatitic granite samples A1881 PGR 1 and A1883 PGR 2 have mostly zircons resembling those of the TTG's. The supposed pegmatitic zircons with high U and low Th are strongly altered. The zircon U-Pb data of A1881 PGR 1 plot roughly in two separate lines on a concordia diagram. The apparently younger ∼1.79 Ga data are all from the high U and low Th/U zircons and therefore certainly set the minimum age for the A1881 PGR 1. It is suggested, that the ∼1.85 Ga data comprise analyses from inherited zircons as it include both lower and higher Th/U zircons and 1.85 Ga coevals with age of the tonalitic gneisses. Thus, the apparent age for the A1881 PGR 1 is ∼1.79 Ga. The U-Pb data of sample A1883 PGR 2 also divide into two groups. The higher Th/U, inherited zircons determine an age of 1852 ± 9 Ma which is the same as that of the TTG's. The low Th/U zircon data scatter and the age of 1.83 Ga for A1883 PGR 2 is only poorly determined. The both potassium feldspar porphyry samples A1882 KFP 1 and A1884 KFP 2 reveal heterogeneous zircon populations. The A1882 KFP 1 zircons showing magmatic zoning in BSE images conceivably determine a concordia age of 1842± 6 Ma for the rock. In addition to that a few ∼1.9 Ga inherited zircon and metamorphic low Th/U rims with ages between 1.88 Ga and 1.83 Ga were detected. The age for the youngest metamorphic zircon rims overlaps with that of the magmatic zircons. The zircons in the other KFP sample A1884 show a wide range of ages

  7. Expansion program is a challenging project

    International Nuclear Information System (INIS)

    Walker, G.L.

    1992-01-01

    This paper reports that construction is set to begin on the $1.5 billion PGT-PG and E Pipeline Expansion Project. It will consist of 691 miles of 42-in pipeline and 110 miles of 36-in. pipeline, to be built over 2 years. The project, which will transport additional supplies of natural gas to US West Coast markets, has its US regulatory approval in hand. On Oct. 16, 1991, the Federal Energy Regulatory Commission authorized Pacific Gas Transmission Co. to construct its Pacific Northwest segment of the expansion. Pacific Gas and Electric Co. received approval to build its California segment in late 1990 from the California Public Utilities Commission

  8. Direct-to-consumer advertising of predictive genetic tests: a health belief model based examination of consumer response.

    Science.gov (United States)

    Rollins, Brent L; Ramakrishnan, Shravanan; Perri, Matthew

    2014-01-01

    Direct-to-consumer (DTC) advertising of predictive genetic tests (PGTs) has added a new dimension to health advertising. This study used an online survey based on the health belief model framework to examine and more fully understand consumers' responses and behavioral intentions in response to a PGT DTC advertisement. Overall, consumers reported moderate intentions to talk with their doctor and seek more information about PGTs after advertisement exposure, though consumers did not seem ready to take the advertised test or engage in active information search. Those who perceived greater threat from the disease, however, had significantly greater behavioral intentions and information search behavior.

  9. SU-F-I-38: Patient Organ Specific Dose Assessment in Coronary CT Angiograph Using Voxellaized Volume Dose Index in Monte Carlo Simulation

    Energy Technology Data Exchange (ETDEWEB)

    Fallal, Mohammadi Gh.; Riyahi, Alam N.; Graily, Gh. [Tehran University of Medical Scienced(TUMS), School of Medicine, Department of Nedical Physics and Biomedical Engineering, Tehran (Iran, Islamic Republic of); Paydar, R. [Iran University of Medical Sciences(IUMS), Allied Medicine Faculty, Department of radiation Sciences, Tehran (Iran, Islamic Republic of)

