Challenges to and proposals for underground gas storage (UGS business in China
Directory of Open Access Journals (Sweden)
Gangxiong Zhang
2017-05-01
Full Text Available Underground gas storage (UGS is one of the major storage and peak-shaving means in the world among numerous storage ways via gas fields, small-scale LNG, etc. With the rapid development of natural gas industry in China, the seasonal peak-shaving issues are increasingly prominent, so how to achieve sustainable development of UGS business has become a major problem at present. In view of this, we studied the present status and trend of UGS development abroad and analyzed the following challenges encountered by UGS in China. (1 UGS construction falls behind the world and peak-shaving capacity is insufficient. (2 There is lack of quality gas sources for storage and the complicated geological conditions make the cost of UGS construction high. (3 UGS construction is still at the preliminary stage, so experience is not enough in safety and scientific operation and management. (4 UGS construction, management and operation are not unified as a whole, so its maximum efficiency fails to be exerted. (5 The economic benefit of UGS is difficult to be shown without independent cost accounting. Based on the experience of other countries, some proposals were put forward on UGS development under the actual present situation: to strengthen strategic UGS layout, intensify storage site screening in key areas and steadily promote UGS construction; to establish professional UGS technical and management teams and intensify the research of key technologies; and to set up a complete and rationally-distributed UGS construction, operation and management system.
The neutron diffraction of molten TlCl, TlBr, and TlI
International Nuclear Information System (INIS)
Satow, T.; Uemura, O.; Hoshino, K.; Watanabe, T.
1984-01-01
Structure factors S(K) for liquid TlCl, TlBr, and TlI are determined by neutron diffraction measurements. Atomic radial distribution functions (RDF) derived from S(K) are presented. All RDF values are slightly smaller than those of their solid state counter parts. Results show that TlX has a tendency not to retain cesium-chloride type local order, but to take sodium-chloride type order when melting
46 CFR 54.01-35 - Corrosion (modifies UG- 25).
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Corrosion (modifies UG- 25). 54.01-35 Section 54.01-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING PRESSURE VESSELS General Requirements § 54.01-35 Corrosion (modifies UG- 25). (a) Vessels or portions of vessels subject to...
Doped Tl-1212 and Tl-1223 superconductors
International Nuclear Information System (INIS)
Eder, M.H.
2001-09-01
This work describes the preparation and characterization of thallium-lead-strontium-barium-calcium-(uranium)-copperoxide (Tl-1212, Tl-1223) high-temperature superconductors. The precursors were prepared via nitrate method. After calcination the oxidic powders were mixed with stoichiometric amounts of an Tl 2 O 3 , PbO, Er 2 O 3 and Gd 2 O 3 by milling and afterwards uniaxial compressed. Sintering was carried out in silver foils. X-ray diffractometry and high-resolution microscopy in combination with scanning electron microscopy (including EDAX) were used to study the influence of varying thallium/lead-, strontium/barium-, calcium/rare earth element ratios and the effect of uranium on the phase composition and microstructure of bulk superconductors. Furthermore the influence of the composition on the electrical and magnetical properties was studied. On phase pure Tl-1212 and Tl-1223 superconductors NMR-measurements were done. Small amounts of gadolinium and erbium instead of calcium and excess-uranium have a positive impact on the electrical and magnetical properties of the Tl-1223 superconductors. Higher amounts of these doping elements favor the Tl-1212 phase. Tl-1212 superconductors with varying thallium/lead- strontium/barium- and calcium/gadolinium ratios were prepared phasepure in wide range of doping. Transition temperatures up to 96 K were achieved. It was shown that lead has an oxidation number of +4 and thallium of +3. (author)
Spectrophotometric determination of Tl carrier in 201Tl-TlCl injection
International Nuclear Information System (INIS)
Gong Quansheng; Jing Lie
1997-01-01
A simple and sensitive method for the spectrophotometric determination of carrier content (Thallium) in 201 Tl-TlCl injection is described. Thallium (I) is oxidised to Thallium (III) by aqueous bromine, then excess bromine is removed by adding sulfosalicylic acid. In buffer solution (NH 4 Cl-NH 4 OH) at pH 11.7 with the presence of emulsifier OP, thallium (III) and cadion form a complex having an absorption maximum at 469 nm with a molar absorptivity of 1.37 x 10 4 m 2 /mol. Beer's law is obeyed in the concentration range of 0-7 μg/5 mL. The effect of impurity elements in 201 Tl-TlCl injection is examined. It is an ideal method for the analysis of radioactive solution
Converting Hg-1212 to Tl-2212 via Tl-Hg cation exchange in combination with Tl cation intercalation
International Nuclear Information System (INIS)
Zhao Hua; Wu, Judy Z
2007-01-01
In a cation exchange process developed recently for epitaxy of HgBa 2 CaCu 2 O 6 (Hg-1212) thin films, TlBa 2 CaCu 2 O 7 (Tl-1212) or Tl 2 Ba 2 CaCu 2 O 9 (Tl-2212) precursor films were employed as the precursor matrices and Hg-1212 was obtained by replacing Tl cations on the precursor lattice with Hg cations. The reversibility of the cation exchange dictates directly the underlying mechanism. Following our recent success in demonstrating a complete reversibility within '1212' structure, we show the conversion from Hg-1212 to Tl-2212 can be achieved via two steps: conversion from Hg-1212 to Tl-1212 followed by Tl intercalation to form double Tl-O plans in each unit cell. The demonstrated reversibility of the cation exchange process has confirmed the process is a thermal perturbation of weakly bonded cations on the lattice and the direction of the process is determined by the population ratio between the replacing cations and that to be replaced
Applications of Universal Grammar (UG) in the ESL/EFL Classroom
Kirkwold, Lorne O.
2007-01-01
The article proposes Stern's (1983) framework for classifying issues related to instruction in order to ascertain the relevance of Universal Grammar (UG) in the ESL/EFL classroom. Discussed in this article, particularly as UG pertains to them, are issues related to: (a) L1 transfer; (b) teaching rules and giving error correction versus presenting…
Superconducting transition in TlBiTe/sub 2/ and TlTe compounds
Energy Technology Data Exchange (ETDEWEB)
Kantser, V G; Popovich, N S; Sidorenko, A S
1985-10-01
On the basis of zone structure calculation for TlBiTe/sub 2/ and TlTe it is found that TlBiTe/sub 2/ is a narrow-gap semiconductor and TlTe is a p-metal. At Tsub(c)=0.19 K TlTe is found to experience the superconducting transition. In TlBiTe/sub 2/ superconductivity is not observed to occur up to 0.05 K, since there is a possibility of occupying the high density of states zones because they are remote from actual ones. The earlier discovered superconducting transition in TlBiTe/sub 2/ is inherent in the alien phase of TlTe.
Wanger, Tim; Scheich, Henning; Ohl, Frank W; Goldschmidt, Jürgen
2012-07-01
The potassium (K(+)) analogue thallium (Tl(+)) can be used as a tracer for mapping neuronal activity. However, because of the poor blood-brain barrier (BBB) K(+) -permeability, only minute amounts of Tl(+) enter the brain after systemic injection of Tl(+) -salts like thallium acetate (TlAc). We have recently shown that it is possible to overcome this limitation by injecting animals with the lipophilic chelate complex thallium diethyldithiocarbamate (TlDDC), that crosses the BBB and releases Tl(+) prior to neuronal or glial uptake. TlDDC can thus be used for mapping CNS K(+) metabolism and neuronal activity. Here, we analyze Tl(+) -kinetics in the rodent brain both experimentally and using simple mathematical models. We systemically injected animals either with TlAc or with TlDDC. Using an autometallographic method we mapped the brain Tl(+) -distribution at various time points after injection. We show that the patterns and kinetics of Tl(+) -redistribution in the brain are essentially the same irrespective of whether animals have been injected with TlAc or TlDDC. Data from modeling and experiments indicate that transmembrane Tl(+) -fluxes in cells within the CNS in vivo equilibrate at similar rates as K(+) -fluxes in vitro. This equilibration is much faster than and largely independent of the equilibration of Tl(+) -fluxes across the BBB. The study provides further proof-of-concept for the use of TlDDC for mapping neuronal activity and CNS K(+) -metabolism. A theoretical guideline is given for the use of K(+) -analogues for imaging neuronal activity with general implications for the use of metal ions in neuroimaging. © 2012 The Authors. Journal of Neurochemistry © 2012 International Society for Neurochemistry.
46 CFR 54.10-10 - Standard hydrostatic test (modifies UG-99).
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Standard hydrostatic test (modifies UG-99). 54.10-10... PRESSURE VESSELS Inspection, Reports, and Stamping § 54.10-10 Standard hydrostatic test (modifies UG-99). (a) All pressure vessels shall satisfactorily pass the hydrostatic test prescribed by this section...
Analytical Review of Universal Grammar (UG) Approach on Second Language Acquisition (SLA)
Irwandy
2015-01-01
The aim of this paper is to explore the analysis of Universal Grammar (UG) approach on Second Language Acquisition (SLA). This paper is significant as the sources for teacher or researcher of the second language since this elaboration is deeply focusing on the use of UG on SLA. The method used in this academic writing is inductive method of…
ASDEX-UG. ASDEX upgrade project proposal. Phase 2
International Nuclear Information System (INIS)
1983-05-01
The objective of ASDEX UG is to investigate the problems relating to tokamak divertor physics and the boundary layer of hot plasmas which cannot be covered otherwise by either ASDEX or other EUROPEAN tokamaks, including JET, but whose investigation is indispensable for NET and INTOR. The configuration of ASDEX UG is changed as compared with ASDEX due to the requirement that all poloidal field coils are located outside the toroidal field magnet. This leads to a highly elongated D-shaped plasma with an ''open'' divertor, which does not allow to close the divertor chamber by such simple means as in ASDEX. In section 2, the aims of ASDEX UG are repeated briefly and the essential features and parameters of the tokamak system are summarized. The summary includes an overview of the tokamak design, the time schedule of design and construction concluding with the estimated investment cost and manpower required. In section 3 the tokamak system components are treated. The circuits and energy supply for the different electrical components are described in section 4. Auxiliary heating requirements and methods are discussed in section 5. Section 6 presents a survey over the periphery of the tokamak system including preparation of the building and radiation shielding. Section 7 outlines the physical programme. Section 8 is devoted to diagnostics. Finally, the principal concepts for control, data acquisition and handling are outlined in section 9. (orig./AH)
International Nuclear Information System (INIS)
Obata, Y.; Matsudaira, Y.; Hasegawa, H.; Tamaki, H.; Takahashi, T.; Morita, A.; Kasai, K.
1993-01-01
As a result of abnormal development of the thymus of these mice, TCR αβ lineage of the T cell differentiation is disturbed and cells belonging to the TCR γδ CD4 - CD8 - double negative (DN) lineage become preponderant. The γδ DN cells migrate into peripheral lymphoid organs and constitute nearly 50% of peripheral T cells. Immune function of the transgenic mice is severely impaired, indicating that the γδ cells are incapable of participating in these reactions. Molecular and serological analyses of T-cell lymphomas reveal that they belong to the γδ lineage. Tg.Tla a -3-1 mice should be useful in defining the role of TL in normal and abnormal T cell differentiation as well as in the development of T-cell lymphomas, and further they should facilitate studies on the differentiation and function of γδ T cells. We isolated T3 b -TL gene from B6 mice and constructed a chimeric gene in which T3 b -TL is driven by the promoter of H-2K b . With the chimeric gene, two transgenic mouse strains, Tg. Con.3-1 and -2 have been derived in C3H background. Both strains express TL antigen in various tissues including skin. The skin graft of transgenic mice on C3H and (B6 X C3H)F 1 mice were rejected. In the mice which rejected the grafts, CD8 + TCRαβ cytotoxic T cells (CTL) against TL antigens were recognized. The recognition of TL by CTL did not require the antigen presentation by H-2 molecules. The results indicated that TL antigen in the skin becomes a transplantation antigen and behaves like a typical allogeneic MHC class I antigen. The facts that (B6 X C3H)F 1 mice rejected the skin expressing T3 b -TL antigen and induced CTL that killed TL + lymphomas of B6 origin revealed that TL antigen encoded by T3 b -TL is recognized as non-self in B6 mice. Experiments are now extended to analyze immune responses to TL antigen expressed on autochthonous T cell lymphomas. (J.P.N.)
Solid solutions of thallium in TlGaSe2, TlGaS2, and TlInS2
International Nuclear Information System (INIS)
Voroshilov, Yu. V.; Potorii, M.V.; Shevchenko, S.V.
1986-01-01
The authors study the nature of the dissolution of thallium in ternary phases. They have synthesized alloys of the stoichiometric compositions TlGaS 2 , TlGaSe 2 , and T1InS 2 , and their solid solutions, maximally enriched in thallium, the compositions of which were Tl /SUB 1.34/ GA /SUB 0.89/ S 2 , Tl /SUB 1.31/ Ga /SUB 0.90/ Se 2 , and Tl /SUB 1.15/ In /SUB 0.95/ S /SUB 2./ . Samples were synthesized from the elemental components of the following purities: gallium of V4 grade; indium of V4 grade; thallium of T1000 grade; selenium of special purity 22-4 grade, and sulfur of special purity garde. The compositions were checked by x-ray-phase-(DRON-0.5) and microstructural-analyses with simultaneous determination of the density and microhardness of the samples. It is found that the lattic parameter increases and the increase in the density and microhardness points to strengthening of the structure during the formation of the solid solutions
Tl Cuprate Superconductors Studied by XPS
Energy Technology Data Exchange (ETDEWEB)
Vasquez, R. P. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109-8099 (United States); Siegal, M. P. [Sandia National Laboratories, Albuquerque, NM 87185-1421 (United States); Overmyer, D. L. [Sandia National Laboratories, Albuquerque, NM 87185-1421 (United States); Ren, Z. F. [Department of Chemistry, State University of New York, Buffalo, NY 14260-3000 (United States); Lao, J. Y. [Department of Chemistry, State University of New York, Buffalo, NY 14260-3000 (United States); Wang, J. H. [Department of Chemistry, State University of New York, Buffalo, NY 14260-3000 (United States)
1999-07-01
XPS measurements on epitaxial thin films of the Tl cuprate superconductors Tl2Ba2CaCu2O8, Tl2Ba2Ca2Cu3O10, and Tl0.78Bi0.22Ba0.4Sr1.6Ca2Cu3O9-{delta} are presented. These data, together with previous measurements in this lab on Tl2Ba2CuO6-{delta} and TlBa2CaCu2O7-{delta}, comprise a comprehensive data set for comparison of Tl cuprates in which the number of Tl-O and Cu-O layers, and hence the chemical and electronic properties, vary. (c) 2000 American Vacuum Society.
Tl Cuprate Superconductors Studied by XPS
International Nuclear Information System (INIS)
Vasquez, R. P.; Siegal, M. P.; Overmyer, D. L.; Ren, Z. F.; Lao, J. Y.; Wang, J. H.
1999-01-01
XPS measurements on epitaxial thin films of the Tl cuprate superconductors Tl2Ba2CaCu2O8, Tl2Ba2Ca2Cu3O10, and Tl0.78Bi0.22Ba0.4Sr1.6Ca2Cu3O9-δ are presented. These data, together with previous measurements in this lab on Tl2Ba2CuO6-δ and TlBa2CaCu2O7-δ, comprise a comprehensive data set for comparison of Tl cuprates in which the number of Tl-O and Cu-O layers, and hence the chemical and electronic properties, vary. (c) 2000 American Vacuum Society
(Tl, Sb) and (Tl, Bi) binary surface reconstructions on Ge(111) substrate
Gruznev, D. V.; Bondarenko, L. V.; Tupchaya, A. Y.; Yakovlev, A. A.; Mihalyuk, A. N.; Zotov, A. V.; Saranin, A. A.
2018-03-01
2D compounds made of Group-III and Group-V elements on the surface of silicon and germanium attract considerable attention due to prospects of creating III-V binary monolayers, which are predicted to hold advanced physical properties. In the present work, we have investigated two such systems, (Tl, Sb)/Ge(111) and (Tl, Bi)/Ge(111) using scanning tunneling microscopy, low energy electron diffraction observations and density-functional-theory calculations. In addition to the previously reported surface structures of 2D (Tl, Sb) and (Tl, Bi) compounds on Si(111), we found new ones, namely, √{ 7} × √{ 7} and 3 × 3. Formation processes and plausible models of their atomic arrangements are discussed.
Isotopic exchange in a neutron-irradiated mixed-valence compound: Tl3(I) Tl(III)Cl6
International Nuclear Information System (INIS)
Fernandez Valverde, S.; Duplatre, G.
1977-01-01
The initial distribution of Tl(I) and Tl(III) species, and its change on heating, have been investigated in solid thermal neutron-irradiated Th 4 Cl 6 . An initial ratio of 5/1 for 204 Tl(I)/ 204 Tl(III) is found and this remains constant for integral gamma-doses of 3 to 12 MRad. The variation of the 204 Tl(III) fraction with temperature is found identical to that observed in labelled Tl 4 Cl 6 for which a genuine isotopic exchange has previously been described. It is concluded that the recoil species are rapidly converted, after the recoil processes, into stable ions
Development of low background CsI(Tl) and NaI(Tl) crystals for WIMP search
Energy Technology Data Exchange (ETDEWEB)
Lee, Hyun Su [Department of Physics, Ewha Womans University, Seoul 120-750 (Korea, Republic of)
2015-08-17
We have developed low background CsI(Tl) and NaI(Tl) crystals to search for weakly interacting massive particles as well as to verify the origin of the annual modulation signal observed by the DAMA/LIBRA experiment. Extensive studies about the contamination mechanisim of {sup 137}Cs in CsI powder lead to the growth of ultra-low-background CsI(Tl) crystals. Similar approaches for NaI(Tl) crystals have been applied to reduce internal backgrounds to less than 0.5 counts/kg/day/keV. Status and understanding of backgrounds and background reduction in NaI(Tl) crystals will be discussed.
Creation of second order magnetic barrier inside chaos created by NTMs in the ASDEX UG
Ali, Halima; Punjabi, Alkesh
2012-10-01
Understanding and stabilization of neoclassical tearing modes (NTM) in tokamaks is an important problem. For low temperature plasmas, tearing modes are believed to be mainly driven by current density gradient. For collisionless plasmas, even when plasma is stable to classical tearing modes, helical reduction in bootstrap current in O-point of an island can destabilize NTMs when an initial island is seeded by other global MHD instabilities or when microturbulence triggers the transition from a linear to nonlinear instability. The onset of NTMs leads to the most serious beta limit in ASDEX UG tokamak [O. Gubner et al 2005 NF 39 1321]. The important NTMs in the ASDDEX UG are (m,n)=(3,2)+(4,3)+(1,1). Realistic parameterization of these NTMs and the safety factor in ASDEX UG are given in [O. Dumbrajs et al 2005 POP 12 1107004]. We use a symplectic map in magnetic coordinates for the ASDEX UG to integrate field lines in presence of the NTMs. We add a second order control term [H. Ali and A. Punjabi 2007 PPCF 49 1565] to this ASDEX UG field line Hamiltonian to create an invariant magnetic surface inside the chaos generated by the NTMs. The relative strength, robustness, and resilience of this barrier are studied to ascertain the most desirable noble barrier in the ASDEX UG with NTMs. We present preliminary results of this work, and discuss its implications with regard to magnetic transport barriers for increasing strength of magnetic perturbations. This work is supported by the grants DE-FG02-01ER54624 and DE-FG02-04ER54793.
Putting Ug99 on the map: An update on current and future monitoring
DEFF Research Database (Denmark)
Hodson, D P; Nazari, K; Park, R F
2011-01-01
Detection of stem rust race TTKSK (Ug99) from Uganda in 1998/99 highlighted not only the extremely high vulnerability of the global wheat crop to stem rust but also a lack of adequate global systems to monitor such a threat. Progress in the development and expansion of the Global Cereal Rust...... Monitoring System (GCRMS) is described. The current situation regarding the Ug99 lineage of races is outlined and the potential for expansion into important wheat areas is considered. The GCRMS has successfully tracked the spread and changes that are occurring within the Ug99 lineage and is now well...... capacity for race analysis is seen to be critical and integration of the Global Rust Reference Centre into the stem rust monitoring network is seen as a positive development. The current acute situation with severe epidemics of stripe rust in many countries indicates a clear need for more effective global...
International Nuclear Information System (INIS)
Fernandes, L.; Silva, C.P.G. da.
1991-09-01
The radiopharmaceutical 201 TlCl is used in Nuclear medicine for myocardial visualization. The solution of 201 TlCl was prepared using 201 Tl obtained by irradiating a natural mercury target with protons. This radionuclide was subjected to different quality control processes to verify the purity required for its use in Medicine. Some of these controls concerned the determination of 200 Tl, 201 Tl and 202 Tl; the chemical identification of 201 Tl +1 ; the hydrazine concentration, mercury contamination and the presence of phosphate. Furthermore, the biologic distribution in Wistar rats and tests for sterility, pyrogens and for toxicity were carried out. It was verified that the solution obtained was in the form of thallous chloride. This radiopharmaceutical can give a good heart image in animals but due to the contamination of 201 Tl with 200 Tl and 202 Tl its use in human beings is not possible unless enriched 202 Hg is used as target of irradiation. (author)
Spectral measurements of loess TL
International Nuclear Information System (INIS)
Rendell, H.M.; Mann, S.J.; Townsend, P.D.
1988-01-01
Variations in thermoluminescence (TL) glow curves are reported for two loess samples when examined with broad band filters in the range 275-650 nm. Samples show striking differences in bleaching behaviour, when their TL emissions are observed in the u.v., blue, green and yellow spectral regions. The age estimates, given by the equivalent dose (ED) values, differ by up to a factor of two for analyses using the green and u.v. TL signals. These ED values also vary with prolonged room temperature storage between the bleaching and irradiation steps. The anomalies in the bleaching behaviour are interpreted in terms of changes in TL efficiency. The results have major implications for the regeneration method of TL dating for these fine-grained sediments and suggest that reliable dates obtained by it may be fortuitous. (author)
207Pb and 205Tl NMR on Perovskite Type Crystals APbX3 (A = Cs, Tl, X = Br, I)
Sharma, Surendra; Weiden, Norbert; Weiss, Alarich
1987-11-01
By 205Tl and 207Pb NM R the chemical shift in polycrystalline samples of binary halides AX, BX2 and ternary halides ABX3 (A = Cs, Tl; B = Pb; X = Br, I) was studied at room temperature. The chemical shift tensors δ ( 205Tl) and δ (207Pb) were determined in magnitude and orientation on single crystals of the orthorhombic TlPbI3. The components of the δ(205Tl) tensor are δx (205Tl) || a = 611ppm; δy (205Tl) || b = 680 ppm; δZ(205Tl) || c = 1329 ppm; δiso(205Tl) = 873.3 ppm (with respect to 3.4 molar aqueous solution of TlOOCCH3). The chemical shift tensor of 207Pb in TlPbI3 shows two orientations. One of them is: δx (207Pb) = 3760 ppm, inclined 30° from b towards c, δy(207Pb) || a = 3485 ppm, δz(207Pb) = 2639 ppm inclined 120° from b towards c. δiso(207Pb) = 3295 ppm (with respect to saturated aqueous solution of Pb(NO3)2). The results are discussed with respect to the crystal structure and a model to explain orientation and anisotropy of the tensors δ(205Tl) and δ(207Pb) in TlPbI3 is proposed. In the system CsPbBr3-x Ix δ(207Pb) was studied on polycrystalline samples. The chemical shift increases with increasing x and negative excess shift is observed.
Energy Technology Data Exchange (ETDEWEB)
Barchiy, I.E.; Tatzkar, A.R. [Department of Chemistry, Uzhgorod National University, Pidgirna St., 46, Uzhgorod 88000 (Ukraine); Fedorchuk, A.O. [Department of Inorganic and Organic Chemistry, Lviv National University of Veterinary Medicine and Biotechnologies, Pekarska St., 50, Lviv 79010 (Ukraine); Plucinski, K., E-mail: kpluc2006@wp.pl [Electronics Department, Military University Technology, Warsaw, Kaliskiego 2, Warsaw 00-908 (Poland)
2016-06-25
Phase relation in the Tl{sub 4}SnSe{sub 4}–TlSbSe{sub 2}–Tl{sub 2}SnSe{sub 3} quasiternary system were studied by the DTA and X-ray diffraction in combination with mathematical modeling. The phase diagrams of the Tl{sub 4}SnSe{sub 4}–TlSbSe{sub 2} and Tl{sub 2}SnSe{sub 3}–TlSbSe{sub 2} systems, the perspective views of the phase interaction in the ternary system, the liquidus surface projection, the isothermal section at 423 K were built for the first time. The Tl{sub 4}SnSe{sub 4}–TlSbSe{sub 2}–Tl{sub 2}SnSe{sub 3} system is of the invariant eutectic type and is characterized by the formation of limited solid solutions following initial ternary compounds. New complex compounds are not formed. - Highlights: • Two Tl{sub 4}SnSe{sub 4}–TlSbSe{sub 2},Tl{sub 2}SnSe{sub 3}–TlSbSe{sub 2} systems were explored. • Invariant processes in the ternary system were determined. • New complex compounds were not observed in ternary system.
Thallium (Tl) sorption onto illite and smectite: Implications for Tl mobility in the environment
Martin, Loïc A.; Wissocq, Aubéry; Benedetti, M. F.; Latrille, Christelle
2018-06-01
Clay minerals play a relevant role in the transport and fate of trace elements in the environment. Though illite has been referred as an important Thallium (Tl) bearing phase in soils, mechanisms and affinity of thallium for clay minerals remain poorly known. This study investigated the sorption behavior of thallium as Tl(I) onto illite and smectite, two clay minerals occurring mainly in soils and sediments. Different sorption experiments were carried out under various pH conditions and Tl concentrations, in competition with sodium and calcium at a constant ionic strength of 0.01 mol L-1. Our results showed that illite displayed more affinity than smectite for thallium. With illite, the distribution coefficients (Kd in L kg-1) varied between 102.75 ± 0.17 and 104.0 ± 0.17 in Na solutions versus between 102.25 ± 0.17 and 103.0 ± 0.17 in Ca solutions, depending on pH. With smectite, Kd (in L kg-1) ranged between 102.50 ± 0.16 and 103.20 ± 0.16 and between 101.25 ± 0.16 and 101.95 ± 0.16 in Na and Ca solutions, respectively. Sorption behavior was described with the Multi-Site Ion Exchanger model and selectivity coefficients with respect to protons were calculated for the first time. In all cases, independently of clay mineral and background electrolyte, low capacity but highly reactive sites were dominant in thallium uptake, highlighting Tl affinity for those sites. Moreover, the exchangeable and reversible interactions between Tl+ and clays reactive sites suggested that in changing conditions, thallium could be released in solution. The role of clay minerals in thallium environmental cycle is evident and confirmed illite to be a dominant Tl bearing phase, in some environment competing with manganese oxides. Compared to others Tl bearing mineral phases, clays are ranked as follows: MnO2 > illite > smectite ∼ ferrihydrite ≥ Al2O3 ∼ goethite > SiO2. Finally, over the three monovalent cations (Tl, Rb, Cs) Tl is the one less sorbed on illite independently of
Rachunek kosztów działańjako podstawa wyceny usług
Directory of Open Access Journals (Sweden)
Gertruda Krystyna Świderska
2009-03-01
Full Text Available Artykuł prezentuje wykorzystanie rachunku kosztów działań do wyceny usług na trzech rynkach podlegających centralnym regulacjom – rynku usług pocztowych, telekomunikacyjnych oraz świadczeń zdrowotnych. Doświadczenia krajów Unii Europejskiej (w tym Polski pokazują nowe obszary wykorzystania rachunku kosztów działań. Potwierdzają, że zastosowanie tego narzędzia pozwala na kontrolę kosztów ponoszonych przy świadczeniu usług oraz wycenę na podstawie rzeczywistego rachunku ekonomicznego. Takie podejście gwarantuje przejrzystość procesu wyceny na rynkach, na których odgrywa to szczególnie istotną rolę. W części pierwszej przedstawiono zarys koncepcji rachunku kosztów działań wykorzystanej w PPUP Poczta Polska. Scharakteryzowano zastosowane rozwiązanie dostosowane do specyfiki działań poczty, zawierające elementy obiektowego rachunku kosztów działań oraz rachunku kosztów działań sterowanego czasem. W części drugiej zaprezentowano zastosowanie koncepcji rachunku kosztów działań do wyceny świadczonych usług w British Telecom. Wykorzystanie właściwych nośników kosztów pozwala na prawidłowe przypisanie kosztów obiektom je generującym. W części trzeciej opisano doświadczenia krajów Unii Europejskiej w zakresie stosowania rachunku kosztów działań do wyceny świadczeń medycznych. Stanowią one przesłankę dla wdrożenia tej koncepcji do wyceny usług zdrowotnych na rynku polskim.
International Nuclear Information System (INIS)
Fernandes, L.; Silva, C.P.G. da
1991-01-01
The radiopharmaceutical sup(201) TlCl is used in Nuclear Medicine for myocardial visualization. The solution of sup(201)TlCl was prepared using sup(201)Tl obtained by irradiating a natural mercury target with protons. This radionuclide was subjected to different quality control processes to verify the purity required for its use in Medicine. Some of these controls concerned the determination of sup(200)Tl, sup(201)Tl and sup(202)Tl; the chemical identification of sup(201)Tl sup(+1); the hydrazine concentration, mercury contamination and the presence of phosphate. Furthermore, the biologic distribution in Wistar rats and tests for sterility pyrogens and for toxicity were carried out. It was verified that the solution obtained was in the form of tallous chloride. This radiopharmaceutical can give a good heart image in animals but due to the contamination of sup(201)Tl with sup(200)Tl and sup(202)Tl its use in human beings is not possible unless enriched sup(202)Hg is used as target of irradiation. (author)
TL dosimetric properties BAM:EU
International Nuclear Information System (INIS)
Rao, Bellam N.; Murthy, K.V.R.; Subba Rao, B.; Saiprasad, A.S.
