WorldWideScience

Sample records for ug nc tl

  1. Doped Tl-1212 and Tl-1223 superconductors

    International Nuclear Information System (INIS)

    Eder, M.H.

    2001-09-01

    This work describes the preparation and characterization of thallium-lead-strontium-barium-calcium-(uranium)-copperoxide (Tl-1212, Tl-1223) high-temperature superconductors. The precursors were prepared via nitrate method. After calcination the oxidic powders were mixed with stoichiometric amounts of an Tl 2 O 3 , PbO, Er 2 O 3 and Gd 2 O 3 by milling and afterwards uniaxial compressed. Sintering was carried out in silver foils. X-ray diffractometry and high-resolution microscopy in combination with scanning electron microscopy (including EDAX) were used to study the influence of varying thallium/lead-, strontium/barium-, calcium/rare earth element ratios and the effect of uranium on the phase composition and microstructure of bulk superconductors. Furthermore the influence of the composition on the electrical and magnetical properties was studied. On phase pure Tl-1212 and Tl-1223 superconductors NMR-measurements were done. Small amounts of gadolinium and erbium instead of calcium and excess-uranium have a positive impact on the electrical and magnetical properties of the Tl-1223 superconductors. Higher amounts of these doping elements favor the Tl-1212 phase. Tl-1212 superconductors with varying thallium/lead- strontium/barium- and calcium/gadolinium ratios were prepared phasepure in wide range of doping. Transition temperatures up to 96 K were achieved. It was shown that lead has an oxidation number of +4 and thallium of +3. (author)

  2. 46 CFR 54.01-35 - Corrosion (modifies UG- 25).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Corrosion (modifies UG- 25). 54.01-35 Section 54.01-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING PRESSURE VESSELS General Requirements § 54.01-35 Corrosion (modifies UG- 25). (a) Vessels or portions of vessels subject to...

  3. TL transgenic mouse strains

    International Nuclear Information System (INIS)

    Obata, Y.; Matsudaira, Y.; Hasegawa, H.; Tamaki, H.; Takahashi, T.; Morita, A.; Kasai, K.

    1993-01-01

    As a result of abnormal development of the thymus of these mice, TCR αβ lineage of the T cell differentiation is disturbed and cells belonging to the TCR γδ CD4 - CD8 - double negative (DN) lineage become preponderant. The γδ DN cells migrate into peripheral lymphoid organs and constitute nearly 50% of peripheral T cells. Immune function of the transgenic mice is severely impaired, indicating that the γδ cells are incapable of participating in these reactions. Molecular and serological analyses of T-cell lymphomas reveal that they belong to the γδ lineage. Tg.Tla a -3-1 mice should be useful in defining the role of TL in normal and abnormal T cell differentiation as well as in the development of T-cell lymphomas, and further they should facilitate studies on the differentiation and function of γδ T cells. We isolated T3 b -TL gene from B6 mice and constructed a chimeric gene in which T3 b -TL is driven by the promoter of H-2K b . With the chimeric gene, two transgenic mouse strains, Tg. Con.3-1 and -2 have been derived in C3H background. Both strains express TL antigen in various tissues including skin. The skin graft of transgenic mice on C3H and (B6 X C3H)F 1 mice were rejected. In the mice which rejected the grafts, CD8 + TCRαβ cytotoxic T cells (CTL) against TL antigens were recognized. The recognition of TL by CTL did not require the antigen presentation by H-2 molecules. The results indicated that TL antigen in the skin becomes a transplantation antigen and behaves like a typical allogeneic MHC class I antigen. The facts that (B6 X C3H)F 1 mice rejected the skin expressing T3 b -TL antigen and induced CTL that killed TL + lymphomas of B6 origin revealed that TL antigen encoded by T3 b -TL is recognized as non-self in B6 mice. Experiments are now extended to analyze immune responses to TL antigen expressed on autochthonous T cell lymphomas. (J.P.N.)

  4. Challenges to and proposals for underground gas storage (UGS business in China

    Directory of Open Access Journals (Sweden)

    Gangxiong Zhang

    2017-05-01

    Full Text Available Underground gas storage (UGS is one of the major storage and peak-shaving means in the world among numerous storage ways via gas fields, small-scale LNG, etc. With the rapid development of natural gas industry in China, the seasonal peak-shaving issues are increasingly prominent, so how to achieve sustainable development of UGS business has become a major problem at present. In view of this, we studied the present status and trend of UGS development abroad and analyzed the following challenges encountered by UGS in China. (1 UGS construction falls behind the world and peak-shaving capacity is insufficient. (2 There is lack of quality gas sources for storage and the complicated geological conditions make the cost of UGS construction high. (3 UGS construction is still at the preliminary stage, so experience is not enough in safety and scientific operation and management. (4 UGS construction, management and operation are not unified as a whole, so its maximum efficiency fails to be exerted. (5 The economic benefit of UGS is difficult to be shown without independent cost accounting. Based on the experience of other countries, some proposals were put forward on UGS development under the actual present situation: to strengthen strategic UGS layout, intensify storage site screening in key areas and steadily promote UGS construction; to establish professional UGS technical and management teams and intensify the research of key technologies; and to set up a complete and rationally-distributed UGS construction, operation and management system.

  5. The neutron diffraction of molten TlCl, TlBr, and TlI

    International Nuclear Information System (INIS)

    Satow, T.; Uemura, O.; Hoshino, K.; Watanabe, T.

    1984-01-01

    Structure factors S(K) for liquid TlCl, TlBr, and TlI are determined by neutron diffraction measurements. Atomic radial distribution functions (RDF) derived from S(K) are presented. All RDF values are slightly smaller than those of their solid state counter parts. Results show that TlX has a tendency not to retain cesium-chloride type local order, but to take sodium-chloride type order when melting

  6. 205Tl experiment

    International Nuclear Information System (INIS)

    Henning, W.; Kutschera, W.; Ernst, H.

    1984-01-01

    205 Tl has been previously proposed as a geological detector for solar neutrinos, making use of the reaction 205 Tl(nu, e - ) 205 Pb with a neutrino threshold of only approx. = 43 keV. We report on an experiment performed to study the feasibility of detecting radioactive 205 Pb nuclei (T/sub 1/2/ = 15 million years) at very low concentrations using the recently developed technique of accelerator mass spectrometry. Employing the high-energy ion beams of good quality from the UNILAC heavy-ion accelerator at the GSI Darmstadt, we are able to demonstrate a suppression of neighbouring isotopes to better than 1 in 10 16 and of neighbouring elements to about 1 in 10 3 . While these results are very encouraging, the minimum number of atoms detectable is still severely limited by the efficiency of producing multiply-charged ions from present ion sources. Future improvements in ion-source performance are briefly discussed

  7. ASDEX-UG. ASDEX upgrade project proposal. Phase 2

    International Nuclear Information System (INIS)

    1983-05-01

    The objective of ASDEX UG is to investigate the problems relating to tokamak divertor physics and the boundary layer of hot plasmas which cannot be covered otherwise by either ASDEX or other EUROPEAN tokamaks, including JET, but whose investigation is indispensable for NET and INTOR. The configuration of ASDEX UG is changed as compared with ASDEX due to the requirement that all poloidal field coils are located outside the toroidal field magnet. This leads to a highly elongated D-shaped plasma with an ''open'' divertor, which does not allow to close the divertor chamber by such simple means as in ASDEX. In section 2, the aims of ASDEX UG are repeated briefly and the essential features and parameters of the tokamak system are summarized. The summary includes an overview of the tokamak design, the time schedule of design and construction concluding with the estimated investment cost and manpower required. In section 3 the tokamak system components are treated. The circuits and energy supply for the different electrical components are described in section 4. Auxiliary heating requirements and methods are discussed in section 5. Section 6 presents a survey over the periphery of the tokamak system including preparation of the building and radiation shielding. Section 7 outlines the physical programme. Section 8 is devoted to diagnostics. Finally, the principal concepts for control, data acquisition and handling are outlined in section 9. (orig./AH)

  8. Spectral measurements of loess TL

    International Nuclear Information System (INIS)

    Rendell, H.M.; Mann, S.J.; Townsend, P.D.

    1988-01-01

    Variations in thermoluminescence (TL) glow curves are reported for two loess samples when examined with broad band filters in the range 275-650 nm. Samples show striking differences in bleaching behaviour, when their TL emissions are observed in the u.v., blue, green and yellow spectral regions. The age estimates, given by the equivalent dose (ED) values, differ by up to a factor of two for analyses using the green and u.v. TL signals. These ED values also vary with prolonged room temperature storage between the bleaching and irradiation steps. The anomalies in the bleaching behaviour are interpreted in terms of changes in TL efficiency. The results have major implications for the regeneration method of TL dating for these fine-grained sediments and suggest that reliable dates obtained by it may be fortuitous. (author)

  9. 201Tl heart studies

    International Nuclear Information System (INIS)

    Bell, R.L.

    1976-01-01

    At the annual meeting of the Society of Nuclear Medicine there was a preponderance of papers dealing with the heart. The most impressive papers detailed the use of monovalent cation 201 Tl in the evaluation of coronary artery disease. Thallium-201 behaves like potassium in that it enters heart muscle quickly and persists in that organ for several hours. It is unlike most radioactive potassium analogues used for heart studies in that: (1) its gamma energy peaks (69 keV and 80 keV) are more easily collimated with resultant image improvement, (2) its physical half life of 72 hours is sufficiently short to attain high counting rates without too much radiation and is sufficiently long so that storage is not prohibitive, (3) its short half life and lack of Beta radiation results in lower radiation to the patient, and (4) its uptake in heart is greater and uptake in liver and stomach less than other potassium analogues

  10. Noble magnetic barriers in the ASDEX UG tokamak

    Science.gov (United States)

    Ali, Halima; Punjabi, Alkesh; Vazquez, Justin

    2010-02-01

    The second-order perturbation method of creating invariant tori inside chaos in Hamiltonian systems (Ali, H.; Punjabi, A. Plasma Phys. Contr. F. 2007, 49, 1565-1582) is applied to the axially symmetric divertor experiment upgrade (ASDEX UG) tokamak to build noble irrational magnetic barriers inside chaos created by resonant magnetic perturbations (m, n)=(3, 2)+(4, 3), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation. The radial dependence of the Fourier modes is ignored. The modes are considered to be locked and have the same amplitude δ. A symplectic mathematical mapping in magnetic coordinates is used to integrate magnetic field line trajectories in the ASDEX UG. Tori with noble irrational rotational transform are the last ones to be destroyed by perturbation in Hamiltonian systems. For this reason, noble irrational magnetic barriers are built inside chaos, and the strongest noble irrational barrier is identified. Three candidate locations for the strongest noble barrier in ASDEX UG are selected. All three candidate locations are chosen to be roughly midway between the resonant rational surfaces ψ32 and ψ43. ψ is the magnetic coordinate of the flux surface. The three candidate surfaces are the noble irrational surfaces close to the surface with q value that is a mediant of q=3/2 and 4/3, q value of the physical midpoint of the two resonant surfaces, and the q value of the surface where the islands of the two perturbing modes just overlap. These q values of the candidate surfaces are denoted by q MED, q MID, and q OVERLAP. The strongest noble barrier close to q MED has the continued fraction representation (CFR) [1;2,2,1∞] and exists for δ≤2.6599×10-4; the strongest noble barrier close to q MID has CFR [1;2,2,2,1∞] and exists for δ≤4.6311×10-4; and the strongest noble barrier close to q OVERLAP has CFR [1;2,2,6,2,1∞] and exists for δ≤1.367770×10-4. From these results, the strongest

  11. Spectrophotometric determination of Tl carrier in 201Tl-TlCl injection

    International Nuclear Information System (INIS)

    Gong Quansheng; Jing Lie

    1997-01-01

    A simple and sensitive method for the spectrophotometric determination of carrier content (Thallium) in 201 Tl-TlCl injection is described. Thallium (I) is oxidised to Thallium (III) by aqueous bromine, then excess bromine is removed by adding sulfosalicylic acid. In buffer solution (NH 4 Cl-NH 4 OH) at pH 11.7 with the presence of emulsifier OP, thallium (III) and cadion form a complex having an absorption maximum at 469 nm with a molar absorptivity of 1.37 x 10 4 m 2 /mol. Beer's law is obeyed in the concentration range of 0-7 μg/5 mL. The effect of impurity elements in 201 Tl-TlCl injection is examined. It is an ideal method for the analysis of radioactive solution

  12. Applications of Universal Grammar (UG) in the ESL/EFL Classroom

    Science.gov (United States)

    Kirkwold, Lorne O.

    2007-01-01

    The article proposes Stern's (1983) framework for classifying issues related to instruction in order to ascertain the relevance of Universal Grammar (UG) in the ESL/EFL classroom. Discussed in this article, particularly as UG pertains to them, are issues related to: (a) L1 transfer; (b) teaching rules and giving error correction versus presenting…

  13. Analytical Review of Universal Grammar (UG) Approach on Second Language Acquisition (SLA)

    Science.gov (United States)

    Irwandy

    2015-01-01

    The aim of this paper is to explore the analysis of Universal Grammar (UG) approach on Second Language Acquisition (SLA). This paper is significant as the sources for teacher or researcher of the second language since this elaboration is deeply focusing on the use of UG on SLA. The method used in this academic writing is inductive method of…

  14. 46 CFR 54.10-10 - Standard hydrostatic test (modifies UG-99).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Standard hydrostatic test (modifies UG-99). 54.10-10... PRESSURE VESSELS Inspection, Reports, and Stamping § 54.10-10 Standard hydrostatic test (modifies UG-99). (a) All pressure vessels shall satisfactorily pass the hydrostatic test prescribed by this section...

  15. Tl Cuprate Superconductors Studied by XPS

    Energy Technology Data Exchange (ETDEWEB)

    Vasquez, R. P. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109-8099 (United States); Siegal, M. P. [Sandia National Laboratories, Albuquerque, NM 87185-1421 (United States); Overmyer, D. L. [Sandia National Laboratories, Albuquerque, NM 87185-1421 (United States); Ren, Z. F. [Department of Chemistry, State University of New York, Buffalo, NY 14260-3000 (United States); Lao, J. Y. [Department of Chemistry, State University of New York, Buffalo, NY 14260-3000 (United States); Wang, J. H. [Department of Chemistry, State University of New York, Buffalo, NY 14260-3000 (United States)

    1999-07-01

    XPS measurements on epitaxial thin films of the Tl cuprate superconductors Tl2Ba2CaCu2O8, Tl2Ba2Ca2Cu3O10, and Tl0.78Bi0.22Ba0.4Sr1.6Ca2Cu3O9-{delta} are presented. These data, together with previous measurements in this lab on Tl2Ba2CuO6-{delta} and TlBa2CaCu2O7-{delta}, comprise a comprehensive data set for comparison of Tl cuprates in which the number of Tl-O and Cu-O layers, and hence the chemical and electronic properties, vary. (c) 2000 American Vacuum Society.

  16. Tl Cuprate Superconductors Studied by XPS

    International Nuclear Information System (INIS)

    Vasquez, R. P.; Siegal, M. P.; Overmyer, D. L.; Ren, Z. F.; Lao, J. Y.; Wang, J. H.

    1999-01-01

    XPS measurements on epitaxial thin films of the Tl cuprate superconductors Tl2Ba2CaCu2O8, Tl2Ba2Ca2Cu3O10, and Tl0.78Bi0.22Ba0.4Sr1.6Ca2Cu3O9-δ are presented. These data, together with previous measurements in this lab on Tl2Ba2CuO6-δ and TlBa2CaCu2O7-δ, comprise a comprehensive data set for comparison of Tl cuprates in which the number of Tl-O and Cu-O layers, and hence the chemical and electronic properties, vary. (c) 2000 American Vacuum Society

  17. Binuclear Pt-Tl bonded complex with square pyramidal coordination around Pt: a combined multinuclear NMR, EXAFS, UV-Vis, and DFT/TDDFT study in dimethylsulfoxide solution.

    Science.gov (United States)

    Purgel, Mihály; Maliarik, Mikhail; Glaser, Julius; Platas-Iglesias, Carlos; Persson, Ingmar; Tóth, Imre

    2011-07-04

    The structure and bonding of a new Pt-Tl bonded complex formed in dimethylsulfoxide (dmso), (CN)(4)Pt-Tl(dmso)(5)(+), have been studied by multinuclear NMR and UV-vis spectroscopies, and EXAFS measurements in combination with density functional theory (DFT) and time dependent density functional theory (TDDFT) calculations. This complex is formed following the equilibrium reaction Pt(CN)(4)(2-) + Tl(dmso)(6)(3+) ⇆ (CN)(4)Pt-Tl(dmso)(5)(+) + dmso. The stability constant of the Pt-Tl bonded species, as determined using (13)C NMR spectroscopy, amounts to log K = 2.9 ± 0.2. The (NC)(4)Pt-Tl(dmso)(5)(+) species constitutes the first example of a Pt-Tl bonded cyanide complex in which the sixth coordination position around Pt (in trans with respect to the Tl atom) is not occupied. The spectral parameters confirm the formation of the metal-metal bond, but differ substantially from those measured earlier in aqueous solution for complexes (CN)(5)Pt-Tl(CN)(n)(H(2)O)(x)(n-) (n = 0-3). The (205) Tl NMR chemical shift, δ = 75 ppm, is at extraordinary high field, while spin-spin coupling constant, (1)J(Pt-Tl) = 93 kHz, is the largest measured to date for a Pt-Tl bond in the absence of supporting bridging ligands. The absorption spectrum is dominated by two strong absorption bands in the UV region that are assigned to MMCT (Pt → Tl) and LMCT (dmso → Tl) bands, respectively, on the basis of MO and TDDFT calculations. The solution of the complex has a bright yellow color as a result of a shoulder present on the low energy side of the band at 355 nm. The geometry of the (CN)(4)Pt-Tl core can be elucidated from NMR data, but the particular stoichiometry and structure involving the dmso ligands are established by using Tl and Pt L(III)-edge EXAFS measurements. The Pt-Tl bond distance is 2.67(1) Å, the Tl-O bond distance is 2.282(6) Å, and the Pt-C-N entity is linear with Pt-C and Pt···N distances amounting to 1.969(6) and 3.096(6) Å, respectively. Geometry optimizations on

  18. Converting Hg-1212 to Tl-2212 via Tl-Hg cation exchange in combination with Tl cation intercalation

    International Nuclear Information System (INIS)

    Zhao Hua; Wu, Judy Z

    2007-01-01

    In a cation exchange process developed recently for epitaxy of HgBa 2 CaCu 2 O 6 (Hg-1212) thin films, TlBa 2 CaCu 2 O 7 (Tl-1212) or Tl 2 Ba 2 CaCu 2 O 9 (Tl-2212) precursor films were employed as the precursor matrices and Hg-1212 was obtained by replacing Tl cations on the precursor lattice with Hg cations. The reversibility of the cation exchange dictates directly the underlying mechanism. Following our recent success in demonstrating a complete reversibility within '1212' structure, we show the conversion from Hg-1212 to Tl-2212 can be achieved via two steps: conversion from Hg-1212 to Tl-1212 followed by Tl intercalation to form double Tl-O plans in each unit cell. The demonstrated reversibility of the cation exchange process has confirmed the process is a thermal perturbation of weakly bonded cations on the lattice and the direction of the process is determined by the population ratio between the replacing cations and that to be replaced

  19. Superconducting transition in TlBiTe/sub 2/ and TlTe compounds

    Energy Technology Data Exchange (ETDEWEB)

    Kantser, V G; Popovich, N S; Sidorenko, A S

    1985-10-01

    On the basis of zone structure calculation for TlBiTe/sub 2/ and TlTe it is found that TlBiTe/sub 2/ is a narrow-gap semiconductor and TlTe is a p-metal. At Tsub(c)=0.19 K TlTe is found to experience the superconducting transition. In TlBiTe/sub 2/ superconductivity is not observed to occur up to 0.05 K, since there is a possibility of occupying the high density of states zones because they are remote from actual ones. The earlier discovered superconducting transition in TlBiTe/sub 2/ is inherent in the alien phase of TlTe.

  20. Putting Ug99 on the map: An update on current and future monitoring

    DEFF Research Database (Denmark)

    Hodson, D P; Nazari, K; Park, R F

    2011-01-01

    Detection of stem rust race TTKSK (Ug99) from Uganda in 1998/99 highlighted not only the extremely high vulnerability of the global wheat crop to stem rust but also a lack of adequate global systems to monitor such a threat. Progress in the development and expansion of the Global Cereal Rust...... Monitoring System (GCRMS) is described. The current situation regarding the Ug99 lineage of races is outlined and the potential for expansion into important wheat areas is considered. The GCRMS has successfully tracked the spread and changes that are occurring within the Ug99 lineage and is now well...... capacity for race analysis is seen to be critical and integration of the Global Rust Reference Centre into the stem rust monitoring network is seen as a positive development. The current acute situation with severe epidemics of stripe rust in many countries indicates a clear need for more effective global...

  1. Creation of second order magnetic barrier inside chaos created by NTMs in the ASDEX UG

    Science.gov (United States)

    Ali, Halima; Punjabi, Alkesh

    2012-10-01

    Understanding and stabilization of neoclassical tearing modes (NTM) in tokamaks is an important problem. For low temperature plasmas, tearing modes are believed to be mainly driven by current density gradient. For collisionless plasmas, even when plasma is stable to classical tearing modes, helical reduction in bootstrap current in O-point of an island can destabilize NTMs when an initial island is seeded by other global MHD instabilities or when microturbulence triggers the transition from a linear to nonlinear instability. The onset of NTMs leads to the most serious beta limit in ASDEX UG tokamak [O. Gubner et al 2005 NF 39 1321]. The important NTMs in the ASDDEX UG are (m,n)=(3,2)+(4,3)+(1,1). Realistic parameterization of these NTMs and the safety factor in ASDEX UG are given in [O. Dumbrajs et al 2005 POP 12 1107004]. We use a symplectic map in magnetic coordinates for the ASDEX UG to integrate field lines in presence of the NTMs. We add a second order control term [H. Ali and A. Punjabi 2007 PPCF 49 1565] to this ASDEX UG field line Hamiltonian to create an invariant magnetic surface inside the chaos generated by the NTMs. The relative strength, robustness, and resilience of this barrier are studied to ascertain the most desirable noble barrier in the ASDEX UG with NTMs. We present preliminary results of this work, and discuss its implications with regard to magnetic transport barriers for increasing strength of magnetic perturbations. This work is supported by the grants DE-FG02-01ER54624 and DE-FG02-04ER54793.

  2. Prolate yrast cascade in 183Tl

    International Nuclear Information System (INIS)

    Reviol, W.; Carpenter, M. P.; Janssens, R. V. F.; Jenkins, D.; Toth, K. S.; Bingham, C. R.; Riedinger, L. L.; Weintraub, W.; Cizewski, J. A.; Lauritsen, T.

    2000-01-01

    The yrast sequence in 183 Tl has been studied for the first time in recoil-mass selected γ-ray spectroscopic measurements. A rotational-like cascade of seven transitions is established down to the band head with probable spin and parity (13/2 + ). Unlike in the adjacent odd-mass Tl nuclei, prompt γ decay from the yrast band to a lower lying weakly deformed (oblate) structure is not observed. These features are consistent with the predicted drop of the prolate band head in 183 Tl compared to 185 Tl. The implications for the prolate energy minimum in odd-mass Tl nuclei at the neutron i 13/2 midshell (N=103) are discussed. (c) 2000 The American Physical Society

  3. Targeted introgression of stem rust Ug99 resistance from wheatgrasses into pasta and bread wheat

    Science.gov (United States)

    In the past 50 years, a number of stem rust resistance (Sr) genes have been transferred from several wheat-related grasses into durum (i.e. pasta) and bread wheat through chromosome translocations and additions. To utilize these genes for controlling the Ug99 races of the stem rust pathogen, we ini...

  4. RDM lifetime measurements in 187Tl

    International Nuclear Information System (INIS)

    Chamoli, S.K.; Joshi, P.; Kumar, A.; Govil, I.M.; Mukherjee, G.; Singh, R.P.; Muralithar, S.; Bhowmik, R.K.

    2003-01-01

    The present work is an attempt to study the shape changes in 187 Tl through a measurement of electromagnetic transition probabilities of the high spin states. The Doppler shifted recoil distance technique was used to measure the lifetimes

  5. Disquisition and technical alteration about TL apparatus

    International Nuclear Information System (INIS)

    Wang Guangxiang; Li Mingliang

    2002-01-01

    The author simply introduces the disadvantage of TL apparatus controlled by single chip. The project uses the PC computer to replace single chip control. So it must be changed the interface and made up a software with Chinese

  6. TL dosimetric properties BAM:EU

    International Nuclear Information System (INIS)

    Rao, Bellam N.; Murthy, K.V.R.; Subba Rao, B.; Saiprasad, A.S.

    2011-01-01

    In phosphor area today top priority is the replacement of the high performance but very expensive rare earth activated phosphors with cheaper materials. This essentially means replacing the rare earth ions with transition metal ions or post transition ions. Now a day's phosphors are used in various fields. After World War II, the advances in the optical spectroscopy of solids, especially those of transition metals ions help to evolve research on phosphor and solid state luminescence. In 1960 efficient rare earth activated phosphors were developed for use in color TV (Tb 3+ green, Eu 3+ red, and Dy 3+ yellow). In 1970 tricolor lamp was introduced blue emission from Ce 3+ + Tb 3+ pair was used in tricolor lamps. At present combination of halo phosphor and tri-band phosphor blend is used in many lamp as a compromise between performance, phosphor cost and the lamp making Cost. Thermo luminescence of 0.5 Gy X-ray irradiated BAM.Eu has been studied. The irradiated phosphor has been studied for its TL dosimetric properties one week after irradiation and after 100 weeks of storage. Interesting TL results are reported in the present paper. Heating rate used in the present experiment is 6.6 deg C/Sec. The following two figures are on TL recorded 100 weeks after irradiation and TL recorded after 235 weeks of storage. Before storage for 100 weeks the TL glow curve with a hump around 180 deg C followed by a peak at 273 deg C. After storage for 100 weeks the TL pattern changes entirely. i.e. the composite TL peak structure emerged as two well resolved peaks and with slightly higher TL peak temperatures at 215 deg C and 300 deg C. Normally after storage for 100 weeks the peak at 190 deg C reduces in its intensity or disappears in some cases, instead of that the peak appears at 215 deg C as well resolved peak and its intensity is almost comparable to that of 300 deg C peak. Since the TL phenomenon observed is interesting the two well resolved, isolated, high intensity peaks

  7. Progress and problems with automated TL dating

    International Nuclear Information System (INIS)

    McKerrell, H.; Mejdahl, V.

    1981-01-01

    A number of basic problems connected with the measurement of beta and gamma dose-rates are discussed, and the possibility of using low-temperature peaks in quartz and feldspar for dose-rate measurements is examined. Preliminary results of TL measurements on individual grains of quartz and feldspar are presented. A TL dating method based on the difference in the archaeological dose received by potassium feldspar and quartz grains is proposed. (author)

  8. The use of thallium diethyldithiocarbamate for mapping CNS potassium metabolism and neuronal activity: Tl+ -redistribution, Tl+ -kinetics and Tl+ -equilibrium distribution.

    Science.gov (United States)

    Wanger, Tim; Scheich, Henning; Ohl, Frank W; Goldschmidt, Jürgen

    2012-07-01

    The potassium (K(+)) analogue thallium (Tl(+)) can be used as a tracer for mapping neuronal activity. However, because of the poor blood-brain barrier (BBB) K(+) -permeability, only minute amounts of Tl(+) enter the brain after systemic injection of Tl(+) -salts like thallium acetate (TlAc). We have recently shown that it is possible to overcome this limitation by injecting animals with the lipophilic chelate complex thallium diethyldithiocarbamate (TlDDC), that crosses the BBB and releases Tl(+) prior to neuronal or glial uptake. TlDDC can thus be used for mapping CNS K(+) metabolism and neuronal activity. Here, we analyze Tl(+) -kinetics in the rodent brain both experimentally and using simple mathematical models. We systemically injected animals either with TlAc or with TlDDC. Using an autometallographic method we mapped the brain Tl(+) -distribution at various time points after injection. We show that the patterns and kinetics of Tl(+) -redistribution in the brain are essentially the same irrespective of whether animals have been injected with TlAc or TlDDC. Data from modeling and experiments indicate that transmembrane Tl(+) -fluxes in cells within the CNS in vivo equilibrate at similar rates as K(+) -fluxes in vitro. This equilibration is much faster than and largely independent of the equilibration of Tl(+) -fluxes across the BBB. The study provides further proof-of-concept for the use of TlDDC for mapping neuronal activity and CNS K(+) -metabolism. A theoretical guideline is given for the use of K(+) -analogues for imaging neuronal activity with general implications for the use of metal ions in neuroimaging. © 2012 The Authors. Journal of Neurochemistry © 2012 International Society for Neurochemistry.

  9. NaI(Tl) electron energy resolution

    CERN Document Server

    Mengesha, W

    2002-01-01

    NaI(Tl) electron energy resolution eta sub e was measured using the Modified Compton Coincidence Technique (MCCT). The MCCT allowed detection of nearly monoenergetic internal electrons resulting from the scattering of incident 662 keV gamma rays within a primary NaI(Tl) detector. Scattered gamma rays were detected using a secondary HPGe detector in a coincidence mode. Measurements were carried out for electron energies ranging from 16 to 438 keV, by varying the scattering angle. Measured HPGe coincidence spectra were deconvolved to determine the scattered energy spectra from the NaI(Tl) detector. Subsequently, the NaI(Tl) electron energy spectra were determined by subtracting the energy of scattered spectra from the incident source energy (662 keV). Using chi-squared minimization, iterative deconvolution of the internal electron energy spectra from the measured NaI(Tl) spectra was then used to determine eta sub e at the electron energy of interest. eta sub e values determined using this technique represent va...

  10. Electrochemically produced alumina as TL detector

    International Nuclear Information System (INIS)

    Osvay, M.

    1996-01-01

    The goal of this work was to compare the TL properties of various electrochemically produced alumina layers (E-AIO) in order to investigate the effect of the electrolyte and the Mg content on the alloys. It has been found that the TL sensitivity of oxidised layers is more influenced by the type of electrolyte, than by the composition of alloy. Hard oxide layer evolved in reduction electrolyte has rather different character compared to other alumina production investigated. The effect of reducing media seems to be very important during preparation of alumina layer. One of the advantages properties of E-AIO is, that it serve a promising method to increase the measuring range of TL method above 10 kGy as well. (author)

  11. Accidental and retrospective dosimetry using TL method

    International Nuclear Information System (INIS)

    Mesterházy, D.; Osvay, M.; Kovács, A.; Kelemen, A.

    2012-01-01

    Retrospective dosimetry is one of the most important tools of accidental dosimetry for dose estimation when dose measurement was not planned. In the affected area many objects can be applied as natural dosimeters. The paper discusses our recent investigations on various electronic components and common salt (NaCl) having useful thermoluminescence (TL) properties. Among materials investigated the electronic components of cell phones seem promising for retrospective dosimetry purposes, having high TL responses, proper glow curve peaks and the intensity of TL peaks vs. gamma dose received provided nearly linear response in the dose range of 10 mGy–1.5 Gy. - Highlights: ► Electronic components and common salt were investigated for accidental and retrospective dosimetry. ► SMD resistors seem promising for retrospective dosimetry purposes. ► Table salt can be used effectively for accidental dosimetry purposes, as well.

  12. Detailed α -decay study of 180Tl

    Science.gov (United States)

    Andel, B.; Andreyev, A. N.; Antalic, S.; Barzakh, A.; Bree, N.; Cocolios, T. E.; Comas, V. F.; Diriken, J.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Franchoo, S.; Ghys, L.; Heredia, J. A.; Huyse, M.; Ivanov, O.; Köster, U.; Liberati, V.; Marsh, B. A.; Nishio, K.; Page, R. D.; Patronis, N.; Seliverstov, M. D.; Tsekhanovich, I.; Van den Bergh, P.; Van De Walle, J.; Van Duppen, P.; Venhart, M.; Vermote, S.; Veselský, M.; Wagemans, C.

    2017-11-01

    A detailed α -decay spectroscopy study of 180Tl has been performed at ISOLDE (CERN). Z -selective ionization by the Resonance Ionization Laser Ion Source (RILIS) coupled to mass separation provided a high-purity beam of 180Tl. Fine-structure α decays to excited levels in the daughter 176Au were identified and an α -decay scheme of 180Tl was constructed based on an analysis of α -γ and α -γ -γ coincidences. Multipolarities of several γ -ray transitions deexciting levels in 176Au were determined. Based on the analysis of reduced α -decay widths, it was found that all α decays are hindered, which signifies a change of configuration between the parent and all daughter states.

  13. Isotopic exchange in a neutron-irradiated mixed-valence compound: Tl3(I) Tl(III)Cl6

    International Nuclear Information System (INIS)

    Fernandez Valverde, S.; Duplatre, G.

    1977-01-01

    The initial distribution of Tl(I) and Tl(III) species, and its change on heating, have been investigated in solid thermal neutron-irradiated Th 4 Cl 6 . An initial ratio of 5/1 for 204 Tl(I)/ 204 Tl(III) is found and this remains constant for integral gamma-doses of 3 to 12 MRad. The variation of the 204 Tl(III) fraction with temperature is found identical to that observed in labelled Tl 4 Cl 6 for which a genuine isotopic exchange has previously been described. It is concluded that the recoil species are rapidly converted, after the recoil processes, into stable ions

  14. Brain SPECT with Tl-201 DDC

    International Nuclear Information System (INIS)

    Bruine, J.F. de.

    1988-01-01

    The development, animal and human experiments and the first clinical results of a new blood flow tracer thallium-201 diethyldithiocarbamate (Tl-201 DDC) are discussed for functional brain imaging with single-photon emission computed tomography (SPECT). 325 refs.; 43 figs.; 22 tabs

  15. (Tl, Sb) and (Tl, Bi) binary surface reconstructions on Ge(111) substrate

    Science.gov (United States)

    Gruznev, D. V.; Bondarenko, L. V.; Tupchaya, A. Y.; Yakovlev, A. A.; Mihalyuk, A. N.; Zotov, A. V.; Saranin, A. A.

    2018-03-01

    2D compounds made of Group-III and Group-V elements on the surface of silicon and germanium attract considerable attention due to prospects of creating III-V binary monolayers, which are predicted to hold advanced physical properties. In the present work, we have investigated two such systems, (Tl, Sb)/Ge(111) and (Tl, Bi)/Ge(111) using scanning tunneling microscopy, low energy electron diffraction observations and density-functional-theory calculations. In addition to the previously reported surface structures of 2D (Tl, Sb) and (Tl, Bi) compounds on Si(111), we found new ones, namely, √{ 7} × √{ 7} and 3 × 3. Formation processes and plausible models of their atomic arrangements are discussed.

  16. Resistance to stem rust Ug99 in six bread wheat cultivars maps to chromosome 6DS.

    Science.gov (United States)

    Lopez-Vera, Eric E; Nelson, Sarah; Singh, Ravi P; Basnet, Bhoja R; Haley, Scott D; Bhavani, Sridhar; Huerta-Espino, Julio; Xoconostle-Cazares, Beatriz G; Ruiz-Medrano, Roberto; Rouse, Matthew N; Singh, Sukhwinder

    2014-01-01

    Identified SSR markers ( Xcfd49 and Xbarc183 ) linked with stem rust resistance for efficient use in marker-assisted selection and stacking of resistance genes in wheat breeding programs. More than 80 % of the worldwide wheat (Triticum aestivum L.) area is currently sown with varieties susceptible to the Ug99 race group of stem rust fungus. However, wheat lines Niini, Tinkio, Coni, Pfunye, Blouk, and Ripper have demonstrated Ug99 resistance at the seedling and adult plant stages. We mapped stem rust resistance in populations derived from crosses of a susceptible parent with each of the resistant lines. The segregation of resistance in each population indicated the presence of a single gene. The resistance gene in Niini mapped to short arm of chromosome 6D and was flanked by SSR markers Xcfd49 at distances of 3.9 cM proximal and Xbarc183 8.4 cM distal, respectively. The chromosome location of this resistance was validated in three other populations: PBW343/Coni, PBW343/Tinkio, and Cacuke/Pfunye. Resistance initially postulated to be conferred by the SrTmp gene in Blouk and Ripper was also linked to Xcfd49 and Xbarc183 on 6DS, but it was mapped proximal to Xbarc183 at a similar position to previously mapped genes Sr42 and SrCad. Based on the variation in diagnostic marker alleles, it is possible that Niini and Pfunye may carry different resistance genes/alleles. Further studies are needed to determine the allelic relationships between various genes located on chromosome arm 6DS. Our results provide valuable molecular marker and genetic information for developing Ug99 resistant wheat varieties in diverse germplasm and using these markers to tag the resistance genes in wheat breeding.

  17. Geology of the U12n.07 UG-3 drill hole, area 12, Nevada Test Site

    International Nuclear Information System (INIS)

    Terry, S.S.; Cunningham, M.J.

    1975-11-01

    The U12n.07 UG-3 horizontal drill hole, located near the eastern edge of the center of Rainier Mesa, Nevada Test Site, was drilled to a total depth of 809 m (2,653 ft). This hole was drilled to further evaluate the tunnel-level stratigraph, and structure southwest of the U12n tunnel complex. The drill hole is collared in the middle of Tertiary tunnel bed 3A and penetrates upsection through tunnel beds 3 and 4 and terminates in subunit 4K, all of Tertiary age. Stratigraphy, structure, engineering geology, and physical properties and their relation to tunnel engineering are discussed

  18. Problems of Gas Pressure Build-up in Casing String of UGS and Gas Wells

    Directory of Open Access Journals (Sweden)

    Peter Sovius

    2006-10-01

    Full Text Available This paper consists of three basic parts. The opening part is a brief description of problems associated with the secondary untightness of UGS wells (Underground Gas Storages and gas wells generally.The main part of the paper is composed of some cases that we have met in our company. Solution proposals of various cases are also supplied in this part. Separate problem situations are described in terms of finding out an untight point and also a testing result and consequential removing of untightness.The conclusion includes knowledge summary that were taken by solution of complicatedsituations connected with well non-hermeticity.

  19. Principles of Good Practice in SoTL

    Science.gov (United States)

    Felten, Peter

    2013-01-01

    For the Scholarship of Teaching and Learning (SoTL) to be understood as significant intellectual work in the academy, SoTL practitioners need to identify shared principles of good practice. While honoring the diversity of SoTL in its many forms across the globe, such principles can serve as a heuristic for assessing work in our field. These…

  20. Activation analysis of thallium in urine using the 203Tl(n,2n) 202Tl reaction

    International Nuclear Information System (INIS)

    Korob, R.O.; Cohen, I.M.; Lage, M.; Baro, G.B.

    1976-04-01

    The method developed by the authors of thallium determination in human urine, based on the 203 Tl(n,2n) 202 Tl reaction followed by chemical separation and measurement of the produced 202 Tl by gamma spectrometry, is described. Its application in some cases of intoxication by thallium is reported. The advantages and limitations of the described technique are discussed. (author) [es

  1. Microcomputer control of automated TL reader

    International Nuclear Information System (INIS)

    Bjarland, B.

    1980-01-01

    An automatic TL reader has been developed for use within a TLD based personal monitoring service. A 6800 based microcomputer is used for system control, operator communication, calibration and checking of reader operation, and for output of data. The dosimeter identity code is printed in human readable characters on the dosimeter card, and is read by using an optical character recognition unit. The code may include individual sensitivity correction coefficients for the TL chips on the card. The chips are heated with hot nitrogen gas and the thermoluminescence is recorded by a photomultiplier tube circuit, the gain and offset of which are continuously monitored and, when necessary, adjusted, to maintain calibration. The reader may operate in any of seven modes, i.e. reading modes for three types of dosimeters, semiautomatic modes for production of the three types of dosimeters, and a monitor mode. (Auth.)

  2. Tl and OSL on diopside crystal

    International Nuclear Information System (INIS)

    Cano, N.F.; Watanabe, S.; Mittani, J.C.R.; Yukihara, E.G.

    2006-01-01

    The diopside with chemical composition CaMgSi 2 O 6 is part of an important solid solution series of the pyroxene group. The mineral is commonly found in meteorites and it is an important rock forming mineral of medium and high grade metamorphic rocks which are rich in calcium. In the bibliography it is possible to found several studies on electron spin resonance (ESR), reflectance, etc. but not on thermoluminescence (TL) or optically stimulated luminescence (OSL). In the present work we studied diopside TL and OSL behaviour on natural and natural irradiated samples. The sample used in our study is a white coloured diopside provided by Mineracao Sao Judas located in Sao Paulo, Brazil. The X-Ray Fluorescence technique has shown high concentrations of SiO 2 (55.81 % mol), CaO (23.47 % mol), MgO (18.03 % mol), Al 2 O 3 (1.56 % mol), Fe 2 O 3 (0.53 % mol), K 2 O (0.44 % mol), TiO 2 (0.065 % mol), P 2 O 5 (0.026 % mol), and MnO (0.013 % mol). TL measurements on natural samples show four TL peaks at 160, 260, 360, and 450 C. After beta-irradiation an increment mainly in the low temperature peaks is observed. As for OSL measurements, low OSL signal was observed on natural samples using blue light stimulation and UV detection. The intensity of the signal was observed to increase with the irradiation dose. (Author)

  3. Measurement of conversion coefficients in 208Tl

    International Nuclear Information System (INIS)

    Wendling, F.

    1976-06-01

    A electron spectrometer composed by a Li drifted Si detector and a uniform magnetic field was constructed. The magnetic field is used to focus the electrons on the detector and to filter the other radiations. After the construction the instrument was calibrated in absolute eficience and was used together with a Ge(Li) spectrometer also calibrated, in the measurement of internal conversion coeficients of the 433 and 453 keV transitions in 208 Tl [pt

  4. Improving TL dosimetry for external radiotherapy

    International Nuclear Information System (INIS)

    Bustos, S.R.; Velez, G.; Rubio, M.

    1998-01-01

    Full text: In vivo thermoluminescence dosimetry (TLD) has always been one of the most accurate dosimetry method for external radiotherapy control, but the delay in the response is a well know drawback when it is applied. In this work we show some improvements and demonstrate that keeping the precision and accuracy of this technique, it is possible to obtain a response in few hours. Harshaw 4000 TL reader and LiF TLD-100 dosimeters, chips (3,1 x 3,1 x 0,9 mm 3 ) and rods (1 x 1 x 6 mm 3 ) have been used. The thermal treatment necessary to reuse the TLD is only 1h at 400 degree C, by using a glow curve analyser developed at the Ciemat (Spain), that allows a complete, prompt and precise identification of the individuals peaks. The dosimeters are periodically and individually calibrated. We also have study the factors contributing to the relation TL-dose like linearity, energy correction, directional response and fading. All those results are included into an Excel worksheet which automatically give us the dose resulting from the TL reading (peaks areas 4 and 5). The obtained uncertainty is better than 5%. The TLD already irradiated in radiotherapy institutions distant 30-40 Km from our centre can be read and analysed in about 3-4 hours. These facts render our methods rapid and allow a better control of radiotherapy treatment even if it is bi-fractionated. (author) [es

  5. Thallium (Tl) sorption onto illite and smectite: Implications for Tl mobility in the environment

    Science.gov (United States)

    Martin, Loïc A.; Wissocq, Aubéry; Benedetti, M. F.; Latrille, Christelle

    2018-06-01

    Clay minerals play a relevant role in the transport and fate of trace elements in the environment. Though illite has been referred as an important Thallium (Tl) bearing phase in soils, mechanisms and affinity of thallium for clay minerals remain poorly known. This study investigated the sorption behavior of thallium as Tl(I) onto illite and smectite, two clay minerals occurring mainly in soils and sediments. Different sorption experiments were carried out under various pH conditions and Tl concentrations, in competition with sodium and calcium at a constant ionic strength of 0.01 mol L-1. Our results showed that illite displayed more affinity than smectite for thallium. With illite, the distribution coefficients (Kd in L kg-1) varied between 102.75 ± 0.17 and 104.0 ± 0.17 in Na solutions versus between 102.25 ± 0.17 and 103.0 ± 0.17 in Ca solutions, depending on pH. With smectite, Kd (in L kg-1) ranged between 102.50 ± 0.16 and 103.20 ± 0.16 and between 101.25 ± 0.16 and 101.95 ± 0.16 in Na and Ca solutions, respectively. Sorption behavior was described with the Multi-Site Ion Exchanger model and selectivity coefficients with respect to protons were calculated for the first time. In all cases, independently of clay mineral and background electrolyte, low capacity but highly reactive sites were dominant in thallium uptake, highlighting Tl affinity for those sites. Moreover, the exchangeable and reversible interactions between Tl+ and clays reactive sites suggested that in changing conditions, thallium could be released in solution. The role of clay minerals in thallium environmental cycle is evident and confirmed illite to be a dominant Tl bearing phase, in some environment competing with manganese oxides. Compared to others Tl bearing mineral phases, clays are ranked as follows: MnO2 > illite > smectite ∼ ferrihydrite ≥ Al2O3 ∼ goethite > SiO2. Finally, over the three monovalent cations (Tl, Rb, Cs) Tl is the one less sorbed on illite independently of

  6. Commentary: "An Evaluation of Universal Grammar and the Phonological Mind"-UG Is Still a Viable Hypothesis.

    Science.gov (United States)

    Berent, Iris

    2016-01-01

    Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett's concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett's logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett's arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett's arguments hardly undermine the viability of this hypothesis.

  7. Commentary: “An Evaluation of Universal Grammar and the Phonological Mind”—UG Is Still a Viable Hypothesis

    Science.gov (United States)

    Berent, Iris

    2016-01-01

    Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett’s concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett’s logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett’s arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett’s arguments hardly undermine the viability of this hypothesis. PMID:27471480

  8. An investigation into breast imaging as part of the undergraduate (UG) education of diagnostic radiography students in the UK

    International Nuclear Information System (INIS)

    Strudwick, R.M.; Taylor, K.