    2016-06-15

    Purpose: Clinical use of multi detector computed tomography(MDCT) in diagnosis of diseases due to high speed in data acquisition and high spatial resolution is significantly increased. Regarding to the high radiation dose in CT and necessity of patient specific radiation risk assessment, the adoption of new method in the calculation of organ dose is completely required and necessary. In this study by introducing a conversion factor, patient organ dose in thorax region based on CT image data using MC system was calculated. Methods: The geometry of x-ray tube, inherent filter, bow tie filter and collimator were designed using EGSnrc/BEAMnrc MC-system component modules according to GE-Light-speed 64-slices CT-scanner geometry. CT-scan image of patient thorax as a specific phantom was voxellised with 6.25mm3 in voxel and 64×64×20 matrix size. Dose to thorax organ include esophagus, lung, heart, breast, ribs, muscle, spine, spinal cord with imaging technical condition of prospectively-gated-coronary CT-Angiography(PGT) as a step and shoot method, were calculated. Irradiation of patient specific phantom was performed using a dedicated MC-code as DOSXYZnrc with PGT-irradiation model. The ratio of organ dose value calculated in MC-method to the volume CT dose index(CTDIvol) reported by CT-scanner machine according to PGT radiation technique has been introduced as conversion factor. Results: In PGT method, CTDIvol was 10.6mGy and Organ Dose/CTDIvol conversion factor for esophagus, lung, heart, breast, ribs, muscle, spine and spinal cord were obtained as; 0.96, 1.46, 1.2, 3.28. 6.68. 1.35, 3.41 and 0.93 respectively. Conclusion: The results showed while, underestimation of patient dose was found in dose calculation based on CTDIvol, also dose to breast is higher than the other studies. Therefore, the method in this study can be used to provide the actual patient organ dose in CT imaging based on CTDIvol in order to calculation of real effective dose(ED) based on organ dose

  10. Use of a simplified spectrophotometric method for quantitative determination of glucose-6-phosphate dehydrogenase activity in normal children from two day-care centers of the city of São Paulo

    Directory of Open Access Journals (Sweden)

    Roberto Muller

    2003-06-01

    Full Text Available Objective: To evaluate the applicability of a simplified method forquantitative determination of glucose-6-phosphate dehydrogenaseactivity in normal children; to determine the mean, standarddeviation and threshold value under which the enzyme activity isconsidered deficient. Methods: Blood samples were collected from201 children from two day-care centers in the city of São Paulo.The subjects were considered normal based on physicalexamination and laboratory tests. The enzyme activity wasdetermined in red blood cells of normal children using the “TestCombination G-6-PDH®” kit. The following statistical analyses werecarried out: the results were submitted to Student’s t test,Kolmogorov-Smirnov test, lower confidence interval (one-tailedtest and Spearman’s correlation coefficient. Results: The meanhemoglobin value for girls was slightly higher than the mean valuefor boys, but this difference was not statistically significant. Therewas no statistical difference in mean enzyme activities for Caucasianand non-Caucasian children. There was no significant correlation amongenzyme activity levels, red blood cells, hemoglobin levels,hematocrit, reticulocytes, white blood cells and age of patients.The mean enzyme activity for boys was 4.448 U/g Hb, standarddeviation = 1.380 U/g Hb. For girls, the mean enzyme activity was4.531 U/g Hb, standard deviation = 1.386 U/g Hb, and the differencewas not statistically significant. Therefore, the two populationgroups were considered as one single population, presenting amean enzyme activity of 4.490 U/g Hb, standard deviation = 1.380 U/g Hb.Since the distribution curve of enzyme activity values was normal,a lower confidence interval was determined (one-tailed test, witha cutoff point of 2.227 U/g Hb. Conclusion: The method used bySolem proved to be simple, fast, very accurate and useful to detectglucose-6-phosphate dehydrogenase activity and to identifychildren with enzyme deficiency.

  11. Enhancement Nisin Activity By Some Natural Additives

    International Nuclear Information System (INIS)

    Hussien, H.A.; El-Fouly, M.E.; Zayed, M.N.; Harroun, M.B.