2011-01-01
In phosphor area today top priority is the replacement of the high performance but very expensive rare earth activated phosphors with cheaper materials. This essentially means replacing the rare earth ions with transition metal ions or post transition ions. Now a day's phosphors are used in various fields. After World War II, the advances in the optical spectroscopy of solids, especially those of transition metals ions help to evolve research on phosphor and solid state luminescence. In 1960 efficient rare earth activated phosphors were developed for use in color TV (Tb 3+ green, Eu 3+ red, and Dy 3+ yellow). In 1970 tricolor lamp was introduced blue emission from Ce 3+ + Tb 3+ pair was used in tricolor lamps. At present combination of halo phosphor and tri-band phosphor blend is used in many lamp as a compromise between performance, phosphor cost and the lamp making Cost. Thermo luminescence of 0.5 Gy X-ray irradiated BAM.Eu has been studied. The irradiated phosphor has been studied for its TL dosimetric properties one week after irradiation and after 100 weeks of storage. Interesting TL results are reported in the present paper. Heating rate used in the present experiment is 6.6 deg C/Sec. The following two figures are on TL recorded 100 weeks after irradiation and TL recorded after 235 weeks of storage. Before storage for 100 weeks the TL glow curve with a hump around 180 deg C followed by a peak at 273 deg C. After storage for 100 weeks the TL pattern changes entirely. i.e. the composite TL peak structure emerged as two well resolved peaks and with slightly higher TL peak temperatures at 215 deg C and 300 deg C. Normally after storage for 100 weeks the peak at 190 deg C reduces in its intensity or disappears in some cases, instead of that the peak appears at 215 deg C as well resolved peak and its intensity is almost comparable to that of 300 deg C peak. Since the TL phenomenon observed is interesting the two well resolved, isolated, high intensity peaks
Prolate yrast cascade in 183Tl
International Nuclear Information System (INIS)
Reviol, W.; Carpenter, M. P.; Janssens, R. V. F.; Jenkins, D.; Toth, K. S.; Bingham, C. R.; Riedinger, L. L.; Weintraub, W.; Cizewski, J. A.; Lauritsen, T.
2000-01-01
The yrast sequence in 183 Tl has been studied for the first time in recoil-mass selected γ-ray spectroscopic measurements. A rotational-like cascade of seven transitions is established down to the band head with probable spin and parity (13/2 + ). Unlike in the adjacent odd-mass Tl nuclei, prompt γ decay from the yrast band to a lower lying weakly deformed (oblate) structure is not observed. These features are consistent with the predicted drop of the prolate band head in 183 Tl compared to 185 Tl. The implications for the prolate energy minimum in odd-mass Tl nuclei at the neutron i 13/2 midshell (N=103) are discussed. (c) 2000 The American Physical Society
Tl, Bi, and Pb doping in Ba4BiPb2TlO12-δ
International Nuclear Information System (INIS)
Sutto, T.E.; Averill, B.A.
1992-01-01
To determine the effects of different 6s metal concentrations on the superconducting nature of Ba 4 BiPb 2 TlO 12-δ , materials produced via four doping schemes were examined: Ba 4 Bi(Pb, Tl) 3 O 12-δ , Ba 4 -(BiPb) 3 TlO 12-δ , Ba 4 (Bi,Tl) 2 Pb 2 O 12-δ , and Ba 4 Bi x Pb 4-2x Tl x O 12-δ . For the parent compound a value of δ = 0.91 was observed, indicating that approximately 1/4 oxygen atom was missing per cubic subsection of the unit cell. For all samples, the symmetry of the parent compound changed from orthorhombic to tetragonal as the system moved away from the ideal composition. This was usually accompanied by the loss of superconductivity, which exhibited a maximum T c of 10.5 K for the parent compound Ba 4 BiPb 2 TlO 12-δ . Also reported are high-temperature magnetic susceptibility results, which are used to determine the effect of metal substitution on the density of states at the Fermi level. For each set of variants on the parent composition, the onset of superconductivity was accompanied by a significant decrease in the size of the Pauli paramagnetic signal. 16 refs., 6 figs
Activation analysis of thallium in urine using the 203Tl(n,2n) 202Tl reaction
International Nuclear Information System (INIS)
Korob, R.O.; Cohen, I.M.; Lage, M.; Baro, G.B.
1976-04-01
The method developed by the authors of thallium determination in human urine, based on the 203 Tl(n,2n) 202 Tl reaction followed by chemical separation and measurement of the produced 202 Tl by gamma spectrometry, is described. Its application in some cases of intoxication by thallium is reported. The advantages and limitations of the described technique are discussed. (author) [es
Thermal and x-ray studies on Tl2U(MoO4)3 and Tl4U(MoO4)4
International Nuclear Information System (INIS)
Dahale, N.D.; Keskar, Meera; Kulkarni, N.K.; Singh Mudher, K.D.
2006-01-01
In the quaternary Tl-U(IV)-Mo-O system, two new compounds namely Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 were prepared and characterized by powder X-ray diffraction and thermal methods. These compounds were prepared by solid state reactions of Tl 2 MoO 4 , UMoO 5 and MoO 3 in the required stoichiometric ratio at 500 deg C in evacuated sealed quartz ampoule. The XRD data of Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 were indexed on orthorhombic cell. TG curves of Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 did not show any weight change up to 700 deg C in an inert atmosphere. During heating in an inert atmosphere, Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 showed endothermic Dta peaks due to melting of the compounds at 519 and 565 deg C, respectively. (author)
Emergence of topological and topological crystalline phases in TlBiS2 and TlSbS2
Zhang, Qingyun
2015-02-11
Using first-principles calculations, we investigate the band structure evolution and topological phase transitions in TlBiS2 and TlSbS2 under hydrostatic pressure as well as uniaxial and biaxial strain. The phase transitions are identified by parity analysis and by calculating the surface states. Zero, one, and four Dirac cones are found for the (111) surfaces of both TlBiS2 and TlSbS2 when the pressure grows, which confirms trivial-nontrivial-trivial phase transitions. The Dirac cones at the (M) over bar points are anisotropic with large out-of-plane component. TlBiS2 shows normal, topological, and topological crystalline insulator phases under hydrostatic pressure, thus being the first compound to exhibit a phase transition from a topological to a topological crystalline insulator.
Emergence of topological and topological crystalline phases in TlBiS2 and TlSbS2
Zhang, Qingyun; Cheng, Yingchun; Schwingenschlö gl, Udo
2015-01-01
Using first-principles calculations, we investigate the band structure evolution and topological phase transitions in TlBiS2 and TlSbS2 under hydrostatic pressure as well as uniaxial and biaxial strain. The phase transitions are identified by parity analysis and by calculating the surface states. Zero, one, and four Dirac cones are found for the (111) surfaces of both TlBiS2 and TlSbS2 when the pressure grows, which confirms trivial-nontrivial-trivial phase transitions. The Dirac cones at the (M) over bar points are anisotropic with large out-of-plane component. TlBiS2 shows normal, topological, and topological crystalline insulator phases under hydrostatic pressure, thus being the first compound to exhibit a phase transition from a topological to a topological crystalline insulator.
Tl-201 per rectum scintigraphy in chronic liver disease: assessment of Tl-201 uptake indices
International Nuclear Information System (INIS)
Moon, Won Jin; Choi, Yun Young; Cho, Suk Shin; Lee, Min Ho
1999-01-01
Heart to liver ratio on Tl-201 per rectal scintigraphy (shunt index) is known to be useful in the assessment of portal systemic shunt. We assessed Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 and correlated with shunt index in patients with chronic active hepatitis (CAH) and liver cirrhosis (LC). Fifty eight patients with biopsy-proven chronic liver disease (35 with CAH, 23 with LC) underwent Tl-201 per rectum scintigraphy after instillation of 18.5 MBq of Tl-201 into the upper rectum. We evaluated hepatic uptake (type 1: homogeneous, 2: inhomogeneous segmental, 3: inhomogeneous nonsegmental) and extrahepatic uptake of spleen, heart and kidney (grade 0: no uptake, 1: less than liver, 2: equal to liver, 3: greater than liver). We measured the early liver/heart uptake rate (the slope of the liver to heart uptake ratio for 10 mim) and shunt index (heart to liver uptake ratio). Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 was correlated with the pathologic diagnosis and shunt index. Hepatic uptake patterns of type 1 and 2 were dominant in CAH (CAH: 27/35, LC: 8/23), and type 3 in LC (CAH: 8/35, LC: 15/23)(p<0.005). The grades of extrahepatic uptake were higher in LC than in CAH (spleen: p<0.001, other soft tissue: p<0.005). The early liver/heart uptake rate of CAH (0.110±0.111) was significantly higher than that of LC (0.014±0.090)(p<0.001). The sensitivity and specificity of the early liver/heart uptake rate were 77.7% and 67.7% in differentiating LC from CAH. There was negative correlation between early liver/heart uptake rate and shunt index (r=-0.3347, p<0.01). Hepatic and extrahepatic uptake pattern and early liver/heart uptake rate on Tl-201 per rectum scintigraphy are useful in the assessment of portal systemic shunt in patients with chronic liver disease
Insight on a novel layered semiconductors: CuTlS and CuTlSe
Energy Technology Data Exchange (ETDEWEB)
Aliev, Ziya S., E-mail: ziyasaliev@gmail.com [Institute of Catalysis and Inorganic Chemistry, ANAS, H.Javid ave. 113, AZ1143 Baku (Azerbaijan); Institute of Physics, ANAS, H.Javid ave. 131, AZ1143 Baku (Azerbaijan); Donostia International Physics Center (DIPC), 20080 San Sebastian (Spain); Zúñiga, Fco. Javier [Departamento de Física de la Materia Condensada, Facultad de Ciencia y Tecnología, Universidad del País Vasco, Apdo. 644, 48080 Bilbao (Spain); Koroteev, Yury M. [Institute of Strength Physics and Materials Science, Russian Academy of Sciences, Siberian Branch, 634055 Tomsk (Russian Federation); Tomsk State University, Tomsk, 634050 (Russian Federation); Breczewski, Tomasz [Departamento de Física de la Materia Condensada, Facultad de Ciencia y Tecnología, Universidad del País Vasco, Apdo. 644, 48080 Bilbao (Spain); Babanly, Nizamaddin B. [Institute of Catalysis and Inorganic Chemistry, ANAS, H.Javid ave. 113, AZ1143 Baku (Azerbaijan); Amiraslanov, Imamaddin R. [Institute of Physics, ANAS, H.Javid ave. 131, AZ1143 Baku (Azerbaijan); Politano, Antonio [Department of Physics, University of Calabria, 87036 Rende (CS) (Italy); Madariaga, Gotzon [Departamento de Física de la Materia Condensada, Facultad de Ciencia y Tecnología, Universidad del País Vasco, Apdo. 644, 48080 Bilbao (Spain); Babanly, Mahammad B. [Institute of Catalysis and Inorganic Chemistry, ANAS, H.Javid ave. 113, AZ1143 Baku (Azerbaijan); and others
2016-10-15
Single crystals of the ternary copper compounds CuTlS and CuTlSe have been successfully grown from stoichiometric melt by using vertical Bridgman-Stockbarger method. The crystal structure of the both compounds has been determined by powder and single crystal X-Ray diffraction. They crystallize in the PbFCl structure type with two formula units in the tetragonal system, space group P4/nmm, a=3.922(2); c=8.123(6); Z=2 and a=4.087(6); c=8.195(19) Å; Z=2, respectively. The band structure of the reported compounds has been analyzed by means of full-potential linearized augmented plane-wave (FLAPW) method based on the density functional theory (DFT). Both compounds have similar band structures and are narrow-gap semiconductors with indirect band gap. The resistivity measurements agree with a semiconductor behavior although anomalies are observed at low temperature. - Graphical abstract: The crystal structures of CuTl and CuTlSe are isostructural with the PbFCl-type and the superconductor LiFeAs-type tetragonal structure. The band structure calculations confirmed that they are narrow-gap semiconductors with indirect band gaps of 0.326 and 0.083 eV. The resistivity measurements, although confirming the semiconducting behavior of both compounds exhibit unusual anomalies at low temperatures. - Highlights: • Single crystals of CuTlS and CuTlSe have been successfully grown by Bridgman-Stockbarger method. • The crystal structure of the both compounds has been determined by single crystal XRD. • The band structure of the both compounds has been analyzed based on the density functional theory (DFT). • The resistivity measurements have been carried out from room temperature down to 10 K.
Energy Technology Data Exchange (ETDEWEB)
Hashimzade, F.M.; Huseinova, D.A. [Institute of Physics, National Academy of Sciences of Azerbaijan, AZ 1143 Baku (Azerbaijan); Jahangirli, Z.A. [Institute of Physics, National Academy of Sciences of Azerbaijan, AZ 1143 Baku (Azerbaijan); Institute of Radiation Problems, National Academy of Sciences of Azerbaijan, AZ 1143 Baku (Azerbaijan); Mehdiyev, B.H., E-mail: bachschi@yahoo.de [Institute of Physics, National Academy of Sciences of Azerbaijan, AZ 1143 Baku (Azerbaijan)
2017-08-01
Highlights: • Half-metallic properties of TlCrS2, TlCrSe2 and hypothetical TlCrSSe have been investigated by first-principles all-electron full-potential linearized augmented plane wave plus local orbital (FP-LAPW+lo) method based on density functional theory (DFT). • Total magnetic moment keeps its integer value on a relatively wide range of changes in volume (−10% ÷ 10%) for TlCrS2 and TlCrSSe, while total magnetic moment TlCrSe2 decreases with increasing volume, approaching to integer value 3 μB. • The states at the Fermi level in the case of spin-up channel consist of a hybridization of p-states of the atom S(Se) with d-states of Cr. - Abstract: Half-metallic properties of TlCrS{sub 2}, TlCrSe{sub 2} and hypothetical TlCrSSe have been investigated by first-principles all-electron full-potential linearized augmented plane wave plus local orbital (FP-LAPW+lo) method based on density functional theory (DFT). The results of calculations show that TlCrS{sub 2} and TlCrSSe are half-metals with energy gap (E{sub g}) ∼0.12 eV for spin-down channel. Strong hybridization of p-state of chalchogen and d-state of Cr leads to bonding and antibonding states and subsequently to the appearance of a gap in spin-down channel of TlCrS{sub 2} and TlCrSSe. In the case of TlCrSe{sub 2}, there is a partial hybridization and p-state is partially present in the DOS at Fermi level making this compound nearly half-metallic. The present calculations revealed that total magnetic moment keeps its integer value on a relatively wide range of changes in volume (−10% ÷ 10%) for TlCrS{sub 2} and TlCrSSe, while total magnetic moment of TlCrSe{sub 2} decreases with increasing volume approaching to integer value 3 μB.
Stability of Tl-Ba-Ca-Cu-O Superconducting Thin Films
Energy Technology Data Exchange (ETDEWEB)
Siegal, M.P.; Overmyer, D.L.; Venturini, E.L.; Padilla, R.R.; Provencio, P.N.
1999-08-23
We report the stability of TlBa{sub 2}CaCu{sub 2}O{sub 7} (Tl-1212) and Tl{sub 2}Ba{sub 2}CaCu{sub 2}O{sub 8} (T1-2212) thin films and by inference, the stability of TlBa{sub 2}Ca{sub 2}Cu{sub 3}O{sub 9} (Tl-1223) and Tl{sub 2}Ba{sub 2}Ca{sub 2}Cu{sub 3}O{sub 10} (Tl-2223) thin films, under a variety of conditions. In general, we observe that the stability behavior of the single Tl-O layer materials (Tl-1212 and Tl-1223)are similar and the double Tl-O layer materials (Tl-2212 and Tl-2223) are similar. All films are stable with repeated thermal cycling to cryogenic temperatures. Films are also stable in acetone and methanol. Moisture degrades film quality rapidly, especially in the form of vapor. Tl-1212 is more sensitive to vapor than Tl-2212. These materials are stable to high temperatures in either N{sub 2}, similar to vacuum for the cuprates, and O{sub 2} ambients. While total degradation of properties (superconducting and structural) occur at the same temperatures for all phases, 600 C in N{sub 2} and 700 C in O{sub 2}, the onset of degradation occurs at somewhat lower temperatures for Tl-1212 than for Tl-2212 films. In all cases, sample degradation is associated with Tl depletion from the films.
NaI(Tl) electron energy resolution
Mengesha, W
2002-01-01
NaI(Tl) electron energy resolution eta sub e was measured using the Modified Compton Coincidence Technique (MCCT). The MCCT allowed detection of nearly monoenergetic internal electrons resulting from the scattering of incident 662 keV gamma rays within a primary NaI(Tl) detector. Scattered gamma rays were detected using a secondary HPGe detector in a coincidence mode. Measurements were carried out for electron energies ranging from 16 to 438 keV, by varying the scattering angle. Measured HPGe coincidence spectra were deconvolved to determine the scattered energy spectra from the NaI(Tl) detector. Subsequently, the NaI(Tl) electron energy spectra were determined by subtracting the energy of scattered spectra from the incident source energy (662 keV). Using chi-squared minimization, iterative deconvolution of the internal electron energy spectra from the measured NaI(Tl) spectra was then used to determine eta sub e at the electron energy of interest. eta sub e values determined using this technique represent va...
Copper interactions in TlCu7S4 and TlCu7Se4
International Nuclear Information System (INIS)
Noren, L.; Delaplane, R.G.; Berger, R.
1999-01-01
Complete text of publication follows. The copper chalcogenides ACu 7 S 4 (A=NH 4 + , Tl + , Rb + ) are quasi-one-dimensional metals at ambient and higher temperatures which is due to the high mobility of copper in these structures. TlCu 7 S 4 and TlCu 7 Se 4 are isostructural compounds, space group I4/m, which can be described on the basis of a TlX 8 cube with two different Cu sites, Cu(1) and Cu(2). Cu(2)-Cu(2) zigzag chains run along the c axis with only 3/4 occupation of the Cu(2) sites. However, these two compounds differ in behaviour on cooling. The sulphide shows a polymorphic first-order transition to the CsAg 7 S 4 type (P4/n) owing to ordering of the vacancies in the Cu(2)-Cu(2) chains. In order to study the nature of the Cu(2) order/disorder in the two title compounds, a series of neutron diffraction measurements (both Bragg and diffuse scattering) were made at several temperatures from 40 to 713 K on the instrument SLAD at Studsvik. The structure at each temperature was modelled using RMC techniques. The resulting configuration show that as the temperature increases, there is a marked increase in the mobility of the Cu atoms in the Cu(2)-Cu(2) chains for TlCu 7 S 4 but not for TlCu 7 Se 4 . This is due to the initial difference in the Cu(2)-Cu(2) distances, only 2.2A for the thiocuprate, but 2.7A in the selenocuprate which explains the relative ease for Cu(2) ordering in the latter case. (author)
[Tl(III)(dota)](-): An Extraordinarily Robust Macrocyclic Complex.
Fodor, Tamás; Bányai, István; Bényei, Attila; Platas-Iglesias, Carlos; Purgel, Mihály; Horváth, Gábor L; Zékány, László; Tircsó, Gyula; Tóth, Imre
2015-06-01
The X-ray structure of {C(NH2)3}[Tl(dota)]·H2O shows that the Tl(3+) ion is deeply buried in the macrocyclic cavity of the dota(4-) ligand (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate) with average Tl-N and Tl-O distances of 2.464 and 2.365 Å, respectively. The metal ion is directly coordinated to the eight donor atoms of the ligand, which results in a twisted square antiprismatic (TSAP') coordination around Tl(3+). A multinuclear (1)H, (13)C, and (205)Tl NMR study combined with DFT calculations confirmed the TSAP' structure of the complex in aqueous solution, which exists as the Λ(λλλλ)/Δ(δδδδ) enantiomeric pair. (205)Tl NMR spectroscopy allowed the protonation constant associated with the protonation of the complex according to [Tl(dota)](-) + H(+) ⇆ [Tl(Hdota)] to be determined, which turned out to be pK(H)Tl(dota) = 1.4 ± 0.1. [Tl(dota)](-) does not react with Br(-), even when using an excess of the anion, but it forms a weak mixed complex with cyanide, [Tl(dota)](-) + CN(-) ⇆ [Tl(dota)(CN)](2-), with an equilibrium constant of Kmix = 6.0 ± 0.8. The dissociation of the [Tl(dota)](-) complex was determined by UV-vis spectrophotometry under acidic conditions using a large excess of Br(-), and it was found to follow proton-assisted kinetics and to take place very slowly (∼10 days), even in 1 M HClO4, with the estimated half-life of the process being in the 10(9) h range at neutral pH. The solution dynamics of [Tl(dota)](-) were investigated using (13)C NMR spectroscopy and DFT calculations. The (13)C NMR spectra recorded at low temperature (272 K) point to C4 symmetry of the complex in solution, which averages to C4v as the temperature increases. This dynamic behavior was attributed to the Λ(λλλλ) ↔ Δ(δδδδ) enantiomerization process, which involves both the inversion of the macrocyclic unit and the rotation of the pendant arms. According to our calculations, the arm-rotation process limits the Λ(λλλλ) ↔
Ultrashort-period lateral composition modulation in TlInGaAsN/TlInP structures
International Nuclear Information System (INIS)
Ishimaru, Manabu; Tanaka, Yuusuke; Hasegawa, Shigehiko; Asahi, Hajime; Sato, Kazuhisa; Konno, Toyohiko J.
2009-01-01
We prepared TlInGaAsN/TlInP quantum well structures using gas source molecular-beam epitaxy and characterized them by means of transmission electron microscopy and scanning transmission electron microscopy. It was found that naturally formed vertical quantum wells, so-called lateral composition modulation (LCM), with a periodicity of ∼1 nm are formed in TlInGaAsN layers. We discuss their formation process using a simple kinetic Ising model for layer-by-layer growth, and point out that the formation of ultrashort-period LCM is a universal phenomenon in most of epitaxially grown III-V semiconductor alloys.
The Development of “Eldo Ngano 1”: The World’s World’s First Ug99 Resistant Mutant Wheat Variety
International Nuclear Information System (INIS)
Forster, Brian P.
2014-01-01
The wheat black stem rust disease is a virulent race of fungus, Puccinia graminis, which affects wheat plants and is caused by a strain of fungus known as Ug99. Named for its place and year of origin, Ug99 was first discovered on wheat in Uganda in 1999. The spores of this plant disease are airborne and can be easily spread by wind. If not prevented, the disease can destroy 70 to 100 per cent of the yield of wheat crops. Annually on average 8.3 million tonnes of wheat grain is lost to this disease, costing US $1.23 billion per year. Ethiopia, Kenya and Uganda are hot spots for this disease. In 2009, growing international concern regarding the horrific impact of Ug99 on wheat led to the establishment of IAEA project INT/5/150, Responding to the Transboundary Threat of Wheat Black Stem Rust (Ug99). This project has involved over 18 countries and 5 national and international institutions, and examined possible mutation induction treatments to deal with the challenges posed by Ug99. Meetings and workshops to facilitate the project efforts have been held in Kenya and Turkey. Ug99 continues to spread globally and has now reached the Islamic Republic of Iran. There are also reports of suspected disease occurrences in Europe. It is essential that work continues on developing mutant lines for further crop protection that can be utilized worldwide to safeguard the wheat crop from this devastating disease
Berent, Iris
2016-01-01
Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett's concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett's logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett's arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett's arguments hardly undermine the viability of this hypothesis.
Characterization of cartilaginous tumors with 201Tl scintigraphy
International Nuclear Information System (INIS)
Higuchi, Takahiro; Taki, Junichi; Sumiya, Hisashi; Kinuya, Seigo; Nakajima, Kenichi; Tonami, Norihisa
2005-01-01
Histological diagnosis and grading of cartilaginous tumors are closely correlated with patient prognosis; consequently, they are essential elements. We attempted to clarify the characteristics of 201 Tl uptake in various histological types of cartilaginous tumors and to assess its clinical value. Twenty-two cases with histologically proven cartilaginous tumors (3 enchondromas, 15 conventional chondrosarcomas (grade I=9, II=5, III=1), 3 mesenchymal chondrosarcomas, and 1 de-differentiated chondrosarcoma) were examined retrospectively. Planar 201 Tl images were recorded 15 mm following intravenous injection of 201 Tl (111 MBq). 201 Tl uptake in the tumor was evaluated visually employing a five-grade scoring system: 0=no appreciable uptake, 1=faint uptake above the background level, 2=moderate uptake, 3=intense uptake but lower than heart uptake and 4=uptake higher than heart uptake. 201 Tl uptake scores were 0 in 3 of 3 enchondromas, 9 of 9 grade I, and 4 of 5 grade II conventional chondrosarcomas. 201 Tl uptake scores were 1 among 1 of 5 grades II and a grade III conventional chondrosarcoma. Mesenchymal chondrosarcoma and de-differentiated chondrosarcoma displayed 201 Tl uptake scores of 2 or 3. Absence of elevated 201 Tl uptake in cartilaginous tumors was indicative of enchondroma or low-grade conventional chondrosarcoma. However, in instances in which 201 Tl uptake is obvious, high-grade chondrosarcoma or variant types should be considered. (author)
Energy Technology Data Exchange (ETDEWEB)
Poetsch, U; Austenfeld, F A
1985-01-01
The effects of TlNO/sub 3/ and Tl(I)EDTA on growth and heavy metal contents of pea plants and field bean plants were compared in hydroponic culture experiments. In the presence of TlNO/sub 3/, the essential heavy metals were available to the plants in their ionic forms. When Tl(I)EDTA was present the essential heavy metals were available as chelated complexes. With increasing concentration of TlNO/sub 3/ dry matter production of pea plants was lowered and the Tl content of each organ was increased. The highest Tl content was found within the stems. The increased Tl contents were accompanied by depressed Mn, Zn, and Cu contents of the roots and depressed Mn contents of the stems, but increased Fe contents of the stems. Substitution of TlNO/sub 3/ by Tl(I)EDTA resulted in a stronger growth inhibition of the pea plants, and higher Tl contents of each organ. The highest Tl content was found within the stems. Tl(I)EDTA depressed Mn in the roots, but increased Fe and Mn in the stems, and Fe, Zn and Cu in the leaves. The increases may due to concentration by growth inhibition. The growth of the field bean was not effected by TlNO/sub 3/ nor by Tl(I)EDTA. The field bean contained most of the Tl within the roots and translocated only relatively small amounts to the shoots. This pattern was independent of the Tl compound. Increasing concentrations of TlNO/sub 3/ resulted in depressed Mn and Zn contents of the roots, and Mn contents of the stems. Chelation of Tl(I) resulted in a decrease of the Tl content of each organ. Tl(I)EDTA depressed only the Mn content of the roots.
Principles of Good Practice in SoTL
Felten, Peter
2013-01-01
For the Scholarship of Teaching and Learning (SoTL) to be understood as significant intellectual work in the academy, SoTL practitioners need to identify shared principles of good practice. While honoring the diversity of SoTL in its many forms across the globe, such principles can serve as a heuristic for assessing work in our field. These…
New colour centres in KCl:(Tl+ + Ca2+) and KCl:(Tl+ + Sr2+) crystals
International Nuclear Information System (INIS)
Ioan, A.; Topa, V.; Giurgea, M.
1978-01-01
Electrolytic colouring under unusual conditions (low temperature and high voltage) gives rise to the appearance of three new absorption bands peaking at 3.2, 2.5, and 1.7 eV and at 2.8, 2.1, and 1.5 eV in KCl:(Tl + + Ca 2+ ) and in KCl:(Tl + + Sr 2+ ) single crystals, respectively. The modifications of the absorption spectra of the coloured crystals induced by the application of a reversed electric field at the colouring temperature or by heat treatment are investigated. It is likely that the colour centre responsible for the new absorption bands is an aggregate centre which, besides an Tl - -complex, contains also at least an Ca(Sr) ion, a trapped electron, and an anionic vacancy. (author)
33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...
Allakhverdiev, K R; Suleymanov, R A; Gasanov, N Z
2003-01-01
The deformation effects in electronic spectra of the ternary layered semiconductors TlGaS sub 2 , TlGaSe sub 2 and TlInS sub 2 are considered. It is shown that the influence of hydrostatic pressure, thermal expansion and variation of composition in solid solutions on the band gap of the crystals investigated can be described in the framework of one common model of deformation potentials. This model appears to be close to that of layered semiconductors of the A sub 3 B sub 6 group, attesting to the fact that the main principles of formation of band structure in these two groups of layered crystals are the same.