    2017-01-01

    Introduction: How mammography is incorporated into undergraduate (UG) radiography training may influence student perception of the speciality and its potential as a future career option. An overview is provided of the academic and clinical content of UG radiography courses relating to mammography across the UK. Methods: Using mixed methods and an iterative, inductive approach supplying quantitative and qualitative data, we identify any variations and discuss possible causes which may help influence future training strategies. A self-designed questionnaire containing open and closed questions was sent online using SurveyMonkey™ to course leaders of all Higher Education Institutions (HEIs) offering BSc (Hons) Diagnostic Radiography courses in the UK. Responses were analysed for trends which were further explored by semi structured telephone interviews. These were transcribed and evaluated using a thematic analysis, the themes being categorised and coded. Results: 19 of 24 (79%) HEIs responded to the questionnaire. Follow up telephone interviews were conducted with five course leaders to further explore themes. Academic teaching ranged from 3 to 25 h over the 3 year course. Compared to other specialities 10 (53%) HEIs spent less time on mammography with 12 (63%) citing HCPC standards as the reason. 11 (65%) HEIs sent students on mammography placements, 2 (12%) sent females only. Placement times ranged between 2 days and 2 weeks. Influences included availability of expert teaching and relationship with clinical departments. Conclusion: There is variation in undergraduate exposure to mammography. Students views should be sought to add validity to these findings - Highlights: • A summary of undergraduate (UG) breast imaging in the UK. • Themes around the delivery of UG breast imaging education in university and practice. • Opinions of UG course leaders and other stakeholders about UG breast imaging education. • There is a variation across UK universities in

  9. The strongest magnetic barrier in the DIII-D tokamak and comparison with the ASDEX UG

    Science.gov (United States)

    Ali, Halima; Punjabi, Alkesh

    2013-05-01

    Magnetic perturbations in tokamaks lead to the formation of magnetic islands, chaotic field lines, and the destruction of flux surfaces. Controlling or reducing transport along chaotic field lines is a key challenge in magnetically confined fusion plasmas. A local control method was proposed by Chandre et al. [Nucl. Fusion 46, 33-45 (2006)] to build barriers to magnetic field line diffusion by addition of a small second-order control term localized in the phase space to the field line Hamiltonian. Formation and existence of such magnetic barriers in Ohmically heated tokamaks (OHT), ASDEX UG and piecewise analytic DIII-D [Luxon, J.L.; Davis, L.E., Fusion Technol. 8, 441 (1985)] plasma equilibria was predicted by the authors [Ali, H.; Punjabi, A., Plasma Phys. Control. Fusion 49, 1565-1582 (2007)]. Very recently, this prediction for the DIII-D has been corroborated [Volpe, F.A., et al., Nucl. Fusion 52, 054017 (2012)] by field-line tracing calculations, using experimentally constrained Equilibrium Fit (EFIT) [Lao, et al., Nucl. Fusion 25, 1611 (1985)] DIII-D equilibria perturbed to include the vacuum field from the internal coils utilized in the experiments. This second-order approach is applied to the DIII-D tokamak to build noble irrational magnetic barriers inside the chaos created by the locked resonant magnetic perturbations (RMPs) (m, n)=(3, 1)+(4, 1), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation with amplitude δ. A piecewise, analytic, accurate, axisymmetric generating function for the trajectories of magnetic field lines in the DIII-D is constructed in magnetic coordinates from the experimental EFIT Grad-Shafranov solver [Lao, L, et al., Fusion Sci. Technol. 48, 968 (2005)] for the shot 115,467 at 3000 ms in the DIII-D. A symplectic mathematical map is used to integrate field lines in the DIII-D. A numerical algorithm [Ali, H., et al., Radiat. Eff. Def. Solids Inc. Plasma Sc. Plasma Tech. 165, 83

  10. New colour centres in KCl:(Tl+ + Ca2+) and KCl:(Tl+ + Sr2+) crystals

    International Nuclear Information System (INIS)

    Ioan, A.; Topa, V.; Giurgea, M.

    1978-01-01

    Electrolytic colouring under unusual conditions (low temperature and high voltage) gives rise to the appearance of three new absorption bands peaking at 3.2, 2.5, and 1.7 eV and at 2.8, 2.1, and 1.5 eV in KCl:(Tl + + Ca 2+ ) and in KCl:(Tl + + Sr 2+ ) single crystals, respectively. The modifications of the absorption spectra of the coloured crystals induced by the application of a reversed electric field at the colouring temperature or by heat treatment are investigated. It is likely that the colour centre responsible for the new absorption bands is an aggregate centre which, besides an Tl - -complex, contains also at least an Ca(Sr) ion, a trapped electron, and an anionic vacancy. (author)

  11. ORF Alignment: NC_003552 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... acetivorans str. C2A] ... Length = 291 ... Query: 27 ... CASPTAPIVYIDTDGSGDYNCDGKNDHIEINEALSFVNKNSDFTTVHLNGSNTYWIND...TL 86 ... CASPTAPIVYIDTDGSGDYNCDGKNDHIEINEALSFVNKNSDFTTVHLNGSNTYWIND...TL Sbjct: 1 ... CASPTAPIVYIDTDGSGDYNCDGKNDHIEINEALSFVNKNSDFTTVHLNGSNTYWINDTL 60 ... Query: 147 GNSFYNM

  12. Copper interactions in TlCu7S4 and TlCu7Se4

    International Nuclear Information System (INIS)

    Noren, L.; Delaplane, R.G.; Berger, R.

    1999-01-01

    Complete text of publication follows. The copper chalcogenides ACu 7 S 4 (A=NH 4 + , Tl + , Rb + ) are quasi-one-dimensional metals at ambient and higher temperatures which is due to the high mobility of copper in these structures. TlCu 7 S 4 and TlCu 7 Se 4 are isostructural compounds, space group I4/m, which can be described on the basis of a TlX 8 cube with two different Cu sites, Cu(1) and Cu(2). Cu(2)-Cu(2) zigzag chains run along the c axis with only 3/4 occupation of the Cu(2) sites. However, these two compounds differ in behaviour on cooling. The sulphide shows a polymorphic first-order transition to the CsAg 7 S 4 type (P4/n) owing to ordering of the vacancies in the Cu(2)-Cu(2) chains. In order to study the nature of the Cu(2) order/disorder in the two title compounds, a series of neutron diffraction measurements (both Bragg and diffuse scattering) were made at several temperatures from 40 to 713 K on the instrument SLAD at Studsvik. The structure at each temperature was modelled using RMC techniques. The resulting configuration show that as the temperature increases, there is a marked increase in the mobility of the Cu atoms in the Cu(2)-Cu(2) chains for TlCu 7 S 4 but not for TlCu 7 Se 4 . This is due to the initial difference in the Cu(2)-Cu(2) distances, only 2.2A for the thiocuprate, but 2.7A in the selenocuprate which explains the relative ease for Cu(2) ordering in the latter case. (author)

  13. Insight on a novel layered semiconductors: CuTlS and CuTlSe

    Energy Technology Data Exchange (ETDEWEB)

    Aliev, Ziya S., E-mail: ziyasaliev@gmail.com [Institute of Catalysis and Inorganic Chemistry, ANAS, H.Javid ave. 113, AZ1143 Baku (Azerbaijan); Institute of Physics, ANAS, H.Javid ave. 131, AZ1143 Baku (Azerbaijan); Donostia International Physics Center (DIPC), 20080 San Sebastian (Spain); Zúñiga, Fco. Javier [Departamento de Física de la Materia Condensada, Facultad de Ciencia y Tecnología, Universidad del País Vasco, Apdo. 644, 48080 Bilbao (Spain); Koroteev, Yury M. [Institute of Strength Physics and Materials Science, Russian Academy of Sciences, Siberian Branch, 634055 Tomsk (Russian Federation); Tomsk State University, Tomsk, 634050 (Russian Federation); Breczewski, Tomasz [Departamento de Física de la Materia Condensada, Facultad de Ciencia y Tecnología, Universidad del País Vasco, Apdo. 644, 48080 Bilbao (Spain); Babanly, Nizamaddin B. [Institute of Catalysis and Inorganic Chemistry, ANAS, H.Javid ave. 113, AZ1143 Baku (Azerbaijan); Amiraslanov, Imamaddin R. [Institute of Physics, ANAS, H.Javid ave. 131, AZ1143 Baku (Azerbaijan); Politano, Antonio [Department of Physics, University of Calabria, 87036 Rende (CS) (Italy); Madariaga, Gotzon [Departamento de Física de la Materia Condensada, Facultad de Ciencia y Tecnología, Universidad del País Vasco, Apdo. 644, 48080 Bilbao (Spain); Babanly, Mahammad B. [Institute of Catalysis and Inorganic Chemistry, ANAS, H.Javid ave. 113, AZ1143 Baku (Azerbaijan); and others

    2016-10-15

    Single crystals of the ternary copper compounds CuTlS and CuTlSe have been successfully grown from stoichiometric melt by using vertical Bridgman-Stockbarger method. The crystal structure of the both compounds has been determined by powder and single crystal X-Ray diffraction. They crystallize in the PbFCl structure type with two formula units in the tetragonal system, space group P4/nmm, a=3.922(2); c=8.123(6); Z=2 and a=4.087(6); c=8.195(19) Å; Z=2, respectively. The band structure of the reported compounds has been analyzed by means of full-potential linearized augmented plane-wave (FLAPW) method based on the density functional theory (DFT). Both compounds have similar band structures and are narrow-gap semiconductors with indirect band gap. The resistivity measurements agree with a semiconductor behavior although anomalies are observed at low temperature. - Graphical abstract: The crystal structures of CuTl and CuTlSe are isostructural with the PbFCl-type and the superconductor LiFeAs-type tetragonal structure. The band structure calculations confirmed that they are narrow-gap semiconductors with indirect band gaps of 0.326 and 0.083 eV. The resistivity measurements, although confirming the semiconducting behavior of both compounds exhibit unusual anomalies at low temperatures. - Highlights: • Single crystals of CuTlS and CuTlSe have been successfully grown by Bridgman-Stockbarger method. • The crystal structure of the both compounds has been determined by single crystal XRD. • The band structure of the both compounds has been analyzed based on the density functional theory (DFT). • The resistivity measurements have been carried out from room temperature down to 10 K.

  14. Tl-201 per rectum scintigraphy in chronic liver disease: assessment of Tl-201 uptake indices

    International Nuclear Information System (INIS)

    Moon, Won Jin; Choi, Yun Young; Cho, Suk Shin; Lee, Min Ho

    1999-01-01

    Heart to liver ratio on Tl-201 per rectal scintigraphy (shunt index) is known to be useful in the assessment of portal systemic shunt. We assessed Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 and correlated with shunt index in patients with chronic active hepatitis (CAH) and liver cirrhosis (LC). Fifty eight patients with biopsy-proven chronic liver disease (35 with CAH, 23 with LC) underwent Tl-201 per rectum scintigraphy after instillation of 18.5 MBq of Tl-201 into the upper rectum. We evaluated hepatic uptake (type 1: homogeneous, 2: inhomogeneous segmental, 3: inhomogeneous nonsegmental) and extrahepatic uptake of spleen, heart and kidney (grade 0: no uptake, 1: less than liver, 2: equal to liver, 3: greater than liver). We measured the early liver/heart uptake rate (the slope of the liver to heart uptake ratio for 10 mim) and shunt index (heart to liver uptake ratio). Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 was correlated with the pathologic diagnosis and shunt index. Hepatic uptake patterns of type 1 and 2 were dominant in CAH (CAH: 27/35, LC: 8/23), and type 3 in LC (CAH: 8/35, LC: 15/23)(p<0.005). The grades of extrahepatic uptake were higher in LC than in CAH (spleen: p<0.001, other soft tissue: p<0.005). The early liver/heart uptake rate of CAH (0.110±0.111) was significantly higher than that of LC (0.014±0.090)(p<0.001). The sensitivity and specificity of the early liver/heart uptake rate were 77.7% and 67.7% in differentiating LC from CAH. There was negative correlation between early liver/heart uptake rate and shunt index (r=-0.3347, p<0.01). Hepatic and extrahepatic uptake pattern and early liver/heart uptake rate on Tl-201 per rectum scintigraphy are useful in the assessment of portal systemic shunt in patients with chronic liver disease

  15. 207Pb and 205Tl NMR on Perovskite Type Crystals APbX3 (A = Cs, Tl, X = Br, I)

    Science.gov (United States)

    Sharma, Surendra; Weiden, Norbert; Weiss, Alarich

    1987-11-01

    By 205Tl and 207Pb NM R the chemical shift in polycrystalline samples of binary halides AX, BX2 and ternary halides ABX3 (A = Cs, Tl; B = Pb; X = Br, I) was studied at room temperature. The chemical shift tensors δ ( 205Tl) and δ (207Pb) were determined in magnitude and orientation on single crystals of the orthorhombic TlPbI3. The components of the δ(205Tl) tensor are δx (205Tl) || a = 611ppm; δy (205Tl) || b = 680 ppm; δZ(205Tl) || c = 1329 ppm; δiso(205Tl) = 873.3 ppm (with respect to 3.4 molar aqueous solution of TlOOCCH3). The chemical shift tensor of 207Pb in TlPbI3 shows two orientations. One of them is: δx (207Pb) = 3760 ppm, inclined 30° from b towards c, δy(207Pb) || a = 3485 ppm, δz(207Pb) = 2639 ppm inclined 120° from b towards c. δiso(207Pb) = 3295 ppm (with respect to saturated aqueous solution of Pb(NO3)2). The results are discussed with respect to the crystal structure and a model to explain orientation and anisotropy of the tensors δ(205Tl) and δ(207Pb) in TlPbI3 is proposed. In the system CsPbBr3-x Ix δ(207Pb) was studied on polycrystalline samples. The chemical shift increases with increasing x and negative excess shift is observed.

  16. Intrinsic thermoluminescence of NaCl:Tl in UV dosimetry

    International Nuclear Information System (INIS)

    Barghare, S.P.; Joshi, R.V.; Joshi, T.R.; Kathuria, S.P.

    1982-01-01

    NaCl:Tl(T) phosphor is found to have high intrinsic thermoluminescence (TL) sensitivity to 253.7 nm UV-radiation. The dosimetric glow peak II grows sublinearly with increase in UV dose in the range 10 3 to 10 6 JM -2 . The other requirements of an efficient dosimeter material such as high storage stability, matching of the spectral response of detector tube and TL-emission from phosphor, reproducibility, desirable size and shape, easy availability in powder, pellet and crystal forms at cheaper rates, and repeated re-usability of the same phosphor without much difficulty, etc., are additional factors which strengthen the claim of NaCl:Tl(T) phosphor as UV dosimetric material. It is proposed that present NaCl:Tl(T) material is suitable TL-phosphor for UV dosimetry in the range 10 3 to 10 6 JM -2 . (author)

  17. Improvements in the Tl dosimetry for Radiotherapy

    International Nuclear Information System (INIS)

    Bustos, S.; Velez, G.; Rubio, M.

    1998-01-01

    The thermoluminescent dosimetry (TLD) in vivo has been demonstrated to be one of the most reliable for the control of radiotherapeutic treatments, but the delay in the response is the main disadvantage in its applicability. In this work are presented important improvements and it is demonstrated that maintaining the accuracy and reliability of the technique, it is possible to accelerate the response times at a few hours. To realize this work is utilized a lecturer Harshaw 4000, dosemeters LiF-TLD-100 chips (3.1 x 3.1 x 0.89 mm 3 ) and rods (1 x 1 x 6 mm 3 ). With the implementation of a glow curve analysis program developed in CIEMAT, its obtained a Tl peaks separation in such manner rapid and accurate, by that the thermal treatment of dosemeters may be reduced at one unique annealing pre-irradiation for 1 hr at 400 Centigrade. It is realized a periodical and individual calibration of the TLD and a study of the factors which influencing the ratio Tl signal-dose as linearity, correction by energy, directional response and pride of Tl signal. the results of this study are introducing in a calculation list specially designed and which allows to obtain absorbed dose by TLD starting of the dates (dosimetric peaks area) which appear of the glow curves analysis. The dose is obtained with an accuracy less than 5 %. The dosemeters already irradiated (in vivo) are analysed and informed in only four hours, allowing a greater control of the treatment and a correction of the possible errors for the next session, still in bi fractional treatments. The method implemented results thus accurate, rapid and reliable. (Author)

  18. The TL dating of ancient porcelain

    International Nuclear Information System (INIS)

    Leung, P.L.; Stokes, M.J.; Wang Weida; Xia Junding; Zhou Zhixin

    1997-01-01

    The age determination of ancient porcelain using the pre-dose technique in TL dating was reported. The variation of beta dose with depth below the surface of the porcelain slice, the thermal activation characteristic (TAC) for 110 degree C peak, the measurement of paleodose and the estimation of annual dose were studied. The results show that this technique is suitable for authenticity testing of ancient porcelain, but both accuracy and precision for porcelain dating are worse than those for pottery, because porcelain differs from pottery on composition, structure and firing temperature. Besides, some complicated factors in the pre-dose technique would be the possible cause of the greater errors

  19. Prediction of Phase Separation of Immiscible Ga-Tl Alloys

    Science.gov (United States)

    Kim, Yunkyum; Kim, Han Gyeol; Kang, Youn-Bae; Kaptay, George; Lee, Joonho

    2017-06-01

    Phase separation temperature of Ga-Tl liquid alloys was investigated using the constrained drop method. With this method, density and surface tension were investigated together. Despite strong repulsive interactions, molar volume showed ideal mixing behavior, whereas surface tension of the alloy was close to that of pure Tl due to preferential adsorption of Tl. Phase separation temperatures and surface tension values obtained with this method were close to the theoretically calculated values using three different thermodynamic models.

  20. Root cause analysis of the fatigue failures of the pulsation dampers of a large underground gas storage (UGS) system

    NARCIS (Netherlands)

    Eijk, A.; Lange, D. de; Maljaars, J.; Tenbrock-Ingenhorst, A.; Gottmer, A.

    2014-01-01

    Two large identical 6-cylinder Ariel JGB/6 reciprocating compressors each of 7.5 MW, are used for an underground gas storage system (UGS) plant of RWE Gasspeicher GmbH located in Epe, Germany. The system is in operation since 2005. In 2011 several internals parts (baffle plates and baffle choke

  1. Identification and validation of single nucleotide polymorphic markers linked to Ug99 stem rust resistance in spring wheat

    Science.gov (United States)

    Wheat stem rust (Puccinia graminis f. sp. tritici Eriks. and E. Henn.) is one of the most destructive diseases world-wide. Races belonging to Ug99 (or TTKSK) continue to cause crop losses in East Africa and threaten global wheat production. Developing and deploying wheat varieties with multiple race...

  2. Genomic analysis of a novel gene conferring resistance to Ug99 stem rust in Triticum turgidum ssp. dicoccum

    Science.gov (United States)

    Wheat production is threatened by the disease stem rust, which is caused by the biotrophic fungal pathogen Puccinia graminis Pers.:Pers. f. sp. tritici (Pgt). Among all known Pgt races, TTKSK (Ug99) and TRTTF are significant threats to North American wheat production due to their virulence against f...

  3. Identification and characterization of Sr13, a tetraploid wheat gene that confers resistance to the Ug99 stem rust race group

    Science.gov (United States)

    The Puccinia graminis f. sp. tritici (Pgt) Ug99 race group is virulent to most stem rust resistance genes currently deployed in wheat and poses a serious threat to global wheat production. The durum wheat (Triticum turgidum ssp. durum) gene Sr13 confers resistance to Ug99 in addition to virulent rac...

  4. Characterization of cartilaginous tumors with 201Tl scintigraphy

    International Nuclear Information System (INIS)

    Higuchi, Takahiro; Taki, Junichi; Sumiya, Hisashi; Kinuya, Seigo; Nakajima, Kenichi; Tonami, Norihisa

    2005-01-01

    Histological diagnosis and grading of cartilaginous tumors are closely correlated with patient prognosis; consequently, they are essential elements. We attempted to clarify the characteristics of 201 Tl uptake in various histological types of cartilaginous tumors and to assess its clinical value. Twenty-two cases with histologically proven cartilaginous tumors (3 enchondromas, 15 conventional chondrosarcomas (grade I=9, II=5, III=1), 3 mesenchymal chondrosarcomas, and 1 de-differentiated chondrosarcoma) were examined retrospectively. Planar 201 Tl images were recorded 15 mm following intravenous injection of 201 Tl (111 MBq). 201 Tl uptake in the tumor was evaluated visually employing a five-grade scoring system: 0=no appreciable uptake, 1=faint uptake above the background level, 2=moderate uptake, 3=intense uptake but lower than heart uptake and 4=uptake higher than heart uptake. 201 Tl uptake scores were 0 in 3 of 3 enchondromas, 9 of 9 grade I, and 4 of 5 grade II conventional chondrosarcomas. 201 Tl uptake scores were 1 among 1 of 5 grades II and a grade III conventional chondrosarcoma. Mesenchymal chondrosarcoma and de-differentiated chondrosarcoma displayed 201 Tl uptake scores of 2 or 3. Absence of elevated 201 Tl uptake in cartilaginous tumors was indicative of enchondroma or low-grade conventional chondrosarcoma. However, in instances in which 201 Tl uptake is obvious, high-grade chondrosarcoma or variant types should be considered. (author)

  5. Methods, qualitative and quantitative evaluations of 201Tl myocardial scintiscans

    International Nuclear Information System (INIS)

    Buell, U.; Kleinhans, E.; Klepzig, M.; Seiderer, M.; Strauer, B.E.

    1981-01-01

    Exercise 201 Tl myocardial scintiscanning is a technique used to supplement exercise electrocardiography. The procedure employed should be identical to the standard procedure of electrocardiography. If the coronary disease has already been established by coronary angiography and kineventriculography, 201 Tl examinations should be carried out before surgery in order to determine the ''regional functional reserve''. Visual evaluations of the 201 Tl scintiscans should be supplemented by quantification methods. Quantification is also required between 201 Tl examination and surgery and to assure constant diagnostic accuracy in case of examination by different examiners. (orig./MG) [de

  6. NaI(Tl) response functions

    International Nuclear Information System (INIS)

    Vega C, H. R.; Ortiz R, J. M.; Benites R, J. L.; De Leon M, H. A.

    2015-09-01

    The response functions of a NaI(Tl) detector have been estimated using Monte Carlo methods. Response functions were calculated for monoenergetic photon sources (0.05 to 3 MeV). Responses were calculated for point-like sources and for sources distributed in Portland cement cylinders. The responses were used to calculate the efficiency functions in term of photon energy. Commonly, sources used for calibration are point-like, and eventually sources to be measured have different features. In order to use the calibrated sources corrections due to solid angle, self-absorption and scattering, must be carried out. However, some of these corrections are not easy to perform. In this work, the calculated responses were used to estimate the detector efficiency of point-like sources, and sources distributed in Portland type cement. Samples of Portland paste were prepared and were exposed to photoneutrons produced by a 15 MV linac. Some of the elements in the cement were activated producing γ-emitting radionuclides that were measured with a NaI(Tl) gamma-ray spectrometer, that was calibrated with point-like sources. In order to determine the specific activity in the induced radioisotopes calculated efficiencies were used to make corrections due to the differences between the solid angle, photon absorption and photon scattering in the point-like calibration sources and the sources distributed in cement. During the interaction between photoneutrons and the cement samples three radioisotopes were induced: 56 Mn, 24 Na, and 28 Al. (Author)

  7. [Tl(III)(dota)](-): An Extraordinarily Robust Macrocyclic Complex.

    Science.gov (United States)

    Fodor, Tamás; Bányai, István; Bényei, Attila; Platas-Iglesias, Carlos; Purgel, Mihály; Horváth, Gábor L; Zékány, László; Tircsó, Gyula; Tóth, Imre

    2015-06-01

    The X-ray structure of {C(NH2)3}[Tl(dota)]·H2O shows that the Tl(3+) ion is deeply buried in the macrocyclic cavity of the dota(4-) ligand (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate) with average Tl-N and Tl-O distances of 2.464 and 2.365 Å, respectively. The metal ion is directly coordinated to the eight donor atoms of the ligand, which results in a twisted square antiprismatic (TSAP') coordination around Tl(3+). A multinuclear (1)H, (13)C, and (205)Tl NMR study combined with DFT calculations confirmed the TSAP' structure of the complex in aqueous solution, which exists as the Λ(λλλλ)/Δ(δδδδ) enantiomeric pair. (205)Tl NMR spectroscopy allowed the protonation constant associated with the protonation of the complex according to [Tl(dota)](-) + H(+) ⇆ [Tl(Hdota)] to be determined, which turned out to be pK(H)Tl(dota) = 1.4 ± 0.1. [Tl(dota)](-) does not react with Br(-), even when using an excess of the anion, but it forms a weak mixed complex with cyanide, [Tl(dota)](-) + CN(-) ⇆ [Tl(dota)(CN)](2-), with an equilibrium constant of Kmix = 6.0 ± 0.8. The dissociation of the [Tl(dota)](-) complex was determined by UV-vis spectrophotometry under acidic conditions using a large excess of Br(-), and it was found to follow proton-assisted kinetics and to take place very slowly (∼10 days), even in 1 M HClO4, with the estimated half-life of the process being in the 10(9) h range at neutral pH. The solution dynamics of [Tl(dota)](-) were investigated using (13)C NMR spectroscopy and DFT calculations. The (13)C NMR spectra recorded at low temperature (272 K) point to C4 symmetry of the complex in solution, which averages to C4v as the temperature increases. This dynamic behavior was attributed to the Λ(λλλλ) ↔ Δ(δδδδ) enantiomerization process, which involves both the inversion of the macrocyclic unit and the rotation of the pendant arms. According to our calculations, the arm-rotation process limits the Λ(λλλλ) ↔

  8. 33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

  9. Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows

    International Nuclear Information System (INIS)

    Osborne, P.E.

    2002-01-01

    The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of 233 U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF 6 and subsequent steam treatments of UO 2 F 2 . For each mole of UF 6 converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance

  10. Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows

    Energy Technology Data Exchange (ETDEWEB)

    Osborne, P.E.

    2002-09-11

    The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of {sup 233}U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF{sub 6} and subsequent steam treatments of UO{sub 2}F{sub 2}. For each mole of UF{sub 6} converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance.

  11. Phytotoxicity of thallium (Tl) in culture solution. Pt. 1. Effects of Tl(I) on the growth and heavy metal contents of pea and field bean plants

    Energy Technology Data Exchange (ETDEWEB)

    Poetsch, U; Austenfeld, F A

    1985-01-01

    The effects of TlNO/sub 3/ and Tl(I)EDTA on growth and heavy metal contents of pea plants and field bean plants were compared in hydroponic culture experiments. In the presence of TlNO/sub 3/, the essential heavy metals were available to the plants in their ionic forms. When Tl(I)EDTA was present the essential heavy metals were available as chelated complexes. With increasing concentration of TlNO/sub 3/ dry matter production of pea plants was lowered and the Tl content of each organ was increased. The highest Tl content was found within the stems. The increased Tl contents were accompanied by depressed Mn, Zn, and Cu contents of the roots and depressed Mn contents of the stems, but increased Fe contents of the stems. Substitution of TlNO/sub 3/ by Tl(I)EDTA resulted in a stronger growth inhibition of the pea plants, and higher Tl contents of each organ. The highest Tl content was found within the stems. Tl(I)EDTA depressed Mn in the roots, but increased Fe and Mn in the stems, and Fe, Zn and Cu in the leaves. The increases may due to concentration by growth inhibition. The growth of the field bean was not effected by TlNO/sub 3/ nor by Tl(I)EDTA. The field bean contained most of the Tl within the roots and translocated only relatively small amounts to the shoots. This pattern was independent of the Tl compound. Increasing concentrations of TlNO/sub 3/ resulted in depressed Mn and Zn contents of the roots, and Mn contents of the stems. Chelation of Tl(I) resulted in a decrease of the Tl content of each organ. Tl(I)EDTA depressed only the Mn content of the roots.

  12. The TL and OSL study of hydroxyapatites for dosimetric applications

    International Nuclear Information System (INIS)

    Alencar, Marcus A. Vallim de

    2009-01-01

    The hydroxyapatite, the principal mineral component of the bone and tooth enamel, is one of the dosimetric materials that has distinguished itself in the high dose and accidents dosimetry, as well as in the dating, for the Electron Paramagnetic Resonance (EPR) technique. For this reason, the hydroxyapatite could also be used as Thermoluminescence (TL) and Optically Stimulated Luminescence (OSL) dosimeter in the dosimetry of high doses and accidents, and also in the archaeological and geological dating. This work presents a brief study of the TL and OSL behaviour of the B type synthetic carbonated hydroxyapatite, observing the possibility to use this material in TL and OSL dosimetry. The samples were irradiated to a dose of 100 Gy and 1000 Gy, and the TL and OSL measurements were obtained by the RISOE TL/OSL reader, model TL/OSL-DA-15B. The first results demonstrate the presence of three peaks in the TL glow curve in the temperatures of 100 deg C, 150 deg C and 280 deg C. The synthetic carbonated hydroxyapatite also presents an OSL signal when the sample is stimulated with blue light and a small OSL signal for stimulation with infrared light (IR). These results indicate the possibility of this synthetic carbonated hydroxyapatite to be used as dose indicator material using the TL and OSL techniques. (author)

  13. Leading the Charge for SoTL--Embracing Collaboration

    Science.gov (United States)

    Cassard, Anita; Sloboda, Brian

    2014-01-01

    The scholarship of teaching and learning (SoTL) enables colleges and universities to assess student learning and measure the outcomes by engaging in meaningful research, and to disseminate this research. The objective of this paper is to give a snapshot of and assess the current thinking behind this scholarship by presenting examples of SoTL, and…

  14. Abnormal 201Tl limb scan due to unilateral tremor

    International Nuclear Information System (INIS)

    Simons, M.; Schelstraete, K.; Bratzlavsky, M.

    1982-01-01

    A abnormal intra- and interextremity distribution pattern on 201 Tl was observed on the limb scan of a patient with a unilateral tremor. This is ascribed to the increased blood flow in the muscles responsible for the tremor. The suggestion is made that the existence of tremor should be considered as a possible explanation for unexpected abnormalities on 201 Tl limb scintigrams

  15. Kinetic parameters and TL mechanism in cadmium tetra borate phosphor

    International Nuclear Information System (INIS)

    Annalakshmi, O.; Jose, M.T.; Sridevi, J.; Venkatraman, B.; Amarendra, G.; Mandal, A.B.

    2014-01-01

    Polycrystalline powder samples of cadmium tetra borate were synthesized by a simple solid state sintering technique and gamma irradiated sample showed a simple Thermoluminescence (TL) glow peak around 460 K. The TL kinetic parameters of gamma irradiated phosphor were determined by initial rise (IR), isothermal decay (ID), peak shape (PS), variable heating rate (VHR) and glow curve de-convolution method. The kinetic parameters such as activation energy (E), frequency factor (s) and order of kinetics (b) were calculated by IR, ID, PS and VHR methods are in the order of ∼1.05 eV, 10 9 –10 12 s −1 and 1.58, respectively. From the results of TL and PL emission studies carried out on the phosphor revealed that the defect centers related to TL is different from that for PL. EPR measurements were carried out to identify the defect centers formed in cadmium tetra borate phosphor on gamma irradiation. Based on EPR studies the mechanism for TL process in cadmium tetra borate is proposed in this paper -- Highlights: • Polycrystalline powder samples of undoped cadmium tetra borate synthesized. • Cadmium tetra borate phosphor exhibits a dosimetric peak at 458 K. • Kinetic parameters of the trap responsible for TL evaluated. • TL mechanism is proposed from TL to EPR correlation studies

  16. Kinetic parameters and TL mechanism in cadmium tetra borate phosphor

    Energy Technology Data Exchange (ETDEWEB)

    Annalakshmi, O. [Radiological Safety Division, Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Jose, M.T., E-mail: mtj@igcar.gov.in [Radiological Safety Division, Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Sridevi, J. [Central Leather Research Institute, Council of Scientific and Industrial Research, Chennai 600 020, Tamilnadhu (India); Venkatraman, B. [Radiological Safety Division, Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Amarendra, G. [Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Mandal, A.B. [Central Leather Research Institute, Council of Scientific and Industrial Research, Chennai 600 020, Tamilnadhu (India)

    2014-03-15

    Polycrystalline powder samples of cadmium tetra borate were synthesized by a simple solid state sintering technique and gamma irradiated sample showed a simple Thermoluminescence (TL) glow peak around 460 K. The TL kinetic parameters of gamma irradiated phosphor were determined by initial rise (IR), isothermal decay (ID), peak shape (PS), variable heating rate (VHR) and glow curve de-convolution method. The kinetic parameters such as activation energy (E), frequency factor (s) and order of kinetics (b) were calculated by IR, ID, PS and VHR methods are in the order of ∼1.05 eV, 10{sup 9}–10{sup 12} s{sup −1} and 1.58, respectively. From the results of TL and PL emission studies carried out on the phosphor revealed that the defect centers related to TL is different from that for PL. EPR measurements were carried out to identify the defect centers formed in cadmium tetra borate phosphor on gamma irradiation. Based on EPR studies the mechanism for TL process in cadmium tetra borate is proposed in this paper -- Highlights: • Polycrystalline powder samples of undoped cadmium tetra borate synthesized. • Cadmium tetra borate phosphor exhibits a dosimetric peak at 458 K. • Kinetic parameters of the trap responsible for TL evaluated. • TL mechanism is proposed from TL to EPR correlation studies.

  17. The role of unattended ground sensors (UGS) in regional confidence building and arms control

    Energy Technology Data Exchange (ETDEWEB)

    Vannoni, M.; Duggan, R.

    1997-03-01

    Although the Cold War has ended, the world has not become more peaceful. Without the stability provided by an international system dominated by two super-powers, local conflicts are more likely to escalate. Agreements to counter destabilizing pressures in regional conflicts can benefit from the use of cooperative monitoring. Cooperative monitoring is the collecting, analyzing, and sharing of information among parties to an agreement. Ground sensor technologies can contribute to the collection of relevant information. If implemented with consideration for local conditions, cooperative monitoring can build confidence, strengthen existing agreements, and set the stage for continued progress. This presentation describes two examples: the Israeli-Egyptian Sinai agreements of the 1970s and a conceptual example for the contemporary Korean Peninsula. The Sinai was a precedent for the successful use of UGS within the context of cooperative monitoring. The Korean Peninsula is the world`s largest military confrontation. Future confidence building measures that address the security needs of both countries could decrease the danger of conflict and help create an environment for a peace agreement.

  18. ESR and TL age determination of caliche nodules

    Energy Technology Data Exchange (ETDEWEB)

    Oezer, A.M. (Middle East Technical Univ., Ankara (Turkey)); Wieser, A.; Goeksu, H.Y.; Mueller, P.; Regulla, D.F. (Gesellschaft fuer Strahlen- und Umweltforschung mbH Muenchen, Neuherberg (Germany, F.R.). Inst. fuer Strahlenschutz); Erol, O. (Istanbul Univ. (Turkey). School of Geography and Marine Sciences)

    1989-01-01

    Feasibility of dating caliche nodules by ESR and TL is investigated. For both methods the properties of the dating signal are described. Chemical composition as well as TL glow curves of caliches originating from different localities exhibit some differences. Due to the complexity of the TL glow curves, some samples required a special post-annealing procedure in order to resolve the main TL peak for age determination. Typical ESR calcite signals do not exist in caliche, therefore usefulness of the g=2.0040 ESR signal is studied. The results of TL and ESR ages are found to be compatible except for two samples. Possible causes of the discrepancy in these samples are discussed. It is shown that, with proper treatment of the radiation-induced signals, it was possible to date caliche formations older than 350 ka, which is not achievable with other methods like uranium series disequilibrium and/or radiocarbon dating. (author).

  19. ESR and TL age determination of caliche nodules

    International Nuclear Information System (INIS)

    Oezer, A.M.; Wieser, A.; Goeksu, H.Y.; Mueller, P.; Regulla, D.F.; Erol, O.

    1989-01-01

    Feasibility of dating caliche nodules by ESR and TL is investigated. For both methods the properties of the dating signal are described. Chemical composition as well as TL glow curves of caliches originating from different localities exhibit some differences. Due to the complexity of the TL glow curves, some samples required a special post-annealing procedure in order to resolve the main TL peak for age determination. Typical ESR calcite signals do not exist in caliche, therefore usefulness of the g=2.0040 ESR signal is studied. The results of TL and ESR ages are found to be compatible except for two samples. Possible causes of the discrepancy in these samples are discussed. It is shown that, with proper treatment of the radiation-induced signals, it was possible to date caliche formations older than 350 ka, which is not achievable with other methods like uranium series disequilibrium and/or radiocarbon dating. (author)

  20. The automated Risoe TL dating reader system

    International Nuclear Information System (INIS)

    Boetter-Jensen, L.

    1988-01-01

    The features of the new modified Riso TL dating reader system are described. A vacuum chamber that accommodates the entire 24-position sample changer unit has been designed. The vacuum and N 2 -gas functions are software-controlled. A newly designed heater system is capable of repeated heating cycles to 700 0 C. The sample changer system accommodates fine-grain discs as well as planchettes for coarse grains. Two software-controlled beta irradiators can be attached to the reader, e.g. for predose measurement. The software allows a user without programming expertise to create any desired measuring sequence, and to store and recall data and glow curves for making analyses. (author)

  1. Evaluasi Pengendalian Sistem Informasi Pengiriman pada TL

    Directory of Open Access Journals (Sweden)

    Nelly Nelly

    2011-06-01

    Full Text Available The purpose of this study is to evaluate the control systems on the TL shipping information, in order to discern weaknesses or problems in delivery of enterprise information systems control using CobIT approach. The research method used is the data collecting by observation, checklists, interviews, and literature study. The results achieved are findings and issue recommendations that provide an illustration about a control of the running information delivery systems. From the illustration it is known that on the company’s control of information delivery system, there are still many things that have not been up to standard. The conclusion obtained is that the control of information delivery systems that have been implemented meets only partially the standards set small, so it still needs much improvement. 

  2. Quality control 201TlCl solution obtained at IPEN-CNEN/SP through the direct method of 201Tl preparation

    International Nuclear Information System (INIS)

    Fernandes, L.; Silva, C.P.G. da.

    1991-09-01

    The radiopharmaceutical 201 TlCl is used in Nuclear medicine for myocardial visualization. The solution of 201 TlCl was prepared using 201 Tl obtained by irradiating a natural mercury target with protons. This radionuclide was subjected to different quality control processes to verify the purity required for its use in Medicine. Some of these controls concerned the determination of 200 Tl, 201 Tl and 202 Tl; the chemical identification of 201 Tl +1 ; the hydrazine concentration, mercury contamination and the presence of phosphate. Furthermore, the biologic distribution in Wistar rats and tests for sterility, pyrogens and for toxicity were carried out. It was verified that the solution obtained was in the form of thallous chloride. This radiopharmaceutical can give a good heart image in animals but due to the contamination of 201 Tl with 200 Tl and 202 Tl its use in human beings is not possible unless enriched 202 Hg is used as target of irradiation. (author)

  3. Clinical use of 201Tl myocardial scintigraphy

    International Nuclear Information System (INIS)

    Senda, Kohei; Imaeda, Takeyoshi; Kato, Toshimitsu; Asada, Shuichi; Doi, Hidetaka

    1977-01-01

    Myocardial imaging with 201 Tl and scinticamera was studied experimentally using specially designed phantoms and clinically in 23 patients with myocardial infarction or other heart disease. In the phantom experiment, quality of image, accumulative count rate, and detectability of the defect were compared to obtain the best technique for their detection, using four different collimators, i.e., converging, pin-hole, 4000-hole, and 140 keV high-resolution, at two photopeak levels of 201 Tl of 75 and 167 keV, and combining a radiation absorber. In patient examination, myocardial images taken at different periods after injection, different detecting conditions of the scinticamera, and various detecting projections were compared. Images of the converging collimator at the 75 keV photopeak revealed considerably higher accumulative counts and relatively higher quality than those of other detecting conditions. It was necessary to take as many images as possible in various projections, in order to detect the location and size of the myocardial ischemic lesion because the lesion was demonstrated as a clear defect only in profile. It became evident that images taken between about 25 and 90 min delineated the myocardium more clearly than those taken in other periods. Normal images taken in 8 patients without ischemic heart disease appeared in the shape of a doughnut of horseshoe, demonstrating mainly the left venticular myocardium. The image was faint in the region of the aortic or mitral valve and thin in the region of the apical wall. A faint image of the right ventricular myocardium was sometimes seen. In 3 patients with valvular heart disease, findings suggested changes in the thickness of myocardium and the distribution of coronary blood flow. In 11 of 12 patients with old myocardial infarction, the location and size of the lesion was detected. (Evans, J.)

  4. NaI(Tl) response functions

    Energy Technology Data Exchange (ETDEWEB)

    Vega C, H. R.; Ortiz R, J. M. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Benites R, J. L. [Centro Estatal de Cancerologia de Nayarit, Calz. de la Cruz 118 Sur, Tepic, Nayarit (Mexico); De Leon M, H. A., E-mail: fermineutron@yahoo.com.mx [Instituto Tecnologico de Aguascalientes, Av. Adolfo Lopez Mateos 1801 Ote., 20155 Aguascalientes, Ags. (Mexico)

    2015-09-15

    The response functions of a NaI(Tl) detector have been estimated using Monte Carlo methods. Response functions were calculated for monoenergetic photon sources (0.05 to 3 MeV). Responses were calculated for point-like sources and for sources distributed in Portland cement cylinders. The responses were used to calculate the efficiency functions in term of photon energy. Commonly, sources used for calibration are point-like, and eventually sources to be measured have different features. In order to use the calibrated sources corrections due to solid angle, self-absorption and scattering, must be carried out. However, some of these corrections are not easy to perform. In this work, the calculated responses were used to estimate the detector efficiency of point-like sources, and sources distributed in Portland type cement. Samples of Portland paste were prepared and were exposed to photoneutrons produced by a 15 MV linac. Some of the elements in the cement were activated producing γ-emitting radionuclides that were measured with a NaI(Tl) gamma-ray spectrometer, that was calibrated with point-like sources. In order to determine the specific activity in the induced radioisotopes calculated efficiencies were used to make corrections due to the differences between the solid angle, photon absorption and photon scattering in the point-like calibration sources and the sources distributed in cement. During the interaction between photoneutrons and the cement samples three radioisotopes were induced: {sup 56}Mn, {sup 24}Na, and {sup 28}Al. (Author)

  5. Photoluminescence and absorption spectra of various common TL phosphors - interpretation of TL mechanisms

    International Nuclear Information System (INIS)

    Nagpal, J.S.

    1980-01-01

    Photoluminescence and absorption spectra of TL phosphors TLD-100, CaF 2 :Dy, CaSO 4 :Dy(0.05%wt), CaSO 4 :Tm(0.05%wt) and Mg 2 SiO 4 :Tb have been measured. The absorption spectra are typical of RE 2+ in rare earth doped irradiated phosphors. On heating RE 2+ yields RE 3+ and emission from the excited states of RE 3+ is observed. (author)

  6. Pulse shaper for scintillation detectors with NaI(Tl) or CsI(Tl) crystals

    International Nuclear Information System (INIS)

    Novisov, B.S.; Maksimenko, A.S.; Baryshev, A.V.; Zhukov, A.V.

    1978-01-01

    The basic circuit of a signal shaper for scintillation detectors with NaI(Tl) and CsI(Tl) crystals is described. To increase amplitude resolution, it is suggested to integrate not the whole charge at the photomultiplier output, but a part of the charge during the initial 100 ns of the current pulse; the remaining part of the current signal is compensated directly at the photomultiplier anode by means of an electric circuit. The principal elements of the spectrometric signal shaper include an input transistor amplifier, a compensation circuit, a key element, a shaper amplifier of time pulses, a shaper of signal duration for controlling the key element, and an output spectrometric amplifier. This device, being used, one can shape pulses at durations of 100 ns and more. The shaper restoration time does not exceed 50 ns. When the shaper operates with NaI(Tl) crystals and at counting rate of 10 6 pulse/s, the amplitude resolution with and without the compensation circuit is 17% and 21% respectively

  7. Emergence of topological and topological crystalline phases in TlBiS2 and TlSbS2

    KAUST Repository

    Zhang, Qingyun; Cheng, Yingchun; Schwingenschlö gl, Udo

    2015-01-01

    Using first-principles calculations, we investigate the band structure evolution and topological phase transitions in TlBiS2 and TlSbS2 under hydrostatic pressure as well as uniaxial and biaxial strain. The phase transitions are identified by parity analysis and by calculating the surface states. Zero, one, and four Dirac cones are found for the (111) surfaces of both TlBiS2 and TlSbS2 when the pressure grows, which confirms trivial-nontrivial-trivial phase transitions. The Dirac cones at the (M) over bar points are anisotropic with large out-of-plane component. TlBiS2 shows normal, topological, and topological crystalline insulator phases under hydrostatic pressure, thus being the first compound to exhibit a phase transition from a topological to a topological crystalline insulator.

  8. Emergence of topological and topological crystalline phases in TlBiS2 and TlSbS2

    KAUST Repository

    Zhang, Qingyun

    2015-02-11

    Using first-principles calculations, we investigate the band structure evolution and topological phase transitions in TlBiS2 and TlSbS2 under hydrostatic pressure as well as uniaxial and biaxial strain. The phase transitions are identified by parity analysis and by calculating the surface states. Zero, one, and four Dirac cones are found for the (111) surfaces of both TlBiS2 and TlSbS2 when the pressure grows, which confirms trivial-nontrivial-trivial phase transitions. The Dirac cones at the (M) over bar points are anisotropic with large out-of-plane component. TlBiS2 shows normal, topological, and topological crystalline insulator phases under hydrostatic pressure, thus being the first compound to exhibit a phase transition from a topological to a topological crystalline insulator.

  9. Development of low background CsI(Tl) and NaI(Tl) crystals for WIMP search

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Hyun Su [Department of Physics, Ewha Womans University, Seoul 120-750 (Korea, Republic of)

    2015-08-17

    We have developed low background CsI(Tl) and NaI(Tl) crystals to search for weakly interacting massive particles as well as to verify the origin of the annual modulation signal observed by the DAMA/LIBRA experiment. Extensive studies about the contamination mechanisim of {sup 137}Cs in CsI powder lead to the growth of ultra-low-background CsI(Tl) crystals. Similar approaches for NaI(Tl) crystals have been applied to reduce internal backgrounds to less than 0.5 counts/kg/day/keV. Status and understanding of backgrounds and background reduction in NaI(Tl) crystals will be discussed.

  10. Color centers in heavily irradiated CsI(Tl) crystals

    International Nuclear Information System (INIS)

    Yakovlev, V.; Meleshko, A.; Trefilova, L.