    2010-01-01

    Nisin showed great inhibition of gram positive bacteria while it had no effect on gram negative bacteria or yeast.It is clear from the present study that 250ug/ml of nisin was lethal for S .aureus but this dose decreased to 25 ug/ml when combined with 0.05% of citric acid or 0.1% of lactic acid or 0.4% of cinnamon. Although nisin had no effect on P. aeruginosa but when 200ug/ml of nisin combined with 0.2% of citric acid or 0.1% of lactic acid or 2% of cinnamon P. aeruginosa completely inhibited.In the same manner 200ug/ml of nisin was sufficient to inhibit Debaryomyces sp. growth when combined by 3% of citric or 3.5% of lactic or 2% of cinnamon. On the other hand, 25 μg/ml of nisin reduced the following lethal concentrations of S .aureus from0.2% to 0.05%, 0.15% to 0.1% and from 1.2% to 0.4% for citric acid, lactic acid and cinnamon, respectively. While. 200 ug/ml of nisin decreased the following lethal concentrations of P. aeruginosa from 0.3% to 0.2%, 0.3% to 0.1% and from 4% to 2% for citric acid, lactic acid and cinnamon, respectively. Two hundred ug/ml of nisin decreased lethal concentrations of Debaryomyces sp. from4% to 3%, 4.5% to 3.5% for citric acid and lactic acid, respectively. Two hundred ug/ml of nisin did not reduce cinnamon lethal dose.

  12. Ultrasonic destruction of albumin microbubbles enhances gene transfection and expression in cardiac myocytes.

    Science.gov (United States)

    Wang, Guo-zhong; Liu, Jing-hua; Lü, Shu-zheng; Lü, Yun; Guo, Cheng-jun; Zhao, Dong-hui; Fang, Dong-ping; He, Dong-fang; Zhou, Yuan; Ge, Chang-jiang

    2011-05-01

    It has been proven that ultrasonic destruction of microbubbles can enhance gene transfection efficiency into the noncardiac cells, but there are few reports about cardiac myocytes. Moreover, the exact mechanisms are not yet clear; whether the characteristic of microbubbles can affect the gene transfection efficiency or not is still controversial. This study was designed to investigate whether the ultrasound destruction of gene-loaded microbubbles could enhance the plasmids carried reporter gene transfection in primary cultured myocardial cell, and evaluate the effects of microbubbles characteristics on the transgene expression in cardiac myocytes. The β-galactosidase plasmids attached to the two types of microbubbles, air-contained sonicated dextrose albumin (ASDA) and perfluoropropane-exposed sonicated dextrose albumin (PESDA) were prepared. The gene transfection into cardiac myocytes was performed in vitro by naked plasmids, ultrasound exposure, ultrasonic destruction of gene-loaded microbubbles and calcium phosphate precipitation, and then the gene expression and cell viability were analyzed. The ultrasonic destruction of gene-loaded microbubbles enhanced gene expression in cardiac myocytes compared with naked plasmid transfection ((51.95 ± 2.41) U/g or (29.28 ± 3.65) U/g vs. (0.84 ± 0.21) U/g, P ASDA ((51.95 ± 2.41) U/g vs. (29.28 ± 3.65) U/g, P < 0.05). Ultrasonic destruction of microbubbles during calcium phosphate precipitation gene transfection enhanced β-galactosidase activity nearly 8-fold compared with calcium phosphate precipitation gene transfection alone ((111.35 ± 11.21) U/g protein vs. (14.13 ± 2.58) U/g protein, P < 0.01). Even 6 hours after calcium phosphate precipitation gene transfection, ultrasound-mediated microbubbles destruction resulted in more intense gene expression ((35.63 ± 7.65) U/g vs. (14.13 ± 2.58) U/g, P < 0.05). Ultrasonic destruction of microbubbles might be a promising method for the delivery of non-viral DNA into

  13. Efecto de un extracto hidroalcohólico de Uncaria tomentosa (uña de gato sobre la población de células dendríticas y sus moléculas hla-dr y cd86 ante el estímulo con lipopolisacáridos