Noble magnetic barriers in the ASDEX UG tokamak
Ali, Halima; Punjabi, Alkesh; Vazquez, Justin
2010-02-01
The second-order perturbation method of creating invariant tori inside chaos in Hamiltonian systems (Ali, H.; Punjabi, A. Plasma Phys. Contr. F. 2007, 49, 1565-1582) is applied to the axially symmetric divertor experiment upgrade (ASDEX UG) tokamak to build noble irrational magnetic barriers inside chaos created by resonant magnetic perturbations (m, n)=(3, 2)+(4, 3), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation. The radial dependence of the Fourier modes is ignored. The modes are considered to be locked and have the same amplitude δ. A symplectic mathematical mapping in magnetic coordinates is used to integrate magnetic field line trajectories in the ASDEX UG. Tori with noble irrational rotational transform are the last ones to be destroyed by perturbation in Hamiltonian systems. For this reason, noble irrational magnetic barriers are built inside chaos, and the strongest noble irrational barrier is identified. Three candidate locations for the strongest noble barrier in ASDEX UG are selected. All three candidate locations are chosen to be roughly midway between the resonant rational surfaces ψ32 and ψ43. ψ is the magnetic coordinate of the flux surface. The three candidate surfaces are the noble irrational surfaces close to the surface with q value that is a mediant of q=3/2 and 4/3, q value of the physical midpoint of the two resonant surfaces, and the q value of the surface where the islands of the two perturbing modes just overlap. These q values of the candidate surfaces are denoted by q MED, q MID, and q OVERLAP. The strongest noble barrier close to q MED has the continued fraction representation (CFR) [1;2,2,1∞] and exists for δ≤2.6599×10-4; the strongest noble barrier close to q MID has CFR [1;2,2,2,1∞] and exists for δ≤4.6311×10-4; and the strongest noble barrier close to q OVERLAP has CFR [1;2,2,6,2,1∞] and exists for δ≤1.367770×10-4. From these results, the strongest
$\\alpha$-decay study of $^{182,184}$Tl
Van Beveren, C; Barzakh, A E; Cocolios, T E; de Groote, R P; Fedorov, D; Fedosseev, V N; Ferrer, R; Ghys, L; Huyse, M; Köster, U; Lane, J; Liberati, V; Lynch, K M; Marsh, B A; Molkanov, P L; Procter, T J; Rapisarda, E; Sandhu, K; Seliverstov, M D; Van Duppen, P; Venhart, M; Veselský, M
2016-01-01
α -decay spectroscopy of 182,184 Tl has been performed at the CERN isotope separator on-line ( ISOLDE ) facility. New fi ne-structure α decays have been observed for both isotopes. α -decay branching ratios of 0.089 ( 19 ) %, 0.047 ( 6 ) % and 1.22 ( 30 ) % have been deduced for the ( 10 − ) , ( 7 + ) and ( 2 − ) states respectively in 184 Tl and a lower limit of 0.49% for the α -decay branching ratio of 182 Tl. A new half-life of 9.5 ( 2 ) s for the ( 2 − ) state in 184 Tl and 1.9 ( 1 ) s for the low-spin state in 182 Tl has been deduced. Using α – γ coincidence analysis, multiple γ rays were observed de-exciting levels in 178,18 0 Au fed by 182,184 Tl α decays. The γ transitions connecting these low-lying states in 178,18 0 Au are essential to sort the data and possibly identify bands from in- beam studies in these isotopes. Owing to the complex fi ne-structure α decays and limited knowledge about the structure of the daughter nuclei, only partial level schemes could be constructed for bot...
Energy Technology Data Exchange (ETDEWEB)
Pieper, B; Austenfeld, F A
1985-01-01
The effects of Tl(NO/sub 3/)/sub 3/ and Tl(III)EDTA on growth and heavy metal contents of pea plants and field bean plants were compared in hydroponic culture experiments. In the presence of Tl(NO/sub 3/)/sub 3/, the essential heavy metals were available to the plants in their ionic forms. When Tl(III)EDTA was present the essential heavy metals were available as chelated complexes. Dry matter production of the pea plants was inhibited to a greater extent by Tl(III)EDTA than by Tl(NO/sub 3/)/sub 3/. The distribution of Tl within the plant was unaffected by the accompanying anion, however an increase of the Tl content of the stems and the leaves was observed in the presence of Tl(III)EDTA. The micronutrients exhibited different interactions with Tl(III). In the presence of increasing concentrations of Tl(NO/sub 3/)/sub 3/ the Mn content of each organ and the Zn content of the roots were lowered, but the Zn content of the stems was increased. Increasing concentrations of Tl(III)EDTA resulted only in a decrease of the Mn content of the roots, but in an increase of the contents of Fe and Mn within the stems, and Fe, Mn, Zn, and Cu within the leaves. The increases may be due to concentration by growth inhibition. In contrast to pea plants, growth of field bean plants was inhibited only by Tl(NO/sub 3/)/sub 3/. The field bean plants retained most of the Tl within the roots independent of the Tl compound in the solution. Chelation of Tl(III) resulted in higher Tl contents of both the roots and the stems, but equal or reduced Tl contents of the leaves. Whereas increasing concentrations of Tl(NO/sub 3/)/sub 3/ reduced the Mn content of each organ as well as the Zn content of the roots and the leaves, Tl(III)EDTA only reduced the Mn content of the roots.
International Nuclear Information System (INIS)
Siegal, M.P.; Venturini, E.L.; Newcomer, P.P.; Overmyer, D.L.; Dominguez, F.; Dunn, R.
1995-01-01
TlBa 2 CaCu 2 O 7 (Tl-1212) superconducting films 5000--6000 A thick have been grown on LaAlO 3 (100) substrates using oxide precursors in a closed two-zone thallination furnace. Tl-1212 films can be grown with transition temperatures ∼100 K, and critical current densities measured by magnetization of J cm (5 K)>10 7 A/cm 2 and J cm (77 K)>10 5 A/cm 2 . Processing conditions, substrate temperatures and Tl-oxide source temperatures are found which result in smooth, nearly phase-pure Tl-1212 films. Variations in the respective temperature ramps of the Tl-oxide zone and the substrate zone can greatly influence resulting film properties such as microstructure, morphology, superconducting transition temperature, and critical current density. copyright 1995 American Institute of Physics
Purgel, Mihály; Maliarik, Mikhail; Glaser, Julius; Platas-Iglesias, Carlos; Persson, Ingmar; Tóth, Imre
2011-07-04
The structure and bonding of a new Pt-Tl bonded complex formed in dimethylsulfoxide (dmso), (CN)(4)Pt-Tl(dmso)(5)(+), have been studied by multinuclear NMR and UV-vis spectroscopies, and EXAFS measurements in combination with density functional theory (DFT) and time dependent density functional theory (TDDFT) calculations. This complex is formed following the equilibrium reaction Pt(CN)(4)(2-) + Tl(dmso)(6)(3+) ⇆ (CN)(4)Pt-Tl(dmso)(5)(+) + dmso. The stability constant of the Pt-Tl bonded species, as determined using (13)C NMR spectroscopy, amounts to log K = 2.9 ± 0.2. The (NC)(4)Pt-Tl(dmso)(5)(+) species constitutes the first example of a Pt-Tl bonded cyanide complex in which the sixth coordination position around Pt (in trans with respect to the Tl atom) is not occupied. The spectral parameters confirm the formation of the metal-metal bond, but differ substantially from those measured earlier in aqueous solution for complexes (CN)(5)Pt-Tl(CN)(n)(H(2)O)(x)(n-) (n = 0-3). The (205) Tl NMR chemical shift, δ = 75 ppm, is at extraordinary high field, while spin-spin coupling constant, (1)J(Pt-Tl) = 93 kHz, is the largest measured to date for a Pt-Tl bond in the absence of supporting bridging ligands. The absorption spectrum is dominated by two strong absorption bands in the UV region that are assigned to MMCT (Pt → Tl) and LMCT (dmso → Tl) bands, respectively, on the basis of MO and TDDFT calculations. The solution of the complex has a bright yellow color as a result of a shoulder present on the low energy side of the band at 355 nm. The geometry of the (CN)(4)Pt-Tl core can be elucidated from NMR data, but the particular stoichiometry and structure involving the dmso ligands are established by using Tl and Pt L(III)-edge EXAFS measurements. The Pt-Tl bond distance is 2.67(1) Å, the Tl-O bond distance is 2.282(6) Å, and the Pt-C-N entity is linear with Pt-C and Pt···N distances amounting to 1.969(6) and 3.096(6) Å, respectively. Geometry optimizations on
Preparation of 199Tl and its labelled compound
International Nuclear Information System (INIS)
Zhou Dehai; Guan Changtian; Kuang Anren
1991-10-01
Usually, 199 Ti is obtained by the nuclear reaction of 197 Au(α, 2n) 199 Tl. A gold target with 50±0.1 mm in diameter, 0.8 mm in thickness and 99.99% in purity was mounted in a cyclotron beam line. The target was bombarded by α particles with the energy of 25∼27 MeV and the beam current of 15∼20μA. The irradiated gold target was dissolved by aqua regia. Then the saturated aqueous solution of SO 2 was added. The 199 Tl(III)reduced to 199 Tl(I). The deposit of gold was removed. For separation of 199 Tl)I), about 5 mL of raw material solution obtained was transferred to 201 x 8 type anion exchange resin column which had been equilibrated with 4 mol/L HCl. The 199 Tl(I) and Au(III) were desorbed separately with the eluants (90% of aqueous diamide solution,, and 2 mol/L HCL∼5% thiourea) at the flow rate of 0.25 mL/min. After separation, the 10 mL concentrated nitric acid was added to the 199 Tl collected solution to destroy and remove the aqueous diamide solution, then 4 mol/L HCl was added and heated up to remove NO 3 - . The TlCl injection with pH = 5 was made up by using physiological saline. After filtering the 199 TlCl injection was sterilized at 137.3 kPa, 120 deg C about 30 min in an autoclave. The 199 TlCl injection was used in the animal pyrogen, a bacterial, safety, dispensation and myocardial imaging experiments. The good results have been obtained. Now it has undergone clinical experiments
Kim, S Y; Kim, Y
2002-01-01
Two crystal structures of dehydrated Ag sup + -and Tl sup + -exchanged zeolite X (Ag sub 2 sub 7 Tl sub 6 sub 5 -X and Ag sub 2 sub 3 Tl sub 6 sub 9 -X) have been determined by single-crystal X-ray diffraction techniques in the cubic space group Fd3 at 21(1) .deg. C (a = 24.758(4) A, a = 24.947(4) A, respectively). Their structures were refined to the final error indices R sub 1 = 0.055 and wR sub 2 = 0.057 with 375 reflections, and R sub 1 = 0.058 and wR sub 2 = 0.057 with 235 reflections, respectively, for which I> 3 sigma(I). In the structure of Ag sub 2 sub 7 Tl sub 6 sub 5 -X, 27 Ag sup + ions were found at two crystallographic sites: 15 Ag sup + ions at site I at the center of the hexagonal prism and the remaining 12 Ag sup + ions at site II' in the sodalite cavity. Sixty-five Tl sup + ions were located at three crystallographic sites: 20 Tl sup + ions at site II opposite single six-rings in the supercage, 18 Tl sup + ions at site I' in the sodalite cavity opposite the D6Rs, and the remaining 27 Tl sup ...
Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD
Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui
2017-11-01
TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.
International Nuclear Information System (INIS)
Strudwick, R.M.; Taylor, K.
2017-01-01
Introduction: How mammography is incorporated into undergraduate (UG) radiography training may influence student perception of the speciality and its potential as a future career option. An overview is provided of the academic and clinical content of UG radiography courses relating to mammography across the UK. Methods: Using mixed methods and an iterative, inductive approach supplying quantitative and qualitative data, we identify any variations and discuss possible causes which may help influence future training strategies. A self-designed questionnaire containing open and closed questions was sent online using SurveyMonkey™ to course leaders of all Higher Education Institutions (HEIs) offering BSc (Hons) Diagnostic Radiography courses in the UK. Responses were analysed for trends which were further explored by semi structured telephone interviews. These were transcribed and evaluated using a thematic analysis, the themes being categorised and coded. Results: 19 of 24 (79%) HEIs responded to the questionnaire. Follow up telephone interviews were conducted with five course leaders to further explore themes. Academic teaching ranged from 3 to 25 h over the 3 year course. Compared to other specialities 10 (53%) HEIs spent less time on mammography with 12 (63%) citing HCPC standards as the reason. 11 (65%) HEIs sent students on mammography placements, 2 (12%) sent females only. Placement times ranged between 2 days and 2 weeks. Influences included availability of expert teaching and relationship with clinical departments. Conclusion: There is variation in undergraduate exposure to mammography. Students views should be sought to add validity to these findings - Highlights: • A summary of undergraduate (UG) breast imaging in the UK. • Themes around the delivery of UG breast imaging education in university and practice. • Opinions of UG course leaders and other stakeholders about UG breast imaging education. • There is a variation across UK universities in
International Nuclear Information System (INIS)
Alkire, R.W.; Vergamini, P.J.; Larson, A.C.; Morosin, B.
1984-01-01
Room-temperature (293 K) single-crystal structure determinations of the isostructural materials Tl 3 PSe 4 and Tl 3 AsS 4 were performed at the Los Alamos National Laboratory Pulsed Neutron Facility. For Tl 3 PSe 4 : Msub(r) = 959.92, Pcmn, a = 9.276 (1), b = 11.036 (2), c = 9.058 (1) A, V = 927.27 A 3 , Z = 4, Dsub(m) = 6.87 (2), Dsub(x) = 6.876 Mg m -3 , lambdasub(neutron) = 0.5 → 5.2 A, F(000) = 252.5 fm. For Tl 3 AsS 4 : Msub(r) = 816.29, Pcmn, a = 9.084 (3), b = 10.877 (3), c = 8.877 (3) A, V = 877.11 A 3 , Z = 4, Dsub(m) = 6.18 (2), Dsub(x) = 6.181 Mg m -3 , lambdasub(neutron) = 0.5 → 5.2 A, F(000) = 177.2 fm. For Tl 3 PSe 4 (Tl 3 AsS 4 ), 1929 (1013) reflections were measured with I > 3sigma(I) and refined by full-matrix least squares to R(F) = 0.061 (0.063). Results on atomic refinement from this study represent an order of magnitude increase in precision over previous single-crystal X-ray structural work using Mo Kα radiation. The PSe 4 3- (AsS 4 3- ) groups have essentially tetrahedral configurations and one Tl + ion shows large anisotropic thermal motion which is structure related. (Auth.)
Energy Technology Data Exchange (ETDEWEB)
Yeon, Jeongho; Kim, Sang-Hwan [Department of Chemistry, University of Houston, 136 Fleming Building, Houston, TX 77204-5003 (United States); Green, Mark A. [Department of Materials Science and Engineering, University of Maryland, College Park, MD, 20742-2115 and NIST Center for Neutron Research, National Institute of Standard and Technology, 100 Bureau Drive, Gaithersburg, MD 20899-6103 (United States); Bhatti, Kanwal Preet; Leighton, C. [Department of Chemical Engineering and Materials Science, University of Minnesota, Minneapolis, MN 55455-0132 (United States); Shiv Halasyamani, P., E-mail: psh@uh.edu [Department of Chemistry, University of Houston, 136 Fleming Building, Houston, TX 77204-5003 (United States)
2012-12-15
Crystals and polycrystalline powders of two new oxide materials, Tl{sub 4}CuTeO{sub 6} and Tl{sub 6}CuTe{sub 2}O{sub 10}, have been synthesized by hydrothermal and solid-state methods. The materials were structurally characterized by single-crystal X-ray diffraction. Tl{sub 4}CuTeO{sub 6} and Tl{sub 6}CuTe{sub 2}O{sub 10} exhibit one dimensional anionic slabs of [CuTeO{sub 6}]{sup 4-} and [CuTe{sub 2}O{sub 10}]{sup 6-}, respectively. Common to both slabs is the occurrence of Cu{sup 2+}O{sub 4} distorted squares and Te{sup 6+}O{sub 6} octahedra. The slabs are separated by Tl{sup +} cations. For Tl{sub 4}CuTeO{sub 6}, magnetic measurements indicate a maximum at {approx}8 K in the temperature dependence of the susceptibility. Low temperature neutron diffraction data confirm no long-range magnetic ordering occurs and the susceptibility was adequately accounted for by fits to a Heisenberg alternating chain model. For Tl{sub 6}CuTe{sub 2}O{sub 10} on the other hand, magnetic measurements revealed paramagnetism with no evidence of long-range magnetic ordering. Infrared, UV-vis spectra, thermogravimetric, and differential thermal analyses are also reported. Crystal data: Tl{sub 4}CuTeO{sub 6}, Triclinic, space group P-1 (No. 2), a=5.8629(8) A, b=8.7848(11) A, c=9.2572(12) A, {alpha}=66.0460(10), {beta}=74.2010(10), {gamma}=79.254(2), V=417.70(9) A{sup 3}, and Z=2; Tl{sub 6}CuTe{sub 2}O{sub 10}, orthorhombic, space group Pnma (No. 62), a=10.8628(6) A, b=11.4962(7) A, c=10.7238(6) A, V=1339.20(13) A{sup 3}, and Z=4. - Graphical Abstract: Two new oxide materials, Tl{sub 4}CuTeO{sub 6} and Tl{sub 6}CuTe{sub 2}O{sub 10}, have been synthesized and characterized. The materials exhibit one dimensional crystal structures consisting of CuO{sub 4} and TeO{sub 6} polyhedra. Highlights: Black-Right-Pointing-Pointer Two New Tl-Te-Cu-oxides have been synthesized and structurally characterized. Black-Right-Pointing-Pointer For Tl{sub 4}CuTeO{sub 6}, magnetic measurements indicate a
Intrinsic thermoluminescence of NaCl:Tl in UV dosimetry
International Nuclear Information System (INIS)
Barghare, S.P.; Joshi, R.V.; Joshi, T.R.; Kathuria, S.P.
1982-01-01
NaCl:Tl(T) phosphor is found to have high intrinsic thermoluminescence (TL) sensitivity to 253.7 nm UV-radiation. The dosimetric glow peak II grows sublinearly with increase in UV dose in the range 10 3 to 10 6 JM -2 . The other requirements of an efficient dosimeter material such as high storage stability, matching of the spectral response of detector tube and TL-emission from phosphor, reproducibility, desirable size and shape, easy availability in powder, pellet and crystal forms at cheaper rates, and repeated re-usability of the same phosphor without much difficulty, etc., are additional factors which strengthen the claim of NaCl:Tl(T) phosphor as UV dosimetric material. It is proposed that present NaCl:Tl(T) material is suitable TL-phosphor for UV dosimetry in the range 10 3 to 10 6 JM -2 . (author)
Berent, Iris
2016-01-01
Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett’s concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett’s logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett’s arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett’s arguments hardly undermine the viability of this hypothesis. PMID:27471480
Exploring the thermoelectric and magnetic properties of uranium selenides: Tl2Ag2USe4 and Tl3Cu4USe6
International Nuclear Information System (INIS)
Azam, Sikander; Khan, Saleem Ayaz; Din, Haleem Ud; Khenata, Rabah; Goumri-Said, Souraya
2016-01-01
The electronic, magnetic and thermoelectric properties of Tl 2 Ag 2 USe 4 and Tl 3 Cu 4 USe 6 compounds were investigated using the full potential linear augmented plane wave (FP-LAPW) method based on the density functional theory (DFT). The exchange correlation was treated with the generalized gradient approximation plus optimized effective Hubbard parameter and spin–orbit coupling (GGA+U+SOC). The present uranium selenides show narrow direct energy band gap values of 0.7 and 0.875 eV for Tl 2 Ag 2 USe 4 and Tl 3 Cu 4 USe 6 respectively. For both selenides U-d/f states are responsible for electrical transport properties. Uranium atoms were the most contributors in the magnetic moment compared to other atoms and show ferromagnetic nature. The spin density isosurfaces show the polarization of neighboring atoms of Uranium, such as silver/copper and selenium. Thermoelectric calculations reveal that Tl 3 Cu 4 USe 6 is more suitable for thermoelectric device applications than Tl 2 Ag 2 USe 4 . - Highlights: • Electronic, magnetic and thermoelectric properties of uranium selenides are investigated with DFT. • They show a narrow direct energy band gap of 0.7 and 0.875 eV. • U-d/f states are responsible for electrical transport properties. • Tl 3 Cu 4 USe 6 is more suitable for thermoelectric device applications than Tl 2 Ag 2 USe 4 .
The Puccinia graminis f. sp. tritici (Pgt) Ug99 race group is virulent to most stem rust resistance genes currently deployed in wheat and poses a serious threat to global wheat production. The durum wheat (Triticum turgidum ssp. durum) gene Sr13 confers resistance to Ug99 in addition to virulent rac...
Chemical bonding in Tl cuprates studied by x-ray photoemission
International Nuclear Information System (INIS)
Vasquez, R.P.; Siegal, M.P.; Overmyer, D.L.; Ren, Z.F.; Lao, J.Y.; Wang, J.H.
1999-01-01
Epitaxial thin films of the Tl cuprate superconductors Tl 2 Ba 2 CaCu 2 O 8 , Tl 2 Ba 2 Ca 2 Cu 3 O 10 , and Tl 0.78 Bi 0.22 Ba 0.4 Sr 1.6 Ca 2 Cu 3 O 9-δ are studied with x-ray photoemission spectroscopy. These data, together with previous measurements in this lab of Tl 2 Ba 2 CuO 6+δ and TlBa 2 CaCu 2 O 7-δ , comprise a comprehensive data set for a comparative study of Tl cuprates with a range of chemical and electronic properties. In the Cu 2p spectra, a larger energy separation between the satellite and main peaks (E s -E m ) and a lower intensity ratio (I s /I m ) are found to correlate with higher values of T c . Analysis of these spectra within a simple configuration interaction model suggests that higher values of T c are related to low values of the O 2p→Cu 3d charge transfer energy. In the O 1s region, a smaller bond length between Ba and Cu-O planar oxygen is found to correlate with a lower binding energy for the signal associated with Cu-O bonding, most likely resulting from the increased polarization screening by Ba 2+ ions. For samples near optimum doping, maximum T c is observed to occur when the Tl 4f 7/2 binding energy is near 117.9 eV, which is near the middle of the range of values observed for Tl cuprates. Higher Tl 4f 7/2 binding energies, corresponding to formal oxidation states nearer Tl 1+ , are also found to correlate with longer bond lengths between Ba and Tl-O planar oxygen, and with higher binding energies of the O 1s signal associated with Tl-O bonding. copyright 1999 The American Physical Society
International Nuclear Information System (INIS)
Hashimoto, T.; Kojima, M.; Shirai, N.; Ichino, M.
1993-01-01
A three-dimensional representation of thermoluminescence (TL) spectra has been established by employing an image intensifier unit combined with a simple spectrophotometer and a microcomputer. By means of this TL spectrometric system, natural quartz grains could be distinguished as either blue-and/or red-TL ones. In these blue- and red-TL wavelength regions, activation energies from artificially irradiated quartz grains are evaluated using a repeated initial rise method. An apparent difference of activation energies in the two colorations was observed for dune sands presumably originating from different quartz sources. On the other hand, quartz grains extracted from a volcanic ash sediment showed completely similar activation energies in both TL color regions over all temperatures. Subsequently, the kinetic parameters were derived for the naturally occurring red-TL, possessing an apparent single peak around 340 o C, from volcanically originating quartz grains by fitting a theoretical equation to the glow curves, after evaluating activation energies. On the basis of the empirical kinetic parameters, the mean life of trapped electrons relating to a main 340 o C peak has been proved to be 1 million years, and a secondary weak peak around 280 o C in the natural red-TL glow curve has been confirmed. (author)
Color centers in heavily irradiated CsI(Tl) crystals
International Nuclear Information System (INIS)
Yakovlev, V.; Meleshko, A.; Trefilova, L.
2008-01-01
The absorption and luminescence properties of CsI(Tl) crystals colored by irradiation are studied by the method of the time-resolved spectroscopy. The scheme of the electron transitions in CsI(Tl) crystal is suggested to explain the appearance of the color centers under exposure to the near-UV light. It is established that either of the two types activator color centers holds the charge carrier with opposite sign. The model of the hole Tl 2+ v c - activator color center is suggested. According to the model the positive charge of Tl 2+ ion is compensated by the negative charge of a close cation vacancy v c - . The color center emission reveals in the cathode-luminescence spectrum of the colored CsI(Tl) crystal. The high-dose irradiation of CsI(Tl) crystal results in the reduction of the decay time of the near-thallium self-trapped excitons (STE) emission. The decay kinetics of Tl 2+ v c - emission contains the time components typical for the decay kinetics of near-thallium STE emission. The reason of the observed effects is the energy transfer from the near-thallium STE excitons to the color centers via the inductive-resonant mechanism
Energy Technology Data Exchange (ETDEWEB)
Ismayilova, N. A., E-mail: ismayilova-narmin-84@mail.ru; Orudjev, H. S.; Jabarov, S. H. [Azerbaijan National Academy of Sciences, Institute of Physics (Azerbaijan)
2017-04-15
The results of ab initio calculations of the electron spectrum of TlFeS{sub 2} and TlFeSe{sub 2} crystals in the antiferromagnetic phase are reported. Calculations are carried out in the context of the density functional theory. The origin of the bands of s, p, and d electron states of Tl, Fe, S, and Se atoms is studied. It is established that, in the antiferromagnetic phase, the crystals possess semiconductor properties. The band gaps are found to be 0.05 and 0.34 eV for TlFeS{sub 2} and TlFeSe{sub 2} crystals, respectively.
ESR and TL age determination of caliche nodules
Energy Technology Data Exchange (ETDEWEB)
Oezer, A.M. (Middle East Technical Univ., Ankara (Turkey)); Wieser, A.; Goeksu, H.Y.; Mueller, P.; Regulla, D.F. (Gesellschaft fuer Strahlen- und Umweltforschung mbH Muenchen, Neuherberg (Germany, F.R.). Inst. fuer Strahlenschutz); Erol, O. (Istanbul Univ. (Turkey). School of Geography and Marine Sciences)
1989-01-01
Feasibility of dating caliche nodules by ESR and TL is investigated. For both methods the properties of the dating signal are described. Chemical composition as well as TL glow curves of caliches originating from different localities exhibit some differences. Due to the complexity of the TL glow curves, some samples required a special post-annealing procedure in order to resolve the main TL peak for age determination. Typical ESR calcite signals do not exist in caliche, therefore usefulness of the g=2.0040 ESR signal is studied. The results of TL and ESR ages are found to be compatible except for two samples. Possible causes of the discrepancy in these samples are discussed. It is shown that, with proper treatment of the radiation-induced signals, it was possible to date caliche formations older than 350 ka, which is not achievable with other methods like uranium series disequilibrium and/or radiocarbon dating. (author).
ESR and TL age determination of caliche nodules
International Nuclear Information System (INIS)
Oezer, A.M.; Wieser, A.; Goeksu, H.Y.; Mueller, P.; Regulla, D.F.; Erol, O.
1989-01-01
Feasibility of dating caliche nodules by ESR and TL is investigated. For both methods the properties of the dating signal are described. Chemical composition as well as TL glow curves of caliches originating from different localities exhibit some differences. Due to the complexity of the TL glow curves, some samples required a special post-annealing procedure in order to resolve the main TL peak for age determination. Typical ESR calcite signals do not exist in caliche, therefore usefulness of the g=2.0040 ESR signal is studied. The results of TL and ESR ages are found to be compatible except for two samples. Possible causes of the discrepancy in these samples are discussed. It is shown that, with proper treatment of the radiation-induced signals, it was possible to date caliche formations older than 350 ka, which is not achievable with other methods like uranium series disequilibrium and/or radiocarbon dating. (author)
Standardization of 201Tl and 55Fe radionuclides in a 4 (PC)-NaI(Tl) coincidence system
International Nuclear Information System (INIS)
Pires, Carlos Augusto
2008-01-01
In the present work the procedure for the standardization of radionuclides using the 4π(PC)-NaI(Tl) coincidence system was developed. The radionuclides selected were 201 Tl, used in nuclear medicine, and 55 Fe primary standard source, used for x-ray spectrometers calibration. The 4π(PC)-NaI(Tl) is composed of a 4 proportional counter operated at 0.1MPa coupled to two NaI(Tl) crystals. The 201 Tl decays by electron capture process followed by a prompt gamma-ray. The disintegration rate was determined by extrapolation technique using two methods: electronic discrimination and external absorbers. The radioactive sources were prepared in a 20 μg cm -2 thick Collodion film. The conventional electronic system was used. The observed events were registered by the TAC method. The 55 Fe decays by electron capture process to the ground state of 55 Mn, emitting x rays with around 6 keV. The standardization was obtained by the tracing method. This technique was applied using two radionuclides, which decay by electron capture process followed by a prompt gamma-ray, namely 51 Cr and 54 Mn, as tracers. Measurements with 1 and 2 aluminum foils, each 150 g cm-2 thick were carried out. The activity was obtained by extrapolation for zero thickness Al foil. The uncertainties were treated by means of matrix covariance methodology and takes into account all correlations involved. (author)
Electrochemically produced alumina as TL detector
International Nuclear Information System (INIS)
Osvay, M.
1996-01-01
The goal of this work was to compare the TL properties of various electrochemically produced alumina layers (E-AIO) in order to investigate the effect of the electrolyte and the Mg content on the alloys. It has been found that the TL sensitivity of oxidised layers is more influenced by the type of electrolyte, than by the composition of alloy. Hard oxide layer evolved in reduction electrolyte has rather different character compared to other alumina production investigated. The effect of reducing media seems to be very important during preparation of alumina layer. One of the advantages properties of E-AIO is, that it serve a promising method to increase the measuring range of TL method above 10 kGy as well. (author)
Chemical Bonding in Tl Cuprates Studied by X-Ray Photoemission
Energy Technology Data Exchange (ETDEWEB)
Lao, J.Y.; Overmyer, D.L.; Ren, Z.F.; Siegal, M.P.; Vasquez, R.P.; Wang, J.H.