    2008-01-01

    The absorption and luminescence properties of CsI(Tl) crystals colored by irradiation are studied by the method of the time-resolved spectroscopy. The scheme of the electron transitions in CsI(Tl) crystal is suggested to explain the appearance of the color centers under exposure to the near-UV light. It is established that either of the two types activator color centers holds the charge carrier with opposite sign. The model of the hole Tl 2+ v c - activator color center is suggested. According to the model the positive charge of Tl 2+ ion is compensated by the negative charge of a close cation vacancy v c - . The color center emission reveals in the cathode-luminescence spectrum of the colored CsI(Tl) crystal. The high-dose irradiation of CsI(Tl) crystal results in the reduction of the decay time of the near-thallium self-trapped excitons (STE) emission. The decay kinetics of Tl 2+ v c - emission contains the time components typical for the decay kinetics of near-thallium STE emission. The reason of the observed effects is the energy transfer from the near-thallium STE excitons to the color centers via the inductive-resonant mechanism

  11. Preparation of 199Tl and its labelled compound

    International Nuclear Information System (INIS)

    Zhou Dehai; Guan Changtian; Kuang Anren

    1991-10-01

    Usually, 199 Ti is obtained by the nuclear reaction of 197 Au(α, 2n) 199 Tl. A gold target with 50±0.1 mm in diameter, 0.8 mm in thickness and 99.99% in purity was mounted in a cyclotron beam line. The target was bombarded by α particles with the energy of 25∼27 MeV and the beam current of 15∼20μA. The irradiated gold target was dissolved by aqua regia. Then the saturated aqueous solution of SO 2 was added. The 199 Tl(III)reduced to 199 Tl(I). The deposit of gold was removed. For separation of 199 Tl)I), about 5 mL of raw material solution obtained was transferred to 201 x 8 type anion exchange resin column which had been equilibrated with 4 mol/L HCl. The 199 Tl(I) and Au(III) were desorbed separately with the eluants (90% of aqueous diamide solution,, and 2 mol/L HCL∼5% thiourea) at the flow rate of 0.25 mL/min. After separation, the 10 mL concentrated nitric acid was added to the 199 Tl collected solution to destroy and remove the aqueous diamide solution, then 4 mol/L HCl was added and heated up to remove NO 3 - . The TlCl injection with pH = 5 was made up by using physiological saline. After filtering the 199 TlCl injection was sterilized at 137.3 kPa, 120 deg C about 30 min in an autoclave. The 199 TlCl injection was used in the animal pyrogen, a bacterial, safety, dispensation and myocardial imaging experiments. The good results have been obtained. Now it has undergone clinical experiments

  12. Comparison of TL profiles in recent sea cores

    Energy Technology Data Exchange (ETDEWEB)

    Castagnoli, G C; Bonino, G

    1985-01-01

    The thermoluminescence (TL) profile of different recent Tyrrhenian sea cores sampled at various intervals during the last centuries have been compared in order to check the reproducibility of the profiles and investigate the possibility of using the results for monitoring solar-terrestrial relations in the past. The satisfactory results obtained by comparison of two different cores in the time interval 1755-1969 A.D. has demonstrated: (a) the two TL profiles are correlated; (b) the 11 yr cycle corresponding to the main solar cycle is evident in both TL profiles.

  13. Dielectric and baric characteristics of TlS single crystal

    Energy Technology Data Exchange (ETDEWEB)

    Mustafaeva, S.N., E-mail: solmust@gmail.com [Institute of Physics, ANAS, G. Javid prosp. 33, Az 1143 Baku (Azerbaijan); Asadov, M.M. [Institute of Chemical Problems, ANAS, G. Javid prosp. 29, Az 1143 Baku (Azerbaijan); Ismailov, A.A. [Institute of Physics, ANAS, G. Javid prosp. 33, Az 1143 Baku (Azerbaijan)

    2014-11-15

    The investigation of the frequency dependences of the dielectric coefficients and ac-conductivity of the TlS single crystals made it possible to elucidate the nature of dielectric loss and the charge transfer mechanism. Moreover, we evaluated the density and energy spread of localized states near the Fermi level, the average hopping time and the average hopping length. It was shown that the dc-conductivity of the TlS single crystals can be controlled by varying the hydrostatic pressure. This has opened up possibilities for using TlS single crystals as active elements of pressure detectors.

  14. Photon and neutron energy response of Thermoluminescent (TL) dosimeters

    International Nuclear Information System (INIS)

    Thilagam, L.; Priya, M.R.; Mohapatra, D.K.

    2018-01-01

    Theoretical Monte Carlo (MC) simulations are carried out to investigate the relative thermoluminesence (TL) response of the most commonly used TLD materials to a wide range of photon energy. The effect of polytetrafluoroethylene (PTFE) on TL response of CaSO 4 :Dy is also studied. Additionally, the neutron response of LiF:Mg,Ti TL materials with different concentrations of 6 Li is estimated in terms of the number of 6 Li(n, t) 4 He capture reactions for a wider neutron energy

  15. Rachunek kosztów działańjako podstawa wyceny usług

    Directory of Open Access Journals (Sweden)

    Gertruda Krystyna Świderska

    2009-03-01

    Full Text Available Artykuł prezentuje wykorzystanie rachunku kosztów działań do wyceny usług na trzech rynkach podlegających centralnym regulacjom – rynku usług pocztowych, telekomunikacyjnych oraz świadczeń zdrowotnych. Doświadczenia krajów Unii Europejskiej (w tym Polski pokazują nowe obszary wykorzystania rachunku kosztów działań. Potwierdzają, że zastosowanie tego narzędzia pozwala na kontrolę kosztów ponoszonych przy świadczeniu usług oraz wycenę na podstawie rzeczywistego rachunku ekonomicznego. Takie podejście gwarantuje przejrzystość procesu wyceny na rynkach, na których odgrywa to szczególnie istotną rolę. W części pierwszej przedstawiono zarys koncepcji rachunku kosztów działań wykorzystanej w PPUP Poczta Polska. Scharakteryzowano zastosowane rozwiązanie dostosowane do specyfiki działań poczty, zawierające elementy obiektowego rachunku kosztów działań oraz rachunku kosztów działań sterowanego czasem. W części drugiej zaprezentowano zastosowanie koncepcji rachunku kosztów działań do wyceny świadczonych usług w British Telecom. Wykorzystanie właściwych nośników kosztów pozwala na prawidłowe przypisanie kosztów obiektom je generującym. W części trzeciej opisano doświadczenia krajów Unii Europejskiej w zakresie stosowania rachunku kosztów działań do wyceny świadczeń medycznych. Stanowią one przesłankę dla wdrożenia tej koncepcji do wyceny usług zdrowotnych na rynku polskim.

  16. Solid solutions of thallium in TlGaSe2, TlGaS2, and TlInS2

    International Nuclear Information System (INIS)

    Voroshilov, Yu. V.; Potorii, M.V.; Shevchenko, S.V.

    1986-01-01

    The authors study the nature of the dissolution of thallium in ternary phases. They have synthesized alloys of the stoichiometric compositions TlGaS 2 , TlGaSe 2 , and T1InS 2 , and their solid solutions, maximally enriched in thallium, the compositions of which were Tl /SUB 1.34/ GA /SUB 0.89/ S 2 , Tl /SUB 1.31/ Ga /SUB 0.90/ Se 2 , and Tl /SUB 1.15/ In /SUB 0.95/ S /SUB 2./ . Samples were synthesized from the elemental components of the following purities: gallium of V4 grade; indium of V4 grade; thallium of T1000 grade; selenium of special purity 22-4 grade, and sulfur of special purity garde. The compositions were checked by x-ray-phase-(DRON-0.5) and microstructural-analyses with simultaneous determination of the density and microhardness of the samples. It is found that the lattic parameter increases and the increase in the density and microhardness points to strengthening of the structure during the formation of the solid solutions

  17. Improvements in the Tl dosimetry for Radiotherapy; Mejoras en la dosimetria Tl para Radioterapia

    Energy Technology Data Exchange (ETDEWEB)

    Bustos, S.; Velez, G.; Rubio, M. [CEPROCOR. Arenales 230 Juniors Cordoba 5000 (Argentina)

    1998-12-31

    The thermoluminescent dosimetry (TLD) in vivo has been demonstrated to be one of the most reliable for the control of radiotherapeutic treatments, but the delay in the response is the main disadvantage in its applicability. In this work are presented important improvements and it is demonstrated that maintaining the accuracy and reliability of the technique, it is possible to accelerate the response times at a few hours. To realize this work is utilized a lecturer Harshaw 4000, dosemeters LiF-TLD-100 chips (3.1 x 3.1 x 0.89 mm{sup 3}) and rods (1 x 1 x 6 mm{sup 3}). With the implementation of a glow curve analysis program developed in CIEMAT, its obtained a Tl peaks separation in such manner rapid and accurate, by that the thermal treatment of dosemeters may be reduced at one unique annealing pre-irradiation for 1 hr at 400 Centigrade. It is realized a periodical and individual calibration of the TLD and a study of the factors which influencing the ratio Tl signal-dose as linearity, correction by energy, directional response and pride of Tl signal. the results of this study are introducing in a calculation list specially designed and which allows to obtain absorbed dose by TLD starting of the dates (dosimetric peaks area) which appear of the glow curves analysis. The dose is obtained with an accuracy less than 5 %. The dosemeters already irradiated (in vivo) are analysed and informed in only four hours, allowing a greater control of the treatment and a correction of the possible errors for the next session, still in bi fractional treatments. The method implemented results thus accurate, rapid and reliable. (Author)

  18. Ultrashort-period lateral composition modulation in TlInGaAsN/TlInP structures

    International Nuclear Information System (INIS)

    Ishimaru, Manabu; Tanaka, Yuusuke; Hasegawa, Shigehiko; Asahi, Hajime; Sato, Kazuhisa; Konno, Toyohiko J.

    2009-01-01

    We prepared TlInGaAsN/TlInP quantum well structures using gas source molecular-beam epitaxy and characterized them by means of transmission electron microscopy and scanning transmission electron microscopy. It was found that naturally formed vertical quantum wells, so-called lateral composition modulation (LCM), with a periodicity of ∼1 nm are formed in TlInGaAsN layers. We discuss their formation process using a simple kinetic Ising model for layer-by-layer growth, and point out that the formation of ultrashort-period LCM is a universal phenomenon in most of epitaxially grown III-V semiconductor alloys.

  19. Superdeformation in the Hg-Tl-Pb region

    International Nuclear Information System (INIS)

    Henry, E.A.; Becker, J.A.; Yates, S.W.; Wang, T.F.; Kuhnert, A.; Brinkman, M.J.; Cizewski, J.A.; Deleplanque, M.A.; Diamond, R.M.; Stephens, F.S.; Azaiez, F.; Korten, W.; Draper, J.E.

    1990-10-01

    Superdeformation in the Hg-Tl-Pb region is discussed, with concentration on the experimental results. At least twenty-five superdeformed bands are known in this region, providing much new data to test theoretical calculations. 22 refs., 5 figs

  20. Use of universal functional optimisation for TL glow curve analysis

    International Nuclear Information System (INIS)

    Pernicka, F.; Linh, H.Q.

    1996-01-01

    The effective use of any TL instrument requires an efficient software package to be able to fulfil different tasks required by research and practical applications. One of the standard features of the package used at the NPI Prague is the application of the interactive modular system Universal Functional Optimisation (UFO) for glow curve deconvolution. The whole system has been tested on standard glow curves using different models of the TL process (a single peak described by the Podgorsak approximation, first order kinetics and/or general order kinetics). Calculated values of basic TL parameters (E and s) show a good agreement with the results obtained by other authors. The main advantage of the system is in its modularity that enables flexible changes in the TL model and mathematical procedures of the glow curve analysis. (author)

  1. Trace element geochemistry and thermoluminescence (TL) of quartz ...

    African Journals Online (AJOL)

    *

    3Department of Materials Science and Engineering, Tsinghua University, Beijing 100084, China. ... exposure in the recent twenty years, the TL characteristics of the fish otolith have not yet been ..... New discoveries in the study of carp otoliths.

  2. A preliminary study of landslide gouge dating by TL technique

    Energy Technology Data Exchange (ETDEWEB)

    Fengju, Ji; Jianping, Li [Inst. of Geology, National Seismological Bereau, Beijing (China); Mingda, Liu [Inst. of Crustal Dynamics, SSB, Beijing (China)

    1993-04-01

    The key to date slipping of landslide by TL method is whether the temperature and pressure caused by slipping can lead the original TL to 'zero'for some minerals within the slipping band. For this purpose, the simulated experiments under different temperature-pressure were made and the TL annealing effect of landslide gouge was studied. The results show that the frictional heating caused during slipping is a main factor leading the mineral's TL to decrease on the slip plane and that increment of temperature is in close relation with strength of shear stress, thickness of landslide gouge and amount of displacement. As an example, the slipping age of a paleo-landslide at Huangtupo, Hubei Province, has been dated to be about 140 ka.

  3. TL dating of vases with elephant ears in Yuan Dynasty

    International Nuclear Information System (INIS)

    Xia Junding; Wang Weida; Leung, P.L.

    2005-01-01

    Thermoluminescence (TL) dating using an activation method in pre-dose technique was described. Three vases in underglaze blue with elephant ears and one vase in underglaze red with elephant ears in Yuan Dynasty were dated by this method. The results show that the TL ages are all less than 100 a B.P., and in which sbc 648 and sbc 649 were imitated in recent years. This method is quick, convenient and reliable for porcelain dating with the age of less than 1000 a B.P.. As a comparison, a porcelain sample with underglaze blue in Yuan Dynasty was dated too, and its TL age is 620 ± 140 B.P.. In addition, some complex factors associated with dating have been discussed and a resolution has been raised, which will help improve the accuracy of TL dating. (authors)

  4. The Development of “Eldo Ngano 1”: The World’s World’s First Ug99 Resistant Mutant Wheat Variety

    International Nuclear Information System (INIS)

    Forster, Brian P.

    2014-01-01

    The wheat black stem rust disease is a virulent race of fungus, Puccinia graminis, which affects wheat plants and is caused by a strain of fungus known as Ug99. Named for its place and year of origin, Ug99 was first discovered on wheat in Uganda in 1999. The spores of this plant disease are airborne and can be easily spread by wind. If not prevented, the disease can destroy 70 to 100 per cent of the yield of wheat crops. Annually on average 8.3 million tonnes of wheat grain is lost to this disease, costing US $1.23 billion per year. Ethiopia, Kenya and Uganda are hot spots for this disease. In 2009, growing international concern regarding the horrific impact of Ug99 on wheat led to the establishment of IAEA project INT/5/150, Responding to the Transboundary Threat of Wheat Black Stem Rust (Ug99). This project has involved over 18 countries and 5 national and international institutions, and examined possible mutation induction treatments to deal with the challenges posed by Ug99. Meetings and workshops to facilitate the project efforts have been held in Kenya and Turkey. Ug99 continues to spread globally and has now reached the Islamic Republic of Iran. There are also reports of suspected disease occurrences in Europe. It is essential that work continues on developing mutant lines for further crop protection that can be utilized worldwide to safeguard the wheat crop from this devastating disease

  5. Quantification of African cassava mosaic virus (ACMV) and East African cassava mosaic virus (EACMV-UG) in single and mixed infected Cassava (Manihot esculenta Crantz) using quantitative PCR.

    Science.gov (United States)

    Naseem, Saadia; Winter, Stephan

    2016-01-01

    The quantity of genomic DNA-A and DNA-B of African cassava mosaic virus (ACMV) and East African cassava mosaic virus Uganda (Uganda variant, EACMV-UG) was analysed using quantitative PCR to assess virus concentrations in plants from susceptible and tolerant cultivars. The concentrations of genome components in absolute and relative quantification experiments in single and mixed viral infections were determined. Virus concentration was much higher in symptomatic leaf tissues compared to non-symptomatic leaves and corresponded with the severity of disease symptoms. In general, higher titres were recorded for EACMV-UG Ca055 compared to ACMV DRC6. The quantitative assessment also showed that the distribution of both viruses in the moderately resistant cassava cv. TMS 30572 was not different from the highly susceptible cv. TME 117. Natural mixed infections with both viruses gave severe disease symptoms. Relative quantification of virus genomes in mixed infections showed higher concentrations of EACMV-UG DNA-A compared to ACMV DNA-A, but a marked reduction of EACMV-UG DNA-B. The higher concentrations of EACMV-UG DNA-B compared to EACMV DNA-A accumulation in single infections were consistent. Since DNA-B is implicated in virus cell-to-cell spread and systemic movement, the abundance of the EACMV-UG DNA-B may be an important factor driving cassava mosaic disease epidemic. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. EnviroAtlas - Durham, NC - Demo (Parent)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

  7. Examination of TL and optical absorption in calcite's mineral

    International Nuclear Information System (INIS)

    Sabikoglu, I.; Can, N.

    2009-01-01

    Calcite which is a form of crystalline of the calcium carbonate composes parent material of chalk stone (limestone) and marble. Calcite which presents in various colors also in our country consists of yellow, blue, transparent and green colors. In this study, green calcite mineral which is taken from the region of Ayvalik, was examined of its thermoluminescence (TL) and optical absorption features in different doses. It has been obtained a large TL peak in 179 degree C and absorption peak in 550 mm.

  8. Deformation effects in electronic spectra of the layered semiconductors TlGaS sub 2 , TlGaSe sub 2 and TlInS sub 2

    CERN Document Server

    Allakhverdiev, K R; Suleymanov, R A; Gasanov, N Z

    2003-01-01

    The deformation effects in electronic spectra of the ternary layered semiconductors TlGaS sub 2 , TlGaSe sub 2 and TlInS sub 2 are considered. It is shown that the influence of hydrostatic pressure, thermal expansion and variation of composition in solid solutions on the band gap of the crystals investigated can be described in the framework of one common model of deformation potentials. This model appears to be close to that of layered semiconductors of the A sub 3 B sub 6 group, attesting to the fact that the main principles of formation of band structure in these two groups of layered crystals are the same.

  9. TL1A regulates TCRγδ+ intraepithelial lymphocytes and gut microbial composition

    DEFF Research Database (Denmark)

    Tougaard, Peter; Skov, S.; Pedersen, A. E.

    2015-01-01

    TL1A is a proinflammatory cytokine, which is prevalent in the gut. High TL1A concentrations are present in patients with inflammatory bowel disease (IBD) and in IBD mouse models. However, the role of TL1A during steady‐state conditions is relatively unknown. Here, we used TL1A knockout (KO) mice ...

  10. Natural quartz TL property and similarity in Piper nigrum L

    International Nuclear Information System (INIS)

    Guzman A, S.; Cruz Z, E.; Furetta, C.; Brown, F.; Barboza F, M.

    2009-10-01

    Quartz is a mineral abundant in nature and can provide information thermoluminescent (TL), and also is located in the mineral fraction of some herbs and spices consumed. It is present the analysis of the TL properties of a sample of natural quartz rock and compared with those obtained from the fraction of Piper nigrum L. poly mineral when they were exposed to 60 Co gamma radiation. The poly minerals of Piper nigrum L. were analyzed by X-ray diffraction, where the quartz was found as a major component. They separated in different particle sizes (10, 53, 74 and 149 μm). The samples were irradiated at relatively low doses (1-500 Gy) and high (0.1-40 kGy) in order to determine the linearity of the TL emission as a function of the dose and the analysis of glow curves. Also there was the fading of the TL signal, the effect of ultra violet light. The reproducibility of the TL signal in the samples indicates that a smaller particle size gives better TL signal. (author)

  11. TL response of citrine samples for high-dose dosimetry

    International Nuclear Information System (INIS)

    Teixeira, Maria Ines; Caldas, Linda V.E.

    2011-01-01

    The possibility of using samples of Brazilian stones as quartz, amethyst, topaz, etc. for high-dose dosimetry has been studied in recent years at IPEN, using the thermoluminescence technique (TL). In this work, the TL properties of citrine samples were studied. They were exposed to different doses of gamma radiation ( 60 Co). The natural citrine stone was extracted from a mine in Minas Gerais state, Brazil; it is a tectosilicate ranked as one of three-dimensional structure, showing clear yellow to golden brown color. The natural citrine stone is classified as quartz (SiO 2 ), and it has a lower symmetry and more compact reticulum. The citrine stone samples were powdered, and the selected grains were mixed with Teflon in the proportion 2 (Teflon):1 (Citrine). The mixture was pressed and sintered for production of Citrine -Teflon pellets of 50 mg. The TL emission curve showed two peaks at 160 deg C and 220 deg C. To remove the TL peak (160 deg C) of the sintered citrine pellet glow curves, different thermal treatments were tested during several time intervals. The TL dose-response curve between 50 Gy and 100 kGy, the reproducibility of TL response and the lower detection dose were obtained. The preliminary results show that citrine may be useful for high-dose dosimetry. (author)

  12. Remote TL and OSL for asteroid and meteorite study

    International Nuclear Information System (INIS)

    Takaki, Shunji; Ikeya, Motoji; Yamanaka, Chihiro

    1997-01-01

    Thermoluminescence (TL) and optically stimulated luminescence (OSL) of the Allende meteorite have been studied using infrared CO 2 laser light as a heat source and He-Ne laser light to excite the material, respectively from a long distance. New techniques of remote TL (R-TL) and remote OSL (R-OSL) have been developed for future remote dating from a long distance in a planetary survey. The upper limits of the distance for R-TL and R-OSL were estimated using the laboratory TL signal of the meteorite peaking at 320 o C: about 400 photons s -1 for the R-TL and 60 photons s -1 for R-OSL at a distance of 1 km using a laser beam with the divergence of 0.1 mrad at powers of 100 and 1 W, respectively. An age limit of 10 5 or 10 6 years due to the signal saturation and the objects heterogeneity, as expected from previous studies, may make the asteroid survey difficult but would still help to investigate the surface activities of icy planets and satellites in outer planet worlds. (author)

  13. Leg 201Tl-SPECT in chronic exertional compartment syndrome

    International Nuclear Information System (INIS)

    Elkadri, N.; Slim, I.; Blondet, C.; Choquet, Ph.; Constantinesco, A.; Lecocq, J.

    2004-01-01

    Leg 201 Tl-SPECT in chronic exertional compartment syndrome Background: The chronic exertional compartment syndrome is one of the most frequent origins regarding leg pain due to sport training. The diagnosis can be established by invasive compartment pressure measurement. The aim of this study is to evaluate the role that could have 201 Tl-SPECT for patients with suspicion of compartment syndrome. Patients and methods: 51 leg 201 Tl-SPECT exams were performed (exercise - and rest without reinjection) in 49 patients; 28 had compartment syndrome confirmed by pressure measurement. About 100 MBq of 201 Tl were injected during exercise, when pain appeared or at least after 25 minutes exercise. We studied mean percentages of level uptake for each compartment, referred to the maximal uptake of both legs. Results: 47 compartments were concerned by compartment syndrome and 361 compartments were not. Scintigraphic patterns in compartments are reversible ischaemia (45%), uptake stability (36%) or reverse redistribution (19%); these patterns are not linked to compartment syndrome. However, there is a significant difference of rest 201 Tl level uptake between compartments with and without compartment syndrome and a significant correlation between muscular pressure measurement and rest level uptake. Conclusion: 201 Tl-SPECT shows that only ischaemia does not explain compartment syndrome. Moreover, it allows to predict pressure variation during exercise but it does not offer any interest in order to select patients for muscular invasive pressure measurement. (author)

  14. $\\alpha$-decay study of $^{182,184}$Tl

    CERN Document Server

    Van Beveren, C; Barzakh, A E; Cocolios, T E; de Groote, R P; Fedorov, D; Fedosseev, V N; Ferrer, R; Ghys, L; Huyse, M; Köster, U; Lane, J; Liberati, V; Lynch, K M; Marsh, B A; Molkanov, P L; Procter, T J; Rapisarda, E; Sandhu, K; Seliverstov, M D; Van Duppen, P; Venhart, M; Veselský, M

    2016-01-01

    α -decay spectroscopy of 182,184 Tl has been performed at the CERN isotope separator on-line ( ISOLDE ) facility. New fi ne-structure α decays have been observed for both isotopes. α -decay branching ratios of 0.089 ( 19 ) %, 0.047 ( 6 ) % and 1.22 ( 30 ) % have been deduced for the ( 10 − ) , ( 7 + ) and ( 2 − ) states respectively in 184 Tl and a lower limit of 0.49% for the α -decay branching ratio of 182 Tl. A new half-life of 9.5 ( 2 ) s for the ( 2 − ) state in 184 Tl and 1.9 ( 1 ) s for the low-spin state in 182 Tl has been deduced. Using α – γ coincidence analysis, multiple γ rays were observed de-exciting levels in 178,18 0 Au fed by 182,184 Tl α decays. The γ transitions connecting these low-lying states in 178,18 0 Au are essential to sort the data and possibly identify bands from in- beam studies in these isotopes. Owing to the complex fi ne-structure α decays and limited knowledge about the structure of the daughter nuclei, only partial level schemes could be constructed for bot...

  15. Tl, Bi, and Pb doping in Ba4BiPb2TlO12-δ

    International Nuclear Information System (INIS)

    Sutto, T.E.; Averill, B.A.

    1992-01-01

    To determine the effects of different 6s metal concentrations on the superconducting nature of Ba 4 BiPb 2 TlO 12-δ , materials produced via four doping schemes were examined: Ba 4 Bi(Pb, Tl) 3 O 12-δ , Ba 4 -(BiPb) 3 TlO 12-δ , Ba 4 (Bi,Tl) 2 Pb 2 O 12-δ , and Ba 4 Bi x Pb 4-2x Tl x O 12-δ . For the parent compound a value of δ = 0.91 was observed, indicating that approximately 1/4 oxygen atom was missing per cubic subsection of the unit cell. For all samples, the symmetry of the parent compound changed from orthorhombic to tetragonal as the system moved away from the ideal composition. This was usually accompanied by the loss of superconductivity, which exhibited a maximum T c of 10.5 K for the parent compound Ba 4 BiPb 2 TlO 12-δ . Also reported are high-temperature magnetic susceptibility results, which are used to determine the effect of metal substitution on the density of states at the Fermi level. For each set of variants on the parent composition, the onset of superconductivity was accompanied by a significant decrease in the size of the Pauli paramagnetic signal. 16 refs., 6 figs

  16. Discovery of a Novel Stem Rust Resistance Allele in Durum Wheat that Exhibits Differential Reactions to Ug99 Isolates

    Directory of Open Access Journals (Sweden)

    Jayaveeramuthu Nirmala

    2017-10-01

    Full Text Available Wheat stem rust, caused by Puccinia graminis f. sp. tritici Eriks. & E. Henn, can incur yield losses in susceptible cultivars of durum wheat, Triticum turgidum ssp. durum (Desf. Husnot. Although several durum cultivars possess the stem rust resistance gene Sr13, additional genes in durum wheat effective against emerging virulent races have not been described. Durum line 8155-B1 confers resistance against the P. graminis f. sp. tritici race TTKST, the variant race of the Ug99 race group with additional virulence to wheat stem rust resistance gene Sr24. However, 8155-B1 does not confer resistance to the first-described race in the Ug99 race group: TTKSK. We mapped a single gene conferring resistance in 8155-B1 against race TTKST, Sr8155B1, to chromosome arm 6AS by utilizing Rusty/8155-B1 and Rusty*2/8155-B1 populations and the 90K Infinium iSelect Custom bead chip supplemented by KASP assays. One marker, KASP_6AS_IWB10558, cosegregated with Sr8155B1 in both populations and correctly predicted Sr8155B1 presence or absence in 11 durum cultivars tested. We confirmed the presence of Sr8155B1 in cultivar Mountrail by mapping in the population Choteau/Mountrail. The marker developed in this study could be used to predict the presence of resistance to race TTKST in uncharacterized durum breeding lines, and also to combine Sr8155B1 with resistance genes effective to Ug99 such as Sr13. The map location of Sr8155B1 cannot rule out the possibility that this gene is an allele at the Sr8 locus. However, race specificity indicates that Sr8155B1 is different from the known alleles Sr8a and Sr8b.

  17. Myocardial viability assessed by Tl-201 SPECT. Redistribution versus reinjection

    International Nuclear Information System (INIS)

    Chalela, William Azem; Pimentel, Flavio Ferrarini de Oliveira; Uchida, Augusto Hiroshi; Bottega, Augusto; Ramires, Jose Antonio Franchine; Izaki, Marisa; Moraes, Aguinaldo Pereira; Soares Junior, Jose; Giorgi, Maria C. Pinto; Moffa, Paulo Jorge; Bellotti, Giovanni; Giovanni Guido Cerri; Meneghetti, Jose Claudio

    1994-01-01

    The purpose of this study was to verify if a third series of images acquired by reinjection thallium-201, 24 h after conventional myocardial perfusion with the radioisotope, improves the identification of myocardial viability segments. The methods: we studied 30 patients, mean age 57.7 ±9.4 years, with old myocardial infarction using thallium (Tl)-201 SPECT, and we obtained three series of images (stress, redistribution after 4 h and reinjection after 24 h. Cardiac images were divided in 5 segments (apical, lateral, anterior, septal and inferior) and each one received a value by a score system according to the Tl-201 myocardial uptake (0=normal uptake; 1=mild hypoperfusion; 2=moderate hypoperfusion; 3=severe hypoperfusion or no myocardial uptake). We considered viable myocardium when the uptake of Tl-201 in the segment related to te myocardial infarction increases at least 1 point in two different axis of Tl-201 SPECT. The results: seven (23,3%) patients demonstrated increase of Tl-201 uptake only at reinjection images, showing a high efficacy of the method. Nine (30%) patients showed persistent hypoperfusion at all series of images suggesting only fibrosis in the are related to the infarction. Fourteen (46,7%) patients showed increase of Tl-201 concentration at redistribution images; among these patients, six showed improvement of myocardial uptake at reinjection. This condition was interpreted as regional chronic ischemic process: hibernating myocardium. The conclusion was that Tl-201 hypoperfusion at redistribution images without significant changes in relation to the stress images do not represent fibrosis at all. The reinjection technic was better than conventional redistribution in the detection of viable myocardium. This data allows a better therapeutic orientation. (author)

  18. Development of tailor-made silica fibres for TL dosimetry

    International Nuclear Information System (INIS)

    Bradley, D.A.; Abdul Sani, Siti F.; Alalawi, Amani I.; Jafari, S.M.; Noor, Noramaliza M.; Hairul Azhar, A.R.; Mahdiraji, Ghafour Amouzad; Tamchek, Nizam; Ghosh, S.; Paul, M.C.; Alzimami, Khalid S.; Nisbet, A.; Maah, M.J.

    2014-01-01

    The Ge dopant in commercially available silica optical fibres gives rise to appreciable thermoluminscence (TL), weight-for-weight offering sensitivity to MV X-rays several times that of the LiF dosimeter TLD100. The response of these fibres to UV radiation, X-rays, electrons, protons, neutrons and alpha particles, with doses from a fraction of 1 Gy up to 10 kGy, have stimulated further investigation of the magnitude of the TL signal for intrinsic and doped SiO 2 fibres. We represent a consortium effort between Malaysian partners and the University of Surrey, aimed at production of silica fibres with specific TL dosimetry applications, utilizing modified chemical vapour deposition (MCVD) doped silica–glass production and fibre-pulling facilities. The work is informed by defect and dopant concentration and various production dependences including pulling parameters such as temperature, speed and tension; the fibres also provide for spatial resolutions down to <10 µm, confronting many limitations faced in use of conventional (TL) dosimetry. Early results are shown for high spatial resolution (∼0.1 mm) single-core Ge-doped TL sensors, suited to radiotherapy applications. Preliminary results are also shown for undoped flat optical fibres of mm dimensions and Ge-B doped flat optical fibres of sub-mm dimensions, with potential for measurement of doses in medical diagnostic applications. - Highlights: • Optical fibres tailor-made for TL dosimetry. • Sensitive to diagnostic as well as therapy doses in medicine. • Preform and fibre pulling facilities. • Relative TL and EPR measurements

  19. Benchmarking NaI(Tl) Electron Energy Resolution Measurements

    International Nuclear Information System (INIS)

    Mengesha, Wondwosen; Valentine, J D.

    2002-01-01

    A technique for validating electron energy resolution results measured using the modified Compton coincidence technique (MCCT) has been developed. This technique relies on comparing measured gamma-ray energy resolution with calculated values that were determined using the measured electron energy resolution results. These gamma-ray energy resolution calculations were based on Monte Carlo photon transport simulations, the measured NaI(Tl) electron response, a simplified cascade sequence, and the measured electron energy resolution results. To demonstrate this technique, MCCT-measured NaI(Tl) electron energy resolution results were used along with measured gamma-ray energy resolution results from the same NaI(Tl) crystal. Agreement to within 5% was observed for all energies considered between the calculated and measured gamma-ray energy resolution results for the NaI(Tl) crystal characterized. The calculated gamma-ray energy resolution results were also compared with previously published gamma-ray energy resolution measurements with good agreement (<10%). In addition to describing the validation technique that was developed in this study and the results, a brief review of the electron energy resolution measurements made using the MCCT is provided. Based on the results of this study, it is believed that the MCCT-measured electron energy resolution results are reliable. Thus, the MCCT and this validation technique can be used in the future to characterize the electron energy resolution of other scintillators and to determine NaI(Tl) intrinsic energy resolution

  20. Phytotoxicity of thallium (Tl) in culture solution. Pt. 2. Effects of Tl(III) on the growth and heavy metal contents of pea and field bean plants

    Energy Technology Data Exchange (ETDEWEB)

    Pieper, B; Austenfeld, F A

    1985-01-01

    The effects of Tl(NO/sub 3/)/sub 3/ and Tl(III)EDTA on growth and heavy metal contents of pea plants and field bean plants were compared in hydroponic culture experiments. In the presence of Tl(NO/sub 3/)/sub 3/, the essential heavy metals were available to the plants in their ionic forms. When Tl(III)EDTA was present the essential heavy metals were available as chelated complexes. Dry matter production of the pea plants was inhibited to a greater extent by Tl(III)EDTA than by Tl(NO/sub 3/)/sub 3/. The distribution of Tl within the plant was unaffected by the accompanying anion, however an increase of the Tl content of the stems and the leaves was observed in the presence of Tl(III)EDTA. The micronutrients exhibited different interactions with Tl(III). In the presence of increasing concentrations of Tl(NO/sub 3/)/sub 3/ the Mn content of each organ and the Zn content of the roots were lowered, but the Zn content of the stems was increased. Increasing concentrations of Tl(III)EDTA resulted only in a decrease of the Mn content of the roots, but in an increase of the contents of Fe and Mn within the stems, and Fe, Mn, Zn, and Cu within the leaves. The increases may be due to concentration by growth inhibition. In contrast to pea plants, growth of field bean plants was inhibited only by Tl(NO/sub 3/)/sub 3/. The field bean plants retained most of the Tl within the roots independent of the Tl compound in the solution. Chelation of Tl(III) resulted in higher Tl contents of both the roots and the stems, but equal or reduced Tl contents of the leaves. Whereas increasing concentrations of Tl(NO/sub 3/)/sub 3/ reduced the Mn content of each organ as well as the Zn content of the roots and the leaves, Tl(III)EDTA only reduced the Mn content of the roots.

  1. Ab initio calculations of the electron spectrum and density of states of TlFeS{sub 2} and TlFeSe{sub 2} crystals

    Energy Technology Data Exchange (ETDEWEB)

    Ismayilova, N. A., E-mail: ismayilova-narmin-84@mail.ru; Orudjev, H. S.; Jabarov, S. H. [Azerbaijan National Academy of Sciences, Institute of Physics (Azerbaijan)

    2017-04-15

    The results of ab initio calculations of the electron spectrum of TlFeS{sub 2} and TlFeSe{sub 2} crystals in the antiferromagnetic phase are reported. Calculations are carried out in the context of the density functional theory. The origin of the bands of s, p, and d electron states of Tl, Fe, S, and Se atoms is studied. It is established that, in the antiferromagnetic phase, the crystals possess semiconductor properties. The band gaps are found to be 0.05 and 0.34 eV for TlFeS{sub 2} and TlFeSe{sub 2} crystals, respectively.

  2. Stability of Tl-Ba-Ca-Cu-O Superconducting Thin Films

    Energy Technology Data Exchange (ETDEWEB)

    Siegal, M.P.; Overmyer, D.L.; Venturini, E.L.; Padilla, R.R.; Provencio, P.N.

    1999-08-23

    We report the stability of TlBa{sub 2}CaCu{sub 2}O{sub 7} (Tl-1212) and Tl{sub 2}Ba{sub 2}CaCu{sub 2}O{sub 8} (T1-2212) thin films and by inference, the stability of TlBa{sub 2}Ca{sub 2}Cu{sub 3}O{sub 9} (Tl-1223) and Tl{sub 2}Ba{sub 2}Ca{sub 2}Cu{sub 3}O{sub 10} (Tl-2223) thin films, under a variety of conditions. In general, we observe that the stability behavior of the single Tl-O layer materials (Tl-1212 and Tl-1223)are similar and the double Tl-O layer materials (Tl-2212 and Tl-2223) are similar. All films are stable with repeated thermal cycling to cryogenic temperatures. Films are also stable in acetone and methanol. Moisture degrades film quality rapidly, especially in the form of vapor. Tl-1212 is more sensitive to vapor than Tl-2212. These materials are stable to high temperatures in either N{sub 2}, similar to vacuum for the cuprates, and O{sub 2} ambients. While total degradation of properties (superconducting and structural) occur at the same temperatures for all phases, 600 C in N{sub 2} and 700 C in O{sub 2}, the onset of degradation occurs at somewhat lower temperatures for Tl-1212 than for Tl-2212 films. In all cases, sample degradation is associated with Tl depletion from the films.

  3. EPR and TL correlation in some powdered Greek white marbles

    International Nuclear Information System (INIS)

    Baieetto, Vanessa; Villeneuve, Gerard; Guibert, Pierre; Schvoerer, Max

    2000-01-01

    Thermoluminescence of white powdered marble samples, chosen to display different EPR spectra, were studied. Two peaks at 280 deg. C and 360 deg. C can be observed among the TL glow curves while the EPR spectra exhibit two signals: the A signal with g perp =2.0038 and g par =2.0024 due to the SO - 3 centre and the B one with g 1 =2.0005; g 2 =2.0001; g 3 =1.9998 due to mechanical powder reduction (drilling). Owing to heating and simultaneous experiments, a correlation have been established: the 280 deg. C TL peak is associated to the A signal and thus to the SO - 3 centre and the 360 deg. C TL peak is caused by mechanical treatment corresponding to the B EPR signal

  4. EPR and TL correlation in some powdered Greek white marbles

    Energy Technology Data Exchange (ETDEWEB)

    Baieetto, Vanessa E-mail: crpaa@montaigne.u-bordeaux.fr; Villeneuve, Gerard; Guibert, Pierre; Schvoerer, Max

    2000-02-01

    Thermoluminescence of white powdered marble samples, chosen to display different EPR spectra, were studied. Two peaks at 280 deg. C and 360 deg. C can be observed among the TL glow curves while the EPR spectra exhibit two signals: the A signal with g{sub perp}=2.0038 and g{sub par} =2.0024 due to the SO{sup -}{sub 3} centre and the B one with g{sub 1}=2.0005; g{sub 2}=2.0001; g{sub 3}=1.9998 due to mechanical powder reduction (drilling). Owing to heating and simultaneous experiments, a correlation have been established: the 280 deg. C TL peak is associated to the A signal and thus to the SO{sup -}{sub 3} centre and the 360 deg. C TL peak is caused by mechanical treatment corresponding to the B EPR signal.

  5. EPR and TL correlation in some powdered Greek white marbles.

    Science.gov (United States)

    Baïetto, V; Villeneuve, G; Guibert, P; Schvoerer, M

    2000-02-01

    Thermoluminescence of white powdered marble samples, chosen to display different EPR spectra, were studied. Two peaks at 280 degrees C and 360 degrees C can be observed among the TL glow curves while the EPR spectra exhibit two signals: the A signal with g perpendicular = 2.0038 and g parallel = 2.0024 due to the SO3- centre and the B one with g1 = 2.0005; g2 = 2.0001; g3 = 1.9998 due to mechanical powder reduction (drilling). Owing to heating and simultaneous experiments, a correlation have been established: the 280 degrees C TL peak is associated to the A signal and thus to the SO3- centre and the 360 degrees C TL peak is caused by mechanical treatment corresponding to the B EPR signal.

  6. Stability of detecting system using NaI(Tl)

    International Nuclear Information System (INIS)

    Zhuo Yunshang; Lei Zhangyun; Zen Yu; Gong Hua

    1996-01-01

    A detecting system using NaI(Tl) is widely used in research and industry of nuclear science and other fields. For providing the high accuracy and working well under inclement environment, the stability of detecting system using NaI(Tl) is very important. The variation of environment temperature, the change of counting rate and long time continuous working of detector will cause un-negligible effect on the measurement. Three approaches were used. They are: 1) temperature control (It makes the effect of the variation of environment temperature on the measurement negligible.); 2) spectrum stabilizing (It adjust the peak position of the spectrum when the counting rate changes.); and 3) auto-checking and adjusting (It adjusts the drift of the NaI(Tl) detecting system when it works continuously)

  7. Standardization of 201Tl and 55Fe radionuclides in a 4 (PC)-NaI(Tl) coincidence system

    International Nuclear Information System (INIS)

    Pires, Carlos Augusto

    2008-01-01

    In the present work the procedure for the standardization of radionuclides using the 4π(PC)-NaI(Tl) coincidence system was developed. The radionuclides selected were 201 Tl, used in nuclear medicine, and 55 Fe primary standard source, used for x-ray spectrometers calibration. The 4π(PC)-NaI(Tl) is composed of a 4 proportional counter operated at 0.1MPa coupled to two NaI(Tl) crystals. The 201 Tl decays by electron capture process followed by a prompt gamma-ray. The disintegration rate was determined by extrapolation technique using two methods: electronic discrimination and external absorbers. The radioactive sources were prepared in a 20 μg cm -2 thick Collodion film. The conventional electronic system was used. The observed events were registered by the TAC method. The 55 Fe decays by electron capture process to the ground state of 55 Mn, emitting x rays with around 6 keV. The standardization was obtained by the tracing method. This technique was applied using two radionuclides, which decay by electron capture process followed by a prompt gamma-ray, namely 51 Cr and 54 Mn, as tracers. Measurements with 1 and 2 aluminum foils, each 150 g cm-2 thick were carried out. The activity was obtained by extrapolation for zero thickness Al foil. The uncertainties were treated by means of matrix covariance methodology and takes into account all correlations involved. (author)

  8. Magnetism and superconductivity of some Tl-Cu oxides

    Science.gov (United States)

    Datta, Timir

    1991-01-01

    Many copper oxide based Thallium compounds are now known. In comparison to the Bi-compounds, the Tl-system shows a richer diversity; i.e., High Temperature Superconductors (HTSC) can be obtained with either one or two Tl-0 layers (m = 1,2); also, the triple-digit phases are easier to synthesize. The value of d, oxygen stoichiometry, is critical to achieving superconductivity. The Tl system is robust to oxygen loss; Tl may be lost or incorporated by diffusion. A diffusion coefficient equal to 10 ms at 900 C was determined. Both ortho-rhombic and tetragonal structures are found, but HTSC behavior is indifferent to the crystal symmetry. This system has the highest T(sub c) confirmed. T(sub c) generally increases with p, the number of CuO layers, but tends to saturate at p = 3. Zero resistance was observed at temperatures as great as 125 K. Most of these HTSC's are hole type, but the Ce-doped specimens may be electronic. The magnetic aspects were studied; because in addition to defining the perfectly diamagnetic ground state as in conventional superconductors, magnetism of the copper oxides show a surprising variety. This is true of both the normal and the superconducting states. Also, due to the large phonon contribution to the specific heat at the high T(sub c) jump, electronic density of states, D(Ef), and coherence length are uncertain, and thus, are estimated from the magnetic results. Results from the Tl-system CuO, LaBaCuO,120 and the Bi-CuO compounds are discussed. The emphasis is on the role of magnetism in the Tl-CuO HTSC, but technological aspects are also pointed out.

  9. Expanding the Teaching Commons: Making the Case for a New Perspective on SoTL

    Directory of Open Access Journals (Sweden)

    Kim A. Case, PhD

    2013-08-01

    Full Text Available As a reflection on O’Meara, Terosky, and Neumann’s (2011 work on scholarship of teaching and learning (SoTL faculty development, this essay describes the benefits of SoTL to individual faculty and university goals. In support and expansion of arguments advanced by O’Meara et al., this work calls for the use of SoTL faculty development to promote the shared teaching commons, active recruitment of new SoTL scholars, institutionalization of SoTL values, and integration of SoTL initiatives in both teaching centers and research-focused development offices.

  10. M1 transitions between superdeformed states in 195Tl

    International Nuclear Information System (INIS)

    Zheng Xing; Xingqu Chen; Xiaochun Wang

    1996-01-01

    Using a triaxial-particle-rotor model, the quadrupole and dipole transition energies, kinematic and dynamic moments of inertia, electromagnetic transition probabilities and the relative intensity of the E2 γ-transitions are calculated for superdeformed bands in 195 Tl. A strong perturbation effect of rotation on transition energies and M1 and E2 transitions of superdeformed states is investigated. The total M1 transitions, enhanced by internal conversion, are expected to compete strongly with the E2 γ-ray at low spins in the superdeformed 195 Tl nucleus. (author)

  11. The model of recombination process in TlBr

    International Nuclear Information System (INIS)

    Grigorjeva, L.; Millers, D.

    2002-01-01

    The time-resolved luminescence was used as a tool in the study of recombination process in several undoped TlBr crystals. The spectra and decay kinetics observed under electron beam excitation were investigated. Observation of several luminescence bands with different decay rates shows that more than one recombination center is involved and the recombination process is quite complicated. The band at ∼2.5 eV is dominant under 10 ns excitation pulse (electron beam or nitrogen laser pulses). The results of short-lived absorption and luminescence are used for analysis of possible mechanisms of recombination processes in TlBr

  12. Portable in situ NaI(Tl) γ spectroscopy system

    International Nuclear Information System (INIS)

    Wang Bairong; Dong Binjiang; Zeng Liping; Shen Tingyun

    2000-01-01

    The author describes a portable in situ NaI(Tl) γ spectroscopy system, which consists of a NaI (Tl) scintillation detector, an integrative spectroscopy card, a notebook computer and spectroscopy software. The spectrometer addresses applications in environmental or nuclear accident in situ γ spectroscopy measurements, and gives valid quantitative results of radionuclide concentrations per unit volume (Bq/kg) or unit area (Bq/cm 2 ) in the soil and absorbed dose rate in air at 1 m above ground (Gy/h)

  13. Anisotropic superconducting state parameters of Tl-2212 superconductors

    International Nuclear Information System (INIS)

    Khaskalam, Amit K.; Singh, R.K.; Varshney, Dinesh

    2001-01-01

    We have estimated the superconducting state parameters and their anisotropy in thallium based superconductors (Tl-2212), in the frame work of Fermi liquid approach. Determination of the effective mass of the charge carriers from the Fermi velocity and estimated anisotropic superconducting state parameters, particularly, the magnetic penetration depth along and perpendicular to the conducting plane. The coherence length along and perpendicular to the ab plane is evaluated and appears to be higher. The temperature dependence of penetration depth, their anisotropy and Ginsburg Landau parameter for optimised doped Tl based cuprates shows the power law. The technique permits a consistency with the reported data. (author)

  14. Coronary spasm: 201Tl scintiscanning following pharmacological provocation

    International Nuclear Information System (INIS)

    Montz, R.; Mathey, D.; Bleifeld, W.; Hamburg Univ.

    1981-01-01

    According to the authors' experience so far, 201 Tl myocardial scintiscanning is a sufficiently sensitive non-invasive method for detection of coronary vasospasm provoked by ergotamine administration. Mild incomplete and asymptotic forms of coronary vasospasm were detected by scintiscanning. Indications for myocardial scintiscanning of ergotamine-provoked vasospasm are: Cases of angina pectoris at rest in which electrocardiograms during spasm are not available; elleviated symptoms after nitroglycerine administration; exercise electrocardiograms without any sign of ischaemia; negative results of exercise 201 Tl myocardial scintiscanning. (orig.) [de

  15. Thermoluminescence (TL) in the identification of irradiated food

    International Nuclear Information System (INIS)

    Luthra, J.M.