    Directory of Open Access Journals (Sweden)

    Iván Lozada-Requena

    2009-04-01

    Full Text Available Objetivo. Determinar el efecto de un extracto hidroalcohólico de uña de gato, Uncaria tomentosa (UG sobre células dendríticas (DC de sangre periférica y la expresión de HLA-DR y CD86 en muestras de sangre periférica de individuos sanos tratadas con lipopolisacáridos (LPS. Materiales y métodos. El polvo de la corteza de UG se preparó como una decocción estéril a 30g/L por 30 minutos. Se obtuvo muestras de sangre periférica de individuos sanos. Las células mononucleares de sangre periférica (CMSP fueron separadas por gradiente de centrifugación, pretratadas o no durante dos horas con distintas concentraciones de UG y estimuladas 24 h con LPS, luego fueron marcadas con anticuerpos monoclonales fluorescentes específicos para HLA-DR, Linaje tipo 1 (Lin1, CD11c y CD86 y preparadas para la citometría de flujo. Resultados. Comparando con el grupo de CMSP con LPS pero sin UG se observó, de manera dosis dependiente, una disminución en el porcentaje de DC mieloides (DCm (p<0,05 y una tendencia a incrementar el porcentaje de DC plasmacitoides (DCp. En las DCp se observó una disminución de la intensidad de fluorescencia media (IFM de HLA-DR sólo a 500 y 1000 μg/mL de UG (p<0,001; mientras que hubo un incremento de la IFM de CD86 en todo el rango (p<0,05. En DCm a las mismas concentraciones no se observó efecto de UG sobre la IFM de HLA-DR y CD86. Conclusiones. Este extracto estandarizado de UG tiende a incrementar el porcentaje de DCp y disminuye el porcentaje de DCm. UG no afecta la expresión de HLA-DR y CD86 en DCm. Este estudio demuestra que este extracto de UG favorece la activación/diferenciación de DCp, la cual participa en mecanismos de respuesta inmune adaptativa.

  14. Laparoscopic-assisted vaginal pull-through: A new approach for congenital adrenal hyperplasia patients with high urogenital sinus

    Directory of Open Access Journals (Sweden)

    Jacques Birraux

    2015-01-01

    Full Text Available Background: To open vaginal cavity to the pelvic floor is part of surgical treatment for urogenital sinus (UGS in girls with congenital adrenal hyperplasia (CAH. For high UGS, this operative procedure can be challenging and may jeopardise urinary continence. Combined perineal and laparoscopic approaches could be useful to minimise perineal dissection and to facilitate the vaginal lowering. Patients and Methods: We report the procedure of a laparoscopic-assisted vaginal pull-through for supra-sphincteric UGS in a 5-year-old girl with CAH. Laparoscopic dissection of the vagina from the posterior wall of the bladder and urethra, division of the confluence and vaginal pull-through to the perineum are described. Discussion: The technique is derived from laparoscopic-assisted treatment for high ano-rectal malformations. Compared with current procedures for treatment for high UGS, laparoscopic-assisted approach allows mobilising vagina with minimal dissection of perineum and complete preservation of urethra. Another major advantage is to provide a direct vision for dissection of the space between rectum and urethra prior to vaginal pull-through. Conclusion: Laparoscopic-assisted vaginal pull-through appears to be an interesting approach for high UGS in CAH patients, reducing dissection and risk of urinary incontinence. This new approach needs to be strengthened by other cases.