1999-04-05
Epitaxial thin films of the Tl cuprate superconductors Tl{sub 2}Ba{sub 2}CaCu{sub 2}O{sub 8}, Tl{sub 2}Ba{sub 2}Ca{sub 2}Cu{sub 3}O{sub 10}, and TL{sub 0.78}Bi{sub 0.22}Ba{sub 0.4}Sr{sub 1.6}Ca{sub 2}Cu{sub 3}O{sub 9{minus}{delta}} are studied with x-ray photoemission spectroscopy. These data, together with previous measurements in this lab of Tl{sub 2}Ba{sub 2}CuO{sub 6+{delta}} and TlBa{sub 2}CaCu{sub 2}O{sub 7{minus}{delta}}, comprise a comprehensive data set for a comparative study of Tl cuprates with a range of chemical and electronic properties. In the Cu 2p spectra, a larger energy separation between the satellite and main peaks (E{sub s}-E{sub m}) and a lower intensity ratio (I{sub s}/I{sub m}) are found to correlate with higher values of T{sub c}. Analysis of these spectra within a simple configuration interaction model suggests that higher values of T{sub c} are related to low values of the O 2p {r_arrow} Cu 3d charge transfer energy. In the O 1s region, a smaller bond length between Ba and Cu-O planar oxygen is found to correlate with a lower binding energy for the signal associated with Cu-O bonding, most likely resulting from the increased polarization screening by Ba{sup 2+} ions. For samples near optimum doping, maximum T{sub c} is observed to occur when the Tl 4f{sub 7/2} binding energy is near 117.9 eV, which is near the middle of the range of values observed for Tl cuprates. Higher Tl 4f{sub 7/2} binding energies, corresponding to formal oxidation states nearer Tl{sup 1+}, are also found to correlate with longer bond lengths between Ba and Tl-O planar oxygen, and with higher binding energies of the O 1s signal associated with Tl-O bonding.
Chemical bonding in Tl cuprates studied by x-ray photoemission
Energy Technology Data Exchange (ETDEWEB)
Vasquez, R.P. [Center for Space Microelectronics Technology, Jet Propulsion Laboratory, California Institute of Technology, Pasadena, California 91109-8099 (United States); Siegal, M.P.; Overmyer, D.L. [Sandia National Laboratories, Albuquerque, New Mexico 87185-1421 (United States); Ren, Z.F.; Lao, J.Y.; Wang, J.H. [Materials Synthesis Laboratory, Department of Chemistry, State University of New York, Buffalo, New York 14260-3000 (United States)
1999-08-01
Epitaxial thin films of the Tl cuprate superconductors Tl{sub 2}Ba{sub 2}CaCu{sub 2}O{sub 8}, Tl{sub 2}Ba{sub 2}Ca{sub 2}Cu{sub 3}O{sub 10}, and Tl{sub 0.78}Bi{sub 0.22}Ba{sub 0.4}Sr{sub 1.6}Ca{sub 2}Cu{sub 3}O{sub 9{minus}{delta}} are studied with x-ray photoemission spectroscopy. These data, together with previous measurements in this lab of Tl{sub 2}Ba{sub 2}CuO{sub 6+{delta}} and TlBa{sub 2}CaCu{sub 2}O{sub 7{minus}{delta}}, comprise a comprehensive data set for a comparative study of Tl cuprates with a range of chemical and electronic properties. In the Cu 2p spectra, a larger energy separation between the satellite and main peaks (E{sub s}{minus}E{sub m}) and a lower intensity ratio (I{sub s}/I{sub m}) are found to correlate with higher values of T{sub c}. Analysis of these spectra within a simple configuration interaction model suggests that higher values of T{sub c} are related to low values of the O&hthinsp;2p{r_arrow}Cu&hthinsp;3d charge transfer energy. In the O&hthinsp;1s region, a smaller bond length between Ba and Cu-O planar oxygen is found to correlate with a lower binding energy for the signal associated with Cu-O bonding, most likely resulting from the increased polarization screening by Ba{sup 2+} ions. For samples near optimum doping, maximum T{sub c} is observed to occur when the Tl 4f{sub 7/2} binding energy is near 117.9 eV, which is near the middle of the range of values observed for Tl cuprates. Higher Tl&hthinsp;4f{sub 7/2} binding energies, corresponding to formal oxidation states nearer Tl{sup 1+}, are also found to correlate with longer bond lengths between Ba and Tl-O planar oxygen, and with higher binding energies of the O&hthinsp;1s signal associated with Tl-O bonding. {copyright} {ital 1999} {ital The American Physical Society}
Pulse shaper for scintillation detectors with NaI(Tl) or CsI(Tl) crystals
International Nuclear Information System (INIS)
Novisov, B.S.; Maksimenko, A.S.; Baryshev, A.V.; Zhukov, A.V.
1978-01-01
The basic circuit of a signal shaper for scintillation detectors with NaI(Tl) and CsI(Tl) crystals is described. To increase amplitude resolution, it is suggested to integrate not the whole charge at the photomultiplier output, but a part of the charge during the initial 100 ns of the current pulse; the remaining part of the current signal is compensated directly at the photomultiplier anode by means of an electric circuit. The principal elements of the spectrometric signal shaper include an input transistor amplifier, a compensation circuit, a key element, a shaper amplifier of time pulses, a shaper of signal duration for controlling the key element, and an output spectrometric amplifier. This device, being used, one can shape pulses at durations of 100 ns and more. The shaper restoration time does not exceed 50 ns. When the shaper operates with NaI(Tl) crystals and at counting rate of 10 6 pulse/s, the amplitude resolution with and without the compensation circuit is 17% and 21% respectively
International Nuclear Information System (INIS)
Zink, A.J.C.; Dabis, S.; Porto, E.; Castaing, J.
2010-01-01
With the development of thermoluminescence (TL) and optically stimulated luminescence (OSL) to determine the authenticity of old ceramics, forgers use artificial irradiation by gamma ray to age modern productions. Besides fraudulent action, objects can be exposed to various sources of X-rays (e.g. radiography, security control at airports). For all these reasons, the determination of artificial irradiation is an important topic for dating art objects. The main technique to identify artificial irradiations is the subtraction technique. It is based on the fact that alpha efficiency varies according to the luminescence technique (fine grain, coarse grains, predose, OSL). Having observed a rather significant difference of alpha efficiency for TL and OSL, we propose a new subtraction technique using OSL and TL of fine grains.
Remote TL and OSL for asteroid and meteorite study
International Nuclear Information System (INIS)
Takaki, Shunji; Ikeya, Motoji; Yamanaka, Chihiro
1997-01-01
Thermoluminescence (TL) and optically stimulated luminescence (OSL) of the Allende meteorite have been studied using infrared CO 2 laser light as a heat source and He-Ne laser light to excite the material, respectively from a long distance. New techniques of remote TL (R-TL) and remote OSL (R-OSL) have been developed for future remote dating from a long distance in a planetary survey. The upper limits of the distance for R-TL and R-OSL were estimated using the laboratory TL signal of the meteorite peaking at 320 o C: about 400 photons s -1 for the R-TL and 60 photons s -1 for R-OSL at a distance of 1 km using a laser beam with the divergence of 0.1 mrad at powers of 100 and 1 W, respectively. An age limit of 10 5 or 10 6 years due to the signal saturation and the objects heterogeneity, as expected from previous studies, may make the asteroid survey difficult but would still help to investigate the surface activities of icy planets and satellites in outer planet worlds. (author)
Studies on the tumor and organ affinity of /sup 201/Tl
Energy Technology Data Exchange (ETDEWEB)
Mori, H; Ando, I; Takeuchi, T [Kanazawa Univ. (Japan). School of Medicine; Ando, A; Hiraki, T
1980-01-01
In order to evaluate the tumor and organ affinity of /sup 201/Tl, using the Yoshida sarcoma bearing rats, the distribution of /sup 201/Tl/sup +/ in tissues and tumor was examined and compared to /sup 22/Na/sup +/, /sup 42/K/sup +/, /sup 86/Rb/sup +/, /sup 134/Cs/sup +/, and /sup 67/Ga-citrate. /sup 201/Tl/sup +/ showed almost same organ accumulation and kinetics as /sup 42/K/sup +/, /sup 86/Rb/sup +/, /sup 134/Cs, whereas /sup 201/Tl/sup +/ and /sup 22/Na/sup +/ had completely different organ distribution. These results suggest that organ affinity of /sup 201/Tl/sup +/ might be related to active transport, namely Na/sup +/-K/sup +/-ATPase pump mechanism as well as blood flow. However, it appeared to be taken into account the other factors such as different accumulation and clearance rate due to different substrates of organs. Kidney accumulation rate of /sup 201/Tl/sup +/ was much higher than /sup 42/K/sup +/, /sup 86/Rb/sup +/, /sup 134/Cs/sup +/ and about 10 times as /sup 42/K/sup +/. Macroautoradiograms of rat kidneys showed that /sup 201/Tl/sup +/ exhibited an initial high accumulation in the cortex and appeared in the outer cortex, as the cortex cleared of radioactivity. /sup 201/Tl might be interchangeable with K/sup +/ in the tubular system, reabsorbed with more affinity and cleared more slowly than K/sup +/. The tumor accumulation /sup 201/Tl/sup +/ might be related to Na/sup +/-K/sup +/-ATPase pump mechanism as well as other organs. However, in terms of tumor accumulation and concentration ratio to other organs, /sup 201/Tl/sup +/ was inferior to /sup 67/Ga-citrate, although the tumor to blood ratio was identical to that of /sup 67/Ga-citrate. Since /sup 201/Tl/sup + + +/ showed almost same distribution as /sup 201/Tl/sup +/, /sup 201/Tl/sup + + +/ might change into /sup 201/Tl/sup +/ in vivo.
The superconductor (Tl,Hg,Ca)2(Ba,Sr)2(Ca,Sr,Tl)Cu2O7.6
International Nuclear Information System (INIS)
Valldor, M.; Bryntse, I.; Morawski, A.
2002-01-01
In the title 2212-type superconductor (thallium mercury calcium barium strontium copper oxide), which contains both Tl and Hg in the charge reservoir (CR), Sr is located at both alkali-earth (AE) metal sites. Ca enters the CR at the same time as Tl shares the smaller AE site, which increases the apical Cu-Cu distance significantly. The structure causes the superconducting Cu-O layers to become significantly puckered. (orig.)
The TL and OSL study of hydroxyapatites for dosimetric applications
International Nuclear Information System (INIS)
Alencar, Marcus A. Vallim de
2009-01-01
The hydroxyapatite, the principal mineral component of the bone and tooth enamel, is one of the dosimetric materials that has distinguished itself in the high dose and accidents dosimetry, as well as in the dating, for the Electron Paramagnetic Resonance (EPR) technique. For this reason, the hydroxyapatite could also be used as Thermoluminescence (TL) and Optically Stimulated Luminescence (OSL) dosimeter in the dosimetry of high doses and accidents, and also in the archaeological and geological dating. This work presents a brief study of the TL and OSL behaviour of the B type synthetic carbonated hydroxyapatite, observing the possibility to use this material in TL and OSL dosimetry. The samples were irradiated to a dose of 100 Gy and 1000 Gy, and the TL and OSL measurements were obtained by the RISOE TL/OSL reader, model TL/OSL-DA-15B. The first results demonstrate the presence of three peaks in the TL glow curve in the temperatures of 100 deg C, 150 deg C and 280 deg C. The synthetic carbonated hydroxyapatite also presents an OSL signal when the sample is stimulated with blue light and a small OSL signal for stimulation with infrared light (IR). These results indicate the possibility of this synthetic carbonated hydroxyapatite to be used as dose indicator material using the TL and OSL techniques. (author)
Kinetic parameters and TL mechanism in cadmium tetra borate phosphor
International Nuclear Information System (INIS)
Annalakshmi, O.; Jose, M.T.; Sridevi, J.; Venkatraman, B.; Amarendra, G.; Mandal, A.B.
2014-01-01
Polycrystalline powder samples of cadmium tetra borate were synthesized by a simple solid state sintering technique and gamma irradiated sample showed a simple Thermoluminescence (TL) glow peak around 460 K. The TL kinetic parameters of gamma irradiated phosphor were determined by initial rise (IR), isothermal decay (ID), peak shape (PS), variable heating rate (VHR) and glow curve de-convolution method. The kinetic parameters such as activation energy (E), frequency factor (s) and order of kinetics (b) were calculated by IR, ID, PS and VHR methods are in the order of ∼1.05 eV, 10 9 –10 12 s −1 and 1.58, respectively. From the results of TL and PL emission studies carried out on the phosphor revealed that the defect centers related to TL is different from that for PL. EPR measurements were carried out to identify the defect centers formed in cadmium tetra borate phosphor on gamma irradiation. Based on EPR studies the mechanism for TL process in cadmium tetra borate is proposed in this paper -- Highlights: • Polycrystalline powder samples of undoped cadmium tetra borate synthesized. • Cadmium tetra borate phosphor exhibits a dosimetric peak at 458 K. • Kinetic parameters of the trap responsible for TL evaluated. • TL mechanism is proposed from TL to EPR correlation studies
Kinetic parameters and TL mechanism in cadmium tetra borate phosphor
Energy Technology Data Exchange (ETDEWEB)
Annalakshmi, O. [Radiological Safety Division, Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Jose, M.T., E-mail: mtj@igcar.gov.in [Radiological Safety Division, Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Sridevi, J. [Central Leather Research Institute, Council of Scientific and Industrial Research, Chennai 600 020, Tamilnadhu (India); Venkatraman, B. [Radiological Safety Division, Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Amarendra, G. [Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Mandal, A.B. [Central Leather Research Institute, Council of Scientific and Industrial Research, Chennai 600 020, Tamilnadhu (India)
2014-03-15
Polycrystalline powder samples of cadmium tetra borate were synthesized by a simple solid state sintering technique and gamma irradiated sample showed a simple Thermoluminescence (TL) glow peak around 460 K. The TL kinetic parameters of gamma irradiated phosphor were determined by initial rise (IR), isothermal decay (ID), peak shape (PS), variable heating rate (VHR) and glow curve de-convolution method. The kinetic parameters such as activation energy (E), frequency factor (s) and order of kinetics (b) were calculated by IR, ID, PS and VHR methods are in the order of ∼1.05 eV, 10{sup 9}–10{sup 12} s{sup −1} and 1.58, respectively. From the results of TL and PL emission studies carried out on the phosphor revealed that the defect centers related to TL is different from that for PL. EPR measurements were carried out to identify the defect centers formed in cadmium tetra borate phosphor on gamma irradiation. Based on EPR studies the mechanism for TL process in cadmium tetra borate is proposed in this paper -- Highlights: • Polycrystalline powder samples of undoped cadmium tetra borate synthesized. • Cadmium tetra borate phosphor exhibits a dosimetric peak at 458 K. • Kinetic parameters of the trap responsible for TL evaluated. • TL mechanism is proposed from TL to EPR correlation studies.
International Nuclear Information System (INIS)
Henning, W.; Kutschera, W.; Ernst, H.
1984-01-01
205 Tl has been previously proposed as a geological detector for solar neutrinos, making use of the reaction 205 Tl(nu, e - ) 205 Pb with a neutrino threshold of only approx. = 43 keV. We report on an experiment performed to study the feasibility of detecting radioactive 205 Pb nuclei (T/sub 1/2/ = 15 million years) at very low concentrations using the recently developed technique of accelerator mass spectrometry. Employing the high-energy ion beams of good quality from the UNILAC heavy-ion accelerator at the GSI Darmstadt, we are able to demonstrate a suppression of neighbouring isotopes to better than 1 in 10 16 and of neighbouring elements to about 1 in 10 3 . While these results are very encouraging, the minimum number of atoms detectable is still severely limited by the efficiency of producing multiply-charged ions from present ion sources. Future improvements in ion-source performance are briefly discussed
Detailed α -decay study of 180Tl
Andel, B.; Andreyev, A. N.; Antalic, S.; Barzakh, A.; Bree, N.; Cocolios, T. E.; Comas, V. F.; Diriken, J.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Franchoo, S.; Ghys, L.; Heredia, J. A.; Huyse, M.; Ivanov, O.; Köster, U.; Liberati, V.; Marsh, B. A.; Nishio, K.; Page, R. D.; Patronis, N.; Seliverstov, M. D.; Tsekhanovich, I.; Van den Bergh, P.; Van De Walle, J.; Van Duppen, P.; Venhart, M.; Vermote, S.; Veselský, M.; Wagemans, C.
2017-11-01
A detailed α -decay spectroscopy study of 180Tl has been performed at ISOLDE (CERN). Z -selective ionization by the Resonance Ionization Laser Ion Source (RILIS) coupled to mass separation provided a high-purity beam of 180Tl. Fine-structure α decays to excited levels in the daughter 176Au were identified and an α -decay scheme of 180Tl was constructed based on an analysis of α -γ and α -γ -γ coincidences. Multipolarities of several γ -ray transitions deexciting levels in 176Au were determined. Based on the analysis of reduced α -decay widths, it was found that all α decays are hindered, which signifies a change of configuration between the parent and all daughter states.
Comparison of TL profiles in recent sea cores
Energy Technology Data Exchange (ETDEWEB)
Castagnoli, G C; Bonino, G
1985-01-01
The thermoluminescence (TL) profile of different recent Tyrrhenian sea cores sampled at various intervals during the last centuries have been compared in order to check the reproducibility of the profiles and investigate the possibility of using the results for monitoring solar-terrestrial relations in the past. The satisfactory results obtained by comparison of two different cores in the time interval 1755-1969 A.D. has demonstrated: (a) the two TL profiles are correlated; (b) the 11 yr cycle corresponding to the main solar cycle is evident in both TL profiles.
International Nuclear Information System (INIS)
Zhou Dehai; Zhou Jimeng
1989-01-01
The adsorptive behavior of polymer of methyl aldehyde of dibenzo-18-crown-6 (PDB-18C6) in hydrochloric acid medium is studied and it is shown that the adsorption of T1(I), Au(III), and Cu(II) depends on the particle size of the crown ether resins, hydrochloric acid concentration and amount of the crown ether resins used. The difference in the adsorption behavior of different particle sizes of crown ether resins may be used for separating Tl(I), Au(III), and Cu(II) ions. The best eluant of Tl(I) and Au(III) is 0.4 mol/l perchloric acid and 2-ethoxy-ethanol. The recovery for Tl(I) is 82-98.8%. The gold target is bombarded in a 1.2 m cyclotron with 25-27 MeV α-particle with a cumulative beam intensities of 27μA·h, and 199 Tl is separated from the gold target with PDB-18C6. γ-spectrometry has shown that the Tl obtained is 199 Tl of high purity containing only about 0.50% 200 Tl
Development of surgical gamma probes with TlBr semiconductors and CsI(Tl) scintillators crystals
International Nuclear Information System (INIS)
Costa, Fabio Eduardo da
2006-01-01
Radio guided surgery, using probes with radiation detectors, has been prominence in the medical area in the last decade. This technique consists in injecting a radioactive substance to concentrate in tumour and assist the localization during the surgical procedure. The radio guided surgeries allowing the identification of lymph node has revolutioned the behavior of tumour in initial stadium when are being spread by lymphatic way. The conditions imposed to the surgery due the proximity between some lymph nodes, demands of the probes, a small diameters and capacity of individual identification of these lymph nodes radiolabelled by a specific tracer. The international market supplies these probes with CdTe semiconductors and scintillators, but there is some time lack a promptly technical assistance in the Brazilian market. This work developed probes with national technology, using CsI(Tl) scintillators crystals and, in substitution to CdTe crystals semiconductors, the TlBr crystal, that is a new semiconductor detector in a world-wide development, with advantages in relation to the CdTe. Both crystals have been grown in IPEN. All the necessary electronics, specially, the preamplifier, that was also a restrictive factor for development of these types of probe in the country, have been developed with components found in the national market. Systematic measures of spatial resolution, spatial selectivity, maximum sensitivity and quality of the shielding have been carried the probes development. The results have shown that the probes, one with the CsI(Tl) crystal and another with TlBr semiconductor presented the requested performance in the international literature for radio guided probes. (author)
How Experienced SoTL Researchers Develop the Credibility of Their Work
Directory of Open Access Journals (Sweden)
Jennie Billot
2017-03-01
Full Text Available Teaching and learning research in higher education, often referred to as the Scholarship of Teaching and Learning (SoTL, is still relatively novel in many academic contexts compared to the mainstay of disciplinary research. One indication of this is the challenges those who engage in SoTL report in terms of how this work is valued or considered credible amongst disciplinary colleagues and in the face of institutional policies and practices. This paper moves beyond the literature that describes these specific challenges to investigate how 23 experienced SoTL researchers from five different countries understood the notion of credibility in relationship to their SoTL research and how they went about developing credibility for their work. Semi-structured interviews were facilitated and analyzed using inductive analysis. Findings indicate that notions of credibility encompassed putting SoTL research into action and building capacity and community around research findings, as well as gaining external validation through traditional indicators such as publishing. SoTL researchers reported a variety of strategies and approaches they were using, both formal and informal, to develop credibility for their work. The direct focus of this paper on credibility of SoTL work as perceived by experienced SoTL researchers, and how they go about developing credibility, is a distinct contribution to the discussions about the valuing of SoTL work.
Automation of TL brick dating by ADAM-1
International Nuclear Information System (INIS)
Cechak, T.; Gerndt, J.; Hirsl, P.; Jirousek, P.; Kubelik, M.; Musilek, L.; Kanaval, J.
2000-01-01
Thermoluminescence has become an established dating method for ceramics and more recently for bricks. Based on the experiences of the work carried out since the late 1970's at the Rathgen-Forschungslabor in Berlin on the dating of bricks from historic architecture, and after evaluating all commercially available and some individually built automated and semi-automated TL-readers, a specially adapted machine for the fine grain dating of bricks was constructed in an interdisciplinary research project, undertaken by a team recruited from three faculties of the Czech Technical University in Prague. The result is the automated TL-reader ADAM-1 (Automated Dating Apparatus for Monuments) for the dating of historic architecture. Both the specific adaptation of the technique and the necessary optimal automation have influenced the design of this TL-reader. The principle advantage of brick as opposed to ceramic TL-dating emerges from the possibility of being able to obtain both a large number of samples and an above average quantity of datable material from each sample. This, together with the specific physical and chemical conditions in a brick wall, allowed a rethinking of the traditional error calculation and thus lower error margins as those obtained when dating ceramic shards. The TL-reader must therefore be able to measure and evaluate automatically numerous samples. The annular sample holder of ADAM-1 has 60 sample positions, which allow the irradiation and evaluation of samples taken from two locations. The thirty samples from one sampling point are divided into subgroups, which are processed in various ways. Three samples serve for a rough estimate of the TL sensitivity of the brick material. Nine samples are used for the measurement of 'natural TL' of the material. A further nine samples are used for testing the sensitivity of the material to beta radiation. The last nine samples serve for the testing of the sensitivity to alpha radiation. To determine the
Two cases of hyperparathyroidism revealed by /sup 201/Tl-chloride
Energy Technology Data Exchange (ETDEWEB)
Otsuka, Kokichi; Asano, Haruko; Moriyama, Shigeharu (Okayama Red Cross Hospital (Japan))
1983-08-01
/sup 201/Tl scintigraphy at 15 min and 120 min after intravenous injection of /sup 201/TlCl revealed a parathyroidal adenoma (1.7g) in a 49-year-old female patient with hyperthyroidism complicated by renal calculi and that (1.8g) in a 58-year-old female patient without symptoms. /sup 75/Se could be substituted by /sup 201/Tl which was useful for localizing parathyroidal adenoma in hyperparathyroidism. /sup 201/Tl scintigraphy revealed the adenoma which was not palpable. The smallest adenoma detected by it was 0.9g.
Methods, qualitative and quantitative evaluations of 201Tl myocardial scintiscans
International Nuclear Information System (INIS)
Buell, U.; Kleinhans, E.; Klepzig, M.; Seiderer, M.; Strauer, B.E.
1981-01-01
Exercise 201 Tl myocardial scintiscanning is a technique used to supplement exercise electrocardiography. The procedure employed should be identical to the standard procedure of electrocardiography. If the coronary disease has already been established by coronary angiography and kineventriculography, 201 Tl examinations should be carried out before surgery in order to determine the ''regional functional reserve''. Visual evaluations of the 201 Tl scintiscans should be supplemented by quantification methods. Quantification is also required between 201 Tl examination and surgery and to assure constant diagnostic accuracy in case of examination by different examiners. (orig./MG) [de
Electronic structure of TlBa2CaCu2O7-δ
Vasquez, R. P.; Novikov, D. L.; Freeman, A. J.; Siegal, M. P.
1997-06-01
The core levels of TlBa2CaCu2O7-δ (Tl-1212) epitaxial films have been measured with x-ray photoelectron spectroscopy (XPS). The valence electronic structure has been determined using the full-potential linear muffin-tin-orbital band-structure method and measured with XPS. The calculations show that a van Hove singularity (VHS) lies above the Fermi level (EF) for the stoichiometric compound (δ=0), while for 50% oxygen vacancies in the Tl-O layer (δ=0.5) EF is in close proximity to the VHS. Samples annealed in nitrogen (to reduce the hole overdoping by the removal of oxygen) exhibit higher core-level binding energies and a higher Tc, consistent with a shift of EF closer to the VHS. Comparisons are made to the core levels and valence bands of Tl2Ba2CaCu2O8+δ (Tl-2212) and HgBa2CaCu2O6+δ (Hg-1212). The similarity of the Cu 2p3/2 spectra for Tl-1212 and Tl-2212 indicates that the number of Tl-O layers has little effect on the Cu-O bonding. However, the Tl-1212 and Hg-1212 Cu 2p3/2 signals exhibit differences which suggest that the replacement of Tl3+ with Hg2+ results in a decrease in the O 2p-->Cu 3d charge-transfer energy and differences in the probabilities of planar vs apical oxygen charge transfer and/or Zhang-Rice singlet-state formation. Differences between the Tl-1212 and the Tl-2212 and Hg-1212 measured valence bands are consistent with the calculated Cu 3d and (Tl,Hg) 6s/5d partial densities of states.
Electronic structure of TlBa2CaCu2O7-δ
International Nuclear Information System (INIS)
Vasquez, R.P.; Novikov, D.L.; Freeman, A.J.; Siegal, M.P.
1997-01-01
The core levels of TlBa 2 CaCu 2 O 7-δ (Tl-1212) epitaxial films have been measured with x-ray photoelectron spectroscopy (XPS). The valence electronic structure has been determined using the full-potential linear muffin-tin-orbital band-structure method and measured with XPS. The calculations show that a van Hove singularity (VHS) lies above the Fermi level (E F ) for the stoichiometric compound (δ=0), while for 50% oxygen vacancies in the Tl-O layer (δ=0.5) E F is in close proximity to the VHS. Samples annealed in nitrogen (to reduce the hole overdoping by the removal of oxygen) exhibit higher core-level binding energies and a higher T c , consistent with a shift of E F closer to the VHS. Comparisons are made to the core levels and valence bands of Tl 2 Ba 2 CaCu 2 O 8+δ (Tl-2212) and HgBa 2 CaCu 2 O 6+δ (Hg-1212). The similarity of the Cu 2p 3/2 spectra for Tl-1212 and Tl-2212 indicates that the number of Tl-O layers has little effect on the Cu-O bonding. However, the Tl-1212 and Hg-1212 Cu 2p 3/2 signals exhibit differences which suggest that the replacement of Tl 3+ with Hg 2+ results in a decrease in the O 2p→Cu 3d charge-transfer energy and differences in the probabilities of planar vs apical oxygen charge transfer and/or Zhang-Rice singlet-state formation. Differences between the Tl-1212 and the Tl-2212 and Hg-1212 measured valence bands are consistent with the calculated Cu 3d and (Tl,Hg) 6s/5d partial densities of states. copyright 1997 The American Physical Society
TL response to quartz and aluminum oxide grain for α-irradiation
International Nuclear Information System (INIS)
Pan Baolin; Wei Mingjian; Li Dongxu; Liu Zhaowen; Liu Chao; Zhao Shiyuan
2009-01-01
Thermoluminescence (TL) response for an α-ray irradiation system ( 241 Am) was examined with quartz grains of 11-40 μm. Quartz grains of different sizes, i.e. 137 Cs), before they were irradiated to different doses by the α-ray irradiation system. TL response to the quartz grain samples was measured. TL response of the quartz grains smaller than 4 μm and 11-40 μm to α-ray irradiation is the best, as the α-rays cannot penetrate quartz larger than 40 μm. The TL response characteristic is related with quartz grain surface area. TL responses to α-irradiation of 11-40 μm quartz and aluminum oxide grains were compared. The α-irradiation TL response of aluminum oxide (330 degree C) is better than the quartz (375 degree C). (authors)
A Call for Expanding Inclusive Student Engagement in SoTL
Directory of Open Access Journals (Sweden)
Peter Felten
2013-09-01
of student-faculty partnerships focused on inquiry into teaching and learning. However, some students tend to be privileged in SoTL initiatives while others are discouraged, implicitly or explicitly, from engaging in this work. In this paper, we consider why certain students tend to be excluded from SoTL, summarize the possible developmental gains made by students and faculty when diverse student voices are included, and highlight strategies for generating a more inclusive SoTL. We call for expanding student engagement in SoTL by encouraging a diversity of student voices to engage in co-inquiry with faculty. Inclusive engagement has tremendous potential to enhance student and faculty learning, to deepen SoTL initiatives, and to help redress the exclusionary practices that too often occur in higher education.