    1992-01-01

    Due to progressive expansion of commercial food irradiation in recent years, the interest in detecting whether a food has been irradiated or not is growing fast and research in several methods for identification of various irradiated food stuffs is the order of the day. TL has emerged as one of the most promising tool for distinguishing between irradiated and unirradiated food. Advantages of TL method over other physical methods, its application to various foods, limitation and present state of art are discussed.(author). 9 refs., 3 tabs

  16. Automation of TL brick dating by ADAM-1

    International Nuclear Information System (INIS)

    Cechak, T.; Gerndt, J.; Hirsl, P.; Jirousek, P.; Kubelik, M.; Musilek, L.; Kanaval, J.

    2000-01-01

    Thermoluminescence has become an established dating method for ceramics and more recently for bricks. Based on the experiences of the work carried out since the late 1970's at the Rathgen-Forschungslabor in Berlin on the dating of bricks from historic architecture, and after evaluating all commercially available and some individually built automated and semi-automated TL-readers, a specially adapted machine for the fine grain dating of bricks was constructed in an interdisciplinary research project, undertaken by a team recruited from three faculties of the Czech Technical University in Prague. The result is the automated TL-reader ADAM-1 (Automated Dating Apparatus for Monuments) for the dating of historic architecture. Both the specific adaptation of the technique and the necessary optimal automation have influenced the design of this TL-reader. The principle advantage of brick as opposed to ceramic TL-dating emerges from the possibility of being able to obtain both a large number of samples and an above average quantity of datable material from each sample. This, together with the specific physical and chemical conditions in a brick wall, allowed a rethinking of the traditional error calculation and thus lower error margins as those obtained when dating ceramic shards. The TL-reader must therefore be able to measure and evaluate automatically numerous samples. The annular sample holder of ADAM-1 has 60 sample positions, which allow the irradiation and evaluation of samples taken from two locations. The thirty samples from one sampling point are divided into subgroups, which are processed in various ways. Three samples serve for a rough estimate of the TL sensitivity of the brick material. Nine samples are used for the measurement of 'natural TL' of the material. A further nine samples are used for testing the sensitivity of the material to beta radiation. The last nine samples serve for the testing of the sensitivity to alpha radiation. To determine the

  17. Alpha efficiency under TL and OSL - A subtraction technique using OSL and TL to detect artificial irradiation

    International Nuclear Information System (INIS)

    Zink, A.J.C.; Dabis, S.; Porto, E.; Castaing, J.

    2010-01-01

    With the development of thermoluminescence (TL) and optically stimulated luminescence (OSL) to determine the authenticity of old ceramics, forgers use artificial irradiation by gamma ray to age modern productions. Besides fraudulent action, objects can be exposed to various sources of X-rays (e.g. radiography, security control at airports). For all these reasons, the determination of artificial irradiation is an important topic for dating art objects. The main technique to identify artificial irradiations is the subtraction technique. It is based on the fact that alpha efficiency varies according to the luminescence technique (fine grain, coarse grains, predose, OSL). Having observed a rather significant difference of alpha efficiency for TL and OSL, we propose a new subtraction technique using OSL and TL of fine grains.

  18. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

  19. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

  20. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

  1. ORF Sequence: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

  2. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

  3. Vortex states of Tl2Ba2CuO6+δ studied via 205Tl NMR at 2 tesla

    International Nuclear Information System (INIS)

    Itoh, Yutaka; Michioka, Chishiro; Yoshimura, Kazuyoshi; Hayashi, Akihiko; Ueda, Yutaka

    2005-01-01

    We report a 205 Tl NMR study of vortex states in an aligned polycrystalline sample of an overdoped high-T c superconductor, Tl 2 Ba 2 CuO 6+δ (Tc - 85 K), at a magnetic field of 2 T along the c axis. We observed an imperfect vortex lattice, so-called Bragg glass, at T=5 K, the coexistence of vortex solid and vortex liquid between 10 and 60 K, and vortex melting between 65 and 85 K. No evidence for local antiferromagnetic ordering at vortex cores was found for our sample. (author)

  4. Performance of novel materials for radiation detection: Tl3AsSe3, TlGaSe2, and Tl4HgI6

    International Nuclear Information System (INIS)

    Kahler, D.; Singh, N.B.; Knuteson, D.J.; Wagner, B.; Berghmans, A.; McLaughlin, S.; King, M.; Schwartz, K.; Suhre, D.; Gotlieb, M.

    2011-01-01

    In this paper we report on the electrical characteristics of three novel ternary compounds, Tl 3 AsSe 3 (TAS), TlGaSe 2 (TGS), and Tl 4 HgI 6 (THI), pertaining to their use as radiation detectors. The details for growth and material characterization are not presented. A semiconductor based gamma ray detector requires a material with high Z, high density, high resistivity, appropriate bandgap (1.5-2 eV), low energy/electron-hole pair, and a high μτ product. CZT is currently the best semiconductor material for room temperature gamma ray spectroscopy; however, it is extremely difficult to produce large volumes of detector grade material, making it expensive and in limited supply. DNDO/DHS began searching for other materials that might perform as well as CZT but be easier to grow and in the end lower the cost. For this purpose, we investigated the above three materials as possible replacements for CZT as gamma ray detectors. The bulk resistivity, I-V curves, X-ray response, and gamma ray response measurements for doped and undoped crystals are presented and discussed. TAS shows good X-ray and gamma ray response, but has poor resistivity, which results in large dark current and poor spectral response. TGS has good resistivity, but shows poor X-ray and gamma ray response. THI has excellent resistivity, shows some X-ray and gamma ray response, and has great potential as a gamma ray detector.

  5. 78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

    Science.gov (United States)

    2013-04-24

    ... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

  6. 78 FR 72009 - Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-12-02

    ...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

  7. Development of a TL personal dosimeter identifiable PA exposure, and comparison with commercial TL dosimeters

    International Nuclear Information System (INIS)

    Kwon, J.W.; Kim, H.K.; Lee, J.K.; Kim, J.L.

    2004-01-01

    A single-dosimeter worn on the anterior surface of the body of a worker was found to significantly underestimate the effective dose to the worker when the radiation comes from the back. Several researchers suggested that this sort of underestimation can be corrected to a certain extent by using an extra dosimeter on the back. However, use of multiple dosimeters also has disadvantages such as complication in control or incurrence of extra cost. Instead of the common multi-dosimeter approach, in this study, a single dosimeter introducing asymmetric filters which enabled to identify PA exposure was designed, and its dose evaluation algorithm for AP-PA mixed radiation fields was established. A prototype TL personal dosimeter was designed and constructed. The Monte Carlo simulations were utilized in the design process and verified by experiments. The dosimeter and algorithm were applicable to photon radiation having an effective energy beyond 100 keV in AP-PA mixed radiation fields. A simplified performance test based on ANSI N13.11 showed satisfactory results. Considering that the requirements of the International Electrotechnical Commission (IEC) and the American National Standards Institute (ANSI) with regard to the dosimeter on angular dependency is reinforced, the dosimeter and the dose evaluation algorithm developed in this study provides a useful approach in practical personal dosimetry against inhomogeneous high energy radiation fields. (author)

  8. Giant Rashba spin splitting in Bi2Se3: Tl

    KAUST Repository

    Singh, Nirpendra; Saeed, Yasir; Schwingenschlö gl, Udo

    2014-01-01

    First-principles calculations are employed to demonstrate a giant Rashba spin splitting in Bi2Se3:Tl. Biaxial tensile and compressive strain is used to tune the splitting by modifying the potential gradient. The band gap is found to increase under

  9. Preparation of biaxially oriented TlCu-1234 thin films

    CERN Document Server

    Khan, N A; Tateai, F; Kojima, T; Ishida, K; Terada, N; Ihara, H

    1999-01-01

    The single phase of TlCu-1234 superconductor thin films is prepared for the first time by the amorphous phase epitaxy (APE) method, which is thallium treatment of sputtered amorphous phase at 900 degrees C for 1 h. The amorphous $9 phase is prepared by sputtering from the stoichiometric target composition CuBa/sub 2/Ca/sub 3/Cu/sub 4/O/sub 12-y/. The films on the SrTiO/sub 3/ substrate are aligned biaxially after the thallium treatment. Highly reproducible $9 TlCu-1234 films are prepared by this method. The XRD reflected a predominant single phase with the c-axis lattice constant of 18.74 AA. This lattice constant value is in between that of Cu-1234 (17.99 AA) and Tl-1234 (19.11 AA) . The $9 pole figure measurements of (103) reflection of the films showed a-axis-oriented crystals with Delta phi =0.8 degrees . The composition of the films after energy dispersive X-ray (EDX) measurements is Tl/sub 0.8/Cu/sub 0.2/Ba/sub $9 2/Ca/sub 3/Cu/sub 4/O /sub 12-y/. From the resistivity measurements, the T/sub c/ is 113 K...

  10. Reader's Response: What Is a SoTL?

    Science.gov (United States)

    Griebenow, Kai

    2010-01-01

    In this response to, "SoTL Commons Conference: A Spirit of Inquiry" (Margaret Davis, Kera Watkins, and Deborah Allen, "International Journal for the Scholarship of Teaching and Learning,"v3 n2 Jul 2009), Griebenow adds his personal impressions as an "SOTL newbie." He states that many scientists have an idea of…

  11. TL, EPR and optical absorption in natural grossular crystal

    Energy Technology Data Exchange (ETDEWEB)

    Yauri, J.M. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-900, Sao Paulo (Brazil); Department of Physics, University of San Agustin, Av. Independencia S/N, Arequipa (Peru); Cano, N.F. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-900, Sao Paulo (Brazil)], E-mail: nilocano@dfn.if.usp.br; Watanabe, S. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-900, Sao Paulo (Brazil)

    2008-10-15

    Grossular is one of six members of silicate Garnet group. Two samples GI and GII have been investigated concerning their luminescence thermally stimulated (TL). EPR and optical absorption and the measurements were carried out to find out whether or not same point defects are responsible for all three properties. Although X-rays diffraction analysis has shown that both GI and GII have practically the same crystal structure of a standard grossular crystal, they presented different behavior in many aspects. The TL glow curve shape, TL response to radiation dose, the effect of annealing at high temperatures before irradiation, the dependence of UV bleaching parameters on peak temperature, all of them differ going from GI to GII. The EPR signals around g=2.0 as well as at g=4.3 and 6.0 have much larger intensity in GI than in GII. Very high temperature (>800 deg. C) annealing causes large increase in the bulk background absorption in GI, however, only very little in GII. In the cases of EPR and optical absorption, the difference in their behavior can be attributed to Fe{sup 3+} ions; however, in the TL case one cannot and the cause was not found as yet.

  12. Neutron Scattering from fcc Pr and Pr3Tl

    DEFF Research Database (Denmark)

    Birgeneau, R. J.; Als-Nielsen, Jens Aage; Bucher, E.

    1972-01-01

    Elastic-neutron-scattering measurements on the singlet-ground-state ferromagnets fcc Pr and Pr3 Tl are reported. Both exhibit magnetic phase transitions, possibly to a simple ferromagnetic state at 20 and 11.6 °K, respectively. The transitions appear to be of second order although that in fcc Pr...

  13. TL, EPR and optical absorption in natural grossular crystal

    International Nuclear Information System (INIS)

    Yauri, J.M.; Cano, N.F.; Watanabe, S.

    2008-01-01

    Grossular is one of six members of silicate Garnet group. Two samples GI and GII have been investigated concerning their luminescence thermally stimulated (TL). EPR and optical absorption and the measurements were carried out to find out whether or not same point defects are responsible for all three properties. Although X-rays diffraction analysis has shown that both GI and GII have practically the same crystal structure of a standard grossular crystal, they presented different behavior in many aspects. The TL glow curve shape, TL response to radiation dose, the effect of annealing at high temperatures before irradiation, the dependence of UV bleaching parameters on peak temperature, all of them differ going from GI to GII. The EPR signals around g=2.0 as well as at g=4.3 and 6.0 have much larger intensity in GI than in GII. Very high temperature (>800 deg. C) annealing causes large increase in the bulk background absorption in GI, however, only very little in GII. In the cases of EPR and optical absorption, the difference in their behavior can be attributed to Fe 3+ ions; however, in the TL case one cannot and the cause was not found as yet

  14. New Seeds are Resistant to Wheat Stem Rust (Ug99) Multinational Programme Supported by FAO and IAEA

    International Nuclear Information System (INIS)

    2013-01-01

    Full text: A multinational effort supported by the International Atomic Energy Agency and the U.N. Food and Agriculture Organization marked a key milestone this week when a Kenyan university debuted two new varieties of disease-resistant wheat to the nation's farmers. Over the past two days, thousands of Kenyan farmers have visited Eldoret University in western Kenya for a two-day agriculture fair highlighting the latest farming technologies. Supporting the development of the new varieties were the IAEA's Technical Cooperation Department and the Joint FAO/IAEA Programme of Nuclear Techniques in Food and Agriculture. They manage an interregional Technical Cooperation project to develop varieties of wheat that are resistant to a devastating type of fungus, causing a disease known as wheat stem rust. Wheat stem rust under control for over 30 years, but a resurgence of the disease was discovered in 1999 in Uganda that swiftly spread to neighbouring Kenya. The wheat stem rust, caused by the strain of the fungus known as Ug99, named after its place and year of origin, has since spread to Iran, Yemen and South Africa and threatens crops as far away as India as spores are carried by wind. Parasitic rusts threaten global wheat production, reducing plant growth and crop yields. The disease can destroy up to 70-100 percent of the yield of wheat crop if not prevented. 'Improving food security in developing countries through the use of nuclear techniques is an important priority of the IAEA', said IAEA Director General Yukiya Amano. 'I am pleased that we have been able to make an important contribution to fighting wheat rust'. 'Wheat rusts, particularly the Ug99 strain, are a major threat to food security because rust epidemics can result in devastating yield losses. This international project involving affected countries, plant scientists and breeders and international organizations is a major breakthrough. It clearly shows the benefits of FAO/IAEA collaboration and that

  15. Thermal and x-ray studies on Tl2U(MoO4)3 and Tl4U(MoO4)4

    International Nuclear Information System (INIS)

    Dahale, N.D.; Keskar, Meera; Kulkarni, N.K.; Singh Mudher, K.D.

    2006-01-01

    In the quaternary Tl-U(IV)-Mo-O system, two new compounds namely Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 were prepared and characterized by powder X-ray diffraction and thermal methods. These compounds were prepared by solid state reactions of Tl 2 MoO 4 , UMoO 5 and MoO 3 in the required stoichiometric ratio at 500 deg C in evacuated sealed quartz ampoule. The XRD data of Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 were indexed on orthorhombic cell. TG curves of Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 did not show any weight change up to 700 deg C in an inert atmosphere. During heating in an inert atmosphere, Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 showed endothermic Dta peaks due to melting of the compounds at 519 and 565 deg C, respectively. (author)

  16. Quality control of the solution sup(201)TlCl obtained at IPEN-CNEN/SP by sup(201)Tl direct preparation

    International Nuclear Information System (INIS)

    Fernandes, L.; Silva, C.P.G. da

    1991-01-01

    The radiopharmaceutical sup(201) TlCl is used in Nuclear Medicine for myocardial visualization. The solution of sup(201)TlCl was prepared using sup(201)Tl obtained by irradiating a natural mercury target with protons. This radionuclide was subjected to different quality control processes to verify the purity required for its use in Medicine. Some of these controls concerned the determination of sup(200)Tl, sup(201)Tl and sup(202)Tl; the chemical identification of sup(201)Tl sup(+1); the hydrazine concentration, mercury contamination and the presence of phosphate. Furthermore, the biologic distribution in Wistar rats and tests for sterility pyrogens and for toxicity were carried out. It was verified that the solution obtained was in the form of tallous chloride. This radiopharmaceutical can give a good heart image in animals but due to the contamination of sup(201)Tl with sup(200)Tl and sup(202)Tl its use in human beings is not possible unless enriched sup(202)Hg is used as target of irradiation. (author)

  17. Investigating the origins of double photopeaks in CsI:Tl samples through activator mapping

    Science.gov (United States)

    Onken, Drew R.; Gridin, Sergii; Williams, Richard T.; Williams, Charles B.; Donati, George L.; Gayshan, Vadim; Vasyukov, Sergey; Gektin, Alex

    2018-06-01

    Careful examination of the origins of double photopeaks in CsI:Tl provides a foundation for exploring the relationship between activator homogeneity and photopeak resolution in scintillators. In rare cases, certain CsI:Tl crystals exhibit a second photopeak in the pulse-height spectrum. A combination of optical mapping and ICP-MS measurements reveals the presence of two distinct regions with differing Tl concentrations in these crystals. The oscillator strength of the 299 nm absorption A-band of Tl in CsI was measured to be 0.0526 ± 0.0008; this parameter can be used to quantify activator concentration from the optical absorption. Using published measurements of luminescence intensity versus Tl concentration, the distributions of Tl measured from optical absorption maps of the samples were reconstructed into photopeaks in good agreement with experiment. The distribution of Tl concentrations in these particular crystals allowed examining luminescence pulse shape as a function of Tl concentration.

  18. Mapping resistance to the Ug99 race group of the stem rust pathogen in a spring wheat landrace.

    Science.gov (United States)

    Babiker, E M; Gordon, T C; Chao, S; Newcomb, M; Rouse, M N; Jin, Y; Wanyera, R; Acevedo, M; Brown-Guedira, G; Williamson, S; Bonman, J M

    2015-04-01

    A new gene for Ug99 resistance from wheat landrace PI 374670 was detected on the long arm of chromosome 7A. Wheat landrace PI 374670 has seedling and field resistance to stem rust caused by Puccinia graminis f. sp tritici Eriks. & E. Henn (Pgt) race TTKSK. To elucidate the inheritance of resistance, 216 BC1F2 families, 192 double haploid (DH) lines, and 185 recombinant inbred lines (RILs) were developed by crossing PI 374670 and the susceptible line LMPG-6. The parents and progeny were evaluated for seedling resistance to Pgt races TTKSK, MCCFC, and TPMKC. The DH lines were tested in field stem rust nurseries in Kenya and Ethiopia. The DH lines were genotyped with the 90K wheat iSelect SNP genotyping platform. Goodness-of-fit tests indicated that a single dominant gene in PI 374670 conditioned seedling resistance to the three Pgt races. The seedling resistance locus mapped to the long arm of chromosome 7A and this result was verified in the RIL population screened with the flanking SNP markers using KASP assays. In the same region, a major QTL for field resistance was detected in a 7.7 cM interval and explained 34-54 and 29-36% of the variation in Kenya and Ethiopia, respectively. Results from tests with specific Pgt races and the csIH81 marker showed that the resistance was not due to Sr22. Thus, a new stem rust resistance gene or allele, either closely linked or allelic to Sr15, is responsible for the seedling and field resistance of PI 374670 to Ug99.

  19. Virtual NC machine model with integrated knowledge data

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2002-01-01

    The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

  20. NC10 bacteria in marine oxygen minimum zones

    DEFF Research Database (Denmark)

    Padilla, Cory C; Bristow, Laura A; Sarode, Neha

    2016-01-01

    Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

  1. Prediction of half-metallic properties in TlCrS{sub 2} and TlCrSe{sub 2} based on density functional theory

    Energy Technology Data Exchange (ETDEWEB)

    Hashimzade, F.M.; Huseinova, D.A. [Institute of Physics, National Academy of Sciences of Azerbaijan, AZ 1143 Baku (Azerbaijan); Jahangirli, Z.A. [Institute of Physics, National Academy of Sciences of Azerbaijan, AZ 1143 Baku (Azerbaijan); Institute of Radiation Problems, National Academy of Sciences of Azerbaijan, AZ 1143 Baku (Azerbaijan); Mehdiyev, B.H., E-mail: bachschi@yahoo.de [Institute of Physics, National Academy of Sciences of Azerbaijan, AZ 1143 Baku (Azerbaijan)

    2017-08-01

    Highlights: • Half-metallic properties of TlCrS2, TlCrSe2 and hypothetical TlCrSSe have been investigated by first-principles all-electron full-potential linearized augmented plane wave plus local orbital (FP-LAPW+lo) method based on density functional theory (DFT). • Total magnetic moment keeps its integer value on a relatively wide range of changes in volume (−10% ÷ 10%) for TlCrS2 and TlCrSSe, while total magnetic moment TlCrSe2 decreases with increasing volume, approaching to integer value 3 μB. • The states at the Fermi level in the case of spin-up channel consist of a hybridization of p-states of the atom S(Se) with d-states of Cr. - Abstract: Half-metallic properties of TlCrS{sub 2}, TlCrSe{sub 2} and hypothetical TlCrSSe have been investigated by first-principles all-electron full-potential linearized augmented plane wave plus local orbital (FP-LAPW+lo) method based on density functional theory (DFT). The results of calculations show that TlCrS{sub 2} and TlCrSSe are half-metals with energy gap (E{sub g}) ∼0.12 eV for spin-down channel. Strong hybridization of p-state of chalchogen and d-state of Cr leads to bonding and antibonding states and subsequently to the appearance of a gap in spin-down channel of TlCrS{sub 2} and TlCrSSe. In the case of TlCrSe{sub 2}, there is a partial hybridization and p-state is partially present in the DOS at Fermi level making this compound nearly half-metallic. The present calculations revealed that total magnetic moment keeps its integer value on a relatively wide range of changes in volume (−10% ÷ 10%) for TlCrS{sub 2} and TlCrSSe, while total magnetic moment of TlCrSe{sub 2} decreases with increasing volume approaching to integer value 3 μB.

  2. Experimental studies on radiation damages of CsI(Tl) crystals

    International Nuclear Information System (INIS)

    He Jingtang; Mao Yufang; Dong Xiaoli; Chen Duanbao; Li Zuhao

    1997-01-01

    The results of experimental studies on radiation damage of CsI(Tl) crystal were reported. There are radiation damage effects on CsI(Tl) crystal. Experimental studies on recovery of damaged CsI(Tl) crystals were made. It seems that after heating at 200 degree C for 4 hours, the damaged crystals could be recovered completely

  3. Left ventricular ejection fraction determined by gated Tl-201 perfusion SPECT and quantitative software

    International Nuclear Information System (INIS)

    Hyun, In Young; Kim, Sung Eun; Seo, Jeong Kee; Hong, Eui Soo; Kwan, Jun; Park, Keum Soo; Lee, Woo Hyung

    2000-01-01

    We compared estimates of ejection fraction (EF) determined by gated Tl-201 perfusion SPECT (g-Tl-SPECT) with those by gated blood pool (GBP) scan. Eighteen subjects underwent g-Tl-SPECT and GBP scan. After reconstruction of g-Tl-SPECT, we measured EF with Cedars software. The comparison of the EF with g-Tl-SPECT and GBP scan was assessed by correlation analysis and Bland Altman plot. The estimates of EF were significantly different (p<0.05) with g-Tl-SPECT (40%±14%) and GBP scan (43%±14%). There was an excellent correlation of EF between g-Tl-SPECT and GBP scan (r=3D0.94, p<0.001). The mean difference of EF between GBP scan and g-Tl-SPECT was +3.2%. Ninety-five percent limits of agreement were ±9.8%. EF between g-Tl-SPECT and GBP scan were in poor agreement. The estimates of EF by g-Tl-SPECT was well correlated with those by GBP scan. However, EF of g-Tl-SPECT doesn't agree with EF of GBP scan. EF of g-Tl-SPECT can't be used interchangeably with EF of GBP scan.=20

  4. Challenges to Disciplinary Knowing and Identity: Experiences of Scholars in a SoTL Development Program

    Science.gov (United States)

    Miller-Young, Janice E.; Yeo, Michelle; Manarin, Karen

    2018-01-01

    Faculty members from five years of an annual Scholarship of Teaching and Learning (SoTL) development program were invited to participate in a study about the impact of SoTL on their teaching, scholarship, and career trajectory. During semi-structured interviews, many expressed feeling discomfort during their journey into SoTL. A qualitative…

  5. High current Tl-203, Rh-103 targets preparation for cyclotron production of Tl-201 and Pd-103 radionuclides

    International Nuclear Information System (INIS)

    Arzumanov, A.; Berger, V.; Borissenko, A.; Gorodisskaya, N.; Ilmatov, I.; Knyazev, A.; Koptev, V.; Lyssukhin, S.; Platov, A.; Sychikov, G.; Zheltov, D.

    2004-01-01

    The objectives of the present work are to increase thermal stability of cyclotron targets for production of Tl-201 isotope, increase Tl-203 regeneration rate at radiochemical reprocessing of the targets and develop production technology for radiochemical sources based on Rd-103 isotope. Electrochemical coating of copper substrate with Tl increased the beam current at target irradiation from 100 μA to 125 μA. Further increase of the beam current results in sharp decrease of target stability time at irradiation to 15 min at beam current 150 μA. Thermal calculations and tests at the electron-beam stand predict satisfactory stability at such currents. The discrepancy with the irradiation results has not been explained. More accurate specification of regimes for Tl-203 electrochemical recovery from irradiated targets and better matching of the electrolyte composition made it possible to increase the recovery rate up to 99.5%. Before the present Project, the INP had no experience in production of radioactive sources based on Pd-103. Thermo-diffusion extraction of Pd-103 from irradiated rhodium foil has been chosen as a technology-defining method. The process assures good extraction rate and high purity of extracted isotope. Production of Pd-103 sources based on this technology is much simpler compared to the same based on electrochemical processes. (author)

  6. Importance of controlling the Tl-oxide partial pressure throughout the processing of TlBa2CaCu2O7 thin films

    International Nuclear Information System (INIS)

    Siegal, M.P.; Venturini, E.L.; Newcomer, P.P.; Overmyer, D.L.; Dominguez, F.; Dunn, R.

    1995-01-01

    TlBa 2 CaCu 2 O 7 (Tl-1212) superconducting films 5000--6000 A thick have been grown on LaAlO 3 (100) substrates using oxide precursors in a closed two-zone thallination furnace. Tl-1212 films can be grown with transition temperatures ∼100 K, and critical current densities measured by magnetization of J cm (5 K)>10 7 A/cm 2 and J cm (77 K)>10 5 A/cm 2 . Processing conditions, substrate temperatures and Tl-oxide source temperatures are found which result in smooth, nearly phase-pure Tl-1212 films. Variations in the respective temperature ramps of the Tl-oxide zone and the substrate zone can greatly influence resulting film properties such as microstructure, morphology, superconducting transition temperature, and critical current density. copyright 1995 American Institute of Physics

  7. Mechanisms of TL for production of the 230 {sup o}C peak in natural sodalite

    Energy Technology Data Exchange (ETDEWEB)

    Cano, Nilo F., E-mail: nilocano@dfn.if.usp.b [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil); Professional School of Physics, University of San Agustin of Arequipa, Av. Independencia S/N, Arequipa (Peru); Blak, Ana R. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil); Ayala-Arenas, Jorge S. [Professional School of Physics, University of San Agustin of Arequipa, Av. Independencia S/N, Arequipa (Peru); Watanabe, Shigueo [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil)

    2011-02-15

    The thermoluminescence (TL) peak in natural sodalite near 230 {sup o}C, which appears only after submitted to thermal treatments and to gamma irradiation, has been studied in parallel with electron paramagnetic resonance (EPR) spectrum appearing under the same procedure. This study revealed a full correlation between the 230 {sup o}C TL peak and the eleven hyperfine lines from EPR spectrum. In both case, the centers disappear at the same temperature and are restored after gamma irradiation. A complete model for the 230 {sup o}C TL peak is presented and discussed. In addition to the correlation and TL model, specific characteristics of the TL peaks are described.

  8. Electronic band structure study of colossal magnetoresistance in Tl 2Mn 2O 7

    Science.gov (United States)

    Seo, D.-K.; Whangbo, M.-H.; Subramanian, M. A.

    1997-02-01

    The electronic structure of Tl 2Mn 2O 7 was examined by performing tight binding band calculations. The overlap between the Mn t 2g- and Tl 6 s-block bands results in a partial filling of the Tl 6 s-block bands. The associated Fermi surface consists of 12 cigar-shape electron pockets with each electron pocket about {1}/{1000} of the first Brillouin zone in size. The Tl 6 s-block bands have orbital contributions from the Mn atoms, and the carrier density is very low. These are important for the occurrence of a colossal magnetoresistance in Tl 2Mn 2O 7.

  9. Two crystal structures of Ag sup + -and Tl sup + -exchanged zeolite X, Ag sub 2 sub 7 Tl sub 6 sub 5 -X and Ag sub 2 sub 3 Tl sub 6 sub 9 -X

    CERN Document Server

    Kim, S Y; Kim, Y

    2002-01-01

    Two crystal structures of dehydrated Ag sup + -and Tl sup + -exchanged zeolite X (Ag sub 2 sub 7 Tl sub 6 sub 5 -X and Ag sub 2 sub 3 Tl sub 6 sub 9 -X) have been determined by single-crystal X-ray diffraction techniques in the cubic space group Fd3 at 21(1) .deg. C (a = 24.758(4) A, a = 24.947(4) A, respectively). Their structures were refined to the final error indices R sub 1 = 0.055 and wR sub 2 = 0.057 with 375 reflections, and R sub 1 = 0.058 and wR sub 2 = 0.057 with 235 reflections, respectively, for which I> 3 sigma(I). In the structure of Ag sub 2 sub 7 Tl sub 6 sub 5 -X, 27 Ag sup + ions were found at two crystallographic sites: 15 Ag sup + ions at site I at the center of the hexagonal prism and the remaining 12 Ag sup + ions at site II' in the sodalite cavity. Sixty-five Tl sup + ions were located at three crystallographic sites: 20 Tl sup + ions at site II opposite single six-rings in the supercage, 18 Tl sup + ions at site I' in the sodalite cavity opposite the D6Rs, and the remaining 27 Tl sup ...

  10. Pulse shape analysis using CsI(Tl) Crystals

    International Nuclear Information System (INIS)

    Silva, J.; Fiori, E.; Loher, B.; Savran, D.; Wirth, R.; Vencelj, M.

    2013-06-01

    The decay time of CsI(Tl) scintillating material consists of more than a single exponential component. The ratio between the intensity of these components varies as a function of the ionizing power of the absorbed particles, such as γ -rays or protons, and the temperature. This property can therefore be used for particle discrimination and for temperature monitoring, using pulse shape analysis. An unsupervised method that uses fuzzy clustering algorithms for particle identification based on pulse shape analysis is presented. The method is applied to discriminate between photon and proton-induced signals in CsI(Tl) scintillator detectors. The first results of a method that uses pulse shape analysis for correcting the temperature-dependent gain effect of the detector are also presented. The method aims at conserving a good energy resolution in a temperature varying environment without the need to measure the temperature of the detector externally (authors)

  11. Statistics and the additive dose method in TL dating

    International Nuclear Information System (INIS)

    Scott, E.M.

    1988-01-01

    Estimation of the palaeo-dose and its associated error in thermoluminescence (TL) dating requires assumptions to be made concerning the error structures of both the TL signal and dose. In this paper, we consider the sensitivity of palaeo-dose estimation to different error structures and describe techniques for estimation of the resultant palaeo-dose errors. We also indicate how the validity of the assumptions may be verified. We have taken the approach that procedures for the analysis of a glow curve at a single temperature must first be proved prior to their inclusion in a full analysis of the glow curves over a series of temperatures. Thus, the paper deals mainly with the analysis of the univariate structure of glow curves, i.e. estimation of the palaeo-dose and error at each temperature, but in the final section of the paper, we discuss briefly the multivariate structure of the results including automatic detection of plateau regions. (author)

  12. Computerized study with 201Tl of the gold thyroid node

    International Nuclear Information System (INIS)

    Palermo, F.; Saitta, B.; Coghetto, F.; Tiberio, M.; Caldato, L.

    1982-01-01

    Because of its physical and potassium-metabolic characteristics 201 Tl is more suitable than 131 Cs for radioisotopic studies of the cold thyroid nodule, with the further diagnostic possibility of quantitatively assessing intranodular behaviour for a specific differentiation among different kinds of neoformations. Using a gamma-camera on line with a computer data processing device, sequential scintiscans were recorded for the first 20-30 min after i.v. administration of 15-20 μCi/kg of radiothallium; delayed sequences were taken at 40-60 min if intranodular uptake appeared. A quantitative appraisal was made of the differential 201 Tl uptake-ratio between nodule and healthy thyroid tissue (density-index) and the multiparameter analysis of thyroid time/activity curves generated on the relative regions of interest (ROIs). This computerized study, in 120 out of 293 patients submitted to this radiothallium test, has shown a) diagnostic agreement between clinical-histological and radioisotopic findings in 76 out of 79 colloid-cystic or degenerative neoformations, in all 16 malignant and in 23 out of 25 hyperplastic benign nodules; b) significant statistical difference of the density-index in solid versus cystic but not between benign and malignant nodules; c) different 201 Tl kinetics behaviour in different kinds of solid thyroid lesions with a satisfactory statistical difference of the radiothallium nodular dissappearance-index. (orig.) [de

  13. Comparison of 201Tl solution sources in UK hospitals, 2001

    International Nuclear Information System (INIS)

    Baker, M.; Woods, M.

    2001-01-01

    During recent years, concerns have been raised within the nuclear medicine field about the accuracy of activity measurements for 201 Tl. And indeed, NPL calibrations repeatedly indicated that the level of impurities present in such samples and the significant amount of activity adsorbed onto the glass wall of the container could produce erroneous results. In addition, the standard P6 vials, in which 201 Tl solution had been previously supplied, were recently replaced with the new ''10R Type 1 plus'' Schott vials. To assess the magnitude of these effects on the accuracy of clinical measurements of the activity of 201 Tl, an intercomparison exercise was conducted between the National Physical Laboratory (NPL), Nycomed-Amersham (NA) and the UK hospital physics community. The majority of the 273 reported results were within the ± 10 % limit of accuracy that hospitals aim to achieve for diagnosis, biased high. The tendency to overestimate the activity was more evident for syringe measurements. The exercise also revealed that the adsorption losses experienced with P6 vials had been solved by the introduction of the 10R vials, but individual calibrators need to be recalibrated for this new container. (author)

  14. Firing temperature of pottery using TL and OSL techniques

    International Nuclear Information System (INIS)

    Polymeris, G.S.; Sakalis, A.; Papadopoulou, D.; Dallas, G.; Kitis, G.; Tsirliganis, N.C.

    2007-01-01

    Several methods of thermal analysis are used to determine in the laboratory the firing temperature of ancient ceramic sherds. These methods are based primarily on changes of physical characteristics occurring when clay minerals are heated. The luminescence properties of quartz grains in a ceramic matrix also undergo certain changes during firing. The possibility of measuring the sensitivity change (sensitization) of quartz in order to determine the firing temperature of archeological ceramic artifacts was investigated. The sensitivity change was studied for both the thermoluminescence (TL) and the optically stimulated luminescence (OSL) signal for a ceramic sample of known firing temperature. Various segments of the sample were annealed to a different temperature. Subsequently, the initial sensitivity, as well as the thermal and the pre-dose sensitization were measured for both TL and OSL at room temperature as a function of the annealing temperature. The obtained TL glow curves showed different shapes for annealing temperatures above the firing temperature. Thermal and pre-dose sensitizations also exhibited a similar, although less prominent, rise. The OSL signal was analyzed by integrating the raw signal over the initial second of stimulation. The initial sensitivity showed an abrupt change for annealing temperatures around the firing temperature. An alternative approach used for the analysis of the OSL signal involved a full-component resolved sensitization study. The same abrupt change for the initial sensitivity of both the first and second components was observed, as well as, a clear but not very prominent thermal sensitization trend for annealing temperatures above the firing temperature

  15. Nuclear resonance fluorescence of {sup 203,205}Tl

    Energy Technology Data Exchange (ETDEWEB)

    Pfeifer, Fabian; Fritzsche, Matthias; Pietralla, Norbert; Savran, Deniz; Weller, Henry; Zweidinger, Markus [Institut fuer Kernphysik, Technische Universitaet, Darmstadt (Germany); Rusev, Gencho; Tonchev, Anton P.; Tornow, Werner [Triangle Universities Nuclear Laboratory, Duke University, Durham (United States); Zilges, Andreas [Institut fuer Kernphysik, Universitaet Koeln (Germany)

    2009-07-01

    In order to investigate the dipole strength distribution in Thalium isotopes we have studied Nuclear Resonance Fluorescence of a sample composed of natural Thallium (consisting of 30% {sup 203}Tl and 70% {sup 205}Tl). Unpolarized bremsstrahlung with photo energies up to 7.5 MeV was used at the High Intensity Photon Setup (HIPS) at S-DALINAC at the IKP Darmstadt. 24 fluorescent {gamma}-ray transitions were observed, 19 of them for the first time. For the assignment of the polarity of two prominent {gamma}-ray transitions, one at 4.7 MeV and one at 4.9 MeV, the polarized photon beam of the High Intensity {gamma}-ray Source (HI{gamma}S) at Duke University was used. The experiment at HI{gamma}S revealed the existence of a photo-excited state of {sup 205}Tl at an excitation energy of 4.971 MeV that exhibits a transition to the first excited state at 203 keV.

  16. Activation analysis of thallium by /sup 203/Tl(n,2n)/sup 202/Tl reaction in nuclear reactors

    Energy Technology Data Exchange (ETDEWEB)

    Cohen, I M; Resnizky, S M; Baro, G B [Comision Nacional de Energia Atomica, Buenos Aires (Argentina). Gerencia de Radioisotopos y Radiaciones

    1982-01-01

    Two techniques are described for neutron activation analysis of thallium in biological and geological materials, based on /sup 203/Tl(n,2n)/sup 202/Tl reaction in nuclear reactors. Co-precipitation with bismuth sulphide is used as a pre-concentration method of thallium in urine samples, and post-irradiation chemical separation is also performed. The detection limit is 0.5 ..mu..g/l, for 100 ml urine samples. For thallium determination in blendes a radiochemical separation is carried out after the irradiation. An extension of this technique is presented for glass and silicate rocks. Results for seven blende samples from different places of Argentina are shown. Analysis of two reference materials, the 614 glass from the National Bureau of Standards and the granodiorite GSP-1 from the U.S. Geological Survey were also performed. The results are in very good agreement with the certified or estimated values.

  17. Exploration of GaInTlP and related Tl-containing III-V alloys for photovoltaics

    International Nuclear Information System (INIS)

    Friedman, D. J.; Kurtz, Sarah R.; Kibbler, A. E.

    1999-01-01

    This paper discusses the results of an attempt to grow GaInTlP for application as a 1-eV material for the third junction of a GaInP/GaAs/3rd-junction high-efficiency solar cell. Although early indications from the literature were promising, we are unable to produce crystalline homogeneous material, and so we conclude that this material is not a promising candidate for such applications as photovoltaics

  18. Development of surgical gamma probes with TlBr semiconductors and CsI(Tl) scintillators crystals

    International Nuclear Information System (INIS)

    Costa, Fabio Eduardo da

    2006-01-01

    Radio guided surgery, using probes with radiation detectors, has been prominence in the medical area in the last decade. This technique consists in injecting a radioactive substance to concentrate in tumour and assist the localization during the surgical procedure. The radio guided surgeries allowing the identification of lymph node has revolutioned the behavior of tumour in initial stadium when are being spread by lymphatic way. The conditions imposed to the surgery due the proximity between some lymph nodes, demands of the probes, a small diameters and capacity of individual identification of these lymph nodes radiolabelled by a specific tracer. The international market supplies these probes with CdTe semiconductors and scintillators, but there is some time lack a promptly technical assistance in the Brazilian market. This work developed probes with national technology, using CsI(Tl) scintillators crystals and, in substitution to CdTe crystals semiconductors, the TlBr crystal, that is a new semiconductor detector in a world-wide development, with advantages in relation to the CdTe. Both crystals have been grown in IPEN. All the necessary electronics, specially, the preamplifier, that was also a restrictive factor for development of these types of probe in the country, have been developed with components found in the national market. Systematic measures of spatial resolution, spatial selectivity, maximum sensitivity and quality of the shielding have been carried the probes development. The results have shown that the probes, one with the CsI(Tl) crystal and another with TlBr semiconductor presented the requested performance in the international literature for radio guided probes. (author)

  19. Non-leptonic kaon decays at large Nc

    Science.gov (United States)

    Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

    2018-03-01

    We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

  20. Exploring the thermoelectric and magnetic properties of uranium selenides: Tl2Ag2USe4 and Tl3Cu4USe6

    International Nuclear Information System (INIS)

    Azam, Sikander; Khan, Saleem Ayaz; Din, Haleem Ud; Khenata, Rabah; Goumri-Said, Souraya

    2016-01-01

    The electronic, magnetic and thermoelectric properties of Tl 2 Ag 2 USe 4 and Tl 3 Cu 4 USe 6 compounds were investigated using the full potential linear augmented plane wave (FP-LAPW) method based on the density functional theory (DFT). The exchange correlation was treated with the generalized gradient approximation plus optimized effective Hubbard parameter and spin–orbit coupling (GGA+U+SOC). The present uranium selenides show narrow direct energy band gap values of 0.7 and 0.875 eV for Tl 2 Ag 2 USe 4 and Tl 3 Cu 4 USe 6 respectively. For both selenides U-d/f states are responsible for electrical transport properties. Uranium atoms were the most contributors in the magnetic moment compared to other atoms and show ferromagnetic nature. The spin density isosurfaces show the polarization of neighboring atoms of Uranium, such as silver/copper and selenium. Thermoelectric calculations reveal that Tl 3 Cu 4 USe 6 is more suitable for thermoelectric device applications than Tl 2 Ag 2 USe 4 . - Highlights: • Electronic, magnetic and thermoelectric properties of uranium selenides are investigated with DFT. • They show a narrow direct energy band gap of 0.7 and 0.875 eV. • U-d/f states are responsible for electrical transport properties. • Tl 3 Cu 4 USe 6 is more suitable for thermoelectric device applications than Tl 2 Ag 2 USe 4 .

  1. Gamma-radiation-induced change in the activation energy of TL traps in LiRbSO[sub 4]:Tl

    Energy Technology Data Exchange (ETDEWEB)

    Kassem, M.E.; El-Kolaly, M.A.; Al-Houty, L.I. (Qatar Univ., Doha (Qatar). Dept. of Physics)

    1994-06-01

    Thermoluminescence (TL) measurements were carried out for pure and doped LiRbSO[sub 4], with different concentrations of thallium (Tl). The glow-curve range of measurement is between room temperature up to 300[sup o]C. The radiation absorbed dose is in the range 56-3.2 x 10[sup 5] Gy. The results show that both pure and doped samples have glow peak temperatures that are dose dependent, and vary between 70-80[sup o]C and 140-170[sup o]C for pure and doped samples respectively. Doped samples display double peaks that increase with dopant concentration up to about 0.7% wt. The second peak which occurs at high temperature increases linearly with dose up to 4500 Gy. From the results it is proposed that LiRbSO[sub 4] doped with 0.7% Tl can be used for dosimetric purposes in this range. The activation energies of structural transitions are estimated and the results are discussed on the basis of radiation-induced stable dipoles in the random field system. (Author).

  2. Tl-201 and Tc-99m-DTPA neuro-SPECT in cerebral radiation necrosis

    International Nuclear Information System (INIS)

    Cleto, E.M. Jr.; Holmes, R.A.; Gumerlock, M.K.; Cabeen, M.; Logan, K.W.; Hoffman, T.J.

    1992-01-01

    The results in 3 cases of radiation necrosis demonstrate that by using both radionuclides Tl-201 and Tc-99m-DTPA, one can provide a semi-quantitative method to differentiate recurrent tumor from radiation necrosis. Focally increased cerebral Tl-201 activity in irradiated brain tumor patients is not specific for tumor recurrence, but when used in combination with DTPA, one is able to estimate the amount of Tl-201 activity resulting from increased blood-brain barrier permeability. If the average Tl-201 index is less than the average Tc-99m-DTPA index it suggests that the increased Tl-201 activity results primarily from blood-brain barrier breakdown. Tc-99m-DTPA SPECT, in addition to Tl-201 SPECT, or serial Tl-201 SPECT imaging may increase the accuracy of brain scintigraphy in differentiating radiation necrosis from tumor recurrence. To verify these preliminary findings, we are in the process of analyzing additional SPECT data on 9 more patients with malignant brain tumors. Using a slightly different method of quantifying Tl- 201/Tc-99m-DTPA ratios (computing the ratio of intralesional Tl-201 or Tc-99m-DTPA activity compared to adjacent scalp activity), patients with tumor recurrence have higher Tl-201/Tc-99m-DTPA ratios compared to those with radiation necrosis (verbal communication with Dr. Mary K. Gumerlock). (orig.) [de

  3. Electronic structure of TlBa2CaCu2O7-δ

    Science.gov (United States)

    Vasquez, R. P.; Novikov, D. L.; Freeman, A. J.; Siegal, M. P.

    1997-06-01

    The core levels of TlBa2CaCu2O7-δ (Tl-1212) epitaxial films have been measured with x-ray photoelectron spectroscopy (XPS). The valence electronic structure has been determined using the full-potential linear muffin-tin-orbital band-structure method and measured with XPS. The calculations show that a van Hove singularity (VHS) lies above the Fermi level (EF) for the stoichiometric compound (δ=0), while for 50% oxygen vacancies in the Tl-O layer (δ=0.5) EF is in close proximity to the VHS. Samples annealed in nitrogen (to reduce the hole overdoping by the removal of oxygen) exhibit higher core-level binding energies and a higher Tc, consistent with a shift of EF closer to the VHS. Comparisons are made to the core levels and valence bands of Tl2Ba2CaCu2O8+δ (Tl-2212) and HgBa2CaCu2O6+δ (Hg-1212). The similarity of the Cu 2p3/2 spectra for Tl-1212 and Tl-2212 indicates that the number of Tl-O layers has little effect on the Cu-O bonding. However, the Tl-1212 and Hg-1212 Cu 2p3/2 signals exhibit differences which suggest that the replacement of Tl3+ with Hg2+ results in a decrease in the O 2p-->Cu 3d charge-transfer energy and differences in the probabilities of planar vs apical oxygen charge transfer and/or Zhang-Rice singlet-state formation. Differences between the Tl-1212 and the Tl-2212 and Hg-1212 measured valence bands are consistent with the calculated Cu 3d and (Tl,Hg) 6s/5d partial densities of states.

  4. Electronic structure of TlBa2CaCu2O7-δ

    International Nuclear Information System (INIS)

    Vasquez, R.P.; Novikov, D.L.; Freeman, A.J.; Siegal, M.P.