  15. A low-noise MEMS accelerometer for unattended ground sensor applications

    Science.gov (United States)

    Speller, Kevin E.; Yu, Duli

    2004-09-01

    A low-noise micro-machined servo accelerometer has been developed for use in Unattended Ground Sensors (UGS). Compared to conventional coil-and-magnet based velocity transducers, this Micro-Electro-Mechanical System (MEMS) accelerometer offers several key benefits for battlefield monitoring. Many UGS require a compass to determine deployment orientation with respect to magnetic North. This orientation information is critical for determining the bearing of incoming signals. Conventional sensors with sensing technology based on a permanent magnet can cause interference with a compass when used in close proximity. This problem is solved with a MEMS accelerometer which does not require any magnetic materials. Frequency information below 10 Hz is valuable for identification of signal sources. Conventional seismometers used in UGS are typically limited in frequency response from 20 to 200 Hz. The MEMS accelerometer has a flat frequency response from DC to 5 kHz. The wider spectrum of signals received improves detection, classification and monitoring on the battlefield. The DC-coupled output of the MEMS accelerometer also has the added benefit of providing tilt orientation data for the deployed UGS. Other performance parameters of the MEMS accelerometer that are important to UGS such as size, weight, shock survivability, phase response, distortion, and cross-axis rejection will be discussed. Additionally, field test data from human footsteps recorded with the MEMS accelerometer will be presented.

  16. Cooperative Behavior in the Ultimatum Game and Prisoner’s Dilemma Depends on Players’ Contributions

    Directory of Open Access Journals (Sweden)

    Amy R. Bland

    2017-06-01

    Full Text Available Economic games such as the Ultimatum Game (UG and Prisoner’s Dilemma (PD are widely used paradigms for studying fairness and cooperation. Monetary versions of these games involve two players splitting an arbitrary sum of money. In real life, however, people’s propensity to engage in cooperative behavior depends on their effort and contribution; factors that are well known to affect perceptions of fairness. We therefore sought to explore the impact of relative monetary contributions by players in the UG and PD. Adapted computerized UG and PD games, in which relative contributions from each player were manipulated, were administered to 200 participants aged 18–50 years old (50% female. We found that players’ contribution had large effects on cooperative behavior. Specifically, cooperation was greater amongst participants when their opponent had contributed more to joint earnings. This was manifested as higher acceptance rates and higher offers in the UG; and fewer defects in the PD compared to when the participant contributed more. Interestingly, equal contributions elicited the greatest sensitivity to fairness in the UG, and least frequent defection in the PD. Acceptance rates correlated positively with anxiety and sex differences were found in defection behavior. This study highlights the feasibility of computerized games to assess cooperative behavior and the importance of considering cooperation within the context of effortful contribution.

  17. [Frequency and in vitro susceptibility antiparasitic of Blastocystis hominis from patients admitted to the Hospital Regional Lambayeque, Peru].

    Science.gov (United States)

    Silva-Díaz, Heber; Flores-Esqueche, Lorena; Llatas-Cancino, Dunalia; Guevara Vásquez, Génesis; Silva-García, Teresa

    2016-01-01

    To describe the frequency and antiparasitic in vitro susceptibility of Blastocystis hominis in patients admitted to theHospital Regional Lambayeque, Peru. A cross-sectional study was conducted from January to August 2015 at 313 patients of all ages. B. hominis detection was performed on serial fecal samples by direct microscopic examination and microculture in modified Locke solution. The in vitro susceptibility testing against the drug metronidazole, nitazoxanide, trimethoprim-sulfamethoxazole and erythromycin was performed in 24 strains of B. hominis, which grew up (microculture method) in 10 double concentrations of each antimicrobial (from 256 ug/ml to 0.5 ug/mL) plus a control. 46.3% (145/313) of the sample had B. hominis, also the age between 12 to 17 years and 60 years was associated with higher frequency of parasites (OR: 2.93 and 2.62). The minimum inhibitory concentration (MIC) 90 of metronidazole and nitazoxanide was 3.19 ug/mL and 11.19 ug/ml, respectively, whereas the MIC 90 of trimethoprim-sulfamethoxazole and erythromycin were above 256 ug/mL. B. hominis occurs in high frequency in patients admitted to the Hospital Regional in Lambayeque, proving to be an important problem of public health in the region. Also B. hominis isolated from these patients were shown to be susceptible in vitro to low concentrations of metronidazole and nitazoxanide so they could be chosen for treatment of this parasite.