Development of tailor-made silica fibres for TL dosimetry
International Nuclear Information System (INIS)
Bradley, D.A.; Abdul Sani, Siti F.; Alalawi, Amani I.; Jafari, S.M.; Noor, Noramaliza M.; Hairul Azhar, A.R.; Mahdiraji, Ghafour Amouzad; Tamchek, Nizam; Ghosh, S.; Paul, M.C.; Alzimami, Khalid S.; Nisbet, A.; Maah, M.J.
2014-01-01
The Ge dopant in commercially available silica optical fibres gives rise to appreciable thermoluminscence (TL), weight-for-weight offering sensitivity to MV X-rays several times that of the LiF dosimeter TLD100. The response of these fibres to UV radiation, X-rays, electrons, protons, neutrons and alpha particles, with doses from a fraction of 1 Gy up to 10 kGy, have stimulated further investigation of the magnitude of the TL signal for intrinsic and doped SiO 2 fibres. We represent a consortium effort between Malaysian partners and the University of Surrey, aimed at production of silica fibres with specific TL dosimetry applications, utilizing modified chemical vapour deposition (MCVD) doped silica–glass production and fibre-pulling facilities. The work is informed by defect and dopant concentration and various production dependences including pulling parameters such as temperature, speed and tension; the fibres also provide for spatial resolutions down to <10 µm, confronting many limitations faced in use of conventional (TL) dosimetry. Early results are shown for high spatial resolution (∼0.1 mm) single-core Ge-doped TL sensors, suited to radiotherapy applications. Preliminary results are also shown for undoped flat optical fibres of mm dimensions and Ge-B doped flat optical fibres of sub-mm dimensions, with potential for measurement of doses in medical diagnostic applications. - Highlights: • Optical fibres tailor-made for TL dosimetry. • Sensitive to diagnostic as well as therapy doses in medicine. • Preform and fibre pulling facilities. • Relative TL and EPR measurements
Natural quartz TL property and similarity in Piper nigrum L
International Nuclear Information System (INIS)
Guzman A, S.; Cruz Z, E.; Furetta, C.; Brown, F.; Barboza F, M.
2009-10-01
Quartz is a mineral abundant in nature and can provide information thermoluminescent (TL), and also is located in the mineral fraction of some herbs and spices consumed. It is present the analysis of the TL properties of a sample of natural quartz rock and compared with those obtained from the fraction of Piper nigrum L. poly mineral when they were exposed to 60 Co gamma radiation. The poly minerals of Piper nigrum L. were analyzed by X-ray diffraction, where the quartz was found as a major component. They separated in different particle sizes (10, 53, 74 and 149 μm). The samples were irradiated at relatively low doses (1-500 Gy) and high (0.1-40 kGy) in order to determine the linearity of the TL emission as a function of the dose and the analysis of glow curves. Also there was the fading of the TL signal, the effect of ultra violet light. The reproducibility of the TL signal in the samples indicates that a smaller particle size gives better TL signal. (author)
Conceptualizing and Communicating SoTL: A Framework for the Field
Directory of Open Access Journals (Sweden)
Janice Miller-Young
2015-09-01
Full Text Available The emerging field of SoTL is an inherently interdisciplinary endeavor which requires embracing a diverse range of research methods and disciplinary differences in world views. This diversity has caused a lack of coherence in its conceptualization and communication, which can be confusing for new scholars. Ongoing debates in the community concern the use of theory and methodology, as well as definitional questions of what constitutes SoTL and the nature of its purpose. This article offers a framework for conceptualizing the field which attempts to broadly delineate the available learning theories underlying and methodologies appropriate to studying teaching and learning, while intending to be hospitable to a broad range of diverse disciplines. Further, the framework illustrates the tacit links between learning theories and methodologies, serving as a guide to potential approaches to SoTL work. The framework is illustrated with example SoTL studies. It is hoped that the framework will help ground future SoTL investigations in appropriate theories and methodologies, and build interdisciplinary communication and understanding in the “trading zone” that is SoTL.
ORF Alignment: NC_003552 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... acetivorans str. C2A] ... Length = 291 ... Query: 27 ... CASPTAPIVYIDTDGSGDYNCDGKNDHIEINEALSFVNKNSDFTTVHLNGSNTYWIND...TL 86 ... CASPTAPIVYIDTDGSGDYNCDGKNDHIEINEALSFVNKNSDFTTVHLNGSNTYWIND...TL Sbjct: 1 ... CASPTAPIVYIDTDGSGDYNCDGKNDHIEINEALSFVNKNSDFTTVHLNGSNTYWINDTL 60 ... Query: 147 GNSFYNM
Experimental studies on radiation damages of CsI(Tl) crystals
International Nuclear Information System (INIS)
He Jingtang; Mao Yufang; Dong Xiaoli; Chen Duanbao; Li Zuhao
1997-01-01
The results of experimental studies on radiation damage of CsI(Tl) crystal were reported. There are radiation damage effects on CsI(Tl) crystal. Experimental studies on recovery of damaged CsI(Tl) crystals were made. It seems that after heating at 200 degree C for 4 hours, the damaged crystals could be recovered completely
Prediction of Phase Separation of Immiscible Ga-Tl Alloys
Kim, Yunkyum; Kim, Han Gyeol; Kang, Youn-Bae; Kaptay, George; Lee, Joonho
2017-06-01
Phase separation temperature of Ga-Tl liquid alloys was investigated using the constrained drop method. With this method, density and surface tension were investigated together. Despite strong repulsive interactions, molar volume showed ideal mixing behavior, whereas surface tension of the alloy was close to that of pure Tl due to preferential adsorption of Tl. Phase separation temperatures and surface tension values obtained with this method were close to the theoretically calculated values using three different thermodynamic models.
Naseem, Saadia; Winter, Stephan
2016-01-01
The quantity of genomic DNA-A and DNA-B of African cassava mosaic virus (ACMV) and East African cassava mosaic virus Uganda (Uganda variant, EACMV-UG) was analysed using quantitative PCR to assess virus concentrations in plants from susceptible and tolerant cultivars. The concentrations of genome components in absolute and relative quantification experiments in single and mixed viral infections were determined. Virus concentration was much higher in symptomatic leaf tissues compared to non-symptomatic leaves and corresponded with the severity of disease symptoms. In general, higher titres were recorded for EACMV-UG Ca055 compared to ACMV DRC6. The quantitative assessment also showed that the distribution of both viruses in the moderately resistant cassava cv. TMS 30572 was not different from the highly susceptible cv. TME 117. Natural mixed infections with both viruses gave severe disease symptoms. Relative quantification of virus genomes in mixed infections showed higher concentrations of EACMV-UG DNA-A compared to ACMV DNA-A, but a marked reduction of EACMV-UG DNA-B. The higher concentrations of EACMV-UG DNA-B compared to EACMV DNA-A accumulation in single infections were consistent. Since DNA-B is implicated in virus cell-to-cell spread and systemic movement, the abundance of the EACMV-UG DNA-B may be an important factor driving cassava mosaic disease epidemic. Copyright © 2015 Elsevier B.V. All rights reserved.
Stability of Tl-Ba-Ca-Cu-O superconducting thin films
International Nuclear Information System (INIS)
Siegal, M. P.; Overmyer, D. L.; Venturini, E. L.; Padilla, R. R.; Provencio, P. N.
1999-01-01
We report the stability of TlBa 2 CaCu 2 O 7 and Tl 2 Ba 2 CaCu 2 O 8 on LaAlO 3 (100) epitaxial thin films, under a variety of conditions. All films are stable in acetone and methanol and with repeated thermal cycling to cryogenic temperatures. Moisture, especially vapor, degrades film quality rapidly. These materials are stable to high temperatures in either N 2 or O 2 ambients. While total degradation, resulting from Tl depletion, occurs at the same temperatures for both phases, 600 degree sign C in N 2 and 700 degree sign C in O 2 , the onset of degradation occurs at somewhat lower temperatures for TlBa 2 CaCu 2 O 7 than for Tl 2 Ba 2 CaCu 2 O 8 . (c) 1999 Materials Research Society
Electronic Structure of TlBa2CaCu2O(7-Delta)
Vasquez, R. P.; Novikov, D. L.; Freeman, A. J.; Siegal, M. P.
1997-01-01
The core levels of TlBa2CaCu2O(7-delta) (Tl-1212) epitaxial films have been measured with X-ray photoelectron spectroscopy (XPS). The valence electronic structure has been determined using the full-potential linear muffin-tin-orbital band-structure method and measured with XPS. The calculations show that a van Hove singularity (VHS) lies above the Fermi level (E(sub F)) for the stoichiometric compound (delta = 0.5), while for 50% oxygen vacancies in the Tl-O layer (delta = 0.5) E(sub F) is in close proximity to the VHS. Samples annealed in nitrogen (to reduce the hole overdoping by the removal of oxygen) exhibit higher core-level binding energies and a higher T(sub c), consistent with a shift of E(sub F) closer to the VHS. Comparisons are made to the core levels and valence bands of Tl2Ba2CaCu2O(8 + delta)(Tl-2212) and HgBa2CaCu2O)6 + delta) (Hg- 1212). The similarity of the Cu 2p(sub 3/2) spectra for Tl-1212 and Tl-2212 indicates that the number of Tl-O layers has little effect on the Cu-O bonding. However, the Tl-1212 and Hg-1212 Cu 2p(sub 3/2) signals exhibit differences which suggest that the replacement of T(sup 3+) with Hg(sup 2+) results in a decrease in the O 2p right arrow Cu 3d charge-transfer energy and differences in the probabilities of planar vs apical oxygen charge transfer and/or Zhang-Rice singlet-state formation. Differences between the Tl-1212 and the Tl-2212 and Hg-1212 measured valence bands are consistent with the calculated Cu 3d and (Tl,Hg) 6s/5d partial densities of states.
TL1A regulates TCRγδ+ intraepithelial lymphocytes and gut microbial composition
DEFF Research Database (Denmark)
Tougaard, Peter; Skov, S.; Pedersen, A. E.
2015-01-01
TL1A is a proinflammatory cytokine, which is prevalent in the gut. High TL1A concentrations are present in patients with inflammatory bowel disease (IBD) and in IBD mouse models. However, the role of TL1A during steady‐state conditions is relatively unknown. Here, we used TL1A knockout (KO) mice ...
TL response of citrine samples for high-dose dosimetry
International Nuclear Information System (INIS)
Teixeira, Maria Ines; Caldas, Linda V.E.
2011-01-01
The possibility of using samples of Brazilian stones as quartz, amethyst, topaz, etc. for high-dose dosimetry has been studied in recent years at IPEN, using the thermoluminescence technique (TL). In this work, the TL properties of citrine samples were studied. They were exposed to different doses of gamma radiation ( 60 Co). The natural citrine stone was extracted from a mine in Minas Gerais state, Brazil; it is a tectosilicate ranked as one of three-dimensional structure, showing clear yellow to golden brown color. The natural citrine stone is classified as quartz (SiO 2 ), and it has a lower symmetry and more compact reticulum. The citrine stone samples were powdered, and the selected grains were mixed with Teflon in the proportion 2 (Teflon):1 (Citrine). The mixture was pressed and sintered for production of Citrine -Teflon pellets of 50 mg. The TL emission curve showed two peaks at 160 deg C and 220 deg C. To remove the TL peak (160 deg C) of the sintered citrine pellet glow curves, different thermal treatments were tested during several time intervals. The TL dose-response curve between 50 Gy and 100 kGy, the reproducibility of TL response and the lower detection dose were obtained. The preliminary results show that citrine may be useful for high-dose dosimetry. (author)
Photon and neutron energy response of Thermoluminescent (TL) dosimeters
International Nuclear Information System (INIS)
Thilagam, L.; Priya, M.R.; Mohapatra, D.K.
2018-01-01
Theoretical Monte Carlo (MC) simulations are carried out to investigate the relative thermoluminesence (TL) response of the most commonly used TLD materials to a wide range of photon energy. The effect of polytetrafluoroethylene (PTFE) on TL response of CaSO 4 :Dy is also studied. Additionally, the neutron response of LiF:Mg,Ti TL materials with different concentrations of 6 Li is estimated in terms of the number of 6 Li(n, t) 4 He capture reactions for a wider neutron energy
Magnetism and superconductivity of some Tl-Cu oxides
Datta, Timir
1991-01-01
Many copper oxide based Thallium compounds are now known. In comparison to the Bi-compounds, the Tl-system shows a richer diversity; i.e., High Temperature Superconductors (HTSC) can be obtained with either one or two Tl-0 layers (m = 1,2); also, the triple-digit phases are easier to synthesize. The value of d, oxygen stoichiometry, is critical to achieving superconductivity. The Tl system is robust to oxygen loss; Tl may be lost or incorporated by diffusion. A diffusion coefficient equal to 10 ms at 900 C was determined. Both ortho-rhombic and tetragonal structures are found, but HTSC behavior is indifferent to the crystal symmetry. This system has the highest T(sub c) confirmed. T(sub c) generally increases with p, the number of CuO layers, but tends to saturate at p = 3. Zero resistance was observed at temperatures as great as 125 K. Most of these HTSC's are hole type, but the Ce-doped specimens may be electronic. The magnetic aspects were studied; because in addition to defining the perfectly diamagnetic ground state as in conventional superconductors, magnetism of the copper oxides show a surprising variety. This is true of both the normal and the superconducting states. Also, due to the large phonon contribution to the specific heat at the high T(sub c) jump, electronic density of states, D(Ef), and coherence length are uncertain, and thus, are estimated from the magnetic results. Results from the Tl-system CuO, LaBaCuO,120 and the Bi-CuO compounds are discussed. The emphasis is on the role of magnetism in the Tl-CuO HTSC, but technological aspects are also pointed out.
International Nuclear Information System (INIS)
Dolidze, Tina D.; Khoshtariya, Dimitri E.; Behm, Martin; Lindbergh, Goeran; Glaser, Julius
2005-01-01
Extending our recent insights in two-electron transfer microscopic mechanisms for a Tl III /Tl I redox system [D.E. Khoshtariya, et al., Inorg. Chem. 41 (2002) 1728], the electrochemical response of glassy carbon electrode in acidified solutions of Tl III (ClO 4 ) 3 containing different concentrations of sodium cyanide has been extensively studied for the first time by use of cyclic voltammetry and the CVSIM curve simulation PC program. The complex [Tl III (CN) 2 ] + has been thoroughly identified electrochemically and shown to display a single well-defined reduction wave (which has no anodic counterpart), ascribed to the two-equivalent process yielding [Tl I (aq)] + . This behavior is similar to that of [Tl III (aq)] 3+ ion in the absence of sodium cyanide, disclosed in the previous work, and is compatible with the quasi-simultaneous yet sequential two-electron transfer pattern (with two reduction waves merged in one), implying the rate-determining first electron transfer step (resulting in the formation of a covalently interacting di-thallium complex as a metastable intermediate), and the fast second electron transfer step. Some preliminary studies of the two-equivalent reduction of directly metal-metal bonded stable compound [(CN) 5 Pt II -Tl III ] 0 has been also performed displaying two reduction waves compatible with a true sequential pattern
International Nuclear Information System (INIS)
Hyun, In Young; Kim, Sung Eun; Seo, Jeong Kee; Hong, Eui Soo; Kwan, Jun; Park, Keum Soo; Lee, Woo Hyung
2000-01-01
We compared estimates of ejection fraction (EF) determined by gated Tl-201 perfusion SPECT (g-Tl-SPECT) with those by gated blood pool (GBP) scan. Eighteen subjects underwent g-Tl-SPECT and GBP scan. After reconstruction of g-Tl-SPECT, we measured EF with Cedars software. The comparison of the EF with g-Tl-SPECT and GBP scan was assessed by correlation analysis and Bland Altman plot. The estimates of EF were significantly different (p<0.05) with g-Tl-SPECT (40%±14%) and GBP scan (43%±14%). There was an excellent correlation of EF between g-Tl-SPECT and GBP scan (r=3D0.94, p<0.001). The mean difference of EF between GBP scan and g-Tl-SPECT was +3.2%. Ninety-five percent limits of agreement were ±9.8%. EF between g-Tl-SPECT and GBP scan were in poor agreement. The estimates of EF by g-Tl-SPECT was well correlated with those by GBP scan. However, EF of g-Tl-SPECT doesn't agree with EF of GBP scan. EF of g-Tl-SPECT can't be used interchangeably with EF of GBP scan.=20
Tl and OSL on diopside crystal
International Nuclear Information System (INIS)
Cano, N.F.; Watanabe, S.; Mittani, J.C.R.; Yukihara, E.G.
2006-01-01
The diopside with chemical composition CaMgSi 2 O 6 is part of an important solid solution series of the pyroxene group. The mineral is commonly found in meteorites and it is an important rock forming mineral of medium and high grade metamorphic rocks which are rich in calcium. In the bibliography it is possible to found several studies on electron spin resonance (ESR), reflectance, etc. but not on thermoluminescence (TL) or optically stimulated luminescence (OSL). In the present work we studied diopside TL and OSL behaviour on natural and natural irradiated samples. The sample used in our study is a white coloured diopside provided by Mineracao Sao Judas located in Sao Paulo, Brazil. The X-Ray Fluorescence technique has shown high concentrations of SiO 2 (55.81 % mol), CaO (23.47 % mol), MgO (18.03 % mol), Al 2 O 3 (1.56 % mol), Fe 2 O 3 (0.53 % mol), K 2 O (0.44 % mol), TiO 2 (0.065 % mol), P 2 O 5 (0.026 % mol), and MnO (0.013 % mol). TL measurements on natural samples show four TL peaks at 160, 260, 360, and 450 C. After beta-irradiation an increment mainly in the low temperature peaks is observed. As for OSL measurements, low OSL signal was observed on natural samples using blue light stimulation and UV detection. The intensity of the signal was observed to increase with the irradiation dose. (Author)
Auto-regenerative TL dating with zircon inclusions from fired materials
International Nuclear Information System (INIS)
Templer, R.H.; Smith, B.W.
1988-01-01
In this paper it is shown that it is possible to date fired material using zircon inclusions. The effects of zoning and anomalous fading are overcome using an auto-regenerative dating procedure. The high radioactivity of the grains gives a measurable self-induced TL (thermoluminescence) signal within a few months. Comparison of this ''auto-regenerated'' TL with the natural TL (which has accumulated since the firing) yields the age of the material. A sensitive TL reader capable of recording the auto-regenerated signal after 6 months is also described, and the results of age determinations on a number of known age samples are presented. (author)
Progress and problems with automated TL dating
International Nuclear Information System (INIS)
McKerrell, H.; Mejdahl, V.
1981-01-01
A number of basic problems connected with the measurement of beta and gamma dose-rates are discussed, and the possibility of using low-temperature peaks in quartz and feldspar for dose-rate measurements is examined. Preliminary results of TL measurements on individual grains of quartz and feldspar are presented. A TL dating method based on the difference in the archaeological dose received by potassium feldspar and quartz grains is proposed. (author)
Energy Technology Data Exchange (ETDEWEB)
Mozolyuk, M.Y.; Piskach, L.V. [Department of Inorganic and Physical Chemistry, Lesya Ukrainka Eastern European National University, 13 Voli Avenue, 43025, Lutsk (Ukraine); Fedorchuk, A.O. [Department of Inorganic and Organic Chemistry, Lviv National University of Veterinary Medicine and Biotechnologies, 50 Pekarska Street, 79010, Lviv (Ukraine); Olekseyuk, I.D.; Parasyuk, O.V. [Department of Inorganic and Physical Chemistry, Lesya Ukrainka Eastern European National University, 13 Voli Avenue, 43025, Lutsk (Ukraine); Khyzhun, O.Y., E-mail: khyzhun@ipms.kiev.ua [Frantsevych Institute for Problems of Materials Science, National Academy of Sciences of Ukraine, 3 Krzhyzhanivsky Street, 03142, Kyiv (Ukraine)
2017-07-01
Chalcogenides of the quasi-ternary system Tl{sub 2}S–PbS–SiS{sub 2} were synthesized in the evacuated silica ampoules by the melting and annealing technique. Phase equilibria in the system was investigated by XRD method. Isothermal section of the system was studied, and two intermediate quaternary phases were discovered to exist (Tl{sub 2}PbSiS{sub 4}, ∼Tl{sub 2}PbSi{sub 3}S{sub 8}). The quasi-binary section Tl{sub 2}SiS{sub 3}–PbS was investigated by DTA. Its phase diagram was constructed, and it was established that the equimolar compound melts incongruently at 818 K. The crystal structure of the quaternary compound Tl{sub 2}PbSiS{sub 4} was determined by X-ray powder diffraction. It crystallizes in the monoclinic space group P2{sub 1}/a with the unit-cell parameters a = 8.8141(4), b = 9.0150(5), c = 10.4383(5) Å, and β = 94.490(4)° (Tl{sub 2}PbGeS{sub 4} structure type). Reliability factors calculated in the isotropic approximation were found to be R{sub I} = 0.0564 and R{sub P} = 0.1070. The Tl{sub 2}PbSiS{sub 4} single crystal was tested with X-ray photoelectron spectroscopy. In particular, the XPS core-level and valence-band spectra were recorded for pristine and Ar{sup +}-ion bombarded surfaces of Tl{sub 2}PbSiS{sub 4}. The Tl{sub 2}PbSiS{sub 4} single crystal was found to be rather stable with respect to Ar{sup +}-ion irradiation. We have also measured the X-ray emission band depicting the energy distribution of mainly the S 3p states and compared it on a common energy scale with the XPS valence-band spectrum of the Tl{sub 2}PbSiS{sub 4} crystal. The above comparison indicates that the S 3p states contribute substantively in the upper portion of the valence band of Tl{sub 2}PbSiS{sub 4}, with their significant contributions in other portions of the valence-band region. - Highlights: • Chalcogenides of the quasi-ternary system Tl{sub 2}S–PbS–SiS{sub 2} were synthesized. • Two intermediate quaternary phases were discovered to exist (Tl
International Nuclear Information System (INIS)
Waetzig, W.
1980-01-01
Using the reaction 197 Au( 3 He,xn) Tl the decay of the nuclides 188 Tl and 190 Tl to 188 Hg (Tsub(1/2) = 70s) respectively to 190 Hg(Tsub(1/2) = 3.0 min) was studied at the mass separator ISOCELE of the Orsay-synchrocyclotron by gamma, conversion electron, gamma-gamma coincidence, and electron-gamma coincidence spectroscopy. The level schemes of 188 Hg and 190 Hg could be remarkably extended in comparison with earlier works. By a statistical analysis of the nuclear level density the nuclear temperature was calculated as a measure for the number of excitation modes of these nuclei. (orig./HSI) [de
Performance of novel materials for radiation detection: Tl3AsSe3, TlGaSe2, and Tl4HgI6
International Nuclear Information System (INIS)
Kahler, D.; Singh, N.B.; Knuteson, D.J.; Wagner, B.; Berghmans, A.; McLaughlin, S.; King, M.; Schwartz, K.; Suhre, D.; Gotlieb, M.
2011-01-01
In this paper we report on the electrical characteristics of three novel ternary compounds, Tl 3 AsSe 3 (TAS), TlGaSe 2 (TGS), and Tl 4 HgI 6 (THI), pertaining to their use as radiation detectors. The details for growth and material characterization are not presented. A semiconductor based gamma ray detector requires a material with high Z, high density, high resistivity, appropriate bandgap (1.5-2 eV), low energy/electron-hole pair, and a high μτ product. CZT is currently the best semiconductor material for room temperature gamma ray spectroscopy; however, it is extremely difficult to produce large volumes of detector grade material, making it expensive and in limited supply. DNDO/DHS began searching for other materials that might perform as well as CZT but be easier to grow and in the end lower the cost. For this purpose, we investigated the above three materials as possible replacements for CZT as gamma ray detectors. The bulk resistivity, I-V curves, X-ray response, and gamma ray response measurements for doped and undoped crystals are presented and discussed. TAS shows good X-ray and gamma ray response, but has poor resistivity, which results in large dark current and poor spectral response. TGS has good resistivity, but shows poor X-ray and gamma ray response. THI has excellent resistivity, shows some X-ray and gamma ray response, and has great potential as a gamma ray detector.
Leg 201Tl-SPECT in chronic exertional compartment syndrome
International Nuclear Information System (INIS)
Elkadri, N.; Slim, I.; Blondet, C.; Choquet, Ph.; Constantinesco, A.; Lecocq, J.
2004-01-01
Leg 201 Tl-SPECT in chronic exertional compartment syndrome Background: The chronic exertional compartment syndrome is one of the most frequent origins regarding leg pain due to sport training. The diagnosis can be established by invasive compartment pressure measurement. The aim of this study is to evaluate the role that could have 201 Tl-SPECT for patients with suspicion of compartment syndrome. Patients and methods: 51 leg 201 Tl-SPECT exams were performed (exercise - and rest without reinjection) in 49 patients; 28 had compartment syndrome confirmed by pressure measurement. About 100 MBq of 201 Tl were injected during exercise, when pain appeared or at least after 25 minutes exercise. We studied mean percentages of level uptake for each compartment, referred to the maximal uptake of both legs. Results: 47 compartments were concerned by compartment syndrome and 361 compartments were not. Scintigraphic patterns in compartments are reversible ischaemia (45%), uptake stability (36%) or reverse redistribution (19%); these patterns are not linked to compartment syndrome. However, there is a significant difference of rest 201 Tl level uptake between compartments with and without compartment syndrome and a significant correlation between muscular pressure measurement and rest level uptake. Conclusion: 201 Tl-SPECT shows that only ischaemia does not explain compartment syndrome. Moreover, it allows to predict pressure variation during exercise but it does not offer any interest in order to select patients for muscular invasive pressure measurement. (author)
Accidental and retrospective dosimetry using TL method
International Nuclear Information System (INIS)
Mesterházy, D.; Osvay, M.; Kovács, A.; Kelemen, A.
2012-01-01
Retrospective dosimetry is one of the most important tools of accidental dosimetry for dose estimation when dose measurement was not planned. In the affected area many objects can be applied as natural dosimeters. The paper discusses our recent investigations on various electronic components and common salt (NaCl) having useful thermoluminescence (TL) properties. Among materials investigated the electronic components of cell phones seem promising for retrospective dosimetry purposes, having high TL responses, proper glow curve peaks and the intensity of TL peaks vs. gamma dose received provided nearly linear response in the dose range of 10 mGy–1.5 Gy. - Highlights: ► Electronic components and common salt were investigated for accidental and retrospective dosimetry. ► SMD resistors seem promising for retrospective dosimetry purposes. ► Table salt can be used effectively for accidental dosimetry purposes, as well.
Stability of Tl-Ba-Ca-Cu-O superconducting thin films
Energy Technology Data Exchange (ETDEWEB)
Siegal, M. P. [Sandia National Laboratories, Albuquerque, New Mexico 87185-1421 (United States); Overmyer, D. L. [Sandia National Laboratories, Albuquerque, New Mexico 87185-1421 (United States); Venturini, E. L. [Sandia National Laboratories, Albuquerque, New Mexico 87185-1421 (United States); Padilla, R. R. [Sandia National Laboratories, Albuquerque, New Mexico 87185-1421 (United States); Provencio, P. N. [Sandia National Laboratories, Albuquerque, New Mexico 87185-1421 (United States)
1999-12-01
We report the stability of TlBa{sub 2}CaCu{sub 2}O{sub 7} and Tl{sub 2}Ba{sub 2}CaCu{sub 2}O{sub 8} on LaAlO{sub 3}(100) epitaxial thin films, under a variety of conditions. All films are stable in acetone and methanol and with repeated thermal cycling to cryogenic temperatures. Moisture, especially vapor, degrades film quality rapidly. These materials are stable to high temperatures in either N{sub 2} or O{sub 2} ambients. While total degradation, resulting from Tl depletion, occurs at the same temperatures for both phases, 600 degree sign C in N{sub 2} and 700 degree sign C in O{sub 2}, the onset of degradation occurs at somewhat lower temperatures for TlBa{sub 2}CaCu{sub 2}O{sub 7} than for Tl{sub 2}Ba{sub 2}CaCu{sub 2}O{sub 8}. (c) 1999 Materials Research Society.
Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells
Das, Debajyoti; Kar, Debjit
2017-12-01
A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.
International Nuclear Information System (INIS)
Arzumanov, A.; Berger, V.; Borissenko, A.; Gorodisskaya, N.; Ilmatov, I.; Knyazev, A.; Koptev, V.; Lyssukhin, S.; Platov, A.; Sychikov, G.; Zheltov, D.
2004-01-01
The objectives of the present work are to increase thermal stability of cyclotron targets for production of Tl-201 isotope, increase Tl-203 regeneration rate at radiochemical reprocessing of the targets and develop production technology for radiochemical sources based on Rd-103 isotope. Electrochemical coating of copper substrate with Tl increased the beam current at target irradiation from 100 μA to 125 μA. Further increase of the beam current results in sharp decrease of target stability time at irradiation to 15 min at beam current 150 μA. Thermal calculations and tests at the electron-beam stand predict satisfactory stability at such currents. The discrepancy with the irradiation results has not been explained. More accurate specification of regimes for Tl-203 electrochemical recovery from irradiated targets and better matching of the electrolyte composition made it possible to increase the recovery rate up to 99.5%. Before the present Project, the INP had no experience in production of radioactive sources based on Pd-103. Thermo-diffusion extraction of Pd-103 from irradiated rhodium foil has been chosen as a technology-defining method. The process assures good extraction rate and high purity of extracted isotope. Production of Pd-103 sources based on this technology is much simpler compared to the same based on electrochemical processes. (author)
Photo-TL in CaSO4:Dy: high exposure dosimetry
International Nuclear Information System (INIS)
Caldas, L.V.E.; Mayhugh, M.R.