    1997-01-01

    The core levels of TlBa 2 CaCu 2 O 7-δ (Tl-1212) epitaxial films have been measured with x-ray photoelectron spectroscopy (XPS). The valence electronic structure has been determined using the full-potential linear muffin-tin-orbital band-structure method and measured with XPS. The calculations show that a van Hove singularity (VHS) lies above the Fermi level (E F ) for the stoichiometric compound (δ=0), while for 50% oxygen vacancies in the Tl-O layer (δ=0.5) E F is in close proximity to the VHS. Samples annealed in nitrogen (to reduce the hole overdoping by the removal of oxygen) exhibit higher core-level binding energies and a higher T c , consistent with a shift of E F closer to the VHS. Comparisons are made to the core levels and valence bands of Tl 2 Ba 2 CaCu 2 O 8+δ (Tl-2212) and HgBa 2 CaCu 2 O 6+δ (Hg-1212). The similarity of the Cu 2p 3/2 spectra for Tl-1212 and Tl-2212 indicates that the number of Tl-O layers has little effect on the Cu-O bonding. However, the Tl-1212 and Hg-1212 Cu 2p 3/2 signals exhibit differences which suggest that the replacement of Tl 3+ with Hg 2+ results in a decrease in the O 2p→Cu 3d charge-transfer energy and differences in the probabilities of planar vs apical oxygen charge transfer and/or Zhang-Rice singlet-state formation. Differences between the Tl-1212 and the Tl-2212 and Hg-1212 measured valence bands are consistent with the calculated Cu 3d and (Tl,Hg) 6s/5d partial densities of states. copyright 1997 The American Physical Society

  5. Chemical bonding in Tl cuprates studied by x-ray photoemission

    International Nuclear Information System (INIS)

    Vasquez, R.P.; Siegal, M.P.; Overmyer, D.L.; Ren, Z.F.; Lao, J.Y.; Wang, J.H.

    1999-01-01

    Epitaxial thin films of the Tl cuprate superconductors Tl 2 Ba 2 CaCu 2 O 8 , Tl 2 Ba 2 Ca 2 Cu 3 O 10 , and Tl 0.78 Bi 0.22 Ba 0.4 Sr 1.6 Ca 2 Cu 3 O 9-δ are studied with x-ray photoemission spectroscopy. These data, together with previous measurements in this lab of Tl 2 Ba 2 CuO 6+δ and TlBa 2 CaCu 2 O 7-δ , comprise a comprehensive data set for a comparative study of Tl cuprates with a range of chemical and electronic properties. In the Cu 2p spectra, a larger energy separation between the satellite and main peaks (E s -E m ) and a lower intensity ratio (I s /I m ) are found to correlate with higher values of T c . Analysis of these spectra within a simple configuration interaction model suggests that higher values of T c are related to low values of the O 2p→Cu 3d charge transfer energy. In the O 1s region, a smaller bond length between Ba and Cu-O planar oxygen is found to correlate with a lower binding energy for the signal associated with Cu-O bonding, most likely resulting from the increased polarization screening by Ba 2+ ions. For samples near optimum doping, maximum T c is observed to occur when the Tl 4f 7/2 binding energy is near 117.9 eV, which is near the middle of the range of values observed for Tl cuprates. Higher Tl 4f 7/2 binding energies, corresponding to formal oxidation states nearer Tl 1+ , are also found to correlate with longer bond lengths between Ba and Tl-O planar oxygen, and with higher binding energies of the O 1s signal associated with Tl-O bonding. copyright 1999 The American Physical Society

  6. ORF Sequence: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

  7. ORF Sequence: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

  8. ORF Sequence: NC_003078 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

  9. ORF Sequence: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

  10. ORF Sequence: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

  11. ORF Sequence: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

  12. ORF Sequence: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

  13. ORF Sequence: NC_003279 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

  14. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

  15. ORF Sequence: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

  16. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

  17. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK

  18. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL

  19. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

  20. Phase equilibria in TlX-Cd(Zn)X (X-S, Se, Te) systems

    International Nuclear Information System (INIS)

    Gusejnov, F.Kh.; Babanly, M.B.; Kuliev, A.A.

    1982-01-01

    The methods of DTA, RPA and measurement of the alloys microhardness have been used to investigate the phase equilibria in the TlX-Zn(Cd)X systems. It is established that the TlZn(Cd)X 2 compounds, the presence of which is mentioned in the literature earlier, do not form in these systems. The TlSe-Zn(Cd)Se systems apply to the simple eutectic type and characterized by digenerated eutectic near the TlSe. Thermodynamical analysis of the liquidus of the TlSe-CdSe and TlTe-Zn(Cd)Te systems in approximation of the regular solutions, taking into account the dissociation of tallium chalcogenides in liquid phase, is made

  1. TL and ESR based identification of gamma-irradiated frozen fish using different hydrolysis techniques

    Science.gov (United States)

    Ahn, Jae-Jun; Akram, Kashif; Shahbaz, Hafiz Muhammad; Kwon, Joong-Ho

    2014-12-01

    Frozen fish fillets (walleye Pollack and Japanese Spanish mackerel) were selected as samples for irradiation (0-10 kGy) detection trials using different hydrolysis methods. Photostimulated luminescence (PSL)-based screening analysis for gamma-irradiated frozen fillets showed low sensitivity due to limited silicate mineral contents on the samples. Same limitations were found in the thermoluminescence (TL) analysis on mineral samples isolated by density separation method. However, acid (HCl) and alkali (KOH) hydrolysis methods were effective in getting enough minerals to carry out TL analysis, which was reconfirmed through the normalization step by calculating the TL ratios (TL1/TL2). For improved electron spin resonance (ESR) analysis, alkali and enzyme (alcalase) hydrolysis methods were compared in separating minute-bone fractions. The enzymatic method provided more clear radiation-specific hydroxyapatite radicals than that of the alkaline method. Different hydrolysis methods could extend the application of TL and ESR techniques in identifying the irradiation history of frozen fish fillets.

  2. TL response to quartz and aluminum oxide grain for α-irradiation

    International Nuclear Information System (INIS)

    Pan Baolin; Wei Mingjian; Li Dongxu; Liu Zhaowen; Liu Chao; Zhao Shiyuan

    2009-01-01

    Thermoluminescence (TL) response for an α-ray irradiation system ( 241 Am) was examined with quartz grains of 11-40 μm. Quartz grains of different sizes, i.e. 137 Cs), before they were irradiated to different doses by the α-ray irradiation system. TL response to the quartz grain samples was measured. TL response of the quartz grains smaller than 4 μm and 11-40 μm to α-ray irradiation is the best, as the α-rays cannot penetrate quartz larger than 40 μm. The TL response characteristic is related with quartz grain surface area. TL responses to α-irradiation of 11-40 μm quartz and aluminum oxide grains were compared. The α-irradiation TL response of aluminum oxide (330 degree C) is better than the quartz (375 degree C). (authors)

  3. Differential diagnosis of thyroid diseases with 131I and 201TlCl scintigraphy

    International Nuclear Information System (INIS)

    Kumano, Machiko; Ishida, Osamu

    1979-01-01

    Scintigraphic study with 131 I and 201 TlCl was performed on the differential diagnosis of various kinds of thyroid disease. When thyroid nodules are cold by scintigraphy with 131 I and hot with 201 TlCl, the lesions were proved to be solid tumor, that is, mostly follicular adenoma and carcinoma, and also most probably chronic thyroiditis. Accumulation of 201 TlCl, however, is not observed in cystic lesions, and is very high with high frequency in metastatic lesion of the lymph nodes as well as the thyroid cancer, especially in well differentiated follicular carcinoma. Therefore 201 TlCl was very useful to confirm the metastatic tumors from the thyroid cancer. These features in accumulation of 131 I and 201 TlCl in thyroid disease suggest the imaging technique with 201 TlCl combined with 131 I seem to provide more pathological information on the thyroid and metastatic lesions. (author)

  4. Radiation exposure around patients after 201Tl-myocardial scintigraphy

    International Nuclear Information System (INIS)

    Kurtaran, A.; Preitfellner, J.; Kohoutek, D.; Tousek, A.; Virgolini, I.; Havlik, E.

    1997-01-01

    Aim: It was the aim of the study to assess the additional radiation exposure to patients, attendents and nurses by patients who are undergoing nuclear medicine investigations (myocardial scintigraphy) with 201 Tl-chloride ( 201 Tl-Cl). Methode: In 16 cases the dose rates at 0.5, 1 and 2 m distance from patients were measured at 0.5, 1.5, 3-4 and 24, in some cases until 370 h after administration of 100±10 MBq 201 Tl-Cl. From the time courses of the dose rates around the patients the possible radiation exposure of other persons were estimated. Results: The initial values of the dose rate were 3.82 μSv/h at 0.5 m, 1.18 μSv/h at 1 m and 0.30 μSv/h at 2 m distance from the patients respectively. The dose rates were decreasing following a monoexponential course with an effective half-life of 60 h. The maximum doses to other persons at 1 m distance from the patients were determined by considering three scenarios. The values were 13 μSv in the waiting room, 26 μSv for nurses working in the ward and 105 μSv for persons living in the same household. Conclusion: Even at very restrictive assumptions the doses were far below the maximum permissible dose to non-radiation workers set by radiation protection regulations (1.5 mSv per year). (orig.) [de

  5. Dosimetric characteristics of LKB:Cu,P solid TL detector

    International Nuclear Information System (INIS)

    Hashim, S.; Alajerami, Y.S.M.; Ghoshal, S.K.; Saleh, M.A.; Saripan, M.I.; Kadir, A.B.A.; Bradley, D.A.; Alzimami, K.

    2014-01-01

    The dosimetric characteristics of newly developed borate glass dosimeter modified with lithium and potassium carbonate (LKB) and co-doped with CuO and NH 4 H 2 PO 4 are reported. Broad peaks in the absence of any sharp peak confirms the amorphous nature of the prepared glass. A simple glow curve of Cu doped sample is observed with a single prominent peak (T m ) at 220 °C. The TL intensity response shows an enhancement of ∼100 times due to the addition of CuO (0.1 mol%) to LKB compound. A further enhancement of the intensity by a factor of 3 from the addition of 0.25 mol% NH 4 H 2 PO 4 as a co-dopant impurity is attributed to the creation of extra electron traps with consequent increase in energy transfer of radiation recombination centers. The TL yield performance of LKB:Cu,P with Z eff ≈8.92 is approximately seventeen times less sensitive compared to LiF:Mg,Ti (TLD-100). The proposed dosimeter shows good linearity up to 10 3 Gy, minimal fading and photon energy independence. These attractive features offered by our dosimeter is expected to pave the way towards dosimetric applications. - Highlights: • The NH 4 H 2 PO 4 impurities are cross linked with the CuO defect. • The addition of NH 4 H 2 PO 4 as a co-dopant improved the TL intensity by a factor of 3. • The proposed dosimeter shows good linearity up to 10 3 Gy. • Minimal fading and photon energy independence were observed

  6. Underground gas storage Uelsen: Findings from planning, building and commissioning the surface buildings and structures; Untertagegasspeicher (UGS) Uelsen: Erkenntnisse aus Planung, Bau und Inbetriebnahme der obertaegigen Anlagen

    Energy Technology Data Exchange (ETDEWEB)

    Focke, H.; Brueggmann, R.; Mende, F.; Steinkraus, D.; Wauer, R. [BEB Erdgas und Erdoel GmbH, Hannover (Germany)

    1998-12-31

    The article describes the concepts of the plants and equipment and the specific features of the underground storage at Uelsen. The underground storage will be purpose-built as an H-gas storage in a nearly depleted sandstone deposit. At a nominal deliverability of 250.000 cubic m/h (Vn) the storage at Uelsen has more potential for expansion. This potential was taken into account by designing appropriate pressure stages, capacities, performance characteristics and space. (orig.). [Deutsch] Die nachfolgende Veroeffentlichung stellt das anlagentechnische Grundkonzept und die spezifischen Besonderheiten des UGS Uelsen dar. Der im suedwestlichen Niedersachsen als H-Gasspeicher in einer nahezu ausgefoerderten Buntsandsteinlagerstaette eingerichtete UGS Uelsen wird in mehreren Ausbaustufen bedarfsgerecht fertiggestellt. Bei einer Nennentnahmekapazitaet von 450.000 m{sup 3}/h (Vn) und einer Nenninjektionsleistung von 250.000 m{sup 3}/h (Vn) weist der UGS Uelsen noch weiteres Potential fuer Erweiterungen auf. Dieses Ausbaupotential wurde bei der Planung und dem Bau der bestehenden Anlagen durch Festlegung entsprechender Druckstufen, Kapazitaeten, Leistungsgroessen und Platzanordnungen beruecksichtigt. (orig.)

  7. Creation of a magnetic barrier at a noble q close to physical midpoint between two resonant surfaces in the ASDEX UG tokamak

    Science.gov (United States)

    Vazquez, Justin; Ali, Halima; Punjabi, Alkesh

    2009-11-01

    Ciraolo, Vittot and Chandre method of building invariant manifolds inside chaos in Hamiltonian systems [Ali H. and Punjabi A, Plasma Phys. Control. Fusion, 49, 1565--1582 (2007)] is used in the ASDEX UG tokamak. In this method, a second order perturbation is added to the perturbed Hamiltonian [op cit]. It creates an invariant torus inside the chaos, and reduces the plasma transport. The perturbation that is added to the equilibrium Hamiltonian is at least an order of magnitude smaller than the perturbation that causes chaos. This additional term has a finite, limited number of Fourier modes. Resonant magnetic perturbations (m,n) = (3,2)+(4,3) are added to the field line Hamiltonian for the ASDEX UG. An area-preserving map for the field line trajectories in the ASDEX UG is used. The common amplitude δ of these modes that gives complete chaos between the resonant surfaces ψ43 and ψ32 is determined. A magnetic barrier is built at a surface with noble q that is very nearly equals to the q at the physical midpoint between the two resonant surfaces. The maximum amplitude of magnetic perturbation for which this barrier can be sustained is determined. This work is supported by US Department of Energy grants DE-FG02-07ER54937, DE-FG02-01ER54624 and DE-FG02-04ER54793.

  8. Model-based visual tracking the OpenTL framework

    CERN Document Server

    Panin, Giorgio

    2011-01-01

    This book has two main goals: to provide a unifed and structured overview of this growing field, as well as to propose a corresponding software framework, the OpenTL library, developed by the author and his working group at TUM-Informatik. The main objective of this work is to show, how most real-world application scenarios can be naturally cast into a common description vocabulary, and therefore implemented and tested in a fully modular and scalable way, through the defnition of a layered, object-oriented software architecture.The resulting architecture covers in a seamless way all processin

  9. Design and manufacture of TL analyser by using the microcomputer

    International Nuclear Information System (INIS)

    Doh, Sih Hong; Woo, Chong Ho

    1986-01-01

    This paper describes the design of the thermoluminescence analyser using microcomputer. TL analyser is designed to perform the three step heat treatment, such as pre-read heating, readout procedure and post-heating (or pre-irradiation ) anneal. We used a 12-bit A/D converter to get the precise measurement and the phase control method to control the heating temperature. Since the used Apple II microcomputer is cheap and popular, it is possible to design the economical system. Experimental results showed the successful operation with flexibility. The error of temperature control was less than ± 0.2% of the expected value. (Author)

  10. Progress in TL Dating at Risø

    DEFF Research Database (Denmark)

    Mejdahl, V.

    1972-01-01

    This article outlines the thermoluminescent dating technique employed at Risö. The intensity of beta and gamma radiation is determined by means of the TL phosphors CaSO4:Mn and CaSO4:Dy, and the determination of accumulated exposure is based on quartz and feldspar inclusions with a size of 0.......3–0.5 mm. Results are presented of a dating programme comprising sherds, bricks, burned stones and burned clay (from kilns) from seventeen excavation sites. The age of the sites ranged from a.d. 1600 to 4000 b.c....

  11. Environmental monitoring by CaSO4:Dy TL dosimeters

    International Nuclear Information System (INIS)

    Deme, S.; Szabo, P.P.

    1975-12-01

    The thermoluminescent dosimeters of high sensitivity are useful for monitoring the area near nuclear installations. CaSO 4 :Dy TL dosimeters have high sensitivity and low fading so that by means of them the dose from the background can be measured with an accuracy of 10-20%. An increase of 2 mR in the background can be observed and doses as high as 1000R can be registered with an accuracy of 5%. The measuring method and results are reported here. For two years these CaSO 4 :Dy dosimeters have been successfully used at the site of the Central Research Institute for Physics. (K.A.)

  12. MF-plan till företaget Design TL

    OpenAIRE

    Virtanen, Aino

    2015-01-01

    Examensarbetet gjordes för företaget Design TL med uppgiften att göra en mark-nadsföringsplan för företaget som skall starta verksamheten 2016. Detta examensar-bete har utförts genom litteraturstudie och information av uppdragsgivaren. Upp-dragsgivaren var Tarja Lamberg. Företaget sysslar med konst, konsthantverks plane-ring och design, tillverkning och försäljning. Uppdragsgivaren gav mig fria händer med planet, det enda som skulle tas i beakta var den begränsade budgeten. Teoride-len satte...

  13. Spins of superdeformed rotational bands in Tl isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Dadwal, Anshul; Mittal, H.M. [Dr. B.R. Ambedkar National Institute of Technology, Jalandhar (India)

    2017-01-15

    The two-parameter model defined for even-even nuclei viz. soft-rotor formula is used to assign the band-head spin of the 17 rotational bands in Tl isotopes. The least-squares fitting method is employed to obtain the spins of these bands in the A ∝ 190 mass region. The calculated transition energies are found to depend sensitively on the proposed spin. Whenever a correct spin assignment is made, the calculated and experimental transition energies coincide very well. The dynamic moment of inertia is also calculated and its variation with rotational frequency is explored. (orig.)

  14. Double blocking in the superdeformed {sup 192}Tl nucleus

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Y; Carpenter, M P; Janssens, R V.F.; Ahmad, I; Henry, R; Khoo, T L; Lauritsen, T [Argonne National Lab., IL (United States); Soramel, F [Padova University, Padova (Italy); Pilotte, S [Ottawa Univ., ON (Canada); Lewis, J M; Riedinger, L L; Yu, C H [Tennessee Univ., Knoxville, TN (United States); Garg, U; Reviol, W [Notre Dame Univ., IN (United States); Bearden, I G [Purdue Univ., Lafayette, IN (United States)

    1992-08-01

    Six superdeformed bands have been found in the nucleus {sup 192}Tl. For two of the bands, the dynamic moment of inertia J{sup (2)} is found to be constant with the rotational frequency {Dirac_h}{omega}. This result can be understood in terms of Pauli blocking of quasiparticle alignments in intruder orbitals, and represents the first experimental evidence that the alignment of these intruders is responsible for the smooth rise in J{sup (2)} seen in other superdeformed nuclei of this mass region. (author). 18 refs., 2 figs.

  15. Scintigraphic detection of ischemic and other myocardial lesions using 201Tl

    International Nuclear Information System (INIS)

    Duska, F.; Novak, J.; Vizda, J.; Kubicek, J.; Kafka, P.

    1981-01-01

    Current knowledge of the myocardium scintiscanning using 201 Tl is briefly outlined. The principle is shown of 201 Tl cumulation in a healthy myocardium and the use of the radionuclide is justified. Heart scintiscanning after exercise or after administration of drugs increasing the blood flow through the coronaries allows detecting latent ischaemic heart disease. 201 Tl scintigraphy can also be used for diagnosing the myocardial infarction, angina pectoris and other heart diseases. (J.P.)

  16. Electronic Structure of TlBa2CaCu2O(7-Delta)

    Science.gov (United States)

    Vasquez, R. P.; Novikov, D. L.; Freeman, A. J.; Siegal, M. P.

    1997-01-01

    The core levels of TlBa2CaCu2O(7-delta) (Tl-1212) epitaxial films have been measured with X-ray photoelectron spectroscopy (XPS). The valence electronic structure has been determined using the full-potential linear muffin-tin-orbital band-structure method and measured with XPS. The calculations show that a van Hove singularity (VHS) lies above the Fermi level (E(sub F)) for the stoichiometric compound (delta = 0.5), while for 50% oxygen vacancies in the Tl-O layer (delta = 0.5) E(sub F) is in close proximity to the VHS. Samples annealed in nitrogen (to reduce the hole overdoping by the removal of oxygen) exhibit higher core-level binding energies and a higher T(sub c), consistent with a shift of E(sub F) closer to the VHS. Comparisons are made to the core levels and valence bands of Tl2Ba2CaCu2O(8 + delta)(Tl-2212) and HgBa2CaCu2O)6 + delta) (Hg- 1212). The similarity of the Cu 2p(sub 3/2) spectra for Tl-1212 and Tl-2212 indicates that the number of Tl-O layers has little effect on the Cu-O bonding. However, the Tl-1212 and Hg-1212 Cu 2p(sub 3/2) signals exhibit differences which suggest that the replacement of T(sup 3+) with Hg(sup 2+) results in a decrease in the O 2p right arrow Cu 3d charge-transfer energy and differences in the probabilities of planar vs apical oxygen charge transfer and/or Zhang-Rice singlet-state formation. Differences between the Tl-1212 and the Tl-2212 and Hg-1212 measured valence bands are consistent with the calculated Cu 3d and (Tl,Hg) 6s/5d partial densities of states.

  17. Photo-TL in CaSO4:Dy: high exposure dosimetry

    International Nuclear Information System (INIS)

    Caldas, L.V.E.; Mayhugh, M.R.

    1974-01-01

    CaSO 4 :Dy exposed to 10 3 to 10 8 R then annealed in the range 280 to 400 0 C displays little TL in the major dosimetry peak near 200 0 C. Subsequent illumination with 250 nm light reinduces the 200 0 C TL. This radiation-enabled photo-TL is roughly proportional to the square root of the enabling exposure at least to 10 8 R. (auth)

  18. Microcomputer-Controlled Reader Systems for Archaeological and Geological TL Dating

    DEFF Research Database (Denmark)

    Bøtter-Jensen, Lars; Mejdahl, V.

    1984-01-01

    Two fully automated TL reader systems for TL dating and a manually operated reader for research purpose were put into operation during 1982-3. All systems are controlled by HP-85 or HP-86 microcomputers; thus flexibility in selection of measurement parameters, calculation of TL signals and displa...... the archaeological and geological ages. The principle of the measurement procedures are described, and dating results are presented to illustrate the performance of the systems...

  19. Activation energies from blue- and red-thermoluminescence (TL) of quartz grains and mean lives of trapped electrons related to natural red-TL

    International Nuclear Information System (INIS)

    Hashimoto, T.; Kojima, M.; Shirai, N.; Ichino, M.

    1993-01-01

    A three-dimensional representation of thermoluminescence (TL) spectra has been established by employing an image intensifier unit combined with a simple spectrophotometer and a microcomputer. By means of this TL spectrometric system, natural quartz grains could be distinguished as either blue-and/or red-TL ones. In these blue- and red-TL wavelength regions, activation energies from artificially irradiated quartz grains are evaluated using a repeated initial rise method. An apparent difference of activation energies in the two colorations was observed for dune sands presumably originating from different quartz sources. On the other hand, quartz grains extracted from a volcanic ash sediment showed completely similar activation energies in both TL color regions over all temperatures. Subsequently, the kinetic parameters were derived for the naturally occurring red-TL, possessing an apparent single peak around 340 o C, from volcanically originating quartz grains by fitting a theoretical equation to the glow curves, after evaluating activation energies. On the basis of the empirical kinetic parameters, the mean life of trapped electrons relating to a main 340 o C peak has been proved to be 1 million years, and a secondary weak peak around 280 o C in the natural red-TL glow curve has been confirmed. (author)

  20. Recovery of 201Tl by ion exchange chromatography from proton bombarded thallium cyclotron targets

    International Nuclear Information System (INIS)

    Walt, T.N. van der; Naidoo, C.

    2000-01-01

    A method based on ion exchange chromatography is presented for the recovery of 201 Tl and its precursor 201 Pb from proton bombarded natural thallium cyclotron targets. After bombardment the target is dissolved in diluted nitric acid. Water, hydrazine and ammonium acetate are added to the solution and the lead radioisotopes separated from the thallium by cation exchange chromatography on a Bio-Rex 70 column. The sorbed lead radioisotopes are eluted with dilute nitric acid and the separation repeated on a second Bio-Rex 70 column. After elution of the remaining thallium the column is left for 32 hours and the 201 Tl formed by decay of 201 Pb is eluted with an ammonium acetate solution. The 201 Tl eluate is acidified with a HNO 3 -HBr-Br 2 mixture and the resulting solution is passed through an AG MP-1 anion exchanger column to remove any remaining lead isotopes. The 201 Tl is eluted with a hydrazine solution, the eluate evaporated to dryness and the 201 Tl finally dissolved in an appropriate solution to produce a 201 TlCl solution suitable for medical use. A high quality 201 Tl product is obtained containing ≤ 0.1 μg of Tl/mCi (37 MBq) 201 Tl. The radionuclidic impurities are less than the maximum values specified by the US Pharmacopoeia and the British Pharmacopoeia. (orig.)

  1. Measurements of environmental gamma-ray spectra using a multi-element TL dosemeter

    International Nuclear Information System (INIS)

    Furuta, Sadaaki; Boetter-Jensen, L.; Nielsen, S.P.

    1986-12-01

    A method to estimate the energy distribution and dose of environmental gamma radiation was developed using a multielement TL dosemeter. Experimentally obtained energy responses from a multi-element TL dosemeter with different kinds of filters were used to calculate the energy distribution and related dose by the SAND-II computer code. The code was originally developed to estimate the neutron flux using a multiple foil activation method. Measurements were made at several locations with the multi-element TL dosemeter and comparisons were made with results from a NaI(Tl) scintillation detector and a high-pressure ionization chamber. (author)

  2. How Experienced SoTL Researchers Develop the Credibility of Their Work

    Directory of Open Access Journals (Sweden)

    Jennie Billot

    2017-03-01

    Full Text Available Teaching and learning research in higher education, often referred to as the Scholarship of Teaching and Learning (SoTL, is still relatively novel in many academic contexts compared to the mainstay of disciplinary research. One indication of this is the challenges those who engage in SoTL report in terms of how this work is valued or considered credible amongst disciplinary colleagues and in the face of institutional policies and practices. This paper moves beyond the literature that describes these specific challenges to investigate how 23 experienced SoTL researchers from five different countries understood the notion of credibility in relationship to their SoTL research and how they went about developing credibility for their work. Semi-structured interviews were facilitated and analyzed using inductive analysis. Findings indicate that notions of credibility encompassed putting SoTL research into action and building capacity and community around research findings, as well as gaining external validation through traditional indicators such as publishing. SoTL researchers reported a variety of strategies and approaches they were using, both formal and informal, to develop credibility for their work. The direct focus of this paper on credibility of SoTL work as perceived by experienced SoTL researchers, and how they go about developing credibility, is a distinct contribution to the discussions about the valuing of SoTL work.

  3. Self-trapping nature of Tl nanoclusters on the Si(111)-7x7 surface

    International Nuclear Information System (INIS)

    Hwang, C G; Kim, N D; Lee, G; Shin, S Y; Kim, J S; Chung, J W

    2008-01-01

    We have studied properties of thallium (Tl) nanoclusters formed on the Si(111)-7x7 surface at room temperature (RT) by utilizing photoemission spectroscopy (PES) and high-resolution electron-energy-loss spectroscopy (HREELS) combined with first principles calculations. Our PES data reveal that the surface states stemming from the Si substrate remain quite inert with Tl adsorption producing no Tl-induced state until saturation at Tl coverage θ=0.21 monolayers. Such a behavior, in sharp contrast with the extremely reactive surface states upon the formation of Na or Li nanoclusters, together with the presence of a unique Tl-induced loss peak in HREELS spectra suggests no strong Si-Tl bonding, and is well understood in terms of gradual filling of Si dangling bonds with increasing θ. Our calculation further indicates the presence of several metastable atomic structures of Tl nanoclusters at RT rapidly transforming from one to another faster than 10 10 flippings per second. We thus conclude that the highly mobile Tl atoms form self-trapped nanoclusters within the attractive basins of the Si substrate at RT with several metastable phases. The mobile and multi-phased nature of Tl nanoclusters not only accounts for all the existing experimental observations available at present, but also provides an example of self-trapping of atoms in a nanometre-scale region

  4. Auto-regenerative TL dating with zircon inclusions from fired materials

    International Nuclear Information System (INIS)

    Templer, R.H.; Smith, B.W.

    1988-01-01

    In this paper it is shown that it is possible to date fired material using zircon inclusions. The effects of zoning and anomalous fading are overcome using an auto-regenerative dating procedure. The high radioactivity of the grains gives a measurable self-induced TL (thermoluminescence) signal within a few months. Comparison of this ''auto-regenerated'' TL with the natural TL (which has accumulated since the firing) yields the age of the material. A sensitive TL reader capable of recording the auto-regenerated signal after 6 months is also described, and the results of age determinations on a number of known age samples are presented. (author)

  5. Two cases of hyperparathyroidism revealed by /sup 201/Tl-chloride

    Energy Technology Data Exchange (ETDEWEB)

    Otsuka, Kokichi; Asano, Haruko; Moriyama, Shigeharu (Okayama Red Cross Hospital (Japan))

    1983-08-01

    /sup 201/Tl scintigraphy at 15 min and 120 min after intravenous injection of /sup 201/TlCl revealed a parathyroidal adenoma (1.7g) in a 49-year-old female patient with hyperthyroidism complicated by renal calculi and that (1.8g) in a 58-year-old female patient without symptoms. /sup 75/Se could be substituted by /sup 201/Tl which was useful for localizing parathyroidal adenoma in hyperparathyroidism. /sup 201/Tl scintigraphy revealed the adenoma which was not palpable. The smallest adenoma detected by it was 0.9g.

  6. 76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-05-23

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

  7. 76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-05

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  8. 76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-06-29

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

  9. 76 FR 23227 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-26

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  10. ncRNA consensus secondary structure derivation using grammar strings.

    Science.gov (United States)

    Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

    2011-04-01

    Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

  11. Inherent and antigen-induced airway hyperreactivity in NC mice

    Directory of Open Access Journals (Sweden)

    Tetsuto Kobayashi

    1999-01-01

    Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

  12. On pseudorandom generators in NC0

    DEFF Research Database (Denmark)

    Cryan, Mary; Miltersen, Peter Bro

    2001-01-01

    In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

  13. Preparation of CaF{sub 2}:Dy chips as thermoluminescent dosimeters for environmental measurements using a Harshaw 2080 TL picoprocessor

    Energy Technology Data Exchange (ETDEWEB)

    Matoso, Erika; Leite, Barbara Eliodora [Centro Tecnologico da Marinha em Sao Paulo (CTMSP/CEA), Ipero, SP (Brazil). Centro Experimental Aramar; Nunes, Maira Goes [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    This work presents the necessary steps to prepare the dosimeters for application in environmental measurements. The material used was calcium fluoride doped with dysprosium (CaF{sub 2}: Dy), commercially supplied by Harshaw as TLD-200. It were carried out four initial irradiations (Co-60 source gamma - 0.8 mGy from Dosimetric Material Laboratory LMD/GMP) in a new batch of TLD-200 dosimeters to achieve a stable response and four more irradiations to separate them, according to their response range. A batch of pre-selected 197 dosimeters from 263 was used to finally obtained two batches of 99 (9.2{+-}0.7nC) and 93 (10.5{+-}0.6nC) dosimeters. A calibration curve was prepared relating the thermoluminescent response of the phosphor and the radiation exposure (0 to 600{mu}Gy), obtained by irradiation with Co-60 source of 4P geometry and measurements using a Harshaw Picoprocessor 2080 TL equipment. Repeatability of the measurements was determined for 100{mu}Gy (CV= 5.09%) and 300{mu}Gy (CV=4.18%) and the minimum detectable dose was evaluated as 2{mu}Gy. The fading was determined by irradiating the dosimeters with 0.8 mGy and reading then after 1, 5, 7, 8, 15, 29, 50, 70 and 90 days. (author)

  14. Reverse 201Tl myocardial redistribution induced by coronary artery spasm

    International Nuclear Information System (INIS)

    Xiang Dingcheng; Yin Jilin; Gong Zhihua; Xie Zhenhong; Zhang Jinhe; Wen Yanfei; Yi Shaodong

    2010-01-01

    Objective: To investigate the mechanism of reverse redistribution (RR) on dipyridamole 201 Tl myocardial perfusion studies in the patients with coronary artery spasm. Methods: Twenty-six patients with coronary artery spasm and presented as RR on dipyridamole 201 Tl myocardial perfusion studies were enlisted as RR group, while other 16 patients with no coronary artery stenosis nor RR were enlisted as control group. Dipyridamole test was repeated during coronary angiography. Corrected thrombolysis in myocardial infarction (TIMI) frame count (CTFC) and TIMI myocardial perfusion grade (TMPG) were measured at RR related and non-RR related coronary arteries before and after dipyridamole infusion respectively. All of the data were analyzed by Student's t-test or χ 2 -test and correlation analysis. Results: Coronary artery angiography showed slower blood flow and lower myocardial perfusion in RR related vessels when compared with non-RR related vessels in RR group, but there was no significant difference among the main coronary arteries in control group. The perfusion defects of RR area at rest were positively related to slower blood velocity at corresponding coronary arteries (r = 0.79, t =10.18, P 0.05). Conclusion: RR is related to the decreased blood flow and myocardial perfusion induced by coronary artery spasm at rest, which may be improved by stress test such as intravenous dipyridamole infusion. (authors)

  15. Radiation accident dosimetry: TL properties of mobile phone screen glass

    International Nuclear Information System (INIS)

    Bassinet, C.; Pirault, N.; Baumann, M.; Clairand, I.

    2014-01-01

    Mobile phones are carried by a large part of the population and previous studies have shown that they may be able to function as individual fortuitous dosimeters in case of radiological accident. This study deals with thermoluminescence (TL) properties of mobile phone screen glass. The presence of a significant background signal which partially overlaps with the radiation-induced signal is a serious issue for dose reconstruction. A mechanical method to reduce this signal using a diamond grinding bit is presented. An over-response at low energy (∼50 keV) is observed for two investigated glasses. The results of a dose recovery test using a single-aliquot regenerative-dose (SAR) procedure are discussed. - Highlights: • Mobile phone screen glass is a promising material for retrospective dosimetry. • The TL non-radiation induced background signal can be significantly reduced by a mechanical method. • A dose recovery test using an SAR procedure was successfully carried out for the investigated glass

  16. Developing SoTL through Organized Scholarship Institutes

    Directory of Open Access Journals (Sweden)

    Elizabeth Marquis

    2015-12-01

    Full Text Available The need to further integrate SoTL into college and university cultures has been discussed relatively frequently in recent teaching and learning literature. While a number of useful strategies to assist in this task have been advanced, one especially promising suggestion is the development of organized, institutionally-recognized scholarship institutes. Centres or units of this sort have been created at higher education institutions in a number of countries, but little published information currently exists about the design of these institutes or the experiences of individuals affiliated with them. To that end, the present study sought to examine the perceived benefits, challenges and design features of teaching and learning scholarship institutes at research-intensive universities worldwide. A website scan and a survey of individuals affiliated with these units were used to collect qualitative and quantitative data of relevance to the research questions. Based on the findings, and on ideas from the existing research institute and scholarship of teaching and learning literatures, a series of recommendations for individuals and campuses interested in developing effective SoTL institutes are provided.

  17. Evaluation of Tl-201 SPECT imaging findings in prostate cancer

    Directory of Open Access Journals (Sweden)

    Sinem Ozyurt

    2015-07-01

    Full Text Available Objectives: To compare with histopathological findings the findings of prostate cancer imaging by SPECT method using Tl-201 as a tumor seeking agent. Methods: The study comprised 59 patients (age range 51-79 years, mean age 65.3 ± 6.8 years who were planned to have transrectal ultrasonography (TRUS-guided biopsies due to suspicion of prostate cancer between April 2011 and September 2011. Early planar, late planar and SPECT images were obtained for all patients. Scintigraphic evaluation was made in relation to uptake presence and patterns in the visual assessment and to Tumor/Background (T/Bg ratios for both planar and SPECT images in the quantitative assessment. Histopathological findings were compatible with benign etiology in 36 (61% patients and malign etiology in 23 (39% patients. Additionally, comparisons were made to evaluate the relationships between uptake patterns,total PSA values and Gleason scores. Results: A statistically significant difference was found between the benign and malignant groups in terms of uptake in planar and SPECT images and T/Bg ratios and PSA values. No statistically significant difference was found between uptake patterns of planar and SPECT images and Gleason scores in the malignant group. Conclusions: SPECT images were superior to planar images in the comparative assessment. Tl-201 SPECT imaging can provide an additional contribution to clinical practice in the diagnosis of prostate cancer and it can be used in selected patients.

  18. Phase diagrams of novel Tl{sub 4}SnSe{sub 4}–TlSbSe{sub 2}–Tl{sub 2}SnSe{sub 3} quasi-ternary system following DTA and X-ray diffraction

    Energy Technology Data Exchange (ETDEWEB)

    Barchiy, I.E.; Tatzkar, A.R. [Department of Chemistry, Uzhgorod National University, Pidgirna St., 46, Uzhgorod 88000 (Ukraine); Fedorchuk, A.O. [Department of Inorganic and Organic Chemistry, Lviv National University of Veterinary Medicine and Biotechnologies, Pekarska St., 50, Lviv 79010 (Ukraine); Plucinski, K., E-mail: kpluc2006@wp.pl [Electronics Department, Military University Technology, Warsaw, Kaliskiego 2, Warsaw 00-908 (Poland)

    2016-06-25

    Phase relation in the Tl{sub 4}SnSe{sub 4}–TlSbSe{sub 2}–Tl{sub 2}SnSe{sub 3} quasiternary system were studied by the DTA and X-ray diffraction in combination with mathematical modeling. The phase diagrams of the Tl{sub 4}SnSe{sub 4}–TlSbSe{sub 2} and Tl{sub 2}SnSe{sub 3}–TlSbSe{sub 2} systems, the perspective views of the phase interaction in the ternary system, the liquidus surface projection, the isothermal section at 423 K were built for the first time. The Tl{sub 4}SnSe{sub 4}–TlSbSe{sub 2}–Tl{sub 2}SnSe{sub 3} system is of the invariant eutectic type and is characterized by the formation of limited solid solutions following initial ternary compounds. New complex compounds are not formed. - Highlights: • Two Tl{sub 4}SnSe{sub 4}–TlSbSe{sub 2},Tl{sub 2}SnSe{sub 3}–TlSbSe{sub 2} systems were explored. • Invariant processes in the ternary system were determined. • New complex compounds were not observed in ternary system.

  19. NC CATCH: Advancing Public Health Analytics.

    Science.gov (United States)

    Studnicki, James; Fisher, John W; Eichelberger, Christopher; Bridger, Colleen; Angelon-Gaetz, Kim; Nelson, Debi

    2010-01-01

    The North Carolina Comprehensive Assessment for Tracking Community Health (NC CATCH) is a Web-based analytical system deployed to local public health units and their community partners. The system has the following characteristics: flexible, powerful online analytic processing (OLAP) interface; multiple sources of multidimensional, event-level data fully conformed to common definitions in a data warehouse structure; enabled utilization of available decision support software tools; analytic capabilities distributed and optimized locally with centralized technical infrastructure; two levels of access differentiated by the user (anonymous versus registered) and by the analytical flexibility (Community Profile versus Design Phase); and, an emphasis on user training and feedback. The ability of local public health units to engage in outcomes-based performance measurement will be influenced by continuing access to event-level data, developments in evidence-based practice for improving population health, and the application of information technology-based analytic tools and methods.

  20. Tl response of KMgF{sub 3}: Lu + PTFE at ultraviolet radiation; Respuesta Tl de KMgF{sub 3}: Lu + PTFE a radiacion ultravioleta

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, P R [Instituto Nacional de Investigaciones Nucleares, A.P. 18 -1027, 11801 Mexico D.F. (Mexico); Alarcon, N G [Facultad de Quimica, Universidad Autonoma del Estado de Mexico. Paseo Tollocan, Esq. con Jesus Carranza, 50180 Toluca, Estado de Mexico (Mexico); Furetta, C; Azorin, J [Universidad Autonoma Metropolitana- Iztapalapa, San Rafael Atlixco 186, 09340 Mexico. D.F. (Mexico)

    2003-07-01

    Ionizing radiation has different types of interaction with a crystalline solid. However, only few effects are interesting to optimize some thermoluminescent (Tl) properties of certain Tl materials. This paper presents results obtained by irradiating KMgF{sub 3}: Lu + Ptfe Tl dosimeters with ultraviolet (UV) radiation previously exposed to gamma radiation. These results showed that those dosimeters not exposed previously to gamma radiation did not presented any Tl signal. Meanwhile, those previously submitted to gamma irradiation showed that their sensitivity was increased as the gamma dose increased. The glow curve of sensitized KMgF{sub 3}: Lu + Ptfe exposed to UV radiation, presented the dosimetric pea at 212 C. This makes this material to be promissory for measuring UV radiation. (Author)

  1. Study of /sup 201/Tl uptake by bone and bone marrow on /sup 201/Tl scintigraphy. With special reference to bone marrow abnormalities

    Energy Technology Data Exchange (ETDEWEB)

    Fujii, Tadashige; Tanaka, Masao; Hirose, Yoshiki; Hirayama, Jiro; Handa, Kenjiro; Nakanishi, Fumiko; Yano, Kesato; Ueda, Hitoshi

    1989-04-01

    Thallium-201 (Tl-201) uptake in the bone and bone marrow was examined in a total of 93 patients with various diseases. Sternal uptake of Tl-201 was observed when patients had bone marrow abnormality especially associated with hematopoietic disease. It was associated with proliferation of immature cells and of various types of bone marrow cells, especially erythroblastic and plasma cells. Whole-body Tl-201 scanning showed a high uptake (82%) in the sternum, chest, lumbar vertebrae, and pelvis. Thallium-201 was definitively taken up by the sternum in polycythemia (5/41), hemolytic anemia (2/2), iron deficiency anemia (2/2), and multiple myeloma (2/5). For leukemia, Tl-201 uptake was slight or negative. Thallium-201 scanning proved useful in visualizing bone marrow abnormality, although careful interpretation of bone and bone marrow uptake is required. (Namekawa, K).

  2. Advanced MicroObserver UGS integration with and cueing of the BattleHawk squad level loitering munition and UAV

    Science.gov (United States)

    Steadman, Bob; Finklea, John; Kershaw, James; Loughman, Cathy; Shaffner, Patti; Frost, Dean; Deller, Sean

    2014-06-01

    Textron's Advanced MicroObserver(R) is a next generation remote unattended ground sensor system (UGS) for border security, infrastructure protection, and small combat unit security. The original MicroObserver(R) is a sophisticated seismic sensor system with multi-node fusion that supports target tracking. This system has been deployed in combat theaters. The system's seismic sensor nodes are uniquely able to be completely buried (including antennas) for optimal covertness. The advanced version adds a wireless day/night Electro-Optic Infrared (EOIR) system, cued by seismic tracking, with sophisticated target discrimination and automatic frame capture features. Also new is a field deployable Gateway configurable with a variety of radio systems and flexible networking, an important upgrade that enabled the research described herein. BattleHawkTM is a small tube launched Unmanned Air Vehicle (UAV) with a warhead. Using transmitted video from its EOIR subsystem an operator can search for and acquire a target day or night, select a target for attack, and execute terminal dive to destroy the target. It is designed as a lightweight squad level asset carried by an individual infantryman. Although BattleHawk has the best loiter time in its class, it's still relatively short compared to large UAVs. Also it's a one-shot asset in its munition configuration. Therefore Textron Defense Systems conducted research, funded internally, to determine if there was military utility in having the highly persistent MicroObserver(R) system cue BattleHawk's launch and vector it to beyond visual range targets for engagement. This paper describes that research; the system configuration implemented, and the results of field testing that was performed on a government range early in 2013. On the integrated system that was implemented, MicroObserver(R) seismic detections activated that system's camera which then automatically captured images of the target. The geo-referenced and time-tagged Micro

  3. Investigation of the gamma radiation from the inelastic scattering of 2.75 MeV on 203Tl and 205Tl

    International Nuclear Information System (INIS)

    Hegewisch, S.

    1976-01-01

    The experimental presupositions for the measurements of (n,n'γ) reactions with time of flight discrimination have been established. By an investigation of the isotopes 203 Tl and 205 Tl with this method 120 gamma-transitions could be determined. The exact evaluation of their energies and intensities led to a completion of the level diagrams. The enrgies could be determined with a precision nearly one order of magnitude higher than the values existing hither to. (orig./WL) [de

  4. The superconductor (Tl,Hg,Ca)2(Ba,Sr)2(Ca,Sr,Tl)Cu2O7.6

    International Nuclear Information System (INIS)

    Valldor, M.; Bryntse, I.; Morawski, A.

    2002-01-01

    In the title 2212-type superconductor (thallium mercury calcium barium strontium copper oxide), which contains both Tl and Hg in the charge reservoir (CR), Sr is located at both alkali-earth (AE) metal sites. Ca enters the CR at the same time as Tl shares the smaller AE site, which increases the apical Cu-Cu distance significantly. The structure causes the superconducting Cu-O layers to become significantly puckered. (orig.)

  5. Antiferromagnetism Induced in the Vortex Core of Tl2Ba2CuO6++δ Probed by Spatially-Resolved 205Tl-NMR

    International Nuclear Information System (INIS)

    Kumagai, K.; Kakuyanagi, K.; Matsuda, Y.; Hasegawa, T.

    2003-01-01

    Magnetism in the vortex core state has been studied by spatially-resolved NMR. The nuclear spin lattice relaxation rate T 1 -1 of 205 Tl in nearly optimal-doped Tl 2 Ba 2 CuO 6+ δ (T c =85 K) is significantly enhanced in the vortex core region. The NMR results suggest that the suppression of the d-wave superconducting order parameter in the vortex core leads to the nucleation of islands with local antiferromagnetic (AF) order. (author)

  6. 201Tl in myocardial diagnosis: studies on the influence of dipyridamole, dobutamine ergometer exercise and background subtraction on the 201Tl myocadial scintiscam

    International Nuclear Information System (INIS)

    Seiderer, M.

    1979-01-01

    Changes in 201 Tl myocardial scintiscans upon administration of dipyridamole or dobutamine and upon ergometer exercise relative to scintiscans at rest were investigated as well as the influence of myocardial background subtraction on scintiscan quality and information. A total of 90 201 Tl examinations were carried out in 59 patients. 18 patients had no myocardial disease, 30 patients had a coronary disease, 5 patients suffered from cardiomyopathy and 6 from left ventricular hypertrophy. The findings are discussed in detail. (orig.) [de

  7. Study of multi-quasiparticle band structures in 197Tl using α beam

    International Nuclear Information System (INIS)

    Mukherjee, G.; Nandi, S.; Pai, H.

    2016-01-01

    Study of the multi-quasiparticle (qp) states and the band structures built on them in the neutron deficient Tl nuclei in A ∼ 190 mass region provides useful information on particle-hole interaction in the heavy nuclei. In order to investigate the multi-qp band structures we have studied the excited states in 197 Tl by gamma ray spectroscopy

  8. On the Constitution of SoTL: Its Domains and Contexts

    Science.gov (United States)

    Booth, S.; Woollacott, L. C.