  18. On the relationship between emotional state and abnormal unfairness sensitivity in alcohol dependence

    Directory of Open Access Journals (Sweden)

    Damien eBrevers

    2015-07-01

    Full Text Available Recent empirical findings suggest that alcohol dependence is characterized by heightened sensitivity to unfairness during social transactions. The present study went a step further and aimed to ascertain whether this abnormal level of sensitivity to unfairness is underlined by an increased emotional reactivity. Twenty-six recently abstinent alcohol-dependent individuals (AD and 32 controls performed an Ultimatum Game (UG, in which participants had to respond to take-it-or-leave-it offers, ranging from fair to unfair and made by a fictive proposer. Emotional state was recorded during UG offers presentation and was indexed by the amplitude of skin conductance response (SCR. Results showed that AD decided to reject unfair offers more frequently than their controls, confirming previous data. The proportion of rejected unfair UG offers was correlated with SCR, in the AD but not in the control group. This finding suggests that deciding to accept or reject unfair UG offers is influenced by arousal-affective activity in AD, but not in controls. Heightened emotional reactivity may have driven AD to punish the proposer rather than acting as a rational economic agent. An implication of present findings is that AD might have difficult to cope with unfair situations triggered by social interactions. Future studies are needed are needed in order to examine whether - emotional and behavioral - reactivity to unfairness during the UG could impact alcohol consumption and relapse in AD.

  19. Uniform Gauss-Weight Quadratures for Discrete Ordinate Transport Calculations

    International Nuclear Information System (INIS)

    Carew, John F.; Hu, Kai; Zamonsky, Gabriel

    2000-01-01

    Recently, a uniform equal-weight quadrature set, UE n , and a uniform Gauss-weight quadrature set, UG n , have been derived. These quadratures have the advantage over the standard level-symmetric LQ n quadrature sets in that the weights are positive for all orders,and the transport solution may be systematically converged by increasing the order of the quadrature set. As the order of the quadrature is increased,the points approach a uniform continuous distribution on the unit sphere,and the quadrature is invariant with respect to spatial rotations. The numerical integrals converge for continuous functions as the order of the quadrature is increased.The numerical characteristics of the UE n quadrature set have been investigated previously. In this paper, numerical calculations are performed to evaluate the application of the UG n quadrature set in typical transport analyses. A series of DORT transport calculations of the >1-MeV neutron flux have been performed for a set of pressure-vessel fluence benchmark problems. These calculations employed the UG n (n = 8, 12, 16, 24, and 32) quadratures and indicate that the UG n solutions have converged to within ∼0.25%. The converged UG n solutions are found to be comparable to the UE n results and are more accurate than the level-symmetric S 16 predictions

  20. Taking it easy when playing ultimatum game with a Down syndrome proposer: Effects on behavior and medial frontal negativity.

    Science.gov (United States)

    Rêgo, Gabriel Gaudencio; Campanhã, Camila; do Egito, Julia Horta Tabosa; Boggio, Paulo Sérgio

    2017-10-01

    The ultimatum game (UG) is an endowment sharing game in which a proposer suggests a division of an asset to a recipient, who must accept or reject it. Economic studies showed that despite recipients usually rejecting unfair offers, perception and reaction to unfairness are highly dependent on who is the proposer. Event-related potentials (ERPs) commonly detected in UG games are the medial frontal negativity (MFN), a component detected in recipients facing unfair offers, and the P300, a component related to attentional and memory processes. Given this, we aimed to investigate the behavioral and ERP responses of healthy people playing the UG game with Down syndrome (DS) and typical development (TD) proposers. Nineteen subjects participated in this study. The UG behavioral data were similar to previous studies. ERP analysis showed no MFN in participants facing unfair offers. A higher P300 amplitude was detected when participants faced fair offers from TD compared to DS fair offers. We also found a positive correlation between P300 amplitude for TD offers and self-esteem scale score. Together these findings indicate that insertion of an atypical player in the UG led to changes in participants' perception and expectancy of the game.