1974-01-01
CaSO 4 :Dy exposed to 10 3 to 10 8 R then annealed in the range 280 to 400 0 C displays little TL in the major dosimetry peak near 200 0 C. Subsequent illumination with 250 nm light reinduces the 200 0 C TL. This radiation-enabled photo-TL is roughly proportional to the square root of the enabling exposure at least to 10 8 R. (auth)
Energy Technology Data Exchange (ETDEWEB)
Gonzalez, P R [Instituto Nacional de Investigaciones Nucleares, A.P. 18 -1027, 11801 Mexico D.F. (Mexico); Alarcon, N G [Facultad de Quimica, Universidad Autonoma del Estado de Mexico. Paseo Tollocan, Esq. con Jesus Carranza, 50180 Toluca, Estado de Mexico (Mexico); Furetta, C; Azorin, J [Universidad Autonoma Metropolitana- Iztapalapa, San Rafael Atlixco 186, 09340 Mexico. D.F. (Mexico)
2003-07-01
Ionizing radiation has different types of interaction with a crystalline solid. However, only few effects are interesting to optimize some thermoluminescent (Tl) properties of certain Tl materials. This paper presents results obtained by irradiating KMgF{sub 3}: Lu + Ptfe Tl dosimeters with ultraviolet (UV) radiation previously exposed to gamma radiation. These results showed that those dosimeters not exposed previously to gamma radiation did not presented any Tl signal. Meanwhile, those previously submitted to gamma irradiation showed that their sensitivity was increased as the gamma dose increased. The glow curve of sensitized KMgF{sub 3}: Lu + Ptfe exposed to UV radiation, presented the dosimetric pea at 212 C. This makes this material to be promissory for measuring UV radiation. (Author)
Annual dose measurements and TL-dating of ancient Egyptian pottery
Energy Technology Data Exchange (ETDEWEB)
Abdel-Wahab, M S; El-Fiki, S A; Abdel-Kariem, S; El-Faramawy, N [Ain Shams University, Cairo (Egypt). Faculty of Science; EL-Fiki, M A [National Institute of Standards, Cairo (Egypt); Gomaa, M [Atomic Energy Establishment, Cairo (Egypt). Nuclear Research Center
1996-05-01
In the course of the dating of ancient Egyptian pottery, pottery sherds were collected from three archaeological tombs in Nazlet El Samman region, Giza zone (Egypt). The annual dose from natural background was measured by gamma spectrosocopic technique as well as thermoluminescence (TL) measurements. The results of both methods are in good agreement with a consistency of 99.69%. The extracted quartz exhibited TL dating peaks at about (305 {+-} 5){sup o}C. The TL dating shows an age of 4301 {+-} 100 years for the examined pottery which belongs to the ``Fourth Dynasty`` in the ``OlKingdom`` . The uncertainties in TL dating using the additive method are much lower than that of archaeologists. (author).
Annual dose measurements and TL-dating of ancient Egyptian pottery
Abdel-Wahab, M. S.; El-Fiki, S. A.; El-Fiki, M. A.; Gomaa, M.; Abdel-Kariem, S.; El-Faramawy, N.
1996-05-01
In the course of the dating of ancient Egyptian pottery, pottery sherds were collected from three archaeological tombs in Nazlet El Samman region, Giza zone (Egypt). The annual dose from natural background was measured by gamma spectroscopic technique as well as thermoluminescence (TL) measurements. The results of both methods are in good agreement with a consistency of 99.69%. The extracted quartz exhibited TL dating peaks at about(305 ± 5|4)°C. The TL dating shows an age of 4301 ± 100 years for the examined pottery which belongs to the "Fourth Dynasty" in the "Old Kingdom". The uncertainties in TL dating using the additive method are much lower than that of archeologists.
Annual dose measurements and TL-dating of ancient Egyptian pottery
International Nuclear Information System (INIS)
Abdel-Wahab, M.S.; El-Fiki, S.A.; Abdel-Kariem, S.; El-Faramawy, N.; Gomaa, M.
1996-01-01
In the course of the dating of ancient Egyptian pottery, pottery sherds were collected from three archaeological tombs in Nazlet El Samman region, Giza zone (Egypt). The annual dose from natural background was measured by gamma spectrosocopic technique as well as thermoluminescence (TL) measurements. The results of both methods are in good agreement with a consistency of 99.69%. The extracted quartz exhibited TL dating peaks at about (305 ± 5) o C. The TL dating shows an age of 4301 ± 100 years for the examined pottery which belongs to the ''Fourth Dynasty'' in the ''OlKingdom'' . The uncertainties in TL dating using the additive method are much lower than that of archaeologists. (author)
Energy Technology Data Exchange (ETDEWEB)
Fujii, Tadashige; Tanaka, Masao; Hirose, Yoshiki; Hirayama, Jiro; Handa, Kenjiro; Nakanishi, Fumiko; Yano, Kesato; Ueda, Hitoshi
1989-04-01
Thallium-201 (Tl-201) uptake in the bone and bone marrow was examined in a total of 93 patients with various diseases. Sternal uptake of Tl-201 was observed when patients had bone marrow abnormality especially associated with hematopoietic disease. It was associated with proliferation of immature cells and of various types of bone marrow cells, especially erythroblastic and plasma cells. Whole-body Tl-201 scanning showed a high uptake (82%) in the sternum, chest, lumbar vertebrae, and pelvis. Thallium-201 was definitively taken up by the sternum in polycythemia (5/41), hemolytic anemia (2/2), iron deficiency anemia (2/2), and multiple myeloma (2/5). For leukemia, Tl-201 uptake was slight or negative. Thallium-201 scanning proved useful in visualizing bone marrow abnormality, although careful interpretation of bone and bone marrow uptake is required. (Namekawa, K).
Leading the Charge for SoTL--Embracing Collaboration
Cassard, Anita; Sloboda, Brian
2014-01-01
The scholarship of teaching and learning (SoTL) enables colleges and universities to assess student learning and measure the outcomes by engaging in meaningful research, and to disseminate this research. The objective of this paper is to give a snapshot of and assess the current thinking behind this scholarship by presenting examples of SoTL, and…
Real-time in-situ monitoring of the topotactic transformation of TlCu3Se2 into TlCu2Se2
International Nuclear Information System (INIS)
Ångström, J.; Sahlberg, M.; Berger, R.
2015-01-01
Highlights: • Topotactic transition from TlCu 3 Se 2 to TlCu 2 Se 2 followed in situ. • Synchrotron radiation X-ray powder diffraction enabled short scans. • Relative abundance of phases refined from powder data. • Opens up for studying similar systems in the same manner. - Abstract: The solid state transformation of monoclinic TlCu 3 Se 2 into tetragonal TlCu 2 Se 2 by oxidative copper leaching in concentrated ammonia solution has been studied in situ by the use of synchrotron radiation. The diffraction patterns of parent and daughter phase are both sharp, indicating a strong topotactic relationship between them that effectuates a rapid change by “chimie douce” performed at +19 °C. The transformation rate is strongly connected to the access of oxygen from the surrounding air. The transformation was followed in a real-time mode, being almost complete after 2.5 h with 1 h incubation due to low oxygen content, as shown from refining the diffraction patterns by Rietveld profile technique
Microcomputer-Controlled Reader Systems for Archaeological and Geological TL Dating
DEFF Research Database (Denmark)
Bøtter-Jensen, Lars; Mejdahl, V.
1984-01-01
Two fully automated TL reader systems for TL dating and a manually operated reader for research purpose were put into operation during 1982-3. All systems are controlled by HP-85 or HP-86 microcomputers; thus flexibility in selection of measurement parameters, calculation of TL signals and displa...... the archaeological and geological ages. The principle of the measurement procedures are described, and dating results are presented to illustrate the performance of the systems...
Non-leptonic kaon decays at large Nc
Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando
2018-03-01
We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.
Tl-201 and Tc-99m-DTPA neuro-SPECT in cerebral radiation necrosis
International Nuclear Information System (INIS)
Cleto, E.M. Jr.; Holmes, R.A.; Gumerlock, M.K.; Cabeen, M.; Logan, K.W.; Hoffman, T.J.
1992-01-01
The results in 3 cases of radiation necrosis demonstrate that by using both radionuclides Tl-201 and Tc-99m-DTPA, one can provide a semi-quantitative method to differentiate recurrent tumor from radiation necrosis. Focally increased cerebral Tl-201 activity in irradiated brain tumor patients is not specific for tumor recurrence, but when used in combination with DTPA, one is able to estimate the amount of Tl-201 activity resulting from increased blood-brain barrier permeability. If the average Tl-201 index is less than the average Tc-99m-DTPA index it suggests that the increased Tl-201 activity results primarily from blood-brain barrier breakdown. Tc-99m-DTPA SPECT, in addition to Tl-201 SPECT, or serial Tl-201 SPECT imaging may increase the accuracy of brain scintigraphy in differentiating radiation necrosis from tumor recurrence. To verify these preliminary findings, we are in the process of analyzing additional SPECT data on 9 more patients with malignant brain tumors. Using a slightly different method of quantifying Tl- 201/Tc-99m-DTPA ratios (computing the ratio of intralesional Tl-201 or Tc-99m-DTPA activity compared to adjacent scalp activity), patients with tumor recurrence have higher Tl-201/Tc-99m-DTPA ratios compared to those with radiation necrosis (verbal communication with Dr. Mary K. Gumerlock). (orig.) [de
Benchmarking NaI(Tl) Electron Energy Resolution Measurements
International Nuclear Information System (INIS)
Mengesha, Wondwosen; Valentine, J D.
2002-01-01
A technique for validating electron energy resolution results measured using the modified Compton coincidence technique (MCCT) has been developed. This technique relies on comparing measured gamma-ray energy resolution with calculated values that were determined using the measured electron energy resolution results. These gamma-ray energy resolution calculations were based on Monte Carlo photon transport simulations, the measured NaI(Tl) electron response, a simplified cascade sequence, and the measured electron energy resolution results. To demonstrate this technique, MCCT-measured NaI(Tl) electron energy resolution results were used along with measured gamma-ray energy resolution results from the same NaI(Tl) crystal. Agreement to within 5% was observed for all energies considered between the calculated and measured gamma-ray energy resolution results for the NaI(Tl) crystal characterized. The calculated gamma-ray energy resolution results were also compared with previously published gamma-ray energy resolution measurements with good agreement (<10%). In addition to describing the validation technique that was developed in this study and the results, a brief review of the electron energy resolution measurements made using the MCCT is provided. Based on the results of this study, it is believed that the MCCT-measured electron energy resolution results are reliable. Thus, the MCCT and this validation technique can be used in the future to characterize the electron energy resolution of other scintillators and to determine NaI(Tl) intrinsic energy resolution
Effects of ischemic-like insult on myocardial 201Tl accumulation
International Nuclear Information System (INIS)
Goldhaber, S.Z.; Newell, J.B.; Alpert, N.M.; Andrews, E.; Pohost, G.M.; Ingwall, J.S.
1983-01-01
Despite extensive clinical use of thallium-201 ( 201 Tl) for myocardial imaging, the effect of ischemia on myocardial accumulation and release of 201 Tl independent of flow has not been fully defined. Therefore, myocardial accumulation of 201 Tl in response to ischemic-like myocardial injury was assessed in vitro using the cultured fetal mouse heart preparation. Cultured fetal mouse hearts (n . 311) were subjected to injury simulating ischemia by deprivation of oxygen and oxidizable substrates for periods ranging from 15 minutes to 10 hours. The extent of irreversible injury was determined by the percentage of lactic dehydrogenase (LDH) lost from the hearts to the culture medium during recovery from injury. Injury was essentially reversible at 1 hour of insult. The fraction of 201 Tl content in injured compared with control hearts was not significantly lower after 1 hour of insult. By 3 hours of insult, irreversible injury as assessed by loss of LDH was detectable and the extent of injury increased progressively through 10 hours. During the 3-10-hour period of irreversible injury, 201 Tl accumulation within injured hearts compared with controls was related in a monotonically decreasing fashion to the loss of LDH as described by a mathematical kinetic model that fit the observations closely (R2 greater than 0.99). These results indicate that in this organ culture preparation, in which there is effectively an unlimited reservoir of 201 Tl and no confounding effects of perfusion, the time-dependent 201 Tl accumulation is determined by the extent of irreversible injury
Systems Tl2MoO4-E(MoO4)2, where E=Zr or Hf, and the crystal structure of Tl8Hf(MoO4)6
International Nuclear Information System (INIS)
Bazarov, B.G.; Bazarova, Ts.T.; Fedorov, K.N.; Bazarova, Zh.G.; Chimitova, O.D.; Klevtsova, R.F.; Glinskaya, L.A.
2006-01-01
Systems Tl 2 MoO 4 -E(MoO 4 ) 2 (E=Zr, Hf) were studied by X-ray diffraction, differential thermal analysis and IR spectroscopy. Formation of Tl 8 E(MoO 4 ) 6 and Tl 2 E(MoO 4 ) 2 compounds was established. Phase T-x diagrams of the Tl 2 MoO 4 -Zr(MoO 4 ) 2 system were constructed. Monocrystals were grown, and structure of Tl 8 Hf(MoO 4 ) 6 was studied. The compound is crystallized in monoclinic syngony with elementary cell parameters a=9.9688(6), b=18.830(1), c=7.8488(5) A, β=108.538(1) Deg, Z=2, sp. gr. C2/m. The isolated group [HfMo 6 O 24 ] 8- is responsible for fundamental fragment of the structure. Three varieties of crystallographically independent Tl-polyhedra fill space evenly between fragments [HfMo 6 O 24 ] 8- forming three-dimensional form [ru
A preliminary study of landslide gouge dating by TL technique
Energy Technology Data Exchange (ETDEWEB)
Fengju, Ji; Jianping, Li [Inst. of Geology, National Seismological Bereau, Beijing (China); Mingda, Liu [Inst. of Crustal Dynamics, SSB, Beijing (China)
1993-04-01
The key to date slipping of landslide by TL method is whether the temperature and pressure caused by slipping can lead the original TL to 'zero'for some minerals within the slipping band. For this purpose, the simulated experiments under different temperature-pressure were made and the TL annealing effect of landslide gouge was studied. The results show that the frictional heating caused during slipping is a main factor leading the mineral's TL to decrease on the slip plane and that increment of temperature is in close relation with strength of shear stress, thickness of landslide gouge and amount of displacement. As an example, the slipping age of a paleo-landslide at Huangtupo, Hubei Province, has been dated to be about 140 ka.
Dielectric and baric characteristics of TlS single crystal
Energy Technology Data Exchange (ETDEWEB)
Mustafaeva, S.N., E-mail: solmust@gmail.com [Institute of Physics, ANAS, G. Javid prosp. 33, Az 1143 Baku (Azerbaijan); Asadov, M.M. [Institute of Chemical Problems, ANAS, G. Javid prosp. 29, Az 1143 Baku (Azerbaijan); Ismailov, A.A. [Institute of Physics, ANAS, G. Javid prosp. 33, Az 1143 Baku (Azerbaijan)
2014-11-15
The investigation of the frequency dependences of the dielectric coefficients and ac-conductivity of the TlS single crystals made it possible to elucidate the nature of dielectric loss and the charge transfer mechanism. Moreover, we evaluated the density and energy spread of localized states near the Fermi level, the average hopping time and the average hopping length. It was shown that the dc-conductivity of the TlS single crystals can be controlled by varying the hydrostatic pressure. This has opened up possibilities for using TlS single crystals as active elements of pressure detectors.
Phase equilibria in TlX-Cd(Zn)X (X-S, Se, Te) systems
International Nuclear Information System (INIS)
Gusejnov, F.Kh.; Babanly, M.B.; Kuliev, A.A.
1982-01-01
The methods of DTA, RPA and measurement of the alloys microhardness have been used to investigate the phase equilibria in the TlX-Zn(Cd)X systems. It is established that the TlZn(Cd)X 2 compounds, the presence of which is mentioned in the literature earlier, do not form in these systems. The TlSe-Zn(Cd)Se systems apply to the simple eutectic type and characterized by digenerated eutectic near the TlSe. Thermodynamical analysis of the liquidus of the TlSe-CdSe and TlTe-Zn(Cd)Te systems in approximation of the regular solutions, taking into account the dissociation of tallium chalcogenides in liquid phase, is made
Targeted introgression of stem rust Ug99 resistance from wheatgrasses into pasta and bread wheat
In the past 50 years, a number of stem rust resistance (Sr) genes have been transferred from several wheat-related grasses into durum (i.e. pasta) and bread wheat through chromosome translocations and additions. To utilize these genes for controlling the Ug99 races of the stem rust pathogen, we ini...
Expanding the Teaching Commons: Making the Case for a New Perspective on SoTL
Directory of Open Access Journals (Sweden)
Kim A. Case, PhD
2013-08-01
Full Text Available As a reflection on O’Meara, Terosky, and Neumann’s (2011 work on scholarship of teaching and learning (SoTL faculty development, this essay describes the benefits of SoTL to individual faculty and university goals. In support and expansion of arguments advanced by O’Meara et al., this work calls for the use of SoTL faculty development to promote the shared teaching commons, active recruitment of new SoTL scholars, institutionalization of SoTL values, and integration of SoTL initiatives in both teaching centers and research-focused development offices.
First-principles prediction of Tl/SiC for valleytronics
Xu, Zhen; Zhang, Qingyun; Shen, Qian; Cheng, Yingchun; Schwingenschlö gl, Udo; Huang, Wei
2017-01-01
Recently, monolayer Tl on a Si or Ge substrate has been proposed for potential valleytronic systems. However, the band gaps of these systems are less than 0.1 eV, which is too small to be applied because an electric field or magnetic doping will reduce the band gaps further for the systems to become metallic. Here, we investigate SiC as an alternative substrate. By first-principles calculations we demonstrate that monolayer Tl can be grown on SiC. There are two valleys around the K/K′ points and the Berry curvature shows that the two valleys are inequivalent, indicating valley pseudospin. Moreover, due to the larger band gap of SiC (3.3 eV), the band gap of the Tl/SiC system is 0.6 eV, which is large enough for valley manipulation. Furthermore, we demonstrate that Cr doping can achieve valley polarization. Our study shows that the Tl/SiC system is promising for valleytronic applications.
First-principles prediction of Tl/SiC for valleytronics
Xu, Zhen
2017-09-22
Recently, monolayer Tl on a Si or Ge substrate has been proposed for potential valleytronic systems. However, the band gaps of these systems are less than 0.1 eV, which is too small to be applied because an electric field or magnetic doping will reduce the band gaps further for the systems to become metallic. Here, we investigate SiC as an alternative substrate. By first-principles calculations we demonstrate that monolayer Tl can be grown on SiC. There are two valleys around the K/K′ points and the Berry curvature shows that the two valleys are inequivalent, indicating valley pseudospin. Moreover, due to the larger band gap of SiC (3.3 eV), the band gap of the Tl/SiC system is 0.6 eV, which is large enough for valley manipulation. Furthermore, we demonstrate that Cr doping can achieve valley polarization. Our study shows that the Tl/SiC system is promising for valleytronic applications.
Myocardial viability assessed by Tl-201 SPECT. Redistribution versus reinjection
International Nuclear Information System (INIS)
Chalela, William Azem; Pimentel, Flavio Ferrarini de Oliveira; Uchida, Augusto Hiroshi; Bottega, Augusto; Ramires, Jose Antonio Franchine; Izaki, Marisa; Moraes, Aguinaldo Pereira; Soares Junior, Jose; Giorgi, Maria C. Pinto; Moffa, Paulo Jorge; Bellotti, Giovanni; Giovanni Guido Cerri; Meneghetti, Jose Claudio
1994-01-01
The purpose of this study was to verify if a third series of images acquired by reinjection thallium-201, 24 h after conventional myocardial perfusion with the radioisotope, improves the identification of myocardial viability segments. The methods: we studied 30 patients, mean age 57.7 ±9.4 years, with old myocardial infarction using thallium (Tl)-201 SPECT, and we obtained three series of images (stress, redistribution after 4 h and reinjection after 24 h. Cardiac images were divided in 5 segments (apical, lateral, anterior, septal and inferior) and each one received a value by a score system according to the Tl-201 myocardial uptake (0=normal uptake; 1=mild hypoperfusion; 2=moderate hypoperfusion; 3=severe hypoperfusion or no myocardial uptake). We considered viable myocardium when the uptake of Tl-201 in the segment related to te myocardial infarction increases at least 1 point in two different axis of Tl-201 SPECT. The results: seven (23,3%) patients demonstrated increase of Tl-201 uptake only at reinjection images, showing a high efficacy of the method. Nine (30%) patients showed persistent hypoperfusion at all series of images suggesting only fibrosis in the are related to the infarction. Fourteen (46,7%) patients showed increase of Tl-201 concentration at redistribution images; among these patients, six showed improvement of myocardial uptake at reinjection. This condition was interpreted as regional chronic ischemic process: hibernating myocardium. The conclusion was that Tl-201 hypoperfusion at redistribution images without significant changes in relation to the stress images do not represent fibrosis at all. The reinjection technic was better than conventional redistribution in the detection of viable myocardium. This data allows a better therapeutic orientation. (author)
Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M
2015-01-30
Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.
Use of universal functional optimisation for TL glow curve analysis
International Nuclear Information System (INIS)
Pernicka, F.; Linh, H.Q.
1996-01-01
The effective use of any TL instrument requires an efficient software package to be able to fulfil different tasks required by research and practical applications. One of the standard features of the package used at the NPI Prague is the application of the interactive modular system Universal Functional Optimisation (UFO) for glow curve deconvolution. The whole system has been tested on standard glow curves using different models of the TL process (a single peak described by the Podgorsak approximation, first order kinetics and/or general order kinetics). Calculated values of basic TL parameters (E and s) show a good agreement with the results obtained by other authors. The main advantage of the system is in its modularity that enables flexible changes in the TL model and mathematical procedures of the glow curve analysis. (author)
Energy Technology Data Exchange (ETDEWEB)
Matoso, Erika; Leite, Barbara Eliodora [Centro Tecnologico da Marinha em Sao Paulo (CTMSP/CEA), Ipero, SP (Brazil). Centro Experimental Aramar; Nunes, Maira Goes [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2011-07-01
This work presents the necessary steps to prepare the dosimeters for application in environmental measurements. The material used was calcium fluoride doped with dysprosium (CaF{sub 2}: Dy), commercially supplied by Harshaw as TLD-200. It were carried out four initial irradiations (Co-60 source gamma - 0.8 mGy from Dosimetric Material Laboratory LMD/GMP) in a new batch of TLD-200 dosimeters to achieve a stable response and four more irradiations to separate them, according to their response range. A batch of pre-selected 197 dosimeters from 263 was used to finally obtained two batches of 99 (9.2{+-}0.7nC) and 93 (10.5{+-}0.6nC) dosimeters. A calibration curve was prepared relating the thermoluminescent response of the phosphor and the radiation exposure (0 to 600{mu}Gy), obtained by irradiation with Co-60 source of 4P geometry and measurements using a Harshaw Picoprocessor 2080 TL equipment. Repeatability of the measurements was determined for 100{mu}Gy (CV= 5.09%) and 300{mu}Gy (CV=4.18%) and the minimum detectable dose was evaluated as 2{mu}Gy. The fading was determined by irradiating the dosimeters with 0.8 mGy and reading then after 1, 5, 7, 8, 15, 29, 50, 70 and 90 days. (author)
International Nuclear Information System (INIS)
Sekiguchi, Masayuki; Yamazaki, Masao; Goto, Michiko; Todoriki, Setsuko; Hagiwara, Shoji
2007-01-01
Our study demonstrated that the effects of the several temperature ranges for integrating TL glow intensity on the TL glow ratios by using spice-set purchased at a Turkish air port. The spice set had no labeling of irradiation feeds, but nine of 12 spices were judged as irradiated food in this study. Those temperature ranges were defined by evaluating the glow curves of irradiated TLD-100 chip (167-230degC), TLD-100 disc (177-238degC) and Dolomite element (145-258degC). Those are relatively stable and the difference of typical glow peak temperatures of TLD-100 disc in two institutes was less than 2%. On the other hand, those of TLD-100 tip was shift to higher temperature side at about 4degC because of declining of thermal conductance. The temperature ranges defined by TLD-100 were showed that discriminate more clearly between irradiated and nonirradiated spices compared with the full temperature range of TL measurement (70-400degC). With the exception of low glow intensity, background measurement for estimating net glow intensity was not necessary because TL glow ratio was hardly influenced whether the background measured or not. (author)
Stability of detecting system using NaI(Tl)
International Nuclear Information System (INIS)
Zhuo Yunshang; Lei Zhangyun; Zen Yu; Gong Hua
1996-01-01
A detecting system using NaI(Tl) is widely used in research and industry of nuclear science and other fields. For providing the high accuracy and working well under inclement environment, the stability of detecting system using NaI(Tl) is very important. The variation of environment temperature, the change of counting rate and long time continuous working of detector will cause un-negligible effect on the measurement. Three approaches were used. They are: 1) temperature control (It makes the effect of the variation of environment temperature on the measurement negligible.); 2) spectrum stabilizing (It adjust the peak position of the spectrum when the counting rate changes.); and 3) auto-checking and adjusting (It adjusts the drift of the NaI(Tl) detecting system when it works continuously)
NC10 bacteria in marine oxygen minimum zones
DEFF Research Database (Denmark)
Padilla, Cory C; Bristow, Laura A; Sarode, Neha
2016-01-01
Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...
Virtual NC machine model with integrated knowledge data
International Nuclear Information System (INIS)
Sidorenko, Sofija; Dukovski, Vladimir
2002-01-01
The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)
Investigating the origins of double photopeaks in CsI:Tl samples through activator mapping
Onken, Drew R.; Gridin, Sergii; Williams, Richard T.; Williams, Charles B.; Donati, George L.; Gayshan, Vadim; Vasyukov, Sergey; Gektin, Alex
2018-06-01
Careful examination of the origins of double photopeaks in CsI:Tl provides a foundation for exploring the relationship between activator homogeneity and photopeak resolution in scintillators. In rare cases, certain CsI:Tl crystals exhibit a second photopeak in the pulse-height spectrum. A combination of optical mapping and ICP-MS measurements reveals the presence of two distinct regions with differing Tl concentrations in these crystals. The oscillator strength of the 299 nm absorption A-band of Tl in CsI was measured to be 0.0526 ± 0.0008; this parameter can be used to quantify activator concentration from the optical absorption. Using published measurements of luminescence intensity versus Tl concentration, the distributions of Tl measured from optical absorption maps of the samples were reconstructed into photopeaks in good agreement with experiment. The distribution of Tl concentrations in these particular crystals allowed examining luminescence pulse shape as a function of Tl concentration.
Gamma-radiation-induced change in the activation energy of TL traps in LiRbSO[sub 4]:Tl
Energy Technology Data Exchange (ETDEWEB)
Kassem, M.E.; El-Kolaly, M.A.; Al-Houty, L.I. (Qatar Univ., Doha (Qatar). Dept. of Physics)
1994-06-01
Thermoluminescence (TL) measurements were carried out for pure and doped LiRbSO[sub 4], with different concentrations of thallium (Tl). The glow-curve range of measurement is between room temperature up to 300[sup o]C. The radiation absorbed dose is in the range 56-3.2 x 10[sup 5] Gy. The results show that both pure and doped samples have glow peak temperatures that are dose dependent, and vary between 70-80[sup o]C and 140-170[sup o]C for pure and doped samples respectively. Doped samples display double peaks that increase with dopant concentration up to about 0.7% wt. The second peak which occurs at high temperature increases linearly with dose up to 4500 Gy. From the results it is proposed that LiRbSO[sub 4] doped with 0.7% Tl can be used for dosimetric purposes in this range. The activation energies of structural transitions are estimated and the results are discussed on the basis of radiation-induced stable dipoles in the random field system. (Author).
Energy Technology Data Exchange (ETDEWEB)
Azam, Sikander; Khan, Saleem Ayaz [New Technologies – Research Center, University of West Bohemia, Univerzitni 8, 30614 Pilsen (Czech Republic); Din, Haleem Ud [Department of Physics, Hazara University, Mansehra (Pakistan); Khenata, Rabah [Laboratoire de Physique Quantique et de Modélisation Mathématique (LPQ3M), Département de Technologie, Université de Mascara, Mascara 29000 (Algeria); Goumri-Said, Souraya, E-mail: sosaid@alfaisal.edu [College of Science, Physics department, Alfaisal University, P.O. Box 50927, Riyadh 11533 (Saudi Arabia)
2016-09-01
The electronic, magnetic and thermoelectric properties of Tl{sub 2}Ag{sub 2}USe{sub 4} and Tl{sub 3}Cu{sub 4}USe{sub 6} compounds were investigated using the full potential linear augmented plane wave (FP-LAPW) method based on the density functional theory (DFT). The exchange correlation was treated with the generalized gradient approximation plus optimized effective Hubbard parameter and spin–orbit coupling (GGA+U+SOC). The present uranium selenides show narrow direct energy band gap values of 0.7 and 0.875 eV for Tl{sub 2}Ag{sub 2}USe{sub 4} and Tl{sub 3}Cu{sub 4}USe{sub 6} respectively. For both selenides U-d/f states are responsible for electrical transport properties. Uranium atoms were the most contributors in the magnetic moment compared to other atoms and show ferromagnetic nature. The spin density isosurfaces show the polarization of neighboring atoms of Uranium, such as silver/copper and selenium. Thermoelectric calculations reveal that Tl{sub 3}Cu{sub 4}USe{sub 6} is more suitable for thermoelectric device applications than Tl{sub 2}Ag{sub 2}USe{sub 4}. - Highlights: • Electronic, magnetic and thermoelectric properties of uranium selenides are investigated with DFT. • They show a narrow direct energy band gap of 0.7 and 0.875 eV. • U-d/f states are responsible for electrical transport properties. • Tl{sub 3}Cu{sub 4}USe{sub 6} is more suitable for thermoelectric device applications than Tl{sub 2}Ag{sub 2}USe{sub 4}.