    2018-01-01

    In this paper, we present an analysis of the Scholarship of Teaching and Learning in Higher Education (SoTL) which contributes to SoTL both as a field of research practice and as a background to professional development in higher education. We analyse and describe the constitution of the field, and in so doing address its nature in the face of the…

  9. Enhanced thermoelectric figure of merit in strained Tl-doped Bi2Se3

    KAUST Repository

    Saeed, Y.; Singh, Nirpendra; Schwingenschlö gl, Udo

    2014-01-01

    We explain recent experimental findings on Tl-doped Bi2Se3 by determining the electronic and transport properties by first-principles calculations and semi-classical Boltzmann theory. Though Tl-doping introduces a momentum-dependent spin

  10. Preparation of 199Tl using the electroplating gold targets on the internal target installation of cyclotron

    International Nuclear Information System (INIS)

    Zhou Dehai; Xie Degao; Chao Yangshu; Liao Fuquan; Zhang Youfa; Wang Zefu

    1992-01-01

    The separative conditions of 199 Tl from Cu, Au and Ga by reaction 197 Au(α, 2n) 199 Tl on the internal target installation of cyclotron is studied. The α-particle energy is selected in the range of 24-15 MeV. The cumulative current intensities of such α-particle beams bombarding the gold target at 150-200 μA are 1200 μA · h and 1500 μA · h respectively. The radiochemical separation of 199 Tl is carried out with isopropyl ether extraction and anions exchange from the irradiated gold targets. The radioactivities of 199 Tl and 200 Tl are 2.3 x 10 5 Bq and 7.1 x 10 2 Bq, and 200 Tl makes up 0.29% of the total radioactivity. The impurity elements contained 1 ml of 199 TlCl injection solution are Au 199 TlCl has been used in clinical experiments in vivo and relatively good results have been obtained

  11. Identification of food preserved by ionizing radiation; Preliminary tests in strawberries using thermoluminescent (TL)

    International Nuclear Information System (INIS)

    Rubio, T.; Sillano, O.; Espinoza, J.; Roman, A.; Deza, A.

    1992-01-01

    TL measurements, of irradiated and unirradiated strawberries were carried out, using peel, seeds (achenes), leaves and sediment. The four types of samples presented a different thermoluminescence response. The best results were obtained with sediment removed from the soil of the fruit surface. It is concluded that TL is a promising technique for detecting irradiated strawberries using sediment samples. (author)

  12. Value of dipyridamole stress 201Tl myocardial SPECT in detecting dysfunction of coronary microcirculation

    International Nuclear Information System (INIS)

    Lou Ying; Jiang Jinqi; Xie Wenhui; Yuan Fang; Wang Tong; Yang Yiqing

    2012-01-01

    Objective: To evaluate the value of dipyridamole stress 201 Tl myocardial SPECT in detecting dysfunction of coronary microcirculation. Methods: Forty-eight patients diagnosed with cardiac syndrome X underwent dipyridamole stress 201 Tl myocardial SPECT. Dipyridamole (0.56 mg/kg) was intravenously injected over 4 min followed by 201 Tl (111 MBq) injection at 2 min after dipyridamole administration. Image was acquired at 10 min and 240 min post-injection and co-analyzed by over two experienced doctors in nuclear medicine after three-dimensional reconstruction. The patients with 'reverse redistribution' underwent repeated dipyridamole stress 201 Tl SPECT after medical therapy for 2 weeks. The clinical symptoms and results of the treadmill exercise test pre-and post-therapy were compared. Results: Forty two patients (42/48, 87.50%) showed segmental defects: 'reverse redistribution' on delayed (240 min) 201 Tl images. After medical treatment, 36 cases of the 42 'reverse redistribution' patients had improvement in both clinical symptoms and treadmill exercise test. Post-treatment 201 Tl imaging showed improvement in 45/49 (91.84%) defect segments. Six of the 42 patients had no improvement in clinical symptoms and/or treadmill exercise test. Post-treatment 201 Tl imaging showed no improvement in all the 7 defect segments on the first scan. Conclusion: Dipyridamole stress 201 Tl myocardial SPECT may be valuable in evaluation of impaired coronary microcirculation associated with cardiac syndrome X. (authors)

  13. Observation of curious spiral growth features in Tl doped Hg bearing ...

    Indian Academy of Sciences (India)

    Synthesis of H(Tl)Ba2Ca2Cu3O8+ superconducting tapes have been accomplished by annealing the precursor tape, Ba2Ca2Cu3O (fabricated by doctor blade tape casting technique) in an environment of H(Tl) vapour. Characterization of superconducting HTSC tape sample was carried out through XRD, TEM, SEM ...

  14. Pulse shaping for fast coincidence with NaI(Tl) detectors

    International Nuclear Information System (INIS)

    Bose, S.; Sinha, B.K.; Bhattacharya, R.

    1983-01-01

    The effect of multiple limiting of the anode pulses of the photomultiplier tubes on the resolving time of an NaI(Tl)-NaI(Tl) fast coincidence set up is investigated with the help of a simple transistored limiter circuit. The performance of the set up for different energy ranges selected in the side channels is also investigated. (orig.)

  15. TL and ESR based identification of gamma-irradiated frozen fish using different hydrolysis techniques

    International Nuclear Information System (INIS)

    Ahn, Jae-Jun; Akram, Kashif; Shahbaz, Hafiz Muhammad; Kwon, Joong-Ho

    2014-01-01

    Frozen fish fillets (walleye Pollack and Japanese Spanish mackerel) were selected as samples for irradiation (0–10 kGy) detection trials using different hydrolysis methods. Photostimulated luminescence (PSL)-based screening analysis for gamma-irradiated frozen fillets showed low sensitivity due to limited silicate mineral contents on the samples. Same limitations were found in the thermoluminescence (TL) analysis on mineral samples isolated by density separation method. However, acid (HCl) and alkali (KOH) hydrolysis methods were effective in getting enough minerals to carry out TL analysis, which was reconfirmed through the normalization step by calculating the TL ratios (TL 1 /TL 2 ). For improved electron spin resonance (ESR) analysis, alkali and enzyme (alcalase) hydrolysis methods were compared in separating minute-bone fractions. The enzymatic method provided more clear radiation-specific hydroxyapatite radicals than that of the alkaline method. Different hydrolysis methods could extend the application of TL and ESR techniques in identifying the irradiation history of frozen fish fillets. - Highlights: • Irradiation has potential to improve hygienic quality of raw and processed seafood. • Detection of irradiated food is important to enforce the applied regulations. • Different techniques were compared to separate silicate minerals from frozen fish. • Limitations were observed in TL analysis on minerals isolated by density separation. • Hydrolysis methods provided more clear identification using TL and ESR techniques

  16. Studies on the tumor and organ affinity of /sup 201/Tl

    Energy Technology Data Exchange (ETDEWEB)

    Mori, H; Ando, I; Takeuchi, T [Kanazawa Univ. (Japan). School of Medicine; Ando, A; Hiraki, T

    1980-01-01

    In order to evaluate the tumor and organ affinity of /sup 201/Tl, using the Yoshida sarcoma bearing rats, the distribution of /sup 201/Tl/sup +/ in tissues and tumor was examined and compared to /sup 22/Na/sup +/, /sup 42/K/sup +/, /sup 86/Rb/sup +/, /sup 134/Cs/sup +/, and /sup 67/Ga-citrate. /sup 201/Tl/sup +/ showed almost same organ accumulation and kinetics as /sup 42/K/sup +/, /sup 86/Rb/sup +/, /sup 134/Cs, whereas /sup 201/Tl/sup +/ and /sup 22/Na/sup +/ had completely different organ distribution. These results suggest that organ affinity of /sup 201/Tl/sup +/ might be related to active transport, namely Na/sup +/-K/sup +/-ATPase pump mechanism as well as blood flow. However, it appeared to be taken into account the other factors such as different accumulation and clearance rate due to different substrates of organs. Kidney accumulation rate of /sup 201/Tl/sup +/ was much higher than /sup 42/K/sup +/, /sup 86/Rb/sup +/, /sup 134/Cs/sup +/ and about 10 times as /sup 42/K/sup +/. Macroautoradiograms of rat kidneys showed that /sup 201/Tl/sup +/ exhibited an initial high accumulation in the cortex and appeared in the outer cortex, as the cortex cleared of radioactivity. /sup 201/Tl might be interchangeable with K/sup +/ in the tubular system, reabsorbed with more affinity and cleared more slowly than K/sup +/. The tumor accumulation /sup 201/Tl/sup +/ might be related to Na/sup +/-K/sup +/-ATPase pump mechanism as well as other organs. However, in terms of tumor accumulation and concentration ratio to other organs, /sup 201/Tl/sup +/ was inferior to /sup 67/Ga-citrate, although the tumor to blood ratio was identical to that of /sup 67/Ga-citrate. Since /sup 201/Tl/sup + + +/ showed almost same distribution as /sup 201/Tl/sup +/, /sup 201/Tl/sup + + +/ might change into /sup 201/Tl/sup +/ in vivo.

  17. Stability of Tl-Ba-Ca-Cu-O superconducting thin films

    International Nuclear Information System (INIS)

    Siegal, M. P.; Overmyer, D. L.; Venturini, E. L.; Padilla, R. R.; Provencio, P. N.

    1999-01-01

    We report the stability of TlBa 2 CaCu 2 O 7 and Tl 2 Ba 2 CaCu 2 O 8 on LaAlO 3 (100) epitaxial thin films, under a variety of conditions. All films are stable in acetone and methanol and with repeated thermal cycling to cryogenic temperatures. Moisture, especially vapor, degrades film quality rapidly. These materials are stable to high temperatures in either N 2 or O 2 ambients. While total degradation, resulting from Tl depletion, occurs at the same temperatures for both phases, 600 degree sign C in N 2 and 700 degree sign C in O 2 , the onset of degradation occurs at somewhat lower temperatures for TlBa 2 CaCu 2 O 7 than for Tl 2 Ba 2 CaCu 2 O 8 . (c) 1999 Materials Research Society

  18. Synthesis and properties of Tl endash Ba endash Ca endash Cu endash O superconductors

    International Nuclear Information System (INIS)

    Siegal, M.P.; Venturini, E.L.; Morosin, B.; Aselage, T.L.

    1997-01-01

    We review the synthesis methods and properties of single crystal, powder and thin film TlBaCaCuO high-temperature superconducting (Tl-HTS) materials. With transition temperatures ≥100K for several compounds, Tl-HTS materials present real opportunities for applications above 77 K. Experiments using (1) single crystals: determined precise structural parameters and identified the complex Tl 1+ -Tl 3+ equilibrium model; (2) powders: studied the complex thermodynamic phase diagram; and (3) epitaxial films: have studied fundamental properties such as electron pair symmetry and the effect of controlled extrinsic defects on flux pinning strength, as well as providing the large-area surfaces required for device applications. copyright 1997 Materials Research Society

  19. Effects of smoking on lung uptake of 201Tl during exercise myocardial perfusion imaging

    International Nuclear Information System (INIS)

    Ouyang Wei; He Guorong; Liu Jinhua

    2004-01-01

    Objective: To investigate the influence of smoking on lung uptake of 201 Tl during myocardial perfusion imaging. Methods: Ninety-two healthy subjects, with normal 201 Tl myocardial perfusion imaging findings but no evidence of left ventricular hypertrophy and pulmonary disease, were divided into three groups, smoker, nonsmoker and quitted smoker groups. Exercise/delay 201 Tl myocardial perfusion imaging was performed on all subjects included. Lung/heart ratio was defined on the anterior planar image obtained during exercise tomography. Results: Both the lung/heart ratios during exercise in smoker (0.40 ± 0.07, F=10.635, P 201 Tl lung/heart ratios in smokers are higher than in nonsmokers and this must be kept in mind when 201 Tl lung/heart ratios are used clinically, even in quitted smokers

  20. A Call for Expanding Inclusive Student Engagement in SoTL

    Directory of Open Access Journals (Sweden)

    Peter Felten

    2013-09-01

    of student-faculty partnerships focused on inquiry into teaching and learning. However, some students tend to be privileged in SoTL initiatives while others are discouraged, implicitly or explicitly, from engaging in this work. In this paper, we consider why certain students tend to be excluded from SoTL, summarize the possible developmental gains made by students and faculty when diverse student voices are included, and highlight strategies for generating a more inclusive SoTL. We call for expanding student engagement in SoTL by encouraging a diversity of student voices to engage in co-inquiry with faculty. Inclusive engagement has tremendous potential to enhance student and faculty learning, to deepen SoTL initiatives, and to help redress the exclusionary practices that too often occur in higher education.

  1. Sample dependent correlation between TL and LM-OSL in Al2O3:C

    International Nuclear Information System (INIS)

    Dallas, G.I.; Polymeris, G.S.; Stefanaki, E.C.; Afouxenidis, D.; Tsirliganis, N.C.; Kitis, G.

    2008-01-01

    Al 2 O 3 :C single crystals are known to exhibit different, sample dependent, glow-curve shapes. The relation between the Thermoluminescence (TL) traps and the linear modulated optically stimulation luminescence (LM-OSL) traps is of high importance. In the present work a correlation study is attempted using 23 single crystals with dimensions between 400 and 500μm. The correlation study involved two steps. In the first step, both TL glow curves and LM-OSL decay curves are deconvoluted and a one-to-one correlation between TL peaks and LM-OSL components is attempted. In the second step the TL glow-curves are corrected for thermal quenching, the corrected curves are deconvoluted and a new correlation between TL and LM-OSL individual components is performed

  2. Clinical application of 201Tl scintigraphy in patients with cold thyroid nodules

    International Nuclear Information System (INIS)

    Tonami, N.; Bunko, H.; Michigishi, T.; Kuwajima, A.; Hisada, K.

    1978-01-01

    201 Tl-chloride scintigraphy was performed in 45 patients with cold thyroid nodules. The 201 Tl scintigram was positive in 17 of 18 thyroid patients with cancer (94.4%), 8 of 20 patients with an adenoma (40.0%), 1 of 2 adenomatous goiter patients (50.5%), and all of 5 cases of chronic thyroiditis (100.0%). When the cold nodule was demonstrated to be positive with 201 Tl, the statistical chance of the lesion being a cellular one was 100.0% and a risk of its malignancy was 54.8%. On the other hand, the nodule with negative 201 Tl concentration had a 14.3% chance of cellularity and a 7.1% risk of malignancy. Thus, 201 Tl scintigraphy is of use in the differential diagnosis of the cold thyroid nodule

  3. Comparison of functional parameters of CsI:Tl crystals and thick films

    International Nuclear Information System (INIS)

    Fedorov, A.; Gektin, A.; Lebedynskiy, A.; Mateychenko, P.; Shkoropatenko, A.

    2013-01-01

    500 mkm thick CsI:Tl columnar films can be produced using thermal evaporation in vacuum by sublimation of the same bulk crystal. Comparison of afterglow and radiation stability of deposited CsI:Tl films with source crystal was the aim of current work. It is shown that the afterglow in the films is always below its level in initial single crystal. It was ascertained that the annealing atmospheres influence the processes leading to the activator depletion of the films during the thermal processing. -- Highlights: ► Thick CsI:Tl columnar films were obtained by thermal evaporation in vacuum. ► Radiation stability of such CsI:Tl films appears to be better than that of crystal. ► CsI:Tl film parameters can be modified by annealing in different atmospheres

  4. Inherent and antigen-induced airway hyperreactivity in NC mice

    OpenAIRE

    Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

    1999-01-01

    In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

  5. Multi-band Monopole Antennas Loaded with Metamaterial TL

    Science.gov (United States)

    Song, Zhi-jie; Liang, Jian-gang

    2015-05-01

    A novel metamaterial transmission line (TL) by loading complementary single Archimedean spiral resonator pair (CSASRP) is investigated and used to design a set of multi-frequency monopole antennas. The particularity is that the CSASRP which features dual-shunt branches in the equivalent circuit model is directly etched in the signal strip. By smartly controlling the element parameters, three antennas are designed and one of them covering UMTS and Bluetooth bands is fabricated and measured. The antenna exhibits impedance matching better than -10 dB and normal monopolar radiation patterns at working bands of 1.9-2.22 and 2.38-2.5 GHz. Moreover, the loaded element also contributes to the radiation, which is the major advantage of this prescription over previous lumped-element loadings. The proposed antenna is also more compact over previous designs.

  6. Superdeformed bands in Hg and Tl nuclei for N≤112

    International Nuclear Information System (INIS)

    Carpenter, M.P.; Jannsens, R.V.F.; Liang, Y.; Ahmad, I.; Henry, R.; Khoo, T.L.; Lauritsen, T.; Soramel, F.; Lewis, J.M.; Riedinger, L.L.; Yu, C.H.; Garg, U.; Reviol, W.; Pilotte, S.; Bearden, I.G.; Daly, P.J.

    1992-01-01

    The study of superdeformed (SD) nuclei in the A ∼ 190 region has provided a wealth of new information on SD states at moderate to high spins (I ∼ 10 to 50 h). The dynamical moment of inertia for almost all of the SD bands reported on to date in this mass region display a similar behavior, i.e. a smooth increase with increasing rotational frequency. This increase has been attributed to both quasiparticle alignments and a decrease in pairing with increasing rotational frequency. However, standard mean-field calculations have problems reproducing the magnitude and extent of the rise. The authors' recent results on SD states in the Hg-Tl nuclei at and below the N = 112 SD-gap add support to this interpretation of the rise in the dynamical moment of inertia while at the same time showing more clearly the inadequacies of the previous theoretical calculations

  7. Retrospective dosimetry using EPR and TL techniques: a status report

    International Nuclear Information System (INIS)

    Haskell, E.H.

    1996-01-01

    Methods of retrospective dosimetry, including luminescence and electron paramagnetic resonance spectroscopy (EPR), rely on measurement of accident dose absorbed by naturally occurring materials - ceramics in the case of both thermoluminescence (TL) and optically stimulated luminescence (OSL) and organic materials and bio- minerals in the case of EPR. Each of these methods relies on measurement of radiation defects resulting from accidental exposure. Since defects also result from natural sources of radiation over the lifetime of a sample, analysis is usually restricted to materials for which the natural dose may be determined and subtracted from the measured cumulative dose. Luminescence dating techniques rely heavily on an accurate assessment of cumulative dose from natural radiation sources, and dating research has provided us with the bulk of our knowledge in this area. Virtually all of the work on natural dose determination can be directly applied to retrospective techniques. With EPR techniques the cumulative dose from diagnostic x- rays is also of importance

  8. A new type of spurious reading in TL personnel monitoring

    International Nuclear Information System (INIS)

    Duftschmid, K.E.; Stadtmann, H.; Strachotinsky, Ch.; Winker, N.

    1996-01-01

    A particularly serious type of spurious reading in automated TL personnel monitoring has been observed. These readings simulate dose values up to several mSv and can only be detected by glow curve analysis. Characteristics for these events are high artifical dose values and irregular glow curves of a particular shape. Extensive investigations to reproduce this effect purposely failed to produce any results. It can be assumed, however, that it must be some chemical surface contamination, which penetrates the sealed dosemeter bag or which is transferred from the bag to the detector. The effect can be eliminated by manual cleaning of the dosemeter cards. The importance of this observation lies in the fact that only proper glow curve evaluation can prevent the monitoring service from reporting artificial high dose readings creating lots of serious problems. The paper shows how this problem can be avoided for this kind of spurious effect, if glow curves are available and stored for every dosemeter readout. (author)

  9. Giant Rashba spin splitting in Bi2Se3: Tl

    KAUST Repository

    Singh, Nirpendra

    2014-07-25

    First-principles calculations are employed to demonstrate a giant Rashba spin splitting in Bi2Se3:Tl. Biaxial tensile and compressive strain is used to tune the splitting by modifying the potential gradient. The band gap is found to increase under compression and decreases under tension, whereas the dependence of the Rashba spin splitting on the strain is the opposite. Large values of αR = 1.57 eV Å at the bottom of the conduction band (electrons) and αR = 3.34 eV Å at the top of the valence band (holes) are obtained without strain. These values can be further enhanced to αR = 1.83 eV Å and αR = 3.64 eV Å, respectively, by 2% tensile strain. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Core excitations across the neutron shell gap in 207Tl

    Directory of Open Access Journals (Sweden)

    E. Wilson

    2015-07-01

    Full Text Available The single closed-neutron-shell, one proton–hole nucleus 207Tl was populated in deep-inelastic collisions of a 208Pb beam with a 208Pb target. The yrast and near-yrast level scheme has been established up to high excitation energy, comprising an octupole phonon state and a large number of core excited states. Based on shell-model calculations, all observed single core excitations were established to arise from the breaking of the N=126 neutron core. While the shell-model calculations correctly predict the ordering of these states, their energies are compressed at high spins. It is concluded that this compression is an intrinsic feature of shell-model calculations using two-body matrix elements developed for the description of two-body states, and that multiple core excitations need to be considered in order to accurately calculate the energy spacings of the predominantly three-quasiparticle states.

  11. Retrospective dosimetry using EPR and TL techniques: a status report

    Energy Technology Data Exchange (ETDEWEB)

    Haskell, E.H.

    1996-12-31

    Methods of retrospective dosimetry, including luminescence and electron paramagnetic resonance spectroscopy (EPR), rely on measurement of accident dose absorbed by naturally occurring materials - ceramics in the case of both thermoluminescence (TL) and optically stimulated luminescence (OSL) and organic materials and bio- minerals in the case of EPR. Each of these methods relies on measurement of radiation defects resulting from accidental exposure. Since defects also result from natural sources of radiation over the lifetime of a sample, analysis is usually restricted to materials for which the natural dose may be determined and subtracted from the measured cumulative dose. Luminescence dating techniques rely heavily on an accurate assessment of cumulative dose from natural radiation sources, and dating research has provided us with the bulk of our knowledge in this area. Virtually all of the work on natural dose determination can be directly applied to retrospective techniques. With EPR techniques the cumulative dose from diagnostic x- rays is also of importance.

  12. Non-radiation induced signals in TL dosimetry

    International Nuclear Information System (INIS)

    German, U.; Weinstein, M.

    2002-01-01

    One source of background signals, which are non-radiation related, is the reader system and it includes dark current, external contaminants and electronic spikes. These factors can induce signals equivalent to several hundredths of mSv. Mostly, the effects are minimised by proper design of the TLD reader, but some effects are dependent on proper operation of the system. The other main group of background signals originate in the TL crystal and is due to tribothermoluminescence, dirt, chemical reactions and stimulation by visible or UV light. These factors can have a significant contribution, equivalent to over several mSv, depending on whether the crystal is bare or protected by PTFE. Working in clean environments, monitoring continuously the glow curve and performing glow curve deconvolution are suggested to minimise non-radiation induced spurious signals. (author)

  13. Clinical use of /sup 201/Tl myocardial scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Senda, K; Imaeda, T; Kato, T; Asada, S; Doi, H

    1977-04-01

    Myocardial imaging with /sup 201/Tl and scinticamera was studied experimentally using specially designed phantoms and clinically in 23 patients with myocardial infarction or other heart disease. In the phantom experiment, quality of image, accumulative count rate, and detectability of the defect were compared to obtain the best technique for their detection, using four different collimators, i.e., converging, pin-hole, 4000-hole, and 140 keV high-resolution, at two photopeak levels of /sup 201/Tl of 75 and 167 keV, and combining a radiation absorber. In patient examination, myocardial images taken at different periods after injection, different detecting conditions of the scinticamera, and various detecting projections were compared. Images of the converging collimator at the 75 keV photopeak revealed considerably higher accumulative counts and relatively higher quality than those of other detecting conditions. It was necessary to take as many images as possible in various projections, in order to detect the location and size of the myocardial ischemic lesion because the lesion was demonstrated as a clear defect only in profile. It became evident that images taken between about 25 and 90 min delineated the myocardium more clearly than those taken in other periods. Normal images taken in 8 patients without ischemic heart disease appeared in the shape of a doughnut of horseshoe, demonstrating mainly the left venticular myocardium. The image was faint in the region of the aortic or mitral valve and thin in the region of the apical wall. A faint image of the right ventricular myocardium was sometimes seen. In 3 patients with valvular heart disease, findings suggested changes in the thickness of myocardium and the distribution of coronary blood flow. In 11 of 12 patients with old myocardial infarction, the location and size of the lesion was detected.

  14. Perswazyjność komunikatów reklamowych w Internecie na podstawie analizy usług finansowych SKOK-ów

    OpenAIRE

    Idzik, Beata

    2014-01-01

    Praca jest wynikiem kilkuletnich obserwacji praktycznej strony funkcjonowania reklamy w zakresie usług finansowych. Autorka starała się oddać wyraz swojemu zainteresowaniu psychologią konsumenta, marketingiem w sektorze finansowym a także fascynacji możliwościom, jakie stwarzają w tym zakresie nowe technologie oparte na Internecie. Praca ma charakter teoretyczno - badawczy. W założeniach metodologicznych sformułowano problem badawczy, cele oraz cztery hipotezy badawcze, które poddano wery...

  15. Chemical Bonding in Tl Cuprates Studied by X-Ray Photoemission

    Energy Technology Data Exchange (ETDEWEB)

    Lao, J.Y.; Overmyer, D.L.; Ren, Z.F.; Siegal, M.P.; Vasquez, R.P.; Wang, J.H.

    1999-04-05

    Epitaxial thin films of the Tl cuprate superconductors Tl{sub 2}Ba{sub 2}CaCu{sub 2}O{sub 8}, Tl{sub 2}Ba{sub 2}Ca{sub 2}Cu{sub 3}O{sub 10}, and TL{sub 0.78}Bi{sub 0.22}Ba{sub 0.4}Sr{sub 1.6}Ca{sub 2}Cu{sub 3}O{sub 9{minus}{delta}} are studied with x-ray photoemission spectroscopy. These data, together with previous measurements in this lab of Tl{sub 2}Ba{sub 2}CuO{sub 6+{delta}} and TlBa{sub 2}CaCu{sub 2}O{sub 7{minus}{delta}}, comprise a comprehensive data set for a comparative study of Tl cuprates with a range of chemical and electronic properties. In the Cu 2p spectra, a larger energy separation between the satellite and main peaks (E{sub s}-E{sub m}) and a lower intensity ratio (I{sub s}/I{sub m}) are found to correlate with higher values of T{sub c}. Analysis of these spectra within a simple configuration interaction model suggests that higher values of T{sub c} are related to low values of the O 2p {r_arrow} Cu 3d charge transfer energy. In the O 1s region, a smaller bond length between Ba and Cu-O planar oxygen is found to correlate with a lower binding energy for the signal associated with Cu-O bonding, most likely resulting from the increased polarization screening by Ba{sup 2+} ions. For samples near optimum doping, maximum T{sub c} is observed to occur when the Tl 4f{sub 7/2} binding energy is near 117.9 eV, which is near the middle of the range of values observed for Tl cuprates. Higher Tl 4f{sub 7/2} binding energies, corresponding to formal oxidation states nearer Tl{sup 1+}, are also found to correlate with longer bond lengths between Ba and Tl-O planar oxygen, and with higher binding energies of the O 1s signal associated with Tl-O bonding.

  16. Chemical bonding in Tl cuprates studied by x-ray photoemission

    Energy Technology Data Exchange (ETDEWEB)

    Vasquez, R.P. [Center for Space Microelectronics Technology, Jet Propulsion Laboratory, California Institute of Technology, Pasadena, California 91109-8099 (United States); Siegal, M.P.; Overmyer, D.L. [Sandia National Laboratories, Albuquerque, New Mexico 87185-1421 (United States); Ren, Z.F.; Lao, J.Y.; Wang, J.H. [Materials Synthesis Laboratory, Department of Chemistry, State University of New York, Buffalo, New York 14260-3000 (United States)

    1999-08-01

    Epitaxial thin films of the Tl cuprate superconductors Tl{sub 2}Ba{sub 2}CaCu{sub 2}O{sub 8}, Tl{sub 2}Ba{sub 2}Ca{sub 2}Cu{sub 3}O{sub 10}, and Tl{sub 0.78}Bi{sub 0.22}Ba{sub 0.4}Sr{sub 1.6}Ca{sub 2}Cu{sub 3}O{sub 9{minus}{delta}} are studied with x-ray photoemission spectroscopy. These data, together with previous measurements in this lab of Tl{sub 2}Ba{sub 2}CuO{sub 6+{delta}} and TlBa{sub 2}CaCu{sub 2}O{sub 7{minus}{delta}}, comprise a comprehensive data set for a comparative study of Tl cuprates with a range of chemical and electronic properties. In the Cu 2p spectra, a larger energy separation between the satellite and main peaks (E{sub s}{minus}E{sub m}) and a lower intensity ratio (I{sub s}/I{sub m}) are found to correlate with higher values of T{sub c}. Analysis of these spectra within a simple configuration interaction model suggests that higher values of T{sub c} are related to low values of the O&hthinsp;2p{r_arrow}Cu&hthinsp;3d charge transfer energy. In the O&hthinsp;1s region, a smaller bond length between Ba and Cu-O planar oxygen is found to correlate with a lower binding energy for the signal associated with Cu-O bonding, most likely resulting from the increased polarization screening by Ba{sup 2+} ions. For samples near optimum doping, maximum T{sub c} is observed to occur when the Tl 4f{sub 7/2} binding energy is near 117.9 eV, which is near the middle of the range of values observed for Tl cuprates. Higher Tl&hthinsp;4f{sub 7/2} binding energies, corresponding to formal oxidation states nearer Tl{sup 1+}, are also found to correlate with longer bond lengths between Ba and Tl-O planar oxygen, and with higher binding energies of the O&hthinsp;1s signal associated with Tl-O bonding. {copyright} {ital 1999} {ital The American Physical Society}

  17. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  18. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  19. ORF Alignment: NC_004663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  20. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  1. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  2. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  3. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  4. ORF Alignment: NC_006349 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  5. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  6. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  7. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  8. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  9. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  10. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  11. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  12. ORF Sequence: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

  13. Observations of NC stop nets for bottlenose dolphin takes

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To observe the NC stop net fishery to document the entanglement of bottlenose dolphins and movement of dolphins around the nets.

  14. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

  15. ORF Sequence: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

  16. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

  17. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

  18. ORF Sequence: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  19. ORF Sequence: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  20. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

  1. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  2. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  3. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

  4. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

  5. ORF Alignment: NC_006569 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

  6. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

  7. Explorations of the extended ncKP hierarchy

    International Nuclear Information System (INIS)

    Dimakis, Aristophanes; Mueller-Hoissen, Folkert

    2004-01-01

    A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

  8. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

  9. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

  10. ORF Alignment: NC_006371 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

  11. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

  12. ORF Alignment: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953

  13. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

  14. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler

  15. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

  16. ORF Sequence: NC_001147 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc

  17. ORF Sequence: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

  18. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

  19. ORF Sequence: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

  20. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

  1. 76 FR 78331 - Environmental Impact Statement: Jackson County, NC

    Science.gov (United States)

    2011-12-16

    ... following purpose description: ``The purpose of this project is to relieve traffic congestion in the Sylva... that improves the NC 107 north/south vehicular mobility by increasing average speeds for through...

  2. ORF Sequence: NC_001137 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

  3. ORF Sequence: NC_001145 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

  4. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  5. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep

  6. ORF Alignment: NC_003306 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  7. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [Actinoplan...es teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD

  8. ORF Alignment: NC_003064 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  9. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

  10. 77 FR 46631 - Television Broadcasting Services; Greenville, NC

    Science.gov (United States)

    2012-08-06

    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Final... acceptance of full power television rulemaking petitions requesting channel substitutions in May 2011, it... Subjects in 47 CFR Part 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video...

  11. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

  12. ORF Sequence: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

  13. ORF Sequence: NC_001134 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

  14. BChPT x 1/Nc: masses and currents

    Energy Technology Data Exchange (ETDEWEB)

    Goity, Jose L. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States); Fernando, Ishara P. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States)

    2018-04-01

    A summary of the implementation of the combined BChPT X 1/Nc expansion for three flavors is presented, along with its applications to the octet and decuplet baryon masses, SU(3) charges and axial couplings.

  15. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

  16. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

  17. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

  18. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

  19. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

  20. Trithallium tetraselenophosphate Tl3PSe4, and trithallium tetrathioarsenate, Tl3AsS4, by neutron time-of-flight diffraction

    International Nuclear Information System (INIS)

    Alkire, R.W.; Vergamini, P.J.; Larson, A.C.; Morosin, B.

    1984-01-01

    Room-temperature (293 K) single-crystal structure determinations of the isostructural materials Tl 3 PSe 4 and Tl 3 AsS 4 were performed at the Los Alamos National Laboratory Pulsed Neutron Facility. For Tl 3 PSe 4 : Msub(r) = 959.92, Pcmn, a = 9.276 (1), b = 11.036 (2), c = 9.058 (1) A, V = 927.27 A 3 , Z = 4, Dsub(m) = 6.87 (2), Dsub(x) = 6.876 Mg m -3 , lambdasub(neutron) = 0.5 → 5.2 A, F(000) = 252.5 fm. For Tl 3 AsS 4 : Msub(r) = 816.29, Pcmn, a = 9.084 (3), b = 10.877 (3), c = 8.877 (3) A, V = 877.11 A 3 , Z = 4, Dsub(m) = 6.18 (2), Dsub(x) = 6.181 Mg m -3 , lambdasub(neutron) = 0.5 → 5.2 A, F(000) = 177.2 fm. For Tl 3 PSe 4 (Tl 3 AsS 4 ), 1929 (1013) reflections were measured with I > 3sigma(I) and refined by full-matrix least squares to R(F) = 0.061 (0.063). Results on atomic refinement from this study represent an order of magnitude increase in precision over previous single-crystal X-ray structural work using Mo Kα radiation. The PSe 4 3- (AsS 4 3- ) groups have essentially tetrahedral configurations and one Tl + ion shows large anisotropic thermal motion which is structure related. (Auth.)

  1. precision deburring using NC and robot equipment. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Gillespie, L.K.

    1980-05-01

    Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

  2. Preliminary results on TL and OSL aluminium oxide dosimeters developed at IPEN

    Energy Technology Data Exchange (ETDEWEB)

    Fukumori, David T.; Yoshito, Walter K.; Ussui, Valter; Lazar, Dolores R.R.; Campos, Leticia L., E-mail: fukumori@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    The aluminum oxide composes the modern TL and OSL radiation dosimeters. TL and OSL phenomena are related to chemical elements in the crystalline structure of {alpha}-Al{sub 2}O{sub 3}. The aim of this work was to develop materials based on aluminum oxide for use in TL and OSL dosimetry. The studies included the dosimetric properties of alumina samples obtained by electro fusion, adsorption and coprecipitation. Electro fused alumina commercially available as abrasive particles was used to produce the pellets by glass sintering. Adsorption and coprecipitation were the methods used to insert metal ions to alumina. The best results were achieved with electro fused alumina and Tm{sup 3+} doped Al{sub 2}O{sub 3} pellets. The electro fused alumina-glass pellets show TL and OSL signals and the TL curve has two peaks. Its minimum detectable radiation dose is 7.2 mGy and the linearity of TL response as function of dose is up to about 800 mGy. The {alpha}-Al{sub 2}O{sub 3}:Tm pellets produced by sintering at 1550 deg C presented a meaningful TL glow curve so that it is worth studying their properties and viability of use in dosimetry. (author)

  3. The usefulness of [sup 201]TlCl scintigraphy for the diagnosis of breast tumor

    Energy Technology Data Exchange (ETDEWEB)

    Takahashi, Tamami; Moriya, Etsuo; Miyamoto, Yukio; Kawakami, Kenji; Kubo, Hirotaka; Uchida, Takeshi [Jikei Univ., Tokyo (Japan). School of Medicine

    1994-06-01

    The usefulness of [sup 201]TlCl SPECT (Tl SPECT) for the diagnosis of breast cancer was evaluated in 14 patients with various breast tumors (9 with invasive ductal carcinoma, 2 with fibroadenoma and 3 with benign process). These tumors ranged in size from 1.5 cm x 1.5 cm to 15.0 cm x 14.0 cm. Tl SPECT was carried out 2 hours after the intravenous injection of [sup 201]TlCl (185 MBq). For quantitative study, ROIs were set in the tumor (T), normal tissue of the opposite breast (B) and myocardium (M). Count ratios of T/B and T/M were calculated. Eight patients with breast cancer and a case of fibroadenoma showed intense accumulation of [sup 201]TlCl in the tumors. The T/B ratio was 1.20[+-]0.68 and the T/M ratio was 0.68[+-]0.31 in the 9 cases. Lymph node metastasis was detected in 2 of 6 cases that were confirmed at operation. No remarkable accumulation of [sup 201]TlCl was seen in 4 patients with benign process. One patient with benign tumor showed a false positive result. The rates of accuracy of mammography and ultrasonography for the same subjects were 82% and 84%, respectively. The results suggest that [sup 201]TlCl SPECT might be useful to assess breast cancer in cases in which the findings of other modalities are equivocal. (author).

  4. Myocardial 201Tl washout after combined dipyridamole submaximal exercise stress: Reference values from different patient groups

    International Nuclear Information System (INIS)

    Fridrich, L.

    1989-01-01

    Dipyridamole stress is favorable in patients unable to exercise maximally for 201 Tl myocardial scintigraphy. Aside from an analysis of uptake defects, proper washout analysis can be limited by heart rate variations when isolated dipyridamole stress is used. Heart rate standardized 201 Tl washout kinetics after a combined dipyridamole and submaximal exercise stress protocol (CDSE), feasible in elderly patients as well as in patients with peripheral artery disease, were therefore studied to investigate the 201 Tl washout after CDSE in differently defined patient groups: Group I comprised 19 patients with documented heart disease and angiographically excluded coronary artery disease (CAD); group II contained 17 patients with a very low likelihood of CAD determined by both normal exercise radionuclide ventriculography and normal 201 Tl uptake. Group III comprised 56 patients with a 50% pretest likelihood of CAD but normal 201 Tl uptake. Mean washout values were nearly identical in all groups. Despite similar uptake patterns, however, washout standardized by CDSE was significantly lower than the normal washout values after maximal treadmill exercise. Thus an obviously lower 201 Tl washout after CDSE than after maximal treadmill exercise must be considered if washout analysis criteria after dipyridamole are applied to evaluate ischemic heart disease. Nevertheless, heart rate elevation achieved by additional submaximal exercise stress seems necessary, adequate and clinically safe for standardisation of washout analysis in dipyridamole 201 Tl scintigraphy. (orig.)

  5. Dipyridamole 201Tl scintigraphy in the evaluation of prognosis after myocardial infarction

    International Nuclear Information System (INIS)

    Okada, R.D.; Glover, D.K.; Leppo, J.A.

    1991-01-01

    Dipyridamole 201Tl imaging has been proposed as an alternative to exercise ECG testing for the prehospital discharge evaluation of patients recovering from myocardial infarction. The rationale is that many postinfarction patients with exercise-induced ischemia experience later cardiac events, and the sensitivity of predischarge exercise ECG testing in patients with multivessel disease ranges from only 45% to 62%. In addition, several groups of investigators have shown the sensitivity of submaximum exercise 201Tl imaging to be less than ideal. This report summarizes the current status of dipyridamole 201Tl imaging in the period of 1-13 days after myocardial infarction. Although the number of studies performed to date is limited, the following conclusions can be drawn: dipyridamole 201Tl imaging after myocardial infarction was associated with no serious side effects, and those present could be quickly reversed with aminophylline; redistribution with dipyridamole 201Tl images definitely correlates with prognosis after uncomplicated myocardial infarction; dipyridamole 201Tl imaging is definitely useful in patients unable to exercise for a variety of reasons; and future studies are definitely indicated to further define the role of dipyridamole 201Tl imaging for assessing prognosis, especially in those patients undergoing interventional therapy after acute myocardial infarction

  6. Usefulness of 201Tl myocardial scintigraphy after dipyridamole infusion in patients with atherosclerotic vascular disease

    International Nuclear Information System (INIS)

    Toyama, Takuji; Nishimura, Tsunehiko; Uehara, Toshiisa

    1992-01-01

    To determine the utility for detecting ischemic heart disease (IHD), dipyridamole thallium myocardial images (DIP-Tl) have been performed in 103 patients with atherosclerotic vascular disease who can't exercise fully. Of the 103 patients, there were 36 patients with arteriosclerosis obliterans (ASO), 31 patients with aneurysm of the abdominal aorta (AAA), 24 patients with aneurysm of the thoracic aorta (TAA) and 12 patients with dissecting aortic aneurysm (DAA). Clinical evidence of IHD was found in 20 patients with ASO, 10 with AAA, 7 with TAA and 4 with DAA. Positive evidence of DIP-Tl was identified in 66% of 41 patients who had clinical evidence of IHD, and particularly in the patients with AAA (80%) and ASO (65%). On the other hand, in the patients without clinical evidence of IHD, positive evidence of DIP-Tl was identified in 19% of 62 patients and particularly in the patients with AAA (39%). In all patients, the percentage of the positive DIP-Tl ratio was 38%. And, when the 38% patients of the positive DIP-Tl were added to the patients of the negative DIP-Tl who had clinical evidence of IHD, almost half patients (51%) were considered to be complicated with IHD. This study suggests that the atherosclerotic vascular disease is highly complicated with IHD and DIP-Tl is useful to detect IHD. (author)

  7. Significance of Tl-201 redistribution on infarcted region assessed by coronary sinus flow and lactate metabolism

    International Nuclear Information System (INIS)

    Mori, Takao; Yamabe, Hiroshi; Suda, Kenichirou; Ohnishi, Masataka; Shiotani, Hideyuki; Kurimoto, Yasuyuki; Kobayashi, Katsuya; Maeda, Kazumi; Fukuzaki, Hisashi

    1987-01-01

    To clarify the significance of Tl-201 redistribution on infarcted regions, coronary sinus and great cardiac vein flow response and lactate metabolism assessed by Webster catheter on 14 infarcted regions after dipyridamole administration were compared with Tl-201 redistribution phenomenon. The regional coronary flow response and lactate extraction ratio in 11 regions with Tl-201 redistribution were lower than those in 3 regions without Tl-201 redistribution. Only 5 regions in 11 with Tl-201 redistribution showed lactate production. The coronary flow response in 5 regions with lactate production was not different from those in 6 without lactate production (1.16 ± 0.89 vs. 1.47 ± 0.67; n.s.). The degree of Tl-201 redistribution assessed by relative activity was not different between regions with and without lactate production. The left ventricular end-diastolic pressure elevated in 5 regions with lactate production (17.8 ± 5.4 mmHg to 29.6 ± 4.9 mmHg; p < 0.05), but didn't in 6 regions without lactate production. Five regions with lactate production contained 4 hypokinetic regions, on the other hand 6 regions without lactate production contained only 3 hypokinetic regions. In conclusion, Tl-201 redistribution on infarcted region revealed not only ischemia but also decreased coronary flow response without lactate production and/or left ventricular dysfunction. (author)

  8. Estimating distribution parameters of annual maximum streamflows in Johor, Malaysia using TL-moments approach

    Science.gov (United States)

    Mat Jan, Nur Amalina; Shabri, Ani

    2017-01-01

    TL-moments approach has been used in an analysis to identify the best-fitting distributions to represent the annual series of maximum streamflow data over seven stations in Johor, Malaysia. The TL-moments with different trimming values are used to estimate the parameter of the selected distributions namely: Three-parameter lognormal (LN3) and Pearson Type III (P3) distribution. The main objective of this study is to derive the TL-moments ( t 1,0), t 1 = 1,2,3,4 methods for LN3 and P3 distributions. The performance of TL-moments ( t 1,0), t 1 = 1,2,3,4 was compared with L-moments through Monte Carlo simulation and streamflow data over a station in Johor, Malaysia. The absolute error is used to test the influence of TL-moments methods on estimated probability distribution functions. From the cases in this study, the results show that TL-moments with four trimmed smallest values from the conceptual sample (TL-moments [4, 0]) of LN3 distribution was the most appropriate in most of the stations of the annual maximum streamflow series in Johor, Malaysia.

  9. AG, TL, and IRSL dosimetric properties in X-ray irradiated HPHT diamond crystals

    Energy Technology Data Exchange (ETDEWEB)

    Gil-Tolano, M.I. [Programa de Posgrado, Departamento de Investigacion en Fisica, Universidad de Sonora, A. P. 5-088, Hermosillo, Sonora, 83190, Mexico (Mexico); Melendrez, R.; Lancheros-Olmos, J.C.; Soto-Puebla, D.; Chernov, V.; Pedroza-Montero, M.; Barboza-Flores, M. [Departamento de Investigacion en Fisica, Universidad de Sonora, A. P. 5-088, Hermosillo, Sonora, 83190, Mexico (Mexico); Castaneda, B. [Departamento de Fisica, Universidad de Sonora, Blvd. Luis Encinas y Rosales S/N, Hermosillo, Sonora, 83000, Mexico (Mexico)

    2014-10-15

    HPHT diamonds have been studied for several years for their potential in different applications. In previous studies it has been found that the thermoluminescence (TL) glow curves of ''as-grown'' HPHT diamonds are non-reproducible. In this work, we study the afterglow (AG), thermoluminescent (TL), and optically stimulated luminescence (OSL) response of commercial samples of synthetic HPHT type-Ib diamond crystals exposed to X-ray irradiation (0.75 mA, 35 kV) at a dose rate of 0.624 Gy/s, after a high gamma ({sup 60}Co) dose irradiation of 500 kGy followed by a thermal treatment at 1073 K for 1 h in nitrogen atmosphere. Deconvolution of the TL glow curves shows four peaks, located around 379, 509, 561, and 609 K. The crystals exhibit evident AG recorded for 300 s immediately after X-ray irradiation, due to the thermal emptying of the traps responsible for the low-temperature TL peaks (below 400 K). The stimulation of irradiated crystals with 870-nm light, creates pronounced OSL and destroys all TL peaks with the exception of the high-temperature peak at 609 K. The dose responses of the integrated AG, TL, and OSL are linear in the range of 0.6-5 Gy and saturated at higher doses. The reproducibility of AG, TL, and OSL measurements is about 5%. The fading in the first hour of storage in dark conditions at RT of TL signal of HPHT diamond is mainly associated to the emptying of the traps responsible for the 379-K TL peaks. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  10. Myocardial uptake of iodinated free fatty acids and 201Tl in experimental ischemia

    International Nuclear Information System (INIS)

    Westera, G.; Wall, E.E. van der; Visser, F.C.; Scholtalbers, A.S.; Eenige, M.J. van; Roos, J.P.