Magnetic properties of Bi- and Tl- based new high-Tc superconductors
International Nuclear Information System (INIS)
Togano, K.; Kumakura, H.; Dietderich, D.H.
1988-01-01
Upper critical field H c2 and Magnetization curve were measured for new high-T c oxide superconductors of Bi-Sr-Ca-Cu-O and Tl-Ba-Ca-Cu-O systems. H c2 values at 77K for the high-T phase of Bi-Sr-Ca-Cu-O, low-T c (T c (ρ = 0) = 105K) phase of Tl-Ba-Ca-Cu-O, and high-T c (T c (ρ = 0)=115K) phase of Tl-Ba-Ca-Cu-O are 41T, 50T, and 100T, respectively. The magnetization curve of the Bi-Sr-Ca-Cu-O shows a relatively small hysterisis, suggesting a weak pinning force compared to Tl-Ba-Ca-Cu-O as well as Ba 2 YCU 3 O x . Critical current density J c of 600A/Cm 2 at 77K and zero-magnetiac field was attained for the high-T c sample of Tl-Ba-Ca-Cu-O
Measurement of the infarcted area by 201Tl myocardial emission CT
International Nuclear Information System (INIS)
Tamaki, Shunichi; Murakami, Tomoyuki; Kambara, Hirofumi
1982-01-01
201 Tl-ECT was performed in 28 cases 4 weeks after the onset of acute myocardial infarction to calculate the volume of infarction for comparison with the CK-MB infarction size obtained in the acute phase. The infarct area obtained by two-dimensional 201 Tl scintigraphy in 18 cases treated by the conventional method showed a positive correlation with the CK-MB infarct size, but the volume of infarction by 201 Tl-ECT produced a better correlation. In the group with successful thrombolysis, the serum CK-MB level reached a peak soon after the onset, accompanied by release of more CK-MB for a constant volume of infarction obtained by 201 Tl-ECT, as compared with the group with unsuccessful thrombolysis or conventional therapy. This suggests the involvement of washout phenomenon by reperfusion. Although there are some limitations, the three-dimensional detection of the distribution of myocardial blood flow by 201 Tl-ECT is useful, covering disadvantages of two-dimensional images. (Chiba, N.)
Regional analysis of annual maximum rainfall using TL-moments method
Shabri, Ani Bin; Daud, Zalina Mohd; Ariff, Noratiqah Mohd
2011-06-01
Information related to distributions of rainfall amounts are of great importance for designs of water-related structures. One of the concerns of hydrologists and engineers is the probability distribution for modeling of regional data. In this study, a novel approach to regional frequency analysis using L-moments is revisited. Subsequently, an alternative regional frequency analysis using the TL-moments method is employed. The results from both methods were then compared. The analysis was based on daily annual maximum rainfall data from 40 stations in Selangor Malaysia. TL-moments for the generalized extreme value (GEV) and generalized logistic (GLO) distributions were derived and used to develop the regional frequency analysis procedure. TL-moment ratio diagram and Z-test were employed in determining the best-fit distribution. Comparison between the two approaches showed that the L-moments and TL-moments produced equivalent results. GLO and GEV distributions were identified as the most suitable distributions for representing the statistical properties of extreme rainfall in Selangor. Monte Carlo simulation was used for performance evaluation, and it showed that the method of TL-moments was more efficient for lower quantile estimation compared with the L-moments.
TL dating of vases with elephant ears in Yuan Dynasty
International Nuclear Information System (INIS)
Xia Junding; Wang Weida; Leung, P.L.
2005-01-01
Thermoluminescence (TL) dating using an activation method in pre-dose technique was described. Three vases in underglaze blue with elephant ears and one vase in underglaze red with elephant ears in Yuan Dynasty were dated by this method. The results show that the TL ages are all less than 100 a B.P., and in which sbc 648 and sbc 649 were imitated in recent years. This method is quick, convenient and reliable for porcelain dating with the age of less than 1000 a B.P.. As a comparison, a porcelain sample with underglaze blue in Yuan Dynasty was dated too, and its TL age is 620 ± 140 B.P.. In addition, some complex factors associated with dating have been discussed and a resolution has been raised, which will help improve the accuracy of TL dating. (authors)
Preliminary results on TL and OSL aluminium oxide dosimeters developed at IPEN
Energy Technology Data Exchange (ETDEWEB)
Fukumori, David T.; Yoshito, Walter K.; Ussui, Valter; Lazar, Dolores R.R.; Campos, Leticia L., E-mail: fukumori@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2011-07-01
The aluminum oxide composes the modern TL and OSL radiation dosimeters. TL and OSL phenomena are related to chemical elements in the crystalline structure of {alpha}-Al{sub 2}O{sub 3}. The aim of this work was to develop materials based on aluminum oxide for use in TL and OSL dosimetry. The studies included the dosimetric properties of alumina samples obtained by electro fusion, adsorption and coprecipitation. Electro fused alumina commercially available as abrasive particles was used to produce the pellets by glass sintering. Adsorption and coprecipitation were the methods used to insert metal ions to alumina. The best results were achieved with electro fused alumina and Tm{sup 3+} doped Al{sub 2}O{sub 3} pellets. The electro fused alumina-glass pellets show TL and OSL signals and the TL curve has two peaks. Its minimum detectable radiation dose is 7.2 mGy and the linearity of TL response as function of dose is up to about 800 mGy. The {alpha}-Al{sub 2}O{sub 3}:Tm pellets produced by sintering at 1550 deg C presented a meaningful TL glow curve so that it is worth studying their properties and viability of use in dosimetry. (author)
Dipyridamole 201Tl scintigraphy in the evaluation of prognosis after myocardial infarction
International Nuclear Information System (INIS)
Okada, R.D.; Glover, D.K.; Leppo, J.A.
1991-01-01
Dipyridamole 201Tl imaging has been proposed as an alternative to exercise ECG testing for the prehospital discharge evaluation of patients recovering from myocardial infarction. The rationale is that many postinfarction patients with exercise-induced ischemia experience later cardiac events, and the sensitivity of predischarge exercise ECG testing in patients with multivessel disease ranges from only 45% to 62%. In addition, several groups of investigators have shown the sensitivity of submaximum exercise 201Tl imaging to be less than ideal. This report summarizes the current status of dipyridamole 201Tl imaging in the period of 1-13 days after myocardial infarction. Although the number of studies performed to date is limited, the following conclusions can be drawn: dipyridamole 201Tl imaging after myocardial infarction was associated with no serious side effects, and those present could be quickly reversed with aminophylline; redistribution with dipyridamole 201Tl images definitely correlates with prognosis after uncomplicated myocardial infarction; dipyridamole 201Tl imaging is definitely useful in patients unable to exercise for a variety of reasons; and future studies are definitely indicated to further define the role of dipyridamole 201Tl imaging for assessing prognosis, especially in those patients undergoing interventional therapy after acute myocardial infarction
Degradation of myocardial perfusion SPECT images caused by contaminants in thallous (201Tl) chloride
International Nuclear Information System (INIS)
Staelens, Steven G.; Wit, Tim C. de; Lemahieu, Ignace A.; Beekman, Freek J.
2008-01-01
Thallous ( 201 Tl) chloride is a single-photon emission computed tomography (SPECT) tracer mainly used for assessing perfusion and viability of myocardial tissue. 201 Tl emits X-rays around 72 keV and gammas at 167 keV, and has a half-life of 73 h. Regulations allow an intrinsic contamination up to 3-5%, which is mainly caused by 200 Tl (368 keV; 26 h) and by 202 Tl (439 keV; 12.2 days). Contra-intuitive to the low-level percentages in which these contaminants are present, their impact may be significant because of much higher gamma camera sensitivity for these high-energy photon emissions. Therefore, we investigate the effects of the contaminants in terms of detected fractions of photons in projections and contrast degradation in reconstructed images. Acquisitions of a digital thorax phantom filled with thallous ( 201 Tl) chloride were simulated with a validated Monte Carlo tool, thereby, modelling 1% of contamination by 200 Tl and 202 Tl each. In addition, measurements of a thorax phantom on a dual-headed gamma camera were performed. The product used was contaminated by 0.17% of 200 Tl and 0.24% of 202 Tl at activity reference time (ART). This ART is specified by the manufacturer, thereby, accounting for the difference in half-lives of 201 Tl and its contaminants. These measurements were repeated at different dates associated with various contamination levels. Simulations showed that, with 1% of 200 Tl and 202 Tl, the total contamination in the 72 keV window can rise up to one out of three detected photons. For the 167keV window, the contamination is even more pronounced: more than four out of five detections in this photopeak window originate from contaminants. Measurements indicate that cold lesion contrast in myocardial perfusion SPECT imaging is at maximum close to ART. In addition to a higher noise level, relative contrast decreases 15% 2 days early to ART, which is explained by an increase in 200 Tl contamination. After ART, contrast decreased by 16% when
Tl response of KMgF3: Lu + PTFE at ultraviolet radiation
International Nuclear Information System (INIS)
Gonzalez, P.R.; Alarcon, N.G.; Furetta, C.; Azorin, J.
2003-01-01
Ionizing radiation has different types of interaction with a crystalline solid. However, only few effects are interesting to optimize some thermoluminescent (Tl) properties of certain Tl materials. This paper presents results obtained by irradiating KMgF 3 : Lu + Ptfe Tl dosimeters with ultraviolet (UV) radiation previously exposed to gamma radiation. These results showed that those dosimeters not exposed previously to gamma radiation did not presented any Tl signal. Meanwhile, those previously submitted to gamma irradiation showed that their sensitivity was increased as the gamma dose increased. The glow curve of sensitized KMgF 3 : Lu + Ptfe exposed to UV radiation, presented the dosimetric pea at 212 C. This makes this material to be promissory for measuring UV radiation. (Author)
Evidence for charge Kondo effect in superconducting Tl-doped PbTe
Energy Technology Data Exchange (ETDEWEB)
Fisher, I
2010-01-11
We report results of low-temperature thermodynamic and transport measurements of Pb{sub 1-x}Tl{sub x}Te single crystals for Tl concentrations up to the solubility limit of approximately x = 1.5%. For all doped samples, we observe a low-temperature resistivity upturn that scales in magnitude with the Tl concentration. The temperature and field dependence of this upturn are consistent with a charge Kondo effect involving degenerate Tl valence states differing by two electrons, with a characteristic Kondo temperature T{sub K} {approx} 6 K. The observation of such an effect supports an electronic pairing mechanism for superconductivity in this material and may account for the anomalously high T{sub c} values.
Investigation of the gamma radiation from the inelastic scattering of 2.75 MeV on 203Tl and 205Tl
International Nuclear Information System (INIS)
Hegewisch, S.
1976-01-01
The experimental presupositions for the measurements of (n,n'γ) reactions with time of flight discrimination have been established. By an investigation of the isotopes 203 Tl and 205 Tl with this method 120 gamma-transitions could be determined. The exact evaluation of their energies and intensities led to a completion of the level diagrams. The enrgies could be determined with a precision nearly one order of magnitude higher than the values existing hither to. (orig./WL) [de
Clinical application of 201Tl scintigraphy in patients with cold thyroid nodules
International Nuclear Information System (INIS)
Tonami, N.; Bunko, H.; Michigishi, T.; Kuwajima, A.; Hisada, K.
1978-01-01
201 Tl-chloride scintigraphy was performed in 45 patients with cold thyroid nodules. The 201 Tl scintigram was positive in 17 of 18 thyroid patients with cancer (94.4%), 8 of 20 patients with an adenoma (40.0%), 1 of 2 adenomatous goiter patients (50.5%), and all of 5 cases of chronic thyroiditis (100.0%). When the cold nodule was demonstrated to be positive with 201 Tl, the statistical chance of the lesion being a cellular one was 100.0% and a risk of its malignancy was 54.8%. On the other hand, the nodule with negative 201 Tl concentration had a 14.3% chance of cellularity and a 7.1% risk of malignancy. Thus, 201 Tl scintigraphy is of use in the differential diagnosis of the cold thyroid nodule
Comparison of functional parameters of CsI:Tl crystals and thick films
International Nuclear Information System (INIS)
Fedorov, A.; Gektin, A.; Lebedynskiy, A.; Mateychenko, P.; Shkoropatenko, A.
2013-01-01
500 mkm thick CsI:Tl columnar films can be produced using thermal evaporation in vacuum by sublimation of the same bulk crystal. Comparison of afterglow and radiation stability of deposited CsI:Tl films with source crystal was the aim of current work. It is shown that the afterglow in the films is always below its level in initial single crystal. It was ascertained that the annealing atmospheres influence the processes leading to the activator depletion of the films during the thermal processing. -- Highlights: ► Thick CsI:Tl columnar films were obtained by thermal evaporation in vacuum. ► Radiation stability of such CsI:Tl films appears to be better than that of crystal. ► CsI:Tl film parameters can be modified by annealing in different atmospheres
Scintigraphic detection of ischemic and other myocardial lesions using 201Tl
International Nuclear Information System (INIS)
Duska, F.; Novak, J.; Vizda, J.; Kubicek, J.; Kafka, P.
1981-01-01
Current knowledge of the myocardium scintiscanning using 201 Tl is briefly outlined. The principle is shown of 201 Tl cumulation in a healthy myocardium and the use of the radionuclide is justified. Heart scintiscanning after exercise or after administration of drugs increasing the blood flow through the coronaries allows detecting latent ischaemic heart disease. 201 Tl scintigraphy can also be used for diagnosing the myocardial infarction, angina pectoris and other heart diseases. (J.P.)
Vortex states of Tl2Ba2CuO6+δ studied via 205Tl NMR at 2 tesla
International Nuclear Information System (INIS)
Itoh, Yutaka; Michioka, Chishiro; Yoshimura, Kazuyoshi; Hayashi, Akihiko; Ueda, Yutaka
2005-01-01
We report a 205 Tl NMR study of vortex states in an aligned polycrystalline sample of an overdoped high-T c superconductor, Tl 2 Ba 2 CuO 6+δ (Tc - 85 K), at a magnetic field of 2 T along the c axis. We observed an imperfect vortex lattice, so-called Bragg glass, at T=5 K, the coexistence of vortex solid and vortex liquid between 10 and 60 K, and vortex melting between 65 and 85 K. No evidence for local antiferromagnetic ordering at vortex cores was found for our sample. (author)
Measurements of environmental gamma-ray spectra using a multi-element TL dosemeter
International Nuclear Information System (INIS)
Furuta, Sadaaki; Boetter-Jensen, L.; Nielsen, S.P.
1986-12-01
A method to estimate the energy distribution and dose of environmental gamma radiation was developed using a multielement TL dosemeter. Experimentally obtained energy responses from a multi-element TL dosemeter with different kinds of filters were used to calculate the energy distribution and related dose by the SAND-II computer code. The code was originally developed to estimate the neutron flux using a multiple foil activation method. Measurements were made at several locations with the multi-element TL dosemeter and comparisons were made with results from a NaI(Tl) scintillation detector and a high-pressure ionization chamber. (author)
Differential diagnosis of thyroid diseases with 131I and 201TlCl scintigraphy
International Nuclear Information System (INIS)
Kumano, Machiko; Ishida, Osamu
1979-01-01
Scintigraphic study with 131 I and 201 TlCl was performed on the differential diagnosis of various kinds of thyroid disease. When thyroid nodules are cold by scintigraphy with 131 I and hot with 201 TlCl, the lesions were proved to be solid tumor, that is, mostly follicular adenoma and carcinoma, and also most probably chronic thyroiditis. Accumulation of 201 TlCl, however, is not observed in cystic lesions, and is very high with high frequency in metastatic lesion of the lymph nodes as well as the thyroid cancer, especially in well differentiated follicular carcinoma. Therefore 201 TlCl was very useful to confirm the metastatic tumors from the thyroid cancer. These features in accumulation of 131 I and 201 TlCl in thyroid disease suggest the imaging technique with 201 TlCl combined with 131 I seem to provide more pathological information on the thyroid and metastatic lesions. (author)
Super-ionic conductivity in (1D) nanofibrous TlGaTe2
International Nuclear Information System (INIS)
Sardarly, R.M.; Samedov, O.A.; Abdullaev, A.P.; Salmanov, F.T.; Urbanovic, A.; Garet, F.; Coutaz, J.-L.
2010-01-01
Full text : Nanodimension topologic-disorder materials constitute an important feature in the development of modern electronics. Among such materials, TlGaTe 2 is a p-type semiconductor with a nanofibrous structure Ga 3 +Te 2 - 2 groups form chains extending along the c-axis of the material. These negatively charged chains are bonded together by Tl+ ions. The resulting tetragonal lattice is characterized by a 18 D4h group symmetry. Recently, much attention has been paid to systems that behave as if they had less than 3 spatial dimensions. Such materials are often called quasi-one-dimensional (1D) nanorods, nanofibrous or nanochains. It was already studied the temperature dependence of conductivity σ (T) and current-voltage (I-V) characteristics of TlGaTe 2 . In the ohmic region of the I -V curve, σ (T) exhibits a behavior typical of hopping conductivity, which can be modeled in the framework of the Mott approximation. Moreover, it was determined the values of the density of localized states, the activation energy, the hop lengths, and the difference between the energies of states and the concentration of deep traps. The abrupt variation of the I-V curve is ascribed to the Pool-Frenkel thermal-field effect, which allows to obtain the concentration of ionized centers, the free-path lengths, the Frenkel coefficients and the shape of the potential well of TlGaTe 2 . For T>300 K, TlGaTe 2 crystals present interesting nonlinear electrical behaviors, such as switching effects and a negative-differential-resistance (NDR) region in their S-type I-V characteristics. In the NDR region, self-excited oscillations of the voltage were also observed. Here, it was investigated the temperature dependence of TlGaTe 2 crystals conductivity σ (T) in two experimental geometries, i.e. parallel and perpendicularly to the tetragonal c-axis of the crystal. The observed sharp increase of TlGaTe 2 conductivity results from a strong change of the number of the high-mobility ions. The
Abnormal 201Tl limb scan due to unilateral tremor
International Nuclear Information System (INIS)
Simons, M.; Schelstraete, K.; Bratzlavsky, M.
1982-01-01
A abnormal intra- and interextremity distribution pattern on 201 Tl was observed on the limb scan of a patient with a unilateral tremor. This is ascribed to the increased blood flow in the muscles responsible for the tremor. The suggestion is made that the existence of tremor should be considered as a possible explanation for unexpected abnormalities on 201 Tl limb scintigrams
Substitution of indium for chromium in TlIn5−xCrxSe8: crystal structure of TlIn4.811(5Cr0.189(5Se8
Directory of Open Access Journals (Sweden)
Robin Lefèvre
2017-04-01
Full Text Available The new thallium penta(indium/chromium octaselenide, TlIn4.811(5Cr0.189(5Se8, has been synthesized by solid-state reaction. It crystallizes isotypically with TlIn5Se8 in the space group C2/m. Although the two Tl positions are disordered and only partially occupied, no Tl deficiency was observed. The insertion of chromium in the structure has been confirmed by EDS analysis. Chromium substitutes indium exclusively at one of three In sites, viz. at one of the positions with site symmetry 2/m (Wyckoff position 2a. In the crystal structure, edge-sharing InSe6 octahedra, and (In,CrSe6 octahedra and InSe4 tetrahedra make up two types of columns that are linked into a framework in which two different types of channels parallel to [010] are present. The Tl atoms are located in the larger of the channels, whereas the other, smaller channel remains unoccupied.
Self-trapping nature of Tl nanoclusters on the Si(111)-7x7 surface
International Nuclear Information System (INIS)
Hwang, C G; Kim, N D; Lee, G; Shin, S Y; Kim, J S; Chung, J W
2008-01-01
We have studied properties of thallium (Tl) nanoclusters formed on the Si(111)-7x7 surface at room temperature (RT) by utilizing photoemission spectroscopy (PES) and high-resolution electron-energy-loss spectroscopy (HREELS) combined with first principles calculations. Our PES data reveal that the surface states stemming from the Si substrate remain quite inert with Tl adsorption producing no Tl-induced state until saturation at Tl coverage θ=0.21 monolayers. Such a behavior, in sharp contrast with the extremely reactive surface states upon the formation of Na or Li nanoclusters, together with the presence of a unique Tl-induced loss peak in HREELS spectra suggests no strong Si-Tl bonding, and is well understood in terms of gradual filling of Si dangling bonds with increasing θ. Our calculation further indicates the presence of several metastable atomic structures of Tl nanoclusters at RT rapidly transforming from one to another faster than 10 10 flippings per second. We thus conclude that the highly mobile Tl atoms form self-trapped nanoclusters within the attractive basins of the Si substrate at RT with several metastable phases. The mobile and multi-phased nature of Tl nanoclusters not only accounts for all the existing experimental observations available at present, but also provides an example of self-trapping of atoms in a nanometre-scale region
Recovery of 201Tl by ion exchange chromatography from proton bombarded thallium cyclotron targets
International Nuclear Information System (INIS)
Walt, T.N. van der; Naidoo, C.
2000-01-01
A method based on ion exchange chromatography is presented for the recovery of 201 Tl and its precursor 201 Pb from proton bombarded natural thallium cyclotron targets. After bombardment the target is dissolved in diluted nitric acid. Water, hydrazine and ammonium acetate are added to the solution and the lead radioisotopes separated from the thallium by cation exchange chromatography on a Bio-Rex 70 column. The sorbed lead radioisotopes are eluted with dilute nitric acid and the separation repeated on a second Bio-Rex 70 column. After elution of the remaining thallium the column is left for 32 hours and the 201 Tl formed by decay of 201 Pb is eluted with an ammonium acetate solution. The 201 Tl eluate is acidified with a HNO 3 -HBr-Br 2 mixture and the resulting solution is passed through an AG MP-1 anion exchanger column to remove any remaining lead isotopes. The 201 Tl is eluted with a hydrazine solution, the eluate evaporated to dryness and the 201 Tl finally dissolved in an appropriate solution to produce a 201 TlCl solution suitable for medical use. A high quality 201 Tl product is obtained containing ≤ 0.1 μg of Tl/mCi (37 MBq) 201 Tl. The radionuclidic impurities are less than the maximum values specified by the US Pharmacopoeia and the British Pharmacopoeia. (orig.)
Study on effects of gamma-ray irradiation on TlBr semiconductor detectors
International Nuclear Information System (INIS)
Matsumura, Motohiro; Watanabe, Kenichi; Yamazaki, Atsushi; Uritani, Akira; Kimura, Norihisa; Nagano, Nobumichi; Hitomi, Keitaro
2016-01-01
Radiation hardness of thallium bromide (TlBr) semiconductor detectors to 60 Co gamma-ray irradiation was evaluated. The energy spectra and μτ products of electrons were measured to evaluate the irradiation effects. No significant degradation of spectroscopic performance of the TlBr detector for 137 Cs gamma-rays was observed up to 45 kGy irradiation. Although the μτ products of electrons in the TlBr detector slightly decreased, position of the photo-peak was stable without significant degradation after the gamma-ray irradiation. We confirmed that the TlBr semiconductor detector has a high tolerance for gamma-ray irradiation at least up to 45 kGy. (author)
Improvements in the Tl dosimetry for Radiotherapy; Mejoras en la dosimetria Tl para Radioterapia
Energy Technology Data Exchange (ETDEWEB)
Bustos, S.; Velez, G.; Rubio, M. [CEPROCOR. Arenales 230 Juniors Cordoba 5000 (Argentina)
1998-12-31
The thermoluminescent dosimetry (TLD) in vivo has been demonstrated to be one of the most reliable for the control of radiotherapeutic treatments, but the delay in the response is the main disadvantage in its applicability. In this work are presented important improvements and it is demonstrated that maintaining the accuracy and reliability of the technique, it is possible to accelerate the response times at a few hours. To realize this work is utilized a lecturer Harshaw 4000, dosemeters LiF-TLD-100 chips (3.1 x 3.1 x 0.89 mm{sup 3}) and rods (1 x 1 x 6 mm{sup 3}). With the implementation of a glow curve analysis program developed in CIEMAT, its obtained a Tl peaks separation in such manner rapid and accurate, by that the thermal treatment of dosemeters may be reduced at one unique annealing pre-irradiation for 1 hr at 400 Centigrade. It is realized a periodical and individual calibration of the TLD and a study of the factors which influencing the ratio Tl signal-dose as linearity, correction by energy, directional response and pride of Tl signal. the results of this study are introducing in a calculation list specially designed and which allows to obtain absorbed dose by TLD starting of the dates (dosimetric peaks area) which appear of the glow curves analysis. The dose is obtained with an accuracy less than 5 %. The dosemeters already irradiated (in vivo) are analysed and informed in only four hours, allowing a greater control of the treatment and a correction of the possible errors for the next session, still in bi fractional treatments. The method implemented results thus accurate, rapid and reliable. (Author)
Bonding and M?ssbauer Isomer Shifts in (Tl,Pb) - 1223 Cuprate
Institute of Scientific and Technical Information of China (English)
无
2002-01-01
By using the chemical bond theory of dielectric description,the chemical bond parameters of (Tl,Pb) - 1223 was calculated.The results show that the Sr-O,Tl-O,and Ca-O types of bond have higher ionic character and the Cu-O types of bond have more covalent character.M?ssbauer isomer shifts of 57Fe and 119Sn doped in (Tl,Pb) -1223 were calculated by using the chemical environmental factor,he,defined by covalency and electronic polarizability.Four valence state tin and three valence iron sites were identified in 57Fe,and 119Sn doped (Tl,Pb) -1223 superconductor.We conclude that all of the Fe atoms substitute the Cu at square planar Cu (1) site,whereas Sn prefers to substitute the square pyramidal Cu (2) site.
AG, TL, and IRSL dosimetric properties in X-ray irradiated HPHT diamond crystals
Energy Technology Data Exchange (ETDEWEB)
Gil-Tolano, M.I. [Programa de Posgrado, Departamento de Investigacion en Fisica, Universidad de Sonora, A. P. 5-088, Hermosillo, Sonora, 83190, Mexico (Mexico); Melendrez, R.; Lancheros-Olmos, J.C.; Soto-Puebla, D.; Chernov, V.; Pedroza-Montero, M.; Barboza-Flores, M. [Departamento de Investigacion en Fisica, Universidad de Sonora, A. P. 5-088, Hermosillo, Sonora, 83190, Mexico (Mexico); Castaneda, B. [Departamento de Fisica, Universidad de Sonora, Blvd. Luis Encinas y Rosales S/N, Hermosillo, Sonora, 83000, Mexico (Mexico)
2014-10-15
HPHT diamonds have been studied for several years for their potential in different applications. In previous studies it has been found that the thermoluminescence (TL) glow curves of ''as-grown'' HPHT diamonds are non-reproducible. In this work, we study the afterglow (AG), thermoluminescent (TL), and optically stimulated luminescence (OSL) response of commercial samples of synthetic HPHT type-Ib diamond crystals exposed to X-ray irradiation (0.75 mA, 35 kV) at a dose rate of 0.624 Gy/s, after a high gamma ({sup 60}Co) dose irradiation of 500 kGy followed by a thermal treatment at 1073 K for 1 h in nitrogen atmosphere. Deconvolution of the TL glow curves shows four peaks, located around 379, 509, 561, and 609 K. The crystals exhibit evident AG recorded for 300 s immediately after X-ray irradiation, due to the thermal emptying of the traps responsible for the low-temperature TL peaks (below 400 K). The stimulation of irradiated crystals with 870-nm light, creates pronounced OSL and destroys all TL peaks with the exception of the high-temperature peak at 609 K. The dose responses of the integrated AG, TL, and OSL are linear in the range of 0.6-5 Gy and saturated at higher doses. The reproducibility of AG, TL, and OSL measurements is about 5%. The fading in the first hour of storage in dark conditions at RT of TL signal of HPHT diamond is mainly associated to the emptying of the traps responsible for the 379-K TL peaks. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Preparation of biaxially oriented TlCu-1234 thin films
Khan, N A; Tateai, F; Kojima, T; Ishida, K; Terada, N; Ihara, H
1999-01-01
The single phase of TlCu-1234 superconductor thin films is prepared for the first time by the amorphous phase epitaxy (APE) method, which is thallium treatment of sputtered amorphous phase at 900 degrees C for 1 h. The amorphous $9 phase is prepared by sputtering from the stoichiometric target composition CuBa/sub 2/Ca/sub 3/Cu/sub 4/O/sub 12-y/. The films on the SrTiO/sub 3/ substrate are aligned biaxially after the thallium treatment. Highly reproducible $9 TlCu-1234 films are prepared by this method. The XRD reflected a predominant single phase with the c-axis lattice constant of 18.74 AA. This lattice constant value is in between that of Cu-1234 (17.99 AA) and Tl-1234 (19.11 AA) . The $9 pole figure measurements of (103) reflection of the films showed a-axis-oriented crystals with Delta phi =0.8 degrees . The composition of the films after energy dispersive X-ray (EDX) measurements is Tl/sub 0.8/Cu/sub 0.2/Ba/sub $9 2/Ca/sub 3/Cu/sub 4/O /sub 12-y/. From the resistivity measurements, the T/sub c/ is 113 K...
Resistance to stem rust Ug99 in six bread wheat cultivars maps to chromosome 6DS.
Lopez-Vera, Eric E; Nelson, Sarah; Singh, Ravi P; Basnet, Bhoja R; Haley, Scott D; Bhavani, Sridhar; Huerta-Espino, Julio; Xoconostle-Cazares, Beatriz G; Ruiz-Medrano, Roberto; Rouse, Matthew N; Singh, Sukhwinder
2014-01-01
Identified SSR markers ( Xcfd49 and Xbarc183 ) linked with stem rust resistance for efficient use in marker-assisted selection and stacking of resistance genes in wheat breeding programs. More than 80 % of the worldwide wheat (Triticum aestivum L.) area is currently sown with varieties susceptible to the Ug99 race group of stem rust fungus. However, wheat lines Niini, Tinkio, Coni, Pfunye, Blouk, and Ripper have demonstrated Ug99 resistance at the seedling and adult plant stages. We mapped stem rust resistance in populations derived from crosses of a susceptible parent with each of the resistant lines. The segregation of resistance in each population indicated the presence of a single gene. The resistance gene in Niini mapped to short arm of chromosome 6D and was flanked by SSR markers Xcfd49 at distances of 3.9 cM proximal and Xbarc183 8.4 cM distal, respectively. The chromosome location of this resistance was validated in three other populations: PBW343/Coni, PBW343/Tinkio, and Cacuke/Pfunye. Resistance initially postulated to be conferred by the SrTmp gene in Blouk and Ripper was also linked to Xcfd49 and Xbarc183 on 6DS, but it was mapped proximal to Xbarc183 at a similar position to previously mapped genes Sr42 and SrCad. Based on the variation in diagnostic marker alleles, it is possible that Niini and Pfunye may carry different resistance genes/alleles. Further studies are needed to determine the allelic relationships between various genes located on chromosome arm 6DS. Our results provide valuable molecular marker and genetic information for developing Ug99 resistant wheat varieties in diverse germplasm and using these markers to tag the resistance genes in wheat breeding.
Nuclear resonance fluorescence of {sup 203,205}Tl
Energy Technology Data Exchange (ETDEWEB)
Pfeifer, Fabian; Fritzsche, Matthias; Pietralla, Norbert; Savran, Deniz; Weller, Henry; Zweidinger, Markus [Institut fuer Kernphysik, Technische Universitaet, Darmstadt (Germany); Rusev, Gencho; Tonchev, Anton P.; Tornow, Werner [Triangle Universities Nuclear Laboratory, Duke University, Durham (United States); Zilges, Andreas [Institut fuer Kernphysik, Universitaet Koeln (Germany)
2009-07-01
In order to investigate the dipole strength distribution in Thalium isotopes we have studied Nuclear Resonance Fluorescence of a sample composed of natural Thallium (consisting of 30% {sup 203}Tl and 70% {sup 205}Tl). Unpolarized bremsstrahlung with photo energies up to 7.5 MeV was used at the High Intensity Photon Setup (HIPS) at S-DALINAC at the IKP Darmstadt. 24 fluorescent {gamma}-ray transitions were observed, 19 of them for the first time. For the assignment of the polarity of two prominent {gamma}-ray transitions, one at 4.7 MeV and one at 4.9 MeV, the polarized photon beam of the High Intensity {gamma}-ray Source (HI{gamma}S) at Duke University was used. The experiment at HI{gamma}S revealed the existence of a photo-excited state of {sup 205}Tl at an excitation energy of 4.971 MeV that exhibits a transition to the first excited state at 203 keV.
Preparation and biodistribution of [201Tl](III)vancomycin complex in normal rats
International Nuclear Information System (INIS)
Jalilian, A.R.; Hosseini, M.A.; Karimian, A.; Saddadi, F.; Sadeghi, M.
2006-01-01
Thallium-201 (T 1/2 = 3.04 days) in Tl + form was converted to Tl 3+ cation in presence of O 3 in 6 M HCl controlled by RTLC/gel electrophoresis methods. The final evaporated activity was reacted with vancomycin (VAN) in water to yield [ 201 Tl](III)VAN. The best results were obtained at room temperature in water after 30 min with a radiochemical yield >99%, after mixing the reactants followed by SPE purification using Si Sep-Pak. The studies showed that thallic ion is mostly incorporated into vancomycin with a radiochemical purity of more than 98 ± 1% by RTLC. A specific activity of about 4.14·10 10 Bq/mmol was obtained. Radiochemical purity and stability of 201 Tl-VAN in the preparation and in presence of human serum was determined up to 5.5 days. Biodistribution study of 201 Tl(III)-vancomycin in normal rats was performed up to 52 h. (authors)
Electronic band structure study of colossal magnetoresistance in Tl 2Mn 2O 7
Seo, D.-K.; Whangbo, M.-H.; Subramanian, M. A.
1997-02-01
The electronic structure of Tl 2Mn 2O 7 was examined by performing tight binding band calculations. The overlap between the Mn t 2g- and Tl 6 s-block bands results in a partial filling of the Tl 6 s-block bands. The associated Fermi surface consists of 12 cigar-shape electron pockets with each electron pocket about {1}/{1000} of the first Brillouin zone in size. The Tl 6 s-block bands have orbital contributions from the Mn atoms, and the carrier density is very low. These are important for the occurrence of a colossal magnetoresistance in Tl 2Mn 2O 7.
Myocardial uptake of iodinated free fatty acids and 201Tl in experimental ischemia
International Nuclear Information System (INIS)
Westera, G.; Wall, E.E. van der; Visser, F.C.; Scholtalbers, A.S.; Eenige, M.J. van; Roos, J.P.
1984-01-01
In an experimental study, we evaluated the uptake of ( 131 I)-17-iodo heptadecanoic acid ( 131 I-HDA), ( 125 I)-15-4 (4-iodophenyl) pentadecanoic acid ( 125 I-PPA) and thallium-201 ( 201 Tl) in the dog heart. Twenty dogs were studied and divided into 3 groups: in group A, 10 dogs (4 normal, 6 with coronary artery occlusion) were studied with 131 I-HDA and 201 Tl; in group B, 5 dogs (with occlusion) received 125 I-PPA and 201 Tl; and in group C, 5 dogs (with occlusion) were studied with 125 I-PPA and 131 I-HDA. Two min after administration of the compounds the hearts were excised and stored in formaldehyde. After sectioning of the left ventricle, total uptake was counted and expressed in percentage of injected dose. Uptake in the normal myocardium (group A) was 4.2+-0.6% for 131 I-HDA and 4.6+-0.7% for 201 Tl; in the occluded dog hearts (group A) we measured values of 2.6+-0.4% for 131 I-HDA (p 201 Tl (p 131 I-HDA, 125 I-PPA and 201 Tl in groups B and C was not significantly different: group B, 125 I-PPA 2.8+-0.8% and 201 Tl 2.5+-0.5%; group C, 125 I-PPA 1.9+-0.7% and 131 I-HDA 1.6+-0.6%. Moreover, regional distribution of both iodinated fatty acids was quite comparable with the distribution of 201 Tl. We conclude that 131 I-HDA and 125 I-PPA show similar uptake as 201 Tl and are distributed according to coronary artery perfusion, which underscores their value as myocardial imaging agents. (orig.) [de
Coronary spasm: 201Tl scintiscanning following pharmacological provocation
International Nuclear Information System (INIS)
Montz, R.; Mathey, D.; Bleifeld, W.; Hamburg Univ.
1981-01-01
According to the authors' experience so far, 201 Tl myocardial scintiscanning is a sufficiently sensitive non-invasive method for detection of coronary vasospasm provoked by ergotamine administration. Mild incomplete and asymptotic forms of coronary vasospasm were detected by scintiscanning. Indications for myocardial scintiscanning of ergotamine-provoked vasospasm are: Cases of angina pectoris at rest in which electrocardiograms during spasm are not available; elleviated symptoms after nitroglycerine administration; exercise electrocardiograms without any sign of ischaemia; negative results of exercise 201 Tl myocardial scintiscanning. (orig.) [de
Thermoluminescence (TL) in the identification of irradiated food
International Nuclear Information System (INIS)
Luthra, J.M.
1992-01-01
Due to progressive expansion of commercial food irradiation in recent years, the interest in detecting whether a food has been irradiated or not is growing fast and research in several methods for identification of various irradiated food stuffs is the order of the day. TL has emerged as one of the most promising tool for distinguishing between irradiated and unirradiated food. Advantages of TL method over other physical methods, its application to various foods, limitation and present state of art are discussed.(author). 9 refs., 3 tabs
Tl response of LiF:Mg, Cu, P + PTFE to Am-Be neutrons
International Nuclear Information System (INIS)
Gonzalez M, P.R.
2000-01-01
In different laboratories of the world it is followed the research about development of new Tl materials, whose main characteristics should be their equivalence with the tissue and their high sensibility to any type of radiation. The study consists in to measure the Tl peak intensity which TLD-100 presents at being irradiated with neutrons and that appears over 250 Centigrade, for compare it with the Tl intensity of the LiF: Mg, Cu, P + PTFE dosemeters. However, not all dosemeters of the same group show the interesting peak, by this only can be the total Tl intensity of dosemeters studied. In the ININ dosemeters development laboratory, we have developed a Tl material of lithium fluoride activated with magnesium, copper and phosphorus (LiF: Mg, Cu, P) that in polycrystalline powder form is almost 35 times more sensitive than the TLD-100 commercial dosemeter of Harshaw/Filtrol, USA. With the use of polytetrafluorethylene (PTFE) and with the above described Tl material, it has been possible to obtain dosemeters in pellet form of LiF: Mg, Cu, P + PTFE. (Author)
Positive Selection of γδ CTL by TL Antigen Expressed in the Thymus
Tsujimura, Kunio; Takahashi, Toshitada; Morita, Akimichi; Hasegawa-Nishiwaki, Hitomi; Iwase, Shigeru; Obata, Yuichi
1996-01-01
To elucidate the function of the mouse TL antigen in the thymus, we have derived two TL transgenic mouse strains by introducing Tla a -3 of A strain origin with its own promoter onto a C3H background with no expression of TL in the thymus. These transgenic mouse strains, both of which express high levels of Tlaa-3-TL antigen in their thymus, were analyzed for their T cell function with emphasis on cytotoxic T lymphocyte (CTL) generation. A T cell response against TL was induced in Tg.Tlaa-3-1, Tg.Tlaa-3-2, and control C3H mice by skin grafts from H-2K b/T3 b transgenic mice, Tg.Con.3-1, expressing T3b-TL ubiquitously. Spleen cells from mice that had rejected the T3b-TL positive skin grafts were restimulated in vitro with Tg.Con.3-1 irradiated spleen cells. In mixed lymphocyte cultures (MLC), approximately 20% and 15% of Thy-1+ T cells derived from Tg.Tlaa-3-1 and Tg.Tlaa-3-2, respectively, expressed TCRγδ, whereas almost all those from C3H expressed TCRαβ. The MLC from Tg.Tlaa-3-2 and C3H demonstrated high CTL activity against TL, while those from Tg.Tlaa-3-1 had little or none. The generation of γδ CTL recognizing TL in Tg.Tlaa-3-2, but not C3H mice, was confirmed by the establishment of CTL clones. A total of 14 γδ CTL clones were established from Tg.Tlaa-3-2, whereas none were obtained from C3H. Of the 14 γδ CTL clones, 8 were CD8+ and 6 were CD4−CD8− double negative. The CTL activity of all these clones was TL specific and inhibited by anti-TL, but not by anti-H-2 antibodies, demonstrating that they recognize TL directly without antigen presentation by H-2. The CTL activity was blocked by antibodies to TCRγδ and CD3, and also by antibodies to CD8α and CD8β in CD8+ clones, showing that the activity was mediated by TCRγδ and coreceptors. The thymic origin of these γδ CTL clones was indicated by the expression of Thy-1 and Ly-1 (CD5), and also CD8αβ heterodimers in CD8+ clones on their surfaces and by the usage of TCR Vγ4 chains in 12 of
Study of 207Tl126 Produced in Deep-Inelastic Reactions
Directory of Open Access Journals (Sweden)
Wilson E.
2014-03-01
Full Text Available Deep-inelastic collisions of a 208Pb beam on a 208Pb target were performed using the ATLAS accelerator at Argonne National Laboratory. The Gammasphere detector array was used for the detection of prompt and delayed gamma-rays of the reaction products.207Tl is one proton away from the 208Pb doubly-magic nucleus. Its low-energy level structure is dominated by the single proton-hole states πs1/2−1, πd3/2−1 and πh11/2−1. The 11/2− state is isomeric with T1/2 = 1.33(11 s. The reaction partner of 207Tl is 209Bi, which has arelatively well established level scheme compared to 207Tl. Cross-coincidences between these two nuclei were used to confirm or establish levels above the 11/2− isomeric state in 207Tl. These states are obtained via breaking of the neutron core. Angular correlation analysis was performed on known transitions in 208Pb, proving the applicability of this method for multipolarity assignment.
International Nuclear Information System (INIS)
Kumagai, K.; Kakuyanagi, K.; Matsuda, Y.; Hasegawa, T.
2003-01-01
Magnetism in the vortex core state has been studied by spatially-resolved NMR. The nuclear spin lattice relaxation rate T 1 -1 of 205 Tl in nearly optimal-doped Tl 2 Ba 2 CuO 6+ δ (T c =85 K) is significantly enhanced in the vortex core region. The NMR results suggest that the suppression of the d-wave superconducting order parameter in the vortex core leads to the nucleation of islands with local antiferromagnetic (AF) order. (author)
Synthesis and properties of Tl endash Ba endash Ca endash Cu endash O superconductors
International Nuclear Information System (INIS)
Siegal, M.P.; Venturini, E.L.; Morosin, B.; Aselage, T.L.
1997-01-01
We review the synthesis methods and properties of single crystal, powder and thin film TlBaCaCuO high-temperature superconducting (Tl-HTS) materials. With transition temperatures ≥100K for several compounds, Tl-HTS materials present real opportunities for applications above 77 K. Experiments using (1) single crystals: determined precise structural parameters and identified the complex Tl 1+ -Tl 3+ equilibrium model; (2) powders: studied the complex thermodynamic phase diagram; and (3) epitaxial films: have studied fundamental properties such as electron pair symmetry and the effect of controlled extrinsic defects on flux pinning strength, as well as providing the large-area surfaces required for device applications. copyright 1997 Materials Research Society
Novel laser-processed CsI:Tl detector for SPECT
Energy Technology Data Exchange (ETDEWEB)
Sabet, H., E-mail: hsabet@mgh.harvard.edu; Uzun-Ozsahin, D.; El-Fakhri, G. [Massachusetts General Hospital, Harvard Medical School, Boston, Massachusetts 02129 (United States); Bläckberg, L. [Massachusetts General Hospital, Harvard Medical School, Boston, Massachusetts 02129 and Department of Physics and Astronomy, Uppsala University, Uppsala 75120 (Sweden)
2016-05-15
Purpose: The aim of this work is to demonstrate the feasibility of a novel technique for fabrication of high spatial resolution CsI:Tl scintillation detectors for single photon emission computed tomography systems. Methods: The scintillators are fabricated using laser-induced optical barriers technique to create optical microstructures (or optical barriers) inside the CsI:Tl crystal bulk. The laser-processed CsI:Tl crystals are 3, 5, and 10 mm in thickness. In this work, the authors focus on the simplest pattern of optical barriers in that the barriers are created in the crystal bulk to form pixel-like patterns resembling mechanically pixelated scintillators. The monolithic CsI:Tl scintillator samples are fabricated with optical barrier patterns with 1.0 × 1.0 mm{sup 2} and 0.625 × 0.625 mm{sup 2} pixels. Experiments were conducted to characterize the fabricated arrays in terms of pixel separation and energy resolution. A 4 × 4 array of multipixel photon counter was used to collect the scintillation light in all the experiments. Results: The process yield for fabricating the CsI:Tl arrays is 100% with processing time under 50 min. From the flood maps of the fabricated detectors exposed to 122 keV gammas, peak-to-valley (P/V) ratios of greater than 2.3 are calculated. The P/V values suggest that regardless of the crystal thickness, the pixels can be resolved. Conclusions: The results suggest that optical barriers can be considered as a robust alternative to mechanically pixelated arrays and can provide high spatial resolution while maintaining the sensitivity in a high-throughput and cost-effective manner.
Novel laser-processed CsI:Tl detector for SPECT
International Nuclear Information System (INIS)
Sabet, H.; Uzun-Ozsahin, D.; El-Fakhri, G.; Bläckberg, L.
2016-01-01
Purpose: The aim of this work is to demonstrate the feasibility of a novel technique for fabrication of high spatial resolution CsI:Tl scintillation detectors for single photon emission computed tomography systems. Methods: The scintillators are fabricated using laser-induced optical barriers technique to create optical microstructures (or optical barriers) inside the CsI:Tl crystal bulk. The laser-processed CsI:Tl crystals are 3, 5, and 10 mm in thickness. In this work, the authors focus on the simplest pattern of optical barriers in that the barriers are created in the crystal bulk to form pixel-like patterns resembling mechanically pixelated scintillators. The monolithic CsI:Tl scintillator samples are fabricated with optical barrier patterns with 1.0 × 1.0 mm"2 and 0.625 × 0.625 mm"2 pixels. Experiments were conducted to characterize the fabricated arrays in terms of pixel separation and energy resolution. A 4 × 4 array of multipixel photon counter was used to collect the scintillation light in all the experiments. Results: The process yield for fabricating the CsI:Tl arrays is 100% with processing time under 50 min. From the flood maps of the fabricated detectors exposed to 122 keV gammas, peak-to-valley (P/V) ratios of greater than 2.3 are calculated. The P/V values suggest that regardless of the crystal thickness, the pixels can be resolved. Conclusions: The results suggest that optical barriers can be considered as a robust alternative to mechanically pixelated arrays and can provide high spatial resolution while maintaining the sensitivity in a high-throughput and cost-effective manner.
TL, EPR and optical absorption in natural grossular crystal
Energy Technology Data Exchange (ETDEWEB)
Yauri, J.M. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-900, Sao Paulo (Brazil); Department of Physics, University of San Agustin, Av. Independencia S/N, Arequipa (Peru); Cano, N.F. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-900, Sao Paulo (Brazil)], E-mail: nilocano@dfn.if.usp.br; Watanabe, S. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-900, Sao Paulo (Brazil)
2008-10-15
Grossular is one of six members of silicate Garnet group. Two samples GI and GII have been investigated concerning their luminescence thermally stimulated (TL). EPR and optical absorption and the measurements were carried out to find out whether or not same point defects are responsible for all three properties. Although X-rays diffraction analysis has shown that both GI and GII have practically the same crystal structure of a standard grossular crystal, they presented different behavior in many aspects. The TL glow curve shape, TL response to radiation dose, the effect of annealing at high temperatures before irradiation, the dependence of UV bleaching parameters on peak temperature, all of them differ going from GI to GII. The EPR signals around g=2.0 as well as at g=4.3 and 6.0 have much larger intensity in GI than in GII. Very high temperature (>800 deg. C) annealing causes large increase in the bulk background absorption in GI, however, only very little in GII. In the cases of EPR and optical absorption, the difference in their behavior can be attributed to Fe{sup 3+} ions; however, in the TL case one cannot and the cause was not found as yet.
TL, EPR and optical absorption in natural grossular crystal
International Nuclear Information System (INIS)
Yauri, J.M.; Cano, N.F.; Watanabe, S.
2008-01-01
Grossular is one of six members of silicate Garnet group. Two samples GI and GII have been investigated concerning their luminescence thermally stimulated (TL). EPR and optical absorption and the measurements were carried out to find out whether or not same point defects are responsible for all three properties. Although X-rays diffraction analysis has shown that both GI and GII have practically the same crystal structure of a standard grossular crystal, they presented different behavior in many aspects. The TL glow curve shape, TL response to radiation dose, the effect of annealing at high temperatures before irradiation, the dependence of UV bleaching parameters on peak temperature, all of them differ going from GI to GII. The EPR signals around g=2.0 as well as at g=4.3 and 6.0 have much larger intensity in GI than in GII. Very high temperature (>800 deg. C) annealing causes large increase in the bulk background absorption in GI, however, only very little in GII. In the cases of EPR and optical absorption, the difference in their behavior can be attributed to Fe 3+ ions; however, in the TL case one cannot and the cause was not found as yet
International Nuclear Information System (INIS)
Ahn, Jae-Jun; Akram, Kashif; Shahbaz, Hafiz Muhammad; Kwon, Joong-Ho
2014-01-01
Frozen fish fillets (walleye Pollack and Japanese Spanish mackerel) were selected as samples for irradiation (0–10 kGy) detection trials using different hydrolysis methods. Photostimulated luminescence (PSL)-based screening analysis for gamma-irradiated frozen fillets showed low sensitivity due to limited silicate mineral contents on the samples. Same limitations were found in the thermoluminescence (TL) analysis on mineral samples isolated by density separation method. However, acid (HCl) and alkali (KOH) hydrolysis methods were effective in getting enough minerals to carry out TL analysis, which was reconfirmed through the normalization step by calculating the TL ratios (TL 1 /TL 2 ). For improved electron spin resonance (ESR) analysis, alkali and enzyme (alcalase) hydrolysis methods were compared in separating minute-bone fractions. The enzymatic method provided more clear radiation-specific hydroxyapatite radicals than that of the alkaline method. Different hydrolysis methods could extend the application of TL and ESR techniques in identifying the irradiation history of frozen fish fillets. - Highlights: • Irradiation has potential to improve hygienic quality of raw and processed seafood. • Detection of irradiated food is important to enforce the applied regulations. • Different techniques were compared to separate silicate minerals from frozen fish. • Limitations were observed in TL analysis on minerals isolated by density separation. • Hydrolysis methods provided more clear identification using TL and ESR techniques
Energy Technology Data Exchange (ETDEWEB)
Kahler, D., E-mail: david.kahler@ngc.com [Northrop Grumman Corporation, ES-ATL, 1212 Winterson Road, Linthicum, MD 21090 (United States); Singh, N.B.; Knuteson, D.J.; Wagner, B.; Berghmans, A.; McLaughlin, S.; King, M.; Schwartz, K. [Northrop Grumman Corporation, ES-ATL, 1212 Winterson Road, Linthicum, MD 21090 (United States); Suhre, D.; Gotlieb, M. [DRS Scientific, 300 Oak Lake Road, New Kensington, PA 15068 (United States)
2011-10-01
In this paper we report on the electrical characteristics of three novel ternary compounds, Tl{sub 3}AsSe{sub 3} (TAS), TlGaSe{sub 2} (TGS), and Tl{sub 4}HgI{sub 6} (THI), pertaining to their use as radiation detectors. The details for growth and material characterization are not presented. A semiconductor based gamma ray detector requires a material with high Z, high density, high resistivity, appropriate bandgap (1.5-2 eV), low energy/electron-hole pair, and a high {mu}{tau} product. CZT is currently the best semiconductor material for room temperature gamma ray spectroscopy; however, it is extremely difficult to produce large volumes of detector grade material, making it expensive and in limited supply. DNDO/DHS began searching for other materials that might perform as well as CZT but be easier to grow and in the end lower the cost. For this purpose, we investigated the above three materials as possible replacements for CZT as gamma ray detectors. The bulk resistivity, I-V curves, X-ray response, and gamma ray response measurements for doped and undoped crystals are presented and discussed. TAS shows good X-ray and gamma ray response, but has poor resistivity, which results in large dark current and poor spectral response. TGS has good resistivity, but shows poor X-ray and gamma ray response. THI has excellent resistivity, shows some X-ray and gamma ray response, and has great potential as a gamma ray detector.
Thallium(I copper(I thorium(IV triselenide, TlCuThSe3
Directory of Open Access Journals (Sweden)
James A. Ibers
2012-07-01
Full Text Available Thallium(I copper(I thorium(IV triselenide, TlCuThSe3, crystallizes with four formula units in the space group Cmcm in the KCuZrS3 structure type. There is one crystallographically independent Th, Tl, and Cu atom at a site of symmetry 2/m.., m2m, and m2m, respectively. There are two crystallographically independent Se atoms at sites of symmetry m.. and m2m. The structure consists of sheets of edge-sharing ThSe6 octahedra and CuSe4 tetrahedra stacked parallel to the (010 face, separated by layers filled with chains of Tl running parallel to [100]. Each Tl is coordinated by a trigonal prism of Se atoms.
Defects that control the properties of Tl- and Hg-based superconductors
International Nuclear Information System (INIS)
Jorgensen, J.D.; Chmaissem, O.; Hinks, D.G.; Mitchell, J.F.; Wagner, J.L.; Univ. of North Dakota, Grand Forks, ND; Jensen, W.R.; Dabrowski, B.; Northern Illinois Univ., DeKalb, IL
1997-03-01
Defects that affect T c in Tl 2 Ba 2 CuO 6+δ and HgBa 2 CuO 4+δ and HgBa 2 CuO 4+δ have been characterized by neutron powder diffraction. In Tl 2 Ba 2 CuO 6+δ , the dominant defect is interstitial oxygen between the two Tl-O planes, but Cu substitution on the Tl site also affects properties and there is evidence for a second oxygen defect for compositions in the vicinity of maximum T c . In HgBa 2 CuO 4+δ , there are two competing oxygen defects in the Hg layer. The relative concentrations of these defects switches upon passing from the underdoped region, through the maximum T c , to the overdoped region. This remarkable behavior could result from a change in the topology of the Fermi surface upon passing through the van Hove singularity
Pulse shaping for fast coincidence with NaI(Tl) detectors
International Nuclear Information System (INIS)
Bose, S.; Sinha, B.K.; Bhattacharya, R.
1983-01-01
The effect of multiple limiting of the anode pulses of the photomultiplier tubes on the resolving time of an NaI(Tl)-NaI(Tl) fast coincidence set up is investigated with the help of a simple transistored limiter circuit. The performance of the set up for different energy ranges selected in the side channels is also investigated. (orig.)
Mat Jan, Nur Amalina; Shabri, Ani
2017-01-01
TL-moments approach has been used in an analysis to identify the best-fitting distributions to represent the annual series of maximum streamflow data over seven stations in Johor, Malaysia. The TL-moments with different trimming values are used to estimate the parameter of the selected distributions namely: Three-parameter lognormal (LN3) and Pearson Type III (P3) distribution. The main objective of this study is to derive the TL-moments ( t 1,0), t 1 = 1,2,3,4 methods for LN3 and P3 distributions. The performance of TL-moments ( t 1,0), t 1 = 1,2,3,4 was compared with L-moments through Monte Carlo simulation and streamflow data over a station in Johor, Malaysia. The absolute error is used to test the influence of TL-moments methods on estimated probability distribution functions. From the cases in this study, the results show that TL-moments with four trimmed smallest values from the conceptual sample (TL-moments [4, 0]) of LN3 distribution was the most appropriate in most of the stations of the annual maximum streamflow series in Johor, Malaysia.
Energy Technology Data Exchange (ETDEWEB)
Ångström, J.; Sahlberg, M.; Berger, R.
2015-07-15
Highlights: • Topotactic transition from TlCu{sub 3}Se{sub 2} to TlCu{sub 2}Se{sub 2} followed in situ. • Synchrotron radiation X-ray powder diffraction enabled short scans. • Relative abundance of phases refined from powder data. • Opens up for studying similar systems in the same manner. - Abstract: The solid state transformation of monoclinic TlCu{sub 3}Se{sub 2} into tetragonal TlCu{sub 2}Se{sub 2} by oxidative copper leaching in concentrated ammonia solution has been studied in situ by the use of synchrotron radiation. The diffraction patterns of parent and daughter phase are both sharp, indicating a strong topotactic relationship between them that effectuates a rapid change by “chimie douce” performed at +19 °C. The transformation rate is strongly connected to the access of oxygen from the surrounding air. The transformation was followed in a real-time mode, being almost complete after 2.5 h with 1 h incubation due to low oxygen content, as shown from refining the diffraction patterns by Rietveld profile technique.
International Nuclear Information System (INIS)
Zhou Dehai; Xie Degao; Chao Yangshu; Liao Fuquan; Zhang Youfa; Wang Zefu
1992-01-01
The separative conditions of 199 Tl from Cu, Au and Ga by reaction 197 Au(α, 2n) 199 Tl on the internal target installation of cyclotron is studied. The α-particle energy is selected in the range of 24-15 MeV. The cumulative current intensities of such α-particle beams bombarding the gold target at 150-200 μA are 1200 μA · h and 1500 μA · h respectively. The radiochemical separation of 199 Tl is carried out with isopropyl ether extraction and anions exchange from the irradiated gold targets. The radioactivities of 199 Tl and 200 Tl are 2.3 x 10 5 Bq and 7.1 x 10 2 Bq, and 200 Tl makes up 0.29% of the total radioactivity. The impurity elements contained 1 ml of 199 TlCl injection solution are Au 199 TlCl has been used in clinical experiments in vivo and relatively good results have been obtained
ncRNA consensus