    1984-01-01

    In an experimental study, we evaluated the uptake of ( 131 I)-17-iodo heptadecanoic acid ( 131 I-HDA), ( 125 I)-15-4 (4-iodophenyl) pentadecanoic acid ( 125 I-PPA) and thallium-201 ( 201 Tl) in the dog heart. Twenty dogs were studied and divided into 3 groups: in group A, 10 dogs (4 normal, 6 with coronary artery occlusion) were studied with 131 I-HDA and 201 Tl; in group B, 5 dogs (with occlusion) received 125 I-PPA and 201 Tl; and in group C, 5 dogs (with occlusion) were studied with 125 I-PPA and 131 I-HDA. Two min after administration of the compounds the hearts were excised and stored in formaldehyde. After sectioning of the left ventricle, total uptake was counted and expressed in percentage of injected dose. Uptake in the normal myocardium (group A) was 4.2+-0.6% for 131 I-HDA and 4.6+-0.7% for 201 Tl; in the occluded dog hearts (group A) we measured values of 2.6+-0.4% for 131 I-HDA (p 201 Tl (p 131 I-HDA, 125 I-PPA and 201 Tl in groups B and C was not significantly different: group B, 125 I-PPA 2.8+-0.8% and 201 Tl 2.5+-0.5%; group C, 125 I-PPA 1.9+-0.7% and 131 I-HDA 1.6+-0.6%. Moreover, regional distribution of both iodinated fatty acids was quite comparable with the distribution of 201 Tl. We conclude that 131 I-HDA and 125 I-PPA show similar uptake as 201 Tl and are distributed according to coronary artery perfusion, which underscores their value as myocardial imaging agents. (orig.) [de

  11. Wpływ informatyzacji Biblioteki Uniwersyteckiej w Poznaniu na zmiany organizacyjne i rozwój usług bibliotecznych

    Directory of Open Access Journals (Sweden)

    Piotr Karwasiński

    2015-12-01

    Full Text Available W artykule omówiono zagadnienia związane z procesami informatyzacji Biblioteki Uniwersyteckiej w Poznaniu. W celu dokładnego scharakteryzowania przemian, prócz rysu historycznego, przedstawiono obszary, które wyraźnie poprawiły jakość pracy personelu i obsługę czytelników oraz przyczyniły się do poznania, upowszechniania i wdrażania nowoczesnych rozwiązań technologicznych. Zaprezentowano proces zmian w zakresie funkcjonowania systemu biblioteczno-informacyjnego Horizon i współpracy z narodowym katalogiem centralnym NUKAT. Opisano etapy rozwoju elektronicznej przestrzeni informacyjnej, w tym budowania elektronicznych zasobów wiedzy i tworzenia narzędzi do ich obsługi i wykorzystania w procesach wyszukiwania źródeł informacji. Zaprezentowano Bibliotekę Uniwersytecką jako partnera w aranżowaniu instytucjonalnych platform cyfrowych do deponowania i udostępniania dorobku intelektualnego społeczności naukowej Uniwersytetu im. Adama Mickiewicza w Poznaniu. Wskazano także funkcjonalność zaprojektowanych i wdrożonych innowacyjnych usług wirtualnych pakietu Libsmart, optymalizujących funkcjonowanie Biblioteki Uniwersyteckiej.

  12. Molecular Cytogenetic Characterization of two Triticum-Secale-Thinopyrum Trigeneric Hybrids Exhibiting Superior Resistance to Fusarium Head Blight, Leaf Rust, and Stem Rust Race Ug99.

    Science.gov (United States)

    Dai, Yi; Duan, Yamei; Liu, Huiping; Chi, Dawn; Cao, Wenguang; Xue, Allen; Gao, Yong; Fedak, George; Chen, Jianmin

    2017-01-01

    Fusarium head blight (FHB), leaf rust, and stem rust are the most destructive fungal diseases in current world wheat production. The diploid wheatgrass, Thinopyrum elongatum (Host) Dewey (2 n = 2 x = 14, EE) is an excellent source of disease resistance genes. Two new Triticum-Secale-Thinopyrum trigeneric hybrids were derived from a cross between a hexaploid triticale (X Triticosecale Wittmack, 2 n = 6 x = 42, AABBRR) and a hexaploid Triticum trititrigia (2 n = 6 x = 42, AABBEE), were produced and analyzed using genomic in situ hybridization and molecular markers. The results indicated that line RE21 contained 14 A-chromosomes, 14 B-chromosomes, three pairs of R-chromosomes (4R, 6R, and 7R), and four pairs of E-chromosomes (1E, 2E, 3E, and 5E) for a total chromosome number of 2 n = 42. Line RE62 contained 14 A-chromosomes, 14 B-chromosomes, six pairs of R-chromosomes, and one pair of translocation chromosomes between chromosome 5R and 5E, for a total chromosome number of 2 n = 42. At the seedling and adult growth stages under greenhouse conditions, line RE21 showed high levels of resistance to FHB, leaf rust, and stem rust race Ug99, and line RE62 was highly resistant to leaf rust and stem rust race Ug99. These two lines (RE21 and RE62) display superior disease resistance characteristics and have the potential to be utilized as valuable germplasm sources for future wheat improvement.

  13. SoTL Research Fellows: Collaborative Pathfinding through Uncertain Terrain

    Directory of Open Access Journals (Sweden)

    Elizabeth Marquis

    2017-12-01

    Full Text Available From 2014-2016, Scholarship of Teaching and Learning (SoTL Research Fellows at a mid-sized Canadian research-intensive, medical-doctoral university undertook to study their own formation as scholars of teaching and learning, as well as benefits and challenges of their cross-appointment to our central teaching and learning institute from their home academic departments. Findings from surveys and focus groups identified themes such as identity, community, access, transfer, and structural elements (each with benefits and challenges to practice. Our autoethnographic work confirms assertions in the literature about the uneasy relation between SoTL and traditional scholarship, while also bearing out the need for departmental support, and for key interventions along the path from novice to practitioner identity. Some discussion of the ambassador or translator role that can flow from such arrangements is included. De 2014 à 2016, les chercheurs en Avancement des connaissances en enseignement et en apprentissage (ACEA d’une université canadienne médicale-doctorale de taille moyenne ayant un coefficient de recherche élevé ont entrepris une étude portant sur leur propre formation en tant que chercheurs érudits en matière d’enseignement et d’apprentissage, ainsi que sur les avantages et les défis de leur nomination conjointe à notre institut central d’enseignement et d’apprentissage tout en enseignant dans leur propre département universitaire. Les résultats des sondages et des groupes de discussion ont permis d’identifier certains thèmes tels que l’identité, la communauté, l’accès, le transfert, ainsi que des éléments structuraux (chacun présentant des avantages et des défis concernant la pratique. Notre travail autoethnographique confirme les assertions présentes dans la documentation existante concernant la relation difficile qui existe entre l’ACEA et la recherche traditionnelle, tout en tenant compte de la n

  14. Myocardial scintigraphy with 199Tl chloride for the assessment of antianginal effect of cardil

    International Nuclear Information System (INIS)

    Chernov, V.I.; Mordovin, V.F.; Vesnina, Zh.V.; Triss, S.V.; Bazilevich, I.A.; Lishmanov, Yu.B.

    1995-01-01

    The aim of this research was examination of myocardial perfusion in cardil therapy of twenty-two coronary patients and analysis of potentialities of load 199 Tl scintigraphy in assessment of the antianginal effect in the course of therapy of coronary patients. The findings evidence that due to short 199 Tl half life and low radiation load of the body because of this radionuclide load 199 Tl scintigraphy of the myocardium carried out in the course of therapy of coronary patients may be used as an objective test to assess myocardial perfusion under the effect of treatment. 8 refs

  15. Experimental study on the CsI (Tl) crystal anti-compton detector in CDEX

    International Nuclear Information System (INIS)

    Liu Shukui; Yue Qian; Tang Changjian

    2012-01-01

    CDEX (China Dark matter Experiment) Collaboration will carry out direct search for dark matter with Ultra-Low Energy Threshold High Purity germanium (ULE-HPGe) detector at CJPL (China Jinping deep underground Laboratory). Before underground research, some experiments of the CsI (Tl) crystal Anti-Compton detector have been done on the ground, including light guide choice, wrapping material choice, height uniformity of CsI (Tl) crystal, side uniformity of CsI (Tl) crystal and the test results of all the crystals. Through the preliminary work on the ground, we have got some knowledge of the anti-compton detector and prepared for the underground experiment. (authors)

  16. Tumor and infection localization in AIDS patients: Ga-67 and Tl-201 findings.

    Science.gov (United States)

    Turoglu, H T; Akisik, M F; Naddaf, S Y; Omar, W S; Kempf, J S; Abdel-Dayem, H M

    1998-07-01

    Examples of Ga-67 and Tl-201 scans in AIDS patients performed at St. Vincent's Hospital and Medical Center of New York are presented. Use of these methods is the adopted approach at this institution in AIDS patients for localizing sites of tumor or infection involvement. A Ga-67 scan is the most common nuclear medicine examination performed on AIDS patients. Sequential Tl-201 and Ga-67 scans have a role in differentiating Kaposi's sarcoma from malignant lymphoma and opportunistic infections. For intracranial lesions, Tc-99m MIBI or Tl-201-201-201-201 chloride can differentiate malignant from benign inflammatory lesions.

  17. Experience with TL-102M for the treatment of radiation stomatitis

    International Nuclear Information System (INIS)

    Nishio, Juntaro; Matsuya, Tokuzo; Inoue, Kazuo; Miyazaki, Tadashi; Maeda, Noriaki.

    1984-01-01

    TL-102M was administered to 14 patients who had radiation stomatitis following radiation therapy for malignant tumors in the oral cavity. Regarding the degree of overall improvement, one of the 14 patients was evaluated as ''extremely improved'', eight as ''improved'', four as ''slightly improved'', and one as ''unchanged''. None of the patients had side effects. Adherent, powdered TL-102M was easy to take for patients. Most of the patients desired to continue to take this drug because of having neither painfulness nor adhesive feeling. The usage of TL-102M could be helpful in promoting the treatment for cancer, thus suggesting that it is useful in treating radiation stomatitis. (Namekawa, K.)

  18. Theories of TL systems: Failures, successes, conflicts, trends: Insights into possible future materials and techniques

    International Nuclear Information System (INIS)

    Horowitz, Y. S.; Belaish, Y.; Oster, L.

    2006-01-01

    In this paper some of the many theoretical models dealing with characteristics of TL materials are discussed. Special attention is given to some of the models dealing with the effects of ionisation density, that is Modified Track Structure Theory (MTST) and Micro-dosimetric Track Structure Theory (MTT) for the calculation of Heavy Charged Particle relative TL efficiencies, as well as solid-state models based on conduction band/valence band theory. Failures, successes, conflicts and trends are highlighted as well as a peek into future avenues of research for dosimetric TL materials. (authors)

  19. TL sensitivity of CaSO4:Dy phosphor powder - effect of grinding

    International Nuclear Information System (INIS)

    Shastry, S.S.; Kher, R.K.

    1979-01-01

    Grinding of polycrystalline CaSO 4 :Dy phosphor to powder form induces lattice defects. Changes in thermoluminescence (TL) sensitivity due to variation in trap density in the bulk and on the surface of phosphor grains are studied using gamma and UV radiations. TL sensitivity to gamma increases with grinding time due to the contribution from the new bulk traps which are generated by grinding. The surface traps degrade with increase in grinding time resulting in a decrease in UV sensitivity. Results on regeneration of the TL sensitivity due to annealing at different temperatures are also included. (Auth.)

  20. X-ray photoemission analysis of chemically modified TlBr surfaces for improved radiation detectors

    International Nuclear Information System (INIS)

    Nelson, A. J.; Voss, L. F.; Beck, P. R.; Graff, R. T.; Conway, A. M.; Nikolic, R. J.; Payne, S. A.; Lee, J.-S.; Kim, H.; Cirignano, L.; Shah, K.

    2013-01-01

    We subjected device-grade TlBr to various chemical treatments used in room temperature radiation detector fabrication to determine the resulting surface composition and electronic structure. As-polished TlBr was treated separately with HCl, SOCl 2 , Br:MeOH and HF solutions. High-resolution photoemission measurements on the valence band electronic structure and Tl 4f, Br 3d, Cl 2p and S 2p core lines were used to evaluate surface chemistry and shallow heterojunction formation. Surface chemistry and valence band electronic structure were correlated with the goal of optimizing the long-term stability and radiation response

  1. Radiation Hardness Study of CsI(Tl) Crystals for Belle II Calorimeter

    CERN Document Server

    Matvienko, D V; Sedov, E V; Shwartz, B A

    2017-01-01

    The Belle II calorimeter (at least, its barrel part) consists of CsI(Tl) scintillation crystals which have been used at the Belle experiment. We perform the radiation hardness study of some typical Belle crystals and conclude their light output reductions are acceptable for Belle II experiment where the absorption dose can reach 10 krad during the detector operation. CsI(Tl) crystals have high stablity and low maintenance cost and are considered as possible option for the calorimeter of the future Super-Charm-Tau factory (SCT) in Novosibirsk. Our study demonstrates sufficiently high radiation hardness of CsI(Tl) crystals for SCT conditions.

  2. Evaluation of /sup 201/TlCl and delayed scan for thyroid imaging agent

    Energy Technology Data Exchange (ETDEWEB)

    Taniguchi, Tatsuyoshi; Harada, Taneichi; Takahashi, Tatsuo; Senoo, Tsuneaki; Ohtsuka, Nobuaki; Ito, Yasuhiko [Kawasaki Medical School, Kurashiki, Okayama (Japan)

    1982-11-01

    The results of 189 patients with nodular goiter by imaging with /sup 201/TlCl following with sup(99m)TcO/sub 4//sup -/ was presented. Accumulation of /sup 201/TlCl to the corresponding area was observed in 85.5% of cancer, 62.2% of adenoma, 42.5% of adenomatous goiter, and the usefulness of /sup 201/TlCl (early scan) for thyroid imaging agent was recognized. On the other hand, delayed scan for purpose of differentiation from benign to malignant was also performed. However, no significant differences were obtained.

  3. Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

    Science.gov (United States)

    Das, Debajyoti; Kar, Debjit

    2017-12-01

    A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

  4. Degradation of myocardial perfusion SPECT images caused by contaminants in thallous (201Tl) chloride

    International Nuclear Information System (INIS)

    Staelens, Steven G.; Wit, Tim C. de; Lemahieu, Ignace A.; Beekman, Freek J.

    2008-01-01

    Thallous ( 201 Tl) chloride is a single-photon emission computed tomography (SPECT) tracer mainly used for assessing perfusion and viability of myocardial tissue. 201 Tl emits X-rays around 72 keV and gammas at 167 keV, and has a half-life of 73 h. Regulations allow an intrinsic contamination up to 3-5%, which is mainly caused by 200 Tl (368 keV; 26 h) and by 202 Tl (439 keV; 12.2 days). Contra-intuitive to the low-level percentages in which these contaminants are present, their impact may be significant because of much higher gamma camera sensitivity for these high-energy photon emissions. Therefore, we investigate the effects of the contaminants in terms of detected fractions of photons in projections and contrast degradation in reconstructed images. Acquisitions of a digital thorax phantom filled with thallous ( 201 Tl) chloride were simulated with a validated Monte Carlo tool, thereby, modelling 1% of contamination by 200 Tl and 202 Tl each. In addition, measurements of a thorax phantom on a dual-headed gamma camera were performed. The product used was contaminated by 0.17% of 200 Tl and 0.24% of 202 Tl at activity reference time (ART). This ART is specified by the manufacturer, thereby, accounting for the difference in half-lives of 201 Tl and its contaminants. These measurements were repeated at different dates associated with various contamination levels. Simulations showed that, with 1% of 200 Tl and 202 Tl, the total contamination in the 72 keV window can rise up to one out of three detected photons. For the 167keV window, the contamination is even more pronounced: more than four out of five detections in this photopeak window originate from contaminants. Measurements indicate that cold lesion contrast in myocardial perfusion SPECT imaging is at maximum close to ART. In addition to a higher noise level, relative contrast decreases 15% 2 days early to ART, which is explained by an increase in 200 Tl contamination. After ART, contrast decreased by 16% when

  5. Application of TL dosimetry in epidemiological studies in HBRAs

    International Nuclear Information System (INIS)

    Chougaonkar, M.P.

    2006-01-01

    Luminescence as a phenomenon has been extensively used in radiation dosimetry, using thermoluminescence. The nuclear industry all over the world over uses TL dosimetry in radiation protection since they have to ensure that the radiation workers and workers involved in industrial applications of radiation sources are not exposed beyond limits set by international monitoring bodies. They have also to ensure that the nuclear applications do not give rise to elevated radiation levels in the environs. In addition, epidemiologists and radiobiologists world over have been working over the past few decades, to study health effects of chronic radiation exposures in populations living in the elevated natural radiation environment. This paper discusses the importance of dosimetric studies, in the normal as well as high background radiation areas (HBRAs), due to the radiation effects on the humans. The application of thermoluminescent dosimeters (TLDs) in population dosimetry with the end point of epidemiological studies is then discussed. The paper outlines the construction of TLDs, methodology of deployment and retrieval and analysis to arrive the dose. To obtain total dose, dosimetric techniques suitable for external gamma radiation, inhalation dose due to radon, thoron and their progenies and radiological analysis of the food items is required. The techniques arriving at the effective dose are outlined. Basics of epidemiological analysis, particularly using case-control methodology and its advantages/ disadvantages are also discussed. Using the previous work by the author, the paper also reviews various analyses that can be carried out the dosimetric data. (author)

  6. Quantitative assessment of 201TlCl myocardial SPECT

    International Nuclear Information System (INIS)

    Uehara, Toshiisa

    1987-01-01

    Clinical evaluation of the quantitative analysis of Tl-201 myocardial tomography by SPECT (Single Photon Emission Computed Tomography) was performed in comparison with visual evaluation. The method of quantitative analysis has been already reported in our previous paper. In this study, the program of re-standardization in the case of lateral myocardial infarction was added. This program was useful mainly for the evaluation of lesions in the left circumflex coronary artery. Regarding the degree of diagnostic accuracy of myocardial infarction in general, quantitative evaluation of myocardial SPECT images was highest followed by visual evaluation of myocardial SPECT images, and visual evaluation of myocardial planar images. However, in the case of anterior myocardial infarction, visual evaluation of myocardial SPECT images has almost the same detectability as quantitative evaluation of myocardial SPECT images. In the case of infero-posterior myocardial infarction, quantitative evaluation was superior to visual evaluation. As for specificity, quantitative evaluation of SPECT images was slightly inferior to visual evaluation of SPECT images. An infarction map was made by quantitative analysis and this enabled us to determine the infarction site, extent and degree according to easily recognizable patterns. As a result, the responsible coronary artery lesion could be inferred correctly and the calculated infarction score could be correlated with the residual left ventricular function after myocardial infarction. (author)

  7. TL studies of calcareous rocks of Danta area, North Gujarat

    International Nuclear Information System (INIS)

    Limaye, M.A.; Desai, S.J.; Murthy, K.V.R.; Joshi, T.R.

    1992-01-01

    The lithounits exposed around Danta in Banaskantha district of North Gujarat belong to Ajabgarh Group, the upper division of the Delhi super group. These rocks are intruded by syn to late kinematic basic rocks and by Erinpura granites of post Delhi age. The Ajabgarh group consists of pelitic and calcareous components. Mineralogically the pelitic rocks comprise cordierite, almandine garnet, k-feldspar, sillimanite, quartz and mica in variable proportions. The calcareous rocks are seen to contain dominantly calcite, scapolite, forsterite, sphene, k-feldspar. These mineral assemblages correspond to upper Amphibolite to lower Granulite facies of regional metamorphism. The chemistry of the calcareous rocks show predominance of CaO over MgO. The glow curves obtained from virgin samples (NTL) as well as artificial beta irradiated indicate glow peaks at 140 o C, 290 o C, 310 o C and 390 o C. The TL glow peak temperatures are in general agreement with those reported by Borsi and Rinaldi and Medlin. The pronounced peak at 390 o C and 290 o C are suggestive of their high irradiation sensitivity and also probably reflect variation in the Mn content of the rocks. (author). 9 refs., 16 tabs., 2 figs

  8. Response function study of a scintillator detector of NaI(Tl); Estudo da funcao resposta de um detector cintilador de NaI(Tl)

    Energy Technology Data Exchange (ETDEWEB)

    Villa, Marcelo Barros; Costa, Alessandro Martins da, E-mail: amcosta@usp.br [Universidade de Sao Paulo (FFCLRP/USP), Ribeirao Preto, SP (Brazil). Faculdade de Filosofia, Ciencias e Letras. Dept. de Fisica

    2014-07-01

    In measurements of gamma rays with Nai (Tl) scintillator, the detectors output data are pulse height spectra, that corresponding to distorted information about the radiation source due to various errors associated with the crystal scintillation process and electronics associated, instead of power spectra photons. Pulse height spectra are related to the real power spectra by means of scintillator detector response function NaI (Tl). In this work, the response function for a cylindrical crystal of Nal (Tl) of 7,62 x 7,62 cm (diameter x length) was studied, by Monte Carlo method, using the EGSnrc tool to model the transport of radiation, combined with experimental measurements. An inverse response matrix, even with the energy of the square root, which transforms the pulse height spectrum of photon energy spectrum was obtained. The results of this transformation of pulse height spectrum for photon energy spectrum is presented, showing that the methodology employed in this study is suitable.

  9. Contributions to a systematic examination of deformed transition nuclei by the study of the decay of 188Tl and 190Tl

    International Nuclear Information System (INIS)

    Waetzig, W.

    1980-01-01

    Using the reaction 197 Au( 3 He,xn) Tl the decay of the nuclides 188 Tl and 190 Tl to 188 Hg (Tsub(1/2) = 70s) respectively to 190 Hg(Tsub(1/2) = 3.0 min) was studied at the mass separator ISOCELE of the Orsay-synchrocyclotron by gamma, conversion electron, gamma-gamma coincidence, and electron-gamma coincidence spectroscopy. The level schemes of 188 Hg and 190 Hg could be remarkably extended in comparison with earlier works. By a statistical analysis of the nuclear level density the nuclear temperature was calculated as a measure for the number of excitation modes of these nuclei. (orig./HSI) [de

  10. Improving Earth Science Metadata: Modernizing ncISO

    Science.gov (United States)

    O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

    2016-12-01

    ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

  11. Annual dose measurements and TL-dating of ancient Egyptian pottery

    Energy Technology Data Exchange (ETDEWEB)

    Abdel-Wahab, M S; El-Fiki, S A; Abdel-Kariem, S; El-Faramawy, N [Ain Shams University, Cairo (Egypt). Faculty of Science; EL-Fiki, M A [National Institute of Standards, Cairo (Egypt); Gomaa, M [Atomic Energy Establishment, Cairo (Egypt). Nuclear Research Center

    1996-05-01

    In the course of the dating of ancient Egyptian pottery, pottery sherds were collected from three archaeological tombs in Nazlet El Samman region, Giza zone (Egypt). The annual dose from natural background was measured by gamma spectrosocopic technique as well as thermoluminescence (TL) measurements. The results of both methods are in good agreement with a consistency of 99.69%. The extracted quartz exhibited TL dating peaks at about (305 {+-} 5){sup o}C. The TL dating shows an age of 4301 {+-} 100 years for the examined pottery which belongs to the ``Fourth Dynasty`` in the ``OlKingdom`` . The uncertainties in TL dating using the additive method are much lower than that of archaeologists. (author).

  12. Annual dose measurements and TL-dating of ancient Egyptian pottery

    Science.gov (United States)

    Abdel-Wahab, M. S.; El-Fiki, S. A.; El-Fiki, M. A.; Gomaa, M.; Abdel-Kariem, S.; El-Faramawy, N.

    1996-05-01

    In the course of the dating of ancient Egyptian pottery, pottery sherds were collected from three archaeological tombs in Nazlet El Samman region, Giza zone (Egypt). The annual dose from natural background was measured by gamma spectroscopic technique as well as thermoluminescence (TL) measurements. The results of both methods are in good agreement with a consistency of 99.69%. The extracted quartz exhibited TL dating peaks at about(305 ± 5|4)°C. The TL dating shows an age of 4301 ± 100 years for the examined pottery which belongs to the "Fourth Dynasty" in the "Old Kingdom". The uncertainties in TL dating using the additive method are much lower than that of archeologists.

  13. Annual dose measurements and TL-dating of ancient Egyptian pottery

    International Nuclear Information System (INIS)

    Abdel-Wahab, M.S.; El-Fiki, S.A.; Abdel-Kariem, S.; El-Faramawy, N.; Gomaa, M.

    1996-01-01

    In the course of the dating of ancient Egyptian pottery, pottery sherds were collected from three archaeological tombs in Nazlet El Samman region, Giza zone (Egypt). The annual dose from natural background was measured by gamma spectrosocopic technique as well as thermoluminescence (TL) measurements. The results of both methods are in good agreement with a consistency of 99.69%. The extracted quartz exhibited TL dating peaks at about (305 ± 5) o C. The TL dating shows an age of 4301 ± 100 years for the examined pottery which belongs to the ''Fourth Dynasty'' in the ''OlKingdom'' . The uncertainties in TL dating using the additive method are much lower than that of archaeologists. (author)

  14. Study on effects of gamma-ray irradiation on TlBr semiconductor detectors

    International Nuclear Information System (INIS)

    Matsumura, Motohiro; Watanabe, Kenichi; Yamazaki, Atsushi; Uritani, Akira; Kimura, Norihisa; Nagano, Nobumichi; Hitomi, Keitaro

    2016-01-01

    Radiation hardness of thallium bromide (TlBr) semiconductor detectors to 60 Co gamma-ray irradiation was evaluated. The energy spectra and μτ products of electrons were measured to evaluate the irradiation effects. No significant degradation of spectroscopic performance of the TlBr detector for 137 Cs gamma-rays was observed up to 45 kGy irradiation. Although the μτ products of electrons in the TlBr detector slightly decreased, position of the photo-peak was stable without significant degradation after the gamma-ray irradiation. We confirmed that the TlBr semiconductor detector has a high tolerance for gamma-ray irradiation at least up to 45 kGy. (author)

  15. Defects that control the properties of Tl- and Hg-based superconductors

    International Nuclear Information System (INIS)

    Jorgensen, J.D.; Chmaissem, O.; Hinks, D.G.; Mitchell, J.F.; Wagner, J.L.; Univ. of North Dakota, Grand Forks, ND; Jensen, W.R.; Dabrowski, B.; Northern Illinois Univ., DeKalb, IL

    1997-03-01

    Defects that affect T c in Tl 2 Ba 2 CuO 6+δ and HgBa 2 CuO 4+δ and HgBa 2 CuO 4+δ have been characterized by neutron powder diffraction. In Tl 2 Ba 2 CuO 6+δ , the dominant defect is interstitial oxygen between the two Tl-O planes, but Cu substitution on the Tl site also affects properties and there is evidence for a second oxygen defect for compositions in the vicinity of maximum T c . In HgBa 2 CuO 4+δ , there are two competing oxygen defects in the Hg layer. The relative concentrations of these defects switches upon passing from the underdoped region, through the maximum T c , to the overdoped region. This remarkable behavior could result from a change in the topology of the Fermi surface upon passing through the van Hove singularity

  16. Bonding and M?ssbauer Isomer Shifts in (Tl,Pb) - 1223 Cuprate

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    By using the chemical bond theory of dielectric description,the chemical bond parameters of (Tl,Pb) - 1223 was calculated.The results show that the Sr-O,Tl-O,and Ca-O types of bond have higher ionic character and the Cu-O types of bond have more covalent character.M?ssbauer isomer shifts of 57Fe and 119Sn doped in (Tl,Pb) -1223 were calculated by using the chemical environmental factor,he,defined by covalency and electronic polarizability.Four valence state tin and three valence iron sites were identified in 57Fe,and 119Sn doped (Tl,Pb) -1223 superconductor.We conclude that all of the Fe atoms substitute the Cu at square planar Cu (1) site,whereas Sn prefers to substitute the square pyramidal Cu (2) site.

  17. Thallium(I copper(I thorium(IV triselenide, TlCuThSe3

    Directory of Open Access Journals (Sweden)

    James A. Ibers

    2012-07-01

    Full Text Available Thallium(I copper(I thorium(IV triselenide, TlCuThSe3, crystallizes with four formula units in the space group Cmcm in the KCuZrS3 structure type. There is one crystallographically independent Th, Tl, and Cu atom at a site of symmetry 2/m.., m2m, and m2m, respectively. There are two crystallographically independent Se atoms at sites of symmetry m.. and m2m. The structure consists of sheets of edge-sharing ThSe6 octahedra and CuSe4 tetrahedra stacked parallel to the (010 face, separated by layers filled with chains of Tl running parallel to [100]. Each Tl is coordinated by a trigonal prism of Se atoms.

  18. Determination of the full energy peak efficiency of NaI(Tl) detectors

    International Nuclear Information System (INIS)

    Cesana, A.; Terrani, M.

    1978-01-01

    A simple procedure for the accurate evaluation of the full energy peak efficiency of NaI(Tl) crystals is described. Particular attention is given to the peak to total ratio determination for which a new method is proposed. (author)

  19. Tl response of KMgF3: Lu + PTFE at ultraviolet radiation

    International Nuclear Information System (INIS)

    Gonzalez, P.R.; Alarcon, N.G.; Furetta, C.; Azorin, J.

    2003-01-01

    Ionizing radiation has different types of interaction with a crystalline solid. However, only few effects are interesting to optimize some thermoluminescent (Tl) properties of certain Tl materials. This paper presents results obtained by irradiating KMgF 3 : Lu + Ptfe Tl dosimeters with ultraviolet (UV) radiation previously exposed to gamma radiation. These results showed that those dosimeters not exposed previously to gamma radiation did not presented any Tl signal. Meanwhile, those previously submitted to gamma irradiation showed that their sensitivity was increased as the gamma dose increased. The glow curve of sensitized KMgF 3 : Lu + Ptfe exposed to UV radiation, presented the dosimetric pea at 212 C. This makes this material to be promissory for measuring UV radiation. (Author)

  20. Enhanced thermoelectric figure of merit in strained Tl-doped Bi2Se3

    KAUST Repository

    Saeed, Y.

    2014-07-21

    We explain recent experimental findings on Tl-doped Bi2Se3 by determining the electronic and transport properties by first-principles calculations and semi-classical Boltzmann theory. Though Tl-doping introduces a momentum-dependent spin-orbit splitting, the effective mass of the carriers is essentially not modified, while the band gap is reduced. Tl is found to be exceptional in this respect as other dopants modify the dispersion, which compromises thermoelectricity. Moreover, we demonstrate that only after Tl-doping strain becomes an efficient tool for enhancing the thermoelectric performance. A high figure of merit of 0.86 is obtained for strong p-doping (7 × 10^20 cm^(−3), maximal power factor) at 500 K under 2% tensile strain.

  1. Evidence for charge Kondo effect in superconducting Tl-doped PbTe

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, I

    2010-01-11

    We report results of low-temperature thermodynamic and transport measurements of Pb{sub 1-x}Tl{sub x}Te single crystals for Tl concentrations up to the solubility limit of approximately x = 1.5%. For all doped samples, we observe a low-temperature resistivity upturn that scales in magnitude with the Tl concentration. The temperature and field dependence of this upturn are consistent with a charge Kondo effect involving degenerate Tl valence states differing by two electrons, with a characteristic Kondo temperature T{sub K} {approx} 6 K. The observation of such an effect supports an electronic pairing mechanism for superconductivity in this material and may account for the anomalously high T{sub c} values.

  2. CsI(Tl)-photodiode detectors for gamma-ray spectroscopy

    CERN Document Server

    Fioretto, E; Viesti, G; Cinausero, M; Zuin, L; Fabris, D; Lunardon, M; Nebbia, G; Prete, G

    2000-01-01

    We report on the performances of CsI(Tl)-photodiode detectors for gamma-ray spectroscopy applications. Light output yield and energy resolution have been measured for different crystals and read-out configurations.

  3. Solvent extraction of Tl(I) with 2-mercaptobenzothiazole into chloroform

    International Nuclear Information System (INIS)

    Itawi, R.K.; Turel, Z.R.

    1984-01-01

    The extraction of Tl(I) with 2-mercaptobenzothiazole into chloroform was studied. The effect of various parameters on the extraction coefficient value was evaluated. The stoichiometry of the extracted species obtained from the substoichiometric extraction was found to be 1:1. This was further supported by the slope ratio method. Decontamination factors of a number of elements in the substoichiometric extraction of Tl(I) were also obtained. (author)

  4. TL and OSL studies on undoped diamond films grown by hot filament chemical vapor deposition

    Energy Technology Data Exchange (ETDEWEB)

    Soni, Anuj, E-mail: anujsoni.phy@gmail.com [Radiological Physics and Advisory Division, Bhabha Atomic Research Center, Mumbai 400 085 (India); Choudhary, R.K. [Materials Processing Division, Bhabha Atomic Research Center, Mumbai 400 085 (India); Polymeris, G.S. [Ankara University, Institute of Nuclear Sciences (Turkey); Mishra, D.R. [Radiological Physics and Advisory Division, Bhabha Atomic Research Center, Mumbai 400 085 (India); Mishra, P. [Materials Processing Division, Bhabha Atomic Research Center, Mumbai 400 085 (India); Kulkarni, M.S. [Radiation Safety Systems Division, Bhabha Atomic Research Center, Mumbai 400 085 (India)

    2016-09-15

    In this work, approximately 0.5 µm thick diamond films were grown on a silicon substrate by hot filament chemical vapour deposition (HFCVD) method in a gas mixture of hydrogen and methane. The batch to batch reproducibility of the sample using this technique was found to be very good. The obtained film was characterized by micro laser Raman spectroscopy (MLRS), grazing incidence X-ray diffractometry (GIXRD), scanning electron microscopy (SEM) and atomic force miscroscopy (AFM) techniques. MLRS and GIXRD results confirmed the formation of diamond whereas SEM and AFM analyses indicated uniform morphology of the film with an average grain size of 200 nm. The deposited film was studied for ionizing radiation dosimetry applications using the thermoluminescence (TL) and optically stimulated luminescence (OSL) techniques after irradiating the film by a calibrated 5 mCi, {sup 90}Sr/{sup 90}Y beta source. In the TL measurement, for a heating rate of 4 K/s, broad glow curve was obtained which was deconvoluted into seven TL peaks. The integrated TL counts were found to vary linearly with increasing the radiation dose up to 10 kGy. The characteristic TL output seen in the temperature range 200–300 °C, may be considered good for thermal stability of the film and it could also avoid TL fading during storage and non-interference of any black body radiation during the measurement. However, in comparison to TL output, the OSL response for 470 nm LED stimulation was found to be lesser. The CW–OSL decay curve has shown two components contributing to the OSL signal, having photoionization cross-section 1.5×10{sup −18} and 5.2×10{sup −19} cm{sup 2} respectively. The studies have revealed the possibility of using diamond film for high dose radiation dosimetry with TL/OSL method.

  5. Investigation and dating of gypsum crystals from Sivrihisar region in Eskisehir by ESR and TL techniques

    International Nuclear Information System (INIS)

    2011-01-01

    Gypsum crystals taken from Sivrihisar-Eskisehir district were investigated and dated by Electron Spin Resonance (ESR) and Thermoluminescence (TL) techniques. The natural ESR spectra of gypsum samples had also the signals of Mn 2 + in addition to the signal at g=2.009. It was observed that the intensity of ESR signal at g=2.009 increased with gamma irradiation dose. This ESR signal (g=2.009) was used as a dating signal in dating of gypsum samples. The only one TL peak at about 278 degree Celsius was observed in TL glow curves of nonirradiated gypsum sample. In the case of irradiated sample, TL peak at 157 degree Celsius was observed in addition of TL peak at 278 degree Celsius. Gypsum samples were irradiated with a 6 0Co gamma source. The ESR spectra and TL glow curve of gypsum samples were recorded by X-band ESR spectrometer and Risφ TL/OSL reader, respectively. For samples, ESR/TL dose-response curves was constructed. Dose-response curves were fitted with an exponential saturation function. Based on this model, accumulated dose (AD) values for dating are determined. 2 38U, 2 32Th and 4 0K analysis was carried out for gypsum crystals and dolomite which enveloped these gypsum crystals. The internal dose rate was calculated from 2 38U, 2 32Th and 4 0K analysis results of gypsum sample. The external dose rate was calculated by using 2 38U, 2 32Th and 4 0K analysis results of dolomite and cosmic dose rate. Internal and external gamma dose-rate was used for dating calculations. Because of successive recrystallization of gypsum sample after formation, calculated age values of gypsum is smaller than expected formation age.

  6. 201Tl scintigraphic evaluation of tumor mass and viability of bone and soft-tissue tumors

    International Nuclear Information System (INIS)

    Tsuda, Takatoshi; Kubota, Masahiro; Yoshida, Satoru; Shibata, Masahito; Wakabayashi, Jun-ichi; Obata, Hiroyuki; Matsuyama, Toshikatsu; Usui, Masamichi; Ishii, Sei-ichi.

    1994-01-01

    To characterize 201 Tl uptake in patients with bone and soft-tissue tumor, we studied 49 patients with surgically proven tumors and one patient with a tumor diagnosed arteriographically. In 37 of our 50 patients, the tumor was evaluated with 201 Tl and arteriography. Moreover, in 14 of patients with pre-operative chemotherapy, pathologic changes were graded on the basis of percent tumor necrosis as defined histologically. The percent tumor necrosis histologically was compared with changes in the scintigraphic and conventional angiographic studies. Radiologic comparisons demonstrated a high degree of correlation with images of 201 Tl and both arterial and blood pool phase of 99m Tc-HMDP. Ninety-six percent of 28 malignant tumors had positive 201 Tl uptake. None of the patients showed any thallium accumulation in the soft tissues or skeleton adjacent to the lesion. Activity of 201 Tl was mainly dependent upon a tumor blood flow and a vascular density. In of 14 cases with the preoperative chemotherapeutic treatment, 201 Tl scintigraphic changes showed concordance with % tumor necrosis. Thallium-201 was superior to 99m Tc-HMDP in predicting tumor response to chemotherapy. Interestingly, delayed images of 99m Tc-HMDP of 5 responders with >90% tumor necrosis showed decreased uptake in the adjacent bone to the tumor mass lesions. It seems to be quite all right to consider that a major determinant of 201 Tl uptake is intratumoral angiogenecity, which is closely connected with tumor viability. Therefore, 201 Tl is a sensitive radiopharmaceutical for detection of vascular rich bone and soft-tissue tumors, and appears to be a simple and an accurate test for evaluating the response to specific therapeutic regimens of malignant bone and soft-tissue tumors. (author)

  7. An overview on STEP-NC compliant controller development

    Science.gov (United States)

    Othman, M. A.; Minhat, M.; Jamaludin, Z.

    2017-10-01

    The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

  8. A novel Robertsonian translocation event leads to transfer of a stem rust resistance gene (Sr52) effective against race Ug99 from Dasypyrum villosum into bread wheat.

    Science.gov (United States)

    Qi, L L; Pumphrey, M O; Friebe, Bernd; Zhang, P; Qian, C; Bowden, R L; Rouse, M N; Jin, Y; Gill, B S

    2011-06-01

    Stem rust (Puccinia graminis f. sp. tritici Eriks. & E. Henn.) (the causal agent of wheat stem rust) race Ug99 (also designated TTKSK) and its derivatives have defeated several important stem rust resistance genes widely used in wheat (Triticum aestivum L.) production, rendering much of the worldwide wheat acreage susceptible. In order to identify new resistance sources, a large collection of wheat relatives and genetic stocks maintained at the Wheat Genetic and Genomic Resources Center was screened. The results revealed that most accessions of the diploid relative Dasypyrum villosum (L.) Candargy were highly resistant. The screening of a set of wheat-D. villosum chromosome addition lines revealed that the wheat-D. villosum disomic addition line DA6V#3 was moderately resistant to race Ug99. The objective of the present study was to produce and characterize compensating wheat-D. villosum whole arm Robertsonian translocations (RobTs) involving chromosomes 6D of wheat and 6V#3 of D. villosum through the mechanism of centric breakage-fusion. Seven 6V#3-specific EST-STS markers were developed for screening F(2) progeny derived from plants double-monosomic for chromosomes 6D and 6V#3. Surprisingly, although 6D was the target chromosome, all recovered RobTs involved chromosome 6A implying a novel mechanism for the origin of RobTs. Homozygous translocations (T6AS·6V#3L and T6AL·6V#3S) with good plant vigor and full fertility were selected from F(3) families. A stem rust resistance gene was mapped to the long arm 6V#3L in T6AS·6V#3L and was designated as Sr52. Sr52 is temperature-sensitive and is most effective at 16°C, partially effective at 24°C, and ineffective at 28°C. The T6AS·6V#3L stock is a new source of resistance to Ug99, is cytogenetically stable, and may be useful in wheat improvement.

  9. Centers responsible for the TL peaks of willemite mineral estimated by EPR analysis

    Energy Technology Data Exchange (ETDEWEB)

    Gundu Rao, T.K. [Instituto de Física, Universidade de São Paulo, Rua do Matão, Travessa R, 187, CEP 05508-090, São Paulo, SP (Brazil); Cano, Nilo F., E-mail: nilo.cano@unifesp.br [Departamento de Ciências do Mar, Universidade Federal de São Paulo, Rua Doutor Carvalho de Mendonça, 144, CEP 11070-102, Santos, SP (Brazil); Silva-Carrera, Betzabel N.; Ferreira, Reinaldo M. [Instituto de Física, Universidade de São Paulo, Rua do Matão, Travessa R, 187, CEP 05508-090, São Paulo, SP (Brazil); Javier-Ccallata, Henry S., E-mail: henrysjc@gmail.com [Escuela Profesional de Física, Facultad de Ciencias Naturales y Formales, Universidad Nacional de San Agustín (UNSA), Av. Independencia S/N, Arequipa (Peru); Watanabe, Shigueo, E-mail: watanabe@if.usp.br [Instituto de Física, Universidade de São Paulo, Rua do Matão, Travessa R, 187, CEP 05508-090, São Paulo, SP (Brazil)

    2016-09-15

    The mineral willemite (Zn{sub 2}SiO{sub 4}) exhibits five thermoluminescence (TL) peaks approximately at 160, 225, 260, 310 and 400 °C. Electron paramagnetic resonance (EPR) studies were carried out to study the defect centers induced in the mineral by gamma irradiation and also to identify the centers responsible for the TL process. Room temperature EPR spectrum of irradiated mineral is a superposition of at least four distinct centers. One of the centers (center I) with an isotropic g factor 2.0114 is attributable to an intrinsic O{sup −} type center and the center correlates with the TL peak at 160 °C. Center II exhibiting hyperfine lines is also tentatively assigned to an O{sup −} ion and is related to the low temperature TL peak at 160 °C. Center III is characterized by an axially symmetric g-tensor with principal values g{sub ||}=2.0451 and g{sub ⊥}=2.011 and is identified as an O{sub 2}{sup −} ion. This center appears to be related to 160, 225 and 260 °C TL peaks. Center IV with principal g-values g{sub ||}=2.0025 and g{sub ⊥}=2.0088 is attributed to an F{sup +}-type center (singly ionized oxygen vacancy) and is the likely recombination center for TL peaks between 160 and 310 °C.

  10. Emission properties of thermoluminescence from natural quartz - blue and red TL response to absorbed dose

    International Nuclear Information System (INIS)

    Hashimoto, T.; Yokosaka, K.; Habuki, H.

    1987-01-01

    The TL spectrometry of natural quartz exposed to a gamma radiation dose of 8.8 kGy proved that the red TL, mainly from volcanically originated quartz, has a broad emission band with a peak around 620 nm, while the blue TL from plutonically originated quartz also has a broad emission band giving a peak around 470 nm. These typical red or blue intrinsic colours were also confirmed on the thermoluminescence colour images (TLCI). Exceptionally, a pegmatite quartz changed its TLCI colour from red to blue when the absorbed dose was increased. By using colour filter assemblies, all these quartz samples were shown to emit mainly blue and red TLs, which have distinctly different TL responses to the absorbed dose; the blue invariably showed a supralinearity relation between 1 and 10 kGy dose. For the purpose of dating, the use of red TL, is preferable. The red TL component is related to the impurity Eu content in quartz minerals. (author)

  11. Minimising the Spurious TL of Recently Fired Ceramics Using the Foil Technique

    International Nuclear Information System (INIS)

    Michael, C.T.; Zacharias, N.; Polikreti, K.; Pagonis, V.

    1999-01-01

    The new foil technique for measuring the natural dose in TL dating is briefly presented. In this technique very thin samples are made with the necessary plasticity to achieve the best heating contact between sample and heater plate. Measurements can then be made in vacuum and it is possible to use higher heating rates. The effect of the increase of the TL signal with the increase of the heating rate is presented. The foil technique reduces chemiluminescence and increases the TL signal. This allows the application of TL dating to be extended to lower limits (lower ages). These limits are determined by estimating quantitatively the effects of the sample preparation procedure on the induction of spurious TL (triboluminescence). Samples from a two year old ceramic vase were prepared with two different powder preparation procedures: (a) by using a hand drill with a common steel edge and (b) by crushing a piece using a vice. Measurements at a heating rate of 50 deg. C.s -1 were made. The two estimates of P (total dose) provide an estimate of age for each procedure. The age estimation for the vice prepared sample is about 30 years and for the drilled sample is higher than 120 years. It is suggested that the use of a drill for powder preparation be avoided, especially in TL dating and authenticity tests of recently fired ceramics (less than 500 years). (author)

  12. TL and LOE dosimetric evaluation of diamond films exposed to beta and ultraviolet radiation

    International Nuclear Information System (INIS)

    Preciado F, S.; Melendrez, R.; Chernov, V.; Barboza F, M.; Schreck, M.; Cruz Z, E.

    2005-01-01

    The diamond possesses a privileged position regarding other materials of great technological importance. Their applications go from the optics, microelectronics, metals industry, medicine and of course as dosemeter, in the registration and detection of ionizing and non ionizing radiation. In this work the results of TL/LOE obtained in two samples of diamond of 10 μm thickness grown by the chemical vapor deposition method (CVD) assisted by microwave plasma. The films were deposited in a silicon substrate (001) starting from a mixture of gases composed of CH 4 /H 2 and 750 ppm of molecular nitrogen as dopant. The samples were exposed to beta radiation (Sr 90 / Y 90 ) and ultraviolet, being stimulated later on thermal (TL) and optically (LOE) to evaluate their dosimetric properties. The sample without doping presented high response TL/LOE to the ultraviolet and beta radiation. The TL glow curve of the sample without doping showed two TL peaks with second order kinetics in the range of 520 to 550 K, besides a peak with first order kinetics of more intensity around 607 K. The TL efficiency of the non doped sample is bigger than the doped with nitrogen; however the LOE efficiency is similar in both samples. The results indicate that the CVD diamond possesses excellent perspectives for dosimetric applications, with special importance in radiotherapy due to it is biologically compatible with the human tissue. (Author)

  13. Conceptualizing and Communicating SoTL: A Framework for the Field

    Directory of Open Access Journals (Sweden)

    Janice Miller-Young

    2015-09-01

    Full Text Available The emerging field of SoTL is an inherently interdisciplinary endeavor which requires embracing a diverse range of research methods and disciplinary differences in world views. This diversity has caused a lack of coherence in its conceptualization and communication, which can be confusing for new scholars. Ongoing debates in the community concern the use of theory and methodology, as well as definitional questions of what constitutes SoTL and the nature of its purpose. This article offers a framework for conceptualizing the field which attempts to broadly delineate the available learning theories underlying and methodologies appropriate to studying teaching and learning, while intending to be hospitable to a broad range of diverse disciplines. Further, the framework illustrates the tacit links between learning theories and methodologies, serving as a guide to potential approaches to SoTL work. The framework is illustrated with example SoTL studies. It is hoped that the framework will help ground future SoTL investigations in appropriate theories and methodologies, and build interdisciplinary communication and understanding in the “trading zone” that is SoTL.

  14. Tl response of LiF:Mg, Cu, P + PTFE to Am-Be neutrons

    International Nuclear Information System (INIS)

    Gonzalez M, P.R.

    2000-01-01

    In different laboratories of the world it is followed the research about development of new Tl materials, whose main characteristics should be their equivalence with the tissue and their high sensibility to any type of radiation. The study consists in to measure the Tl peak intensity which TLD-100 presents at being irradiated with neutrons and that appears over 250 Centigrade, for compare it with the Tl intensity of the LiF: Mg, Cu, P + PTFE dosemeters. However, not all dosemeters of the same group show the interesting peak, by this only can be the total Tl intensity of dosemeters studied. In the ININ dosemeters development laboratory, we have developed a Tl material of lithium fluoride activated with magnesium, copper and phosphorus (LiF: Mg, Cu, P) that in polycrystalline powder form is almost 35 times more sensitive than the TLD-100 commercial dosemeter of Harshaw/Filtrol, USA. With the use of polytetrafluorethylene (PTFE) and with the above described Tl material, it has been possible to obtain dosemeters in pellet form of LiF: Mg, Cu, P + PTFE. (Author)

  15. Repair of U/G and U/A in DNA by UNG2-associated repair complexes takes place predominantly by short-patch repair both in proliferating and growth-arrested cells

    DEFF Research Database (Denmark)

    Akbari, Mansour; Otterlei, Marit; Pena Diaz, Javier

    2004-01-01

    Nuclear uracil-DNA glycosylase UNG2 has an established role in repair of U/A pairs resulting from misincorporation of dUMP during replication. In antigen-stimulated B-lymphocytes UNG2 removes uracil from U/G mispairs as part of somatic hypermutation and class switch recombination processes. Using......, PCNA and DNA ligase, the latter detected as activity. Short-patch repair was the predominant mechanism both in extracts and UNG2-ARC from proliferating and less BER-proficient growth-arrested cells. Repair of U/G mispairs and U/A pairs was completely inhibited by neutralizing UNG...

  16. The X-ray response of TlBr

    International Nuclear Information System (INIS)

    Owens, Alan; Bavdaz, M.; Brammertz, G.; Gostilo, V.; Graafsma, H.; Kozorezov, A.; Krumrey, M.; Lisjutin, I.; Peacock, A.; Puig, A.; Sipila, H.; Zatoloka, S.

    2003-01-01

    We present the results of a series of X-ray measurements on several prototype TlBr detectors. The devices were fabricated from mono-crystalline material and were typically of size 2.7x2.7x0.8 mm 3 . The material is extremely pure, having impurity concentrations -4 and 1x10 -5 cm 2 V -1 , respectively, which are about an order of magnitude higher than previously reported values. Three detectors were fabricated and extensively tested over the energy range 2.3-100 keV at three synchrotron radiation facilities: the Physikalisch-Technische Bundesanstalt (PTB) laboratory at the Berliner Elektronenspeicherring fuer Synchrotronstrahlung (BESSY II), the European Synchrotron Radiation Research Facility (ESRF) and the Hamburger Synchrotron-strahlungslabor (HASYLAB) radiation facility. Room temperature energy resolutions under full-area illumination of 1.8 and 3.3 keV FWHM have been achieved at 5.9 and 59.95 keV, respectively. At reduced detector temperatures of -30 deg. C, these fall to 800 eV and 2.6 keV FWHM, respectively. Under monochromatic pencil beam illumination, the measured energy resolutions at 6 and 60 keV were 664 eV and ∼3 keV FWHM at the same temperature. For energies 2 , 12 keV mono-energetic X-ray beam, raster scanned over the forward active area. Whilst two detectors were spatially uniform to a level commensurate with statistics, the third was not. In all cases, evidence was found for charge collection problems caused by field fringing

  17. Working conditions analysis according T.L. personal dosimetry results

    International Nuclear Information System (INIS)

    Marinkovic, O.; Jovanovic, S.

    2006-01-01

    Laboratory for personal dosimetry in the Institute of Occupational and Radiological Health, Belgrade, used TLD more than twenty years. Before that, film dosimetry was main method in external monitoring. T.L. dosimetry was started with Reader Toledo 654 and crystals Mg B 4 O 7 . Finally, from 1992 laboratory has Harshaw TLD Reader Model 6600. Dosimeters are crystals LiF type 100, card packed, worn in standard filtrated holders. Personal dosimetry data are keeping 30 years for each worker according to regulations. The data from 1990 are in electronic form. Long experience enables conclusion that new technique means more advantages in practice. Recommendation from this laboratory practice refers to TLD read-out cycle. The longest period should be one month. LiF is recommended crystal. Glow curve deconvolution gives information about chronological irradiation. It is very important to conclude was dosimetry irradiated by 'one-shot' or continuously. Preparing calibration for determination the time since accident laboratory has to define adequate dose calibration methodology including low temperature peaks. Possibility to follow working conditions analyzing TLD glow curve is much more important than low decrease of dose severity. Time depend analyze is not possible if TLD would be read-out more than (approximately) six weeks after irradiation. If ionizing sources produce such low dose and has negligible probability of accidental exposure (according nowadays regulation read-out frequency could be once in three month), the recommendation is not to use external personal monitoring. Reading personal dosimeters once in three months deemed not useful. Complete and successful personal dosimetry dictates using system that enables glow curve shape representation to be sure that signal is ionizing irradiation result or not. Time depend analyze imparts information about protection permanence. In special circumstance, it is possible to estimate the time of exposure. This is extremely

  18. TL dosimetry for quality control of CR mammography imaging systems

    Science.gov (United States)

    Gaona, E.; Nieto, J. A.; Góngora, J. A. I. D.; Arreola, M.; Enríquez, J. G. F.

    The aim of this work is to estimate the average glandular dose with thermoluminescent (TL) dosimetry and comparison with quality imaging in computed radiography (CR) mammography. For a measuring dose, the Food and Drug Administration (FDA) and the American College of Radiology (ACR) use a phantom, so that dose and image quality are assessed with the same test object. The mammography is a radiological image to visualize early biological manifestations of breast cancer. Digital systems have two types of image-capturing devices, full field digital mammography (FFDM) and CR mammography. In Mexico, there are several CR mammography systems in clinical use, but only one system has been approved for use by the FDA. Mammography CR uses a photostimulable phosphor detector (PSP) system. Most CR plates are made of 85% BaFBr and 15% BaFI doped with europium (Eu) commonly called barium flourohalideE We carry out an exploratory survey of six CR mammography units from three different manufacturers and six dedicated X-ray mammography units with fully automatic exposure. The results show three CR mammography units (50%) have a dose greater than 3.0 mGy without demonstrating improved image quality. The differences between doses averages from TLD system and dosimeter with ionization chamber are less than 10%. TLD system is a good option for average glandular dose measurement for X-rays with a HVL (0.35-0.38 mmAl) and kVp (24-26) used in quality control procedures with ACR Mammography Accreditation Phantom.

  19. Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

    Science.gov (United States)

    Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

    2017-11-01

    TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

  20. Zasady ujawniania aktywów biologicznychw sprawozdaniach finansowych jednostek rolniczychwedług Międzynarodowych StandardówSprawozdawczości Finansowej

    Directory of Open Access Journals (Sweden)

    Teresa Kiziukiewicz

    2009-03-01

    Full Text Available Charakterystycznym dla przedsiębiorstw rolniczych składnikiem aktywów są aktywa biologiczne. Wyróżnia je fakt podlegania przemianie biologicznej, wskutek której przekształcają się one w produkty rolnicze lub inne aktywa biologiczne. W związku z tą specyfiką powstaje problem odpowiedniej prezentacji informacji o nich. W artykule są przedstawione zasady i zakres ujawnień o aktywach biologicznych w sprawozdaniu finansowym i dołączanych do niego raportach szczegółowych, ze szczególnym uwzględnieniem problemów wyceny według wartości godziwej.

  1. Identification and mapping of Sr46 from Aegilops tauschii accession CIae 25 conferring resistance to race TTKSK (Ug99) of wheat stem rust pathogen.

    Science.gov (United States)

    Yu, Guotai; Zhang, Qijun; Friesen, Timothy L; Rouse, Matthew N; Jin, Yue; Zhong, Shaobin; Rasmussen, Jack B; Lagudah, Evans S; Xu, Steven S

    2015-03-01

    Mapping studies confirm that resistance to Ug99 race of stem rust pathogen in Aegilops tauschii accession Clae 25 is conditioned by Sr46 and markers linked to the gene were developed for marker-assisted selection. The race TTKSK (Ug99) of Puccinia graminis f. sp. tritici, the causal pathogen for wheat stem rust, is considered as a major threat to global wheat production. To address this threat, researchers across the world have been devoted to identifying TTKSK-resistant genes. Here, we report the identification and mapping of a stem rust resistance gene in Aegilops tauschii accession CIae 25 that confers resistance to TTKSK and the development of molecular markers for the gene. An F2 population of 710 plants from an Ae. tauschii cross CIae 25 × AL8/78 were first evaluated against race TPMKC. A set of 14 resistant and 116 susceptible F2:3 families from the F2 plants were then evaluated for their reactions to TTKSK. Based on the tests, 179 homozygous susceptible F2 plants were selected as the mapping population to identify the simple sequence repeat (SSR) and sequence tagged site (STS) markers linked to the gene by bulk segregant analysis. A dominant stem rust resistance gene was identified and mapped with 16 SSR and five new STS markers to the deletion bin 2DS5-0.47-1.00 of chromosome arm 2DS in which Sr46 was located. Molecular marker and stem rust tests on CIae 25 and two Ae. tauschii accessions carrying Sr46 confirmed that the gene in CIae 25 is Sr46. This study also demonstrated that Sr46 is temperature-sensitive being less effective at low temperatures. The marker validation indicated that two closely linked markers Xgwm210 and Xwmc111 can be used for marker-assisted selection of Sr46 in wheat breeding programs.

  2. Molecular Cytogenetic Characterization of two Triticum–Secale–Thinopyrum Trigeneric Hybrids Exhibiting Superior Resistance to Fusarium Head Blight, Leaf Rust, and Stem Rust Race Ug99

    Directory of Open Access Journals (Sweden)

    Yi Dai

    2017-05-01

    Full Text Available Fusarium head blight (FHB, leaf rust, and stem rust are the most destructive fungal diseases in current world wheat production. The diploid wheatgrass, Thinopyrum elongatum (Host Dewey (2n = 2x = 14, EE is an excellent source of disease resistance genes. Two new Triticum–Secale–Thinopyrum trigeneric hybrids were derived from a cross between a hexaploid triticale (X Triticosecale Wittmack, 2n = 6x = 42, AABBRR and a hexaploid Triticum trititrigia (2n = 6x = 42, AABBEE, were produced and analyzed using genomic in situ hybridization and molecular markers. The results indicated that line RE21 contained 14 A-chromosomes, 14 B-chromosomes, three pairs of R-chromosomes (4R, 6R, and 7R, and four pairs of E-chromosomes (1E, 2E, 3E, and 5E for a total chromosome number of 2n = 42. Line RE62 contained 14 A-chromosomes, 14 B-chromosomes, six pairs of R-chromosomes, and one pair of translocation chromosomes between chromosome 5R and 5E, for a total chromosome number of 2n = 42. At the seedling and adult growth stages under greenhouse conditions, line RE21 showed high levels of resistance to FHB, leaf rust, and stem rust race Ug99, and line RE62 was highly resistant to leaf rust and stem rust race Ug99. These two lines (RE21 and RE62 display superior disease resistance characteristics and have the potential to be utilized as valuable germplasm sources for future wheat improvement.

  3. Detection of irradiated foods by the thermoluminescence. Relationships between the temperature ranges of integrating TL glow curves and TL glow ratios

    International Nuclear Information System (INIS)

    Sekiguchi, Masayuki; Yamazaki, Masao; Goto, Michiko; Todoriki, Setsuko; Hagiwara, Shoji

    2007-01-01

    Our study demonstrated that the effects of the several temperature ranges for integrating TL glow intensity on the TL glow ratios by using spice-set purchased at a Turkish air port. The spice set had no labeling of irradiation feeds, but nine of 12 spices were judged as irradiated food in this study. Those temperature ranges were defined by evaluating the glow curves of irradiated TLD-100 chip (167-230degC), TLD-100 disc (177-238degC) and Dolomite element (145-258degC). Those are relatively stable and the difference of typical glow peak temperatures of TLD-100 disc in two institutes was less than 2%. On the other hand, those of TLD-100 tip was shift to higher temperature side at about 4degC because of declining of thermal conductance. The temperature ranges defined by TLD-100 were showed that discriminate more clearly between irradiated and nonirradiated spices compared with the full temperature range of TL measurement (70-400degC). With the exception of low glow intensity, background measurement for estimating net glow intensity was not necessary because TL glow ratio was hardly influenced whether the background measured or not. (author)

  4. Real-time in-situ monitoring of the topotactic transformation of TlCu3Se2 into TlCu2Se2

    International Nuclear Information System (INIS)

    Ångström, J.; Sahlberg, M.; Berger, R.

    2015-01-01

    Highlights: • Topotactic transition from TlCu 3 Se 2 to TlCu 2 Se 2 followed in situ. • Synchrotron radiation X-ray powder diffraction enabled short scans. • Relative abundance of phases refined from powder data. • Opens up for studying similar systems in the same manner. - Abstract: The solid state transformation of monoclinic TlCu 3 Se 2 into tetragonal TlCu 2 Se 2 by oxidative copper leaching in concentrated ammonia solution has been studied in situ by the use of synchrotron radiation. The diffraction patterns of parent and daughter phase are both sharp, indicating a strong topotactic relationship between them that effectuates a rapid change by “chimie douce” performed at +19 °C. The transformation rate is strongly connected to the access of oxygen from the surrounding air. The transformation was followed in a real-time mode, being almost complete after 2.5 h with 1 h incubation due to low oxygen content, as shown from refining the diffraction patterns by Rietveld profile technique

  5. SCOPE-mTL: A non-invasive tool for identifying and lateralizing mesial temporal lobe seizures prior to scalp EEG ictal onset.

    Science.gov (United States)

    Lam, Alice D; Maus, Douglas; Zafar, Sahar F; Cole, Andrew J; Cash, Sydney S

    2017-09-01

    In mesial temporal lobe (mTL) epilepsy, seizure onset can precede the appearance of a scalp EEG ictal pattern by many seconds. The ability to identify this early, occult mTL seizure activity could improve lateralization and localization of mTL seizures on scalp EEG. Using scalp EEG spectral features and machine learning approaches on a dataset of combined scalp EEG and foramen ovale electrode recordings in patients with mTL epilepsy, we developed an algorithm, SCOPE-mTL, to detect and lateralize early, occult mTL seizure activity, prior to the appearance of a scalp EEG ictal pattern. Using SCOPE-mTL, 73% of seizures with occult mTL onset were identified as such, and no seizures that lacked an occult mTL onset were identified as having one. Predicted mTL seizure onset times were highly correlated with actual mTL seizure onset times (r=0.69). 50% of seizures with early mTL onset were lateralizable prior to scalp ictal onset, with 94% accuracy. SCOPE-mTL can identify and lateralize mTL seizures prior to scalp EEG ictal onset, with high sensitivity, specificity, and accuracy. Quantitative analysis of scalp EEG can provide important information about mTL seizures, even in the absence of a visible scalp EEG ictal correlate. Copyright © 2017 International Federation of Clinical Neurophysiology. Published by Elsevier B.V. All rights reserved.

  6. Novel interplay between high-Tc superconductivity and antiferromagnetism in Tl-Based Six-CuO2-layered cuprates. 205Tl- and 63Cu-NMR probes

    International Nuclear Information System (INIS)

    Mukuda, Hidekazu; Shiki, Nozomu; Kimoto, Naoki; Yashima, Mitsuharu; Kitaoka, Yoshio; Tokiwa, Kazuyasu; Iyo, Akira

    2016-01-01

    We report 63 Cu- and 205 Tl-NMR studies on six-layered (n = 6) high-T c superconducting (SC) cuprate TlBa 2 Ca 5 Cu 6 O 14+δ (Tl1256) with T c ∼ 100 K, which reveal that antiferromagnetic (AFM) order takes place below T N ∼ 170 K. In this compound, four underdoped inner CuO 2 planes [n(IP) = 4] sandwiched by two outer planes (OPs) are responsible for the onset of AFM order, whereas the nearly optimally-doped OPs responsible for the onset of bulk SC. It is pointed out that an increase in the out-of-plane magnetic interaction within an intra-unit-cell causes T N ∼ 45 K for Tl1245 with n(IP) = 3 to increase to ∼170 K for Tl1256 with n(IP) = 4. It is remarkable that the marked increase in T N and the AFM moments for the IPs does not bring about any reduction in T c , since T c ∼ 100 K is maintained for both compounds with nearly optimally doped OP. We highlight the fact that the SC order for n ≥ 5 is mostly dominated by the long-range in-plane SC correlation even in the multilayered structure, which is insensitive to the magnitude of T N and the AFM moments at the IPs or the AFM interaction among the IPs. These results demonstrate a novel interplay between the SC and AFM orders when the charge imbalance between the IPs and OP is significantly large. (author)

  7. Quantitative evaluation of right ventricular overload in cor pulmonale using sup 201 Tl myocardial SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Kato, Hiroshi; Misawa, Toshihiro; Kutsumi, Yasunori [Fukui Medical School, Matsuoka (Japan); and others

    1991-01-01

    To determine quantitatively the discriminant and characteristics of cor pulmonale, {sup 201}Tl myocardial perfusion SPECT was performed in 16 patients with chronic obstructive pulmonary disease (COPD) and 7 with restrictive pulmonary disease (RPD). One section of the short-axis SPECT image in which the right ventricle was most clearly visualized was selected. Tl-score was defined as the ratio of the sum of counts in the region of interest (ROI) at the anterior, mid, and posterior regions of the right ventricular free wall to the sum of counts in ROI at the posterior, lateral, and anterior walls of the left ventricle, and the anterior and posterior regions of the interventricular septum. In the group of COPD patients, Tl-score was positively correlated with mean pulmonary arterial pressure (mPAP), total pulmonary vascular resistance (TPR), and arterial carbon dioxide tension (PaCO{sub 2}), while it was inversely correlated with arterial oxygen tension (PaO{sub 2}). However, there was no significant correlation between Tl-score and mPAP, TPR, PaCO{sub 2}, and PaO{sub 2} in the group of RPD patients. In assessing pulmonary hypertension as defined by mPAP over 20 mmHg, a Tl-score greater than 0.25 was useful with a sensitivity of 69% and a specificity of 90%. The occurrence of cor pulmonale is a major factor in determining the prognosis of COPD patients. It was concluded that {sup 201}Tl myocardial SPECT is useful for evaluating right ventricular overload quantitatively, as well as for assessing core pulmonale, especially in COPD patients, since the ratio of Tl counts in the right and left ventricles was significantly correlated with right cardiopulmonary hemodynamic parameters. (N.K.).

  8. TL and OSL studies of carbon doped magnesium aluminate (MgAl2O4:C)

    Science.gov (United States)

    Raj, Sanu S.; Mishra, D. R.; Soni, Anuj; Grover, V.; Polymeris, G. S.; Muthe, K. P.; Jha, S. K.; Tyagi, A. K.

    2016-10-01

    The MgAl2O4:C has been synthesized by using two different methods by electron gun and vacuum assisted melting of MgAl2O4 in presence of graphite. The MgAl2O4:C phosphor thus developed by these two different methods have similar types of the TL/OSL defects with multiple overlapping TL glow peaks from 100 °C to 400 °C. The Computerized Curve De-convolution Analysis (CCDA) has been used to measure TL parameters such as thermal trap depth, frequency factor and order of kinetic associated with charge transfer process in TL phenomenon. The investigated TL/OSL results show that these two methods of incorporating carbon in MgAl2O4 have generated closely resemble the defects of similar types in MgAl2O4:C lattice. However, the MgAl2O4:C synthesized by electron gun shows relatively larger concentration of the TL/OSL defects as compared to MgAl2O4:C synthesized using vacuum assisted melting method. The photo-ionization cross-section (PIC) associated with fastest OSL component of MgAl2O4: C is found to be ∼ 0.5 times than that of fastest OSL component of commercially available dosimetric grade α-Al2O3:C. The MgAl2O4:C thus developed shows good dynamic OSL dose linearity from few mGy to 1 Gy. This work reveals that MgAl2O4:C could be developed as potential tissue equivalent OSL / TL material.

  9. TL and OSL dosimetric properties of Opal gemstone for gamma radiation dosimetry

    International Nuclear Information System (INIS)

    Antonio, Patrícia L.; Gronchi, Claudia C.; Oliveira, Raquel A.P.; Khoury, Helen J.; Caldas, Linda V.E.

    2016-01-01

    In this work, the response of the natural material Opal was studied in relation to its thermoluminescence (TL) and optically stimulated luminescence (OSL), after exposure to the gamma radiation of a "6"0Co source. The structure of the powdered Opal was verified using the X-ray diffraction, scanning electronic microscopy and energy-dispersive X-ray spectroscopy techniques. The material, in its stone form, was turned into powder and mixed to Teflon (also in powder) in three different concentrations, and then pellets were manufactured. The aim of this work was to evaluate the response of these pellets in high-doses of gamma radiation beams, and to observe their possible application as dosimeters, using the TL and OSL techniques. The dosimetric properties of the samples were analyzed by means of different tests, as: TL emission curves and OSL signal decay curves, reproducibility of TL and OSL response, minimum detectable dose, TL and OSL dose–response curves (5 Gy–10 kGy), and fading. The results obtained in this work, for the TL and OSL phenomena, demonstrated that the pellets of Opal + Teflon present an adequate performance e possibility of use as dosimeters in beams of high-dose gamma radiation. - Highlights: • The XRD, SEM and EDX techniques were used to investigate powdered Opal. • Pellets of three different concentrations of Opal and Teflon were studied. • The dosimetric properties of the Opal + Teflon pellets were verified. • TL and OSL techniques were used to analyze the characteristics of the pellets. • Pellets of concentration of 2:1 (Opal:Teflon) presented the most adequate results.

  10. Quantitative evaluation of right ventricular overload in cor pulmonale using 201Tl myocardial SPECT

    International Nuclear Information System (INIS)

    Kato, Hiroshi; Misawa, Toshihiro; Kutsumi, Yasunori

    1991-01-01

    To determine quantitatively the discriminant and characteristics of cor pulmonale, 201 Tl myocardial perfusion SPECT was performed in 16 patients with chronic obstructive pulmonary disease (COPD) and 7 with restrictive pulmonary disease (RPD). One section of the short-axis SPECT image in which the right ventricle was most clearly visualized was selected. Tl-score was defined as the ratio of the sum of counts in the region of interest (ROI) at the anterior, mid, and posterior regions of the right ventricular free wall to the sum of counts in ROI at the posterior, lateral, and anterior walls of the left ventricle, and the anterior and posterior regions of the interventricular septum. In the group of COPD patients, Tl-score was positively correlated with mean pulmonary arterial pressure (mPAP), total pulmonary vascular resistance (TPR), and arterial carbon dioxide tension (PaCO 2 ), while it was inversely correlated with arterial oxygen tension (PaO 2 ). However, there was no significant correlation between Tl-score and mPAP, TPR, PaCO 2 , and PaO 2 in the group of RPD patients. In assessing pulmonary hypertension as defined by mPAP over 20 mmHg, a Tl-score greater than 0.25 was useful with a sensitivity of 69% and a specificity of 90%. The occurrence of cor pulmonale is a major factor in determining the prognosis of COPD patients. It was concluded that 201 Tl myocardial SPECT is useful for evaluating right ventricular overload quantitatively, as well as for assessing core pulmonale, especially in COPD patients, since the ratio of Tl counts in the right and left ventricles was significantly correlated with right cardiopulmonary hemodynamic parameters. (N.K.)

  11. Development of NaI(Tl) scintillating films for imaging soft x-rays

    International Nuclear Information System (INIS)

    Shepherd, J.A.

    1993-01-01

    Thin film NaI(Tl) scintillators, of areas of up to 130 cm 2 , have been fabricated and characterized for use on soft x-ray imaging photomultiplier tubes. Relevant parameters of photon-counting imaging detectors are defined and used to predict the performance of several materials, including CsI(Na), CsI(Tl), CaF 2 (Eu), Lu 2 (SiO 4 )O:Ce, and NaI(Tl), as thin film scintillators on fiber optic substrates. Also, x-ray imaging methodologies are compared. The NaI(Tl) films were vapor-deposited onto quartz and fiber optic substrates using a powder flash deposition technique. When compared to single crystal NaI(Tl), the films were found to have equally high light yield but lower energy resolution. Light yield optimization was studied in detail including the effects of substrate temperature, activator concentration in the evaporant, and boat temperature. Spatial resolution as well as parallax errors are discussed and measured for film thicknesses up to 61 μm. A technique is described that can substantially increase the light collection of high index films on fiber optic disks. The light collection was improved by 20% by coating the disk with potassium silicate before the NaI(Tl) deposition. Large area films, up to 130 cm 2 , had a spatial uniformity of response within ±1.5% for count rate and ±3.5% for light yield, and their spatial resolution exceeded 16.6 lp mm -1 when deposited onto fiber optic substrates. The 8-keV x-ray detection efficiency of the microchannel plate imaging photomultiplier tube coupled to a NaI(Tl) film scintillator is predicted to be 88%. Other uses for the films are also described

  12. Effects of ischemic-like insult on myocardial 201Tl accumulation

    International Nuclear Information System (INIS)

    Goldhaber, S.Z.; Newell, J.B.; Alpert, N.M.; Andrews, E.; Pohost, G.M.; Ingwall, J.S.

    1983-01-01

    Despite extensive clinical use of thallium-201 ( 201 Tl) for myocardial imaging, the effect of ischemia on myocardial accumulation and release of 201 Tl independent of flow has not been fully defined. Therefore, myocardial accumulation of 201 Tl in response to ischemic-like myocardial injury was assessed in vitro using the cultured fetal mouse heart preparation. Cultured fetal mouse hearts (n . 311) were subjected to injury simulating ischemia by deprivation of oxygen and oxidizable substrates for periods ranging from 15 minutes to 10 hours. The extent of irreversible injury was determined by the percentage of lactic dehydrogenase (LDH) lost from the hearts to the culture medium during recovery from injury. Injury was essentially reversible at 1 hour of insult. The fraction of 201 Tl content in injured compared with control hearts was not significantly lower after 1 hour of insult. By 3 hours of insult, irreversible injury as assessed by loss of LDH was detectable and the extent of injury increased progressively through 10 hours. During the 3-10-hour period of irreversible injury, 201 Tl accumulation within injured hearts compared with controls was related in a monotonically decreasing fashion to the loss of LDH as described by a mathematical kinetic model that fit the observations closely (R2 greater than 0.99). These results indicate that in this organ culture preparation, in which there is effectively an unlimited reservoir of 201 Tl and no confounding effects of perfusion, the time-dependent 201 Tl accumulation is determined by the extent of irreversible injury

  13. Structure and scintillation properties of CsI(Tl) films on Si single crystal substrates

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Lina [State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China, Chengdu 610054 (China); Liu, Shuang, E-mail: shuangliu@uestc.edu.cn [State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China, Chengdu 610054 (China); Chen, Dejun; Zhang, Shangjian; Liu, Yong; Zhong, Zhiyong [State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China, Chengdu 610054 (China); Falco, Charles M. [University of Arizona, College of Optical Sciences, AZ 85721 (United States)

    2016-10-30

    Highlights: • We obtained the desired micro-columnar structure of CsI(Tl) films on the orienting Si substrates. • We improved the micro-columnar structure of CsI(Tl) films under the relatively large deposition rate through using the substrate with a pre-deposited CsI nanolayer. • We modeled the interface structures between the CsI(Tl) films with (200) and (310) orientation and Si(111) substrates to explain the preferred orientation of film under the influence of the orienting substrate significantly. • We gained a new spectrum of the CsI(Tl) films peaked at 740 nm wavelength. - Abstract: CsI(Tl) scintillation films fabricated on glass substrates are widely applied for X-ray imaging because their ability to grow in micro-columnar structure and proper emission wavelength matching CCD cameras. But the coupling process between the CsI(Tl) films and Si-based photo detector would cause coupling loss. In this work, CsI(Tl) films were deposited on the orienting Si substrates and the Si substrates covered by the pre-deposited CsI nanolayers. Structure and scintillation properties of films were examined by using scanning electron microscopy, X-ray diffraction, photoluminescence and radioluminescent spectrum. The films deposited on the orienting Si substrates show the micro-columnar morphology with perfect single crystalline structure and the photoluminescence spectra with bimodal distribution. The performances of the films prepared on the pre-deposited CsI nanolayer, containing micro-columns structure and the light yield are improved.

  14. Structure and scintillation properties of CsI(Tl) films on Si single crystal substrates

    International Nuclear Information System (INIS)

    Guo, Lina; Liu, Shuang; Chen, Dejun; Zhang, Shangjian; Liu, Yong; Zhong, Zhiyong; Falco, Charles M.

    2016-01-01

    Highlights: • We obtained the desired micro-columnar structure of CsI(Tl) films on the orienting Si substrates. • We improved the micro-columnar structure of CsI(Tl) films under the relatively large deposition rate through using the substrate with a pre-deposited CsI nanolayer. • We modeled the interface structures between the CsI(Tl) films with (200) and (310) orientation and Si(111) substrates to explain the preferred orientation of film under the influence of the orienting substrate significantly. • We gained a new spectrum of the CsI(Tl) films peaked at 740 nm wavelength. - Abstract: CsI(Tl) scintillation films fabricated on glass substrates are widely applied for X-ray imaging because their ability to grow in micro-columnar structure and proper emission wavelength matching CCD cameras. But the coupling process between the CsI(Tl) films and Si-based photo detector would cause coupling loss. In this work, CsI(Tl) films were deposited on the orienting Si substrates and the Si substrates covered by the pre-deposited CsI nanolayers. Structure and scintillation properties of films were examined by using scanning electron microscopy, X-ray diffraction, photoluminescence and radioluminescent spectrum. The films deposited on the orienting Si substrates show the micro-columnar morphology with perfect single crystalline structure and the photoluminescence spectra with bimodal distribution. The performances of the films prepared on the pre-deposited CsI nanolayer, containing micro-columns structure and the light yield are improved.

  15. Comparative Evaluation of Ultrafiltration/Microfiltration Membranes for Removal of Nitrocellulose (NC) Fines from Wastewater

    National Research Council Canada - National Science Library

    Kim, Byung

    1997-01-01

    .... In Phase II, a pilot-scale crossflow membrane filtration system was constructed to: (1) investigate the concentration polarization and fouling mechanism caused by NC fines during crossflow filtration of NC wastewater, (2...

  16. Lattice distortions in TlInSe{sub 2} thermoelectric material studied by X-ray absorption fine structure

    Energy Technology Data Exchange (ETDEWEB)

    Hosokawa, Shinya; Stellhorn, Jens Ruediger [Department of Physics, Kumamoto University, Kumamoto (Japan); Ikemoto, Hiroyuki [Department of Physics, University of Toyama, Toyama (Japan); Mimura, Kojiro [Department of Mathematical Sciences, Graduate School of Engineering, Osaka Prefecture University, Sakai (Japan); Wakita, Kazuki [Faculty of Engineering, Chiba Institute of Technology, Narashino (Japan); Mamedov, Nazim [Institute of Physics, Azerbaijan National Academy of Sciences, Baku (Azerbaijan)

    2018-01-15

    Tl L{sub II} and In K X-ray absorption fine structure (XAFS) measurements were performed on a TlInSe{sub 2} thermoelectric material in the temperature range of 25-300 K including the incommensurate-commensurate phase transition temperature of about 135 K. Most of the bond lengths obtained from the present XAFS measurements are in good agreement with existing X-ray diffraction data at room temperature, while only the Tl-Tl correlation shows inconsistent values indicating the commensurate properties of the Tl chains expected from the thermodynamic properties. The present XAFS data clearly support positional fluctuations of the Tl atoms found in three-dimensional atomic images reconstructed from X-ray fluorescence holography. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  17. The effects of chemical and radioactive properties of Tl-201 on human erythrocyte glucose 6-phosphate dehydrogenase activity

    International Nuclear Information System (INIS)

    Sahin, Ali; Senturk, Murat; Ciftci, Mehmet; Varoglu, Erhan; Kufrevioglu, Omer Irfan

    2010-01-01

    Aim: The inhibitory effects of thallium-201 ( 201 Tl) solution on human erythrocyte glucose 6-phosphate dehydrogenase (G6PD) activity were investigated. Methods: For this purpose, erythrocyte G6PD was initially purified 835-fold at a yield of 41.7% using 2',5'-Adenosine diphosphate sepharose 4B affinity gel chromatography. The purification was monitored by sodium dodecyl sulfate-polyacrylamide gel electrophoresis, which showed a single band for the final enzyme preparation. The in vitro and in vivo effects of the 201 Tl solution including Tl + , Fe +3 and Cu +2 metals and the in vitro effects of the radiation effect of the 201 Tl solution and non-radioactive Tl + , Fe +3 and Cu +2 metals on human erythrocyte G6PD enzyme were studied. Enzyme activity was determined with the Beutler method at 340 nm using a spectrophotometer. All purification procedures were carried out at +4 deg. C. Results: 201 Tl solution and radiation exposure had inhibitory effects on the enzyme activity. IC 50 value of 201 Tl solution was 36.86 μl ([Tl + ]: 0.0036 μM, [Cu +2 ]: 0.0116 μM, [Fe +3 ]: 0.0132 μM), of human erythrocytes G6PD. Seven human patients were also used for in vivo studies of 201 Tl solution. Furthermore, non-radioactive Tl + , Fe +3 and Cu +2 were found not to have influenced the enzyme in vitro. Conclusion: Human erythrocyte G6PD activity was inhibited by exposure for up to 10 minutes to 0.057 mCi/kg 201 Tl solution. It was detected in in vitro and in vivo studies that the human erythrocyte G6PD enzyme is inhibited due to the radiation effect of 201 Tl solution.

  18. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...

  19. ORF Alignment: NC_002570 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...

  20. ORF Alignment: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis

  1. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

  2. ORF Alignment: NC_003098 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003098 gi|15902282 >1in4A 3 311 20 328 5e-98 ... ref|NP_357832.1| Branch migration of Holliday structures... [Streptococcus pneumoniae ... R6] gb|AAK99042.1| Branch migration of Holliday ... structures... [Streptococcus pneumoniae R6] pir||F97901 ... branch migration of Holliday structures

  3. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42524871 >1tjlA 27 144 16 133 6e-10 ... ref|NP_970251.1| dnaK deletion s...uppressor protein [Bdellovibrio bacteriovorus HD100] ... emb|CAE78310.1| dnaK deletion suppressor pro

  4. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro

  5. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  6. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  7. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1mgtA 4 167 79 239 2e-25 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletio...n [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  8. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1adn0 1 76 1 75 1e-17 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletion... [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  9. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...

  10. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179784 >1j9iA 1 68 1 68 5e-21 ... ref|YP_216201.1| Gifsy-1 prophage DNA packaging... ... gb|AAX65120.1| Gifsy-1 prophage DNA packaging protein ... [Phage Gifsy-1] ... Length = 68 ... Q

  11. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG

  12. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  13. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  14. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002929 gi|33592330 >1uynX 1 299 352 647 5e-40 ... ref|NP_879974.1| tracheal colonization... factor precursor [Bordetella pertussis Tohama ... I] emb|CAA08832.2| tracheal colonization fac...tor ... [Bordetella pertussis] emb|CAE41497.1| tracheal ... colonization factor precursor [Bor

  15. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|18397761 >1wocC 2 96 2 97 5e-15 ... ref|YP_063428.1| ssb1 [Campylobacter... ... gb|EAL55921.1| single-strand binding protein, putative ... [Campylobacter coli RM2228] gb|AAR29517.1| ssb1

  16. ORF Alignment: NC_003075 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003075 gi|30692533 >3ullA 5 115 1 104 8e-18 ... ref|YP_063478.1| ssb1 [Campylobact...er jejuni] gb|AAR29567.1| ssb1 [Campylobacter ... jejuni] ... Length = 104 ... Query: 31 ... GQDSDVS

  17. ORF Alignment: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003282 gi|17540144 >1n0rA 2 124 89 212 5e-26 ... gb|AAA96093.1| Feminization of xx and xo animals... ... homolog a, FEMinization of XX and XO animals FEM-1 ... (fem-1) [Caenorhabditis elegans] pir||

  18. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004605 gi|28900808 >1l3wA 6 536 1265 1798 3e-11 ... ref|NP_800463.1| putative biofilm...-associated surface protein [Vibrio parahaemolyticus ... RIMD 2210633] dbj|BAC62296.1| putative biofilm

  19. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA

  20. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|15221381 >1bq00 2 77 15 90 4e-20 ... ref|NP_177004.1| gravity-responsive... protein / altered response to gravity protein ... (ARG1) [Arabidopsis thaliana] gb|AAD13758.1| Altere

  1. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  2. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  3. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669839 >1gxlA 2 204 475 685 1e-34 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  4. ORF Alignment: NC_003237 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003237 gi|19075000 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  5. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669839 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus jannaschii ... DSM 2661] gb|AAB99663.1| chromosome segreta

  6. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1| ... acyl-CoA dehydrogenase, ferrulic acid biotransformation ... protein, putative [Pseudomo...ransformation protein, ... putative [Pseudomonas putida KT2440] gb|AAN68958.... NC_002947 gi|26990069 >1u8vA 9 432 4 458 7e-34 ... ref|NP_745494.1| acyl-CoA dehydrogenase, ferrulic acid biot

  7. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24

  8. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

  9. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

  10. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter crescent...us CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...

  11. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most

  12. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

  13. ORF Alignment: NC_000917 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000917 gi|11498546 >1yozA 1 116 1 116 6e-47 ... pdb|1YOZ|B Chain B, Predicted Coding... Region Af0941 From Archaeoglobus Fulgidus ... pdb|1YOZ|A Chain A, Predicted Coding Region Af0941 F

  14. ORF Alignment: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|17561408 >1bor0 2 53 282 342 3e-04 ... ref|NP_757385.1| synoviolin 1 iso...form b [Homo sapiens] gb|AAH30530.1| Synoviolin 1, ... isoform b [Homo sapiens] ... Length = 61

  15. ORF Alignment: NC_006841 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...

  16. ORF Alignment: NC_003228 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...

  17. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604438 >1xvqA 17 163 47 203 4e-07 ... ref|NP_220956.1| SCO2 PROTEIN PRECURSOR (sco2...) [Rickettsia prowazekii str. Madrid E] ... emb|CAA15032.1| SCO2 PROTEIN PRECURSOR (sco2...) ... [Rickettsia prowazekii] pir||F71663 sco2 protein ... precursor (sco2) RP587 - Rickettsia

  18. ORF Alignment: NC_006142 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006142 gi|51473766 >1xvqA 17 163 40 196 7e-07 ... ref|YP_067523.1| Sco2-like prote...in [Rickettsia typhi str. Wilmington] gb|AAU04041.1| ... Sco2-like protein [Rickettsia typhi str. Wil

  19. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56698151 >1wy2A 3 347 27 396 7e-44 ... gb|AAV96554.1| creatinase [Silici...bacter pomeroyi DSS-3] ref|YP_168523.1| ... creatinase [Silicibacter pomeroyi DSS-3] ... Length

  20. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...

  1. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26990378 >1wy2A 3 347 23 393 2e-45 ... ref|NP_745803.1| creatinase [Pseu...domonas putida KT2440] gb|AAN69267.1| creatinase ... [Pseudomonas putida KT2440] ... Length = 3

  2. ORF Alignment: NC_003030 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003030 gi|15895740 >1w3oA 13 174 5 153 2e-30 ... ref|NP_349089.1| Possible 5-Nitroimidazole antibiotics... ... gb|AAK80429.1| Possible 5-Nitroimidazole antibiotics ... resistance protein, NimA-family [Clost...ridium ... acetobutylicum ATCC 824] pir||B97205 probable ... 5-Nitroimidazole antibiotics

  3. ORF Alignment: NC_000964 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B

  4. ORF Alignment: NC_003921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003921 gi|21264213 >1ub4C 1 63 1 63 4e-10 ... gb|AAM39232.1| plasmid stable inheritance... protein I [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644714.1| plasmid stable ... inheritance

  5. ORF Alignment: NC_002946 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002946 gi|59800954 >1ub4B 4 109 2 113 3e-22 ... ref|YP_207666.1| putative plasmid stable inheritance... ... gb|AAW89254.1| putative plasmid stable inheritance ... protein putative phage associated prote

  6. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available pothetical stbA Plasmid stable inheritance protein ... [Photobacterium profundum] ... Length = ... NC_006370 gi|54307287 >1mwmA 2 317 24 344 3e-96 ... ref|YP_128307.1| Hypothetical stbA Plasmid stable inherita...nce protein ... [Photobacterium profundum SS9] emb|CAG18505.1| ... Hy

  7. ORF Alignment: NC_003921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003921 gi|21264212 >1m1fA 1 109 2 110 1e-34 ... gb|AAM39231.1| plasmid stable inheritance... protein K [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644713.1| plasmid stable ... inheritance

  8. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45358156 >1wcv1 4 241 4 235 5e-21 ... ref|NP_987713.1| walker type ATPas...e [Methanococcus maripaludis S2] emb|CAF30149.1| ... walker type ATPase [Methanococcus maripaludis S2

  9. ORF Alignment: NC_004547 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004547 gi|50121646 >1kmoA 14 661 37 705 8e-56 ... ref|YP_050813.1| exogenous ferri...c siderophore TonB-dependent receptor [Erwinia ... carotovora subsp. atroseptica SCRI1043] emb|CAG75622.1| ... exogenou

  10. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003305 gi|17937619 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

  11. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003063 gi|15891046 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

  12. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002927 gi|33603734 >1kmoA 3 661 60 754 2e-50 ... ref|NP_891294.1| exogenous ferric... siderophore receptor [Bordetella bronchiseptica ... RB50] gb|AAB51774.1| exogenous ferric siderophor...e ... receptor emb|CAE35124.1| exogenous ferric siderophore ... receptor [Bordetella bronchise

  13. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...

  14. ORF Alignment: NC_005861 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005861 gi|46446610 >1f39A 5 95 55 141 1e-16 ... ref|YP_007975.1| probable SOS mutagenesis... and repair protein UmuD [Parachlamydia sp. ... UWE25] emb|CAF23700.1| probable SOS mutagenesis

  15. ORF Alignment: NC_005070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005070 gi|33865578 >1f39A 4 97 54 143 4e-22 ... ref|NP_897137.1| putative SOS mutagenesis... protein UmuD [Synechococcus sp. WH 8102] ... emb|CAE07559.1| putative SOS mutagenesis protein

  16. ORF Alignment: NC_003233 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003233 gi|19074284 >1ltlE 10 233 29 251 7e-31 ... emb|CAD25394.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM5 ... [Encephalitozoon cuniculi GB-M1] ref|NP_585790.1| DNA ... REPLICATION

  17. ORF Alignment: NC_003236 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003236 gi|19074669 >1ewiA 5 113 54 161 1e-18 ... emb|CAD25779.1| DNA REPLICATION F...ACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PROT

  18. ORF Alignment: NC_003238 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003238 gi|19173253 >1a5t0 17 316 29 298 4e-25 ... emb|CAD27104.1| REPLICATION FACT...OR C (ACTIVATOR 1) 37kDa SUBUNIT [Encephalitozoon ... cuniculi GB-M1] ref|NP_597056.1| REPLICATION FA

  19. ORF Alignment: NC_003238 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003238 gi|19173256 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  20. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)

  1. ORF Alignment: NC_003238 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003238 gi|19173256 >1ltlE 44 240 100 302 2e-23 ... emb|CAD27107.1| DNA REPLICATION... LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  2. ORF Alignment: NC_003364 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003364 gi|18312259 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

  3. ORF Alignment: NC_003236 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003236 gi|19074669 >1jmcA 1 238 213 445 1e-62 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

  4. ORF Alignment: NC_005787 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005787 gi|45198873 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  5. ORF Alignment: NC_002607 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002607 gi|15791012 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

  6. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17987645 >1j1vA 4 94 20 109 8e-10 ... gb|AAL52543.1| CHROMOSOMAL REPLICATION... INITIATOR PROTEIN DNAA [Brucella melitensis ... 16M] ref|NP_540279.1| CHROMOSOMAL REPLICATION IN

  7. ORF Alignment: NC_003229 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003229 gi|19074034 >1ltlE 2 242 49 290 7e-40 ... emb|CAD25144.1| DNA REPLICATION L...ICENSING FACTOR OF THE MCM FAMILY (MCM4) ... [Encephalitozoon cuniculi GB-M1] ref|NP_584640.1| DNA ... REPLICATION

  8. ORF Alignment: NC_003236 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003236 gi|19074669 >1l1oC 2 175 456 623 1e-43 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

  9. ORF Alignment: NC_003229 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003229 gi|19073988 >1a5t0 2 324 6 283 2e-17 ... emb|CAD25098.1| DNA REPLICATION FA...CTOR (ACTIVATOR 1) 36 kDa SUBUNIT ... [Encephalitozoon cuniculi GB-M1] ref|NP_584594.1| DNA ... REPLICATION

  10. ORF Alignment: NC_003232 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION

  11. Stepping Motor - Hydraulic Motor Servo Drives for an NC Milling ...

    African Journals Online (AJOL)

    In this paper the retrofit design of the control system of an NC milling machine with a stepping motor and stepping motor - actuated hydraulic motor servo mechanism on the machines X-axis is described. The servo designed in the course of this study was tested practically and shown to be linear - the velocity following errors ...

  12. ORF Alignment: NC_000117 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000117 gi|15605324 >1jgmA 39 326 7 260 4e-33 ... ref|NP_220110.1| PHP superfamily hydrolase [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68196.1| PHP... ... trachomatis D/UW-3/CX] pir||G71494 probable php ... hydrolase - Chlamydia trachomatis (sero

  13. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...

  14. ORF Alignment: NC_006582 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006582 gi|56962048 >1sd4A 2 99 6 103 1e-24 ... ref|YP_173770.1| methicillin resist...ance regulatory protein MecI [Bacillus clausii ... KSM-K16] dbj|BAD62809.1| methicillin resistance ...

  15. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...

  16. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13472874 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  17. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006177 gi|51893967 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  18. ORF Alignment: NC_002967 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002967 gi|42528039 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  19. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792055 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  20. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31793631 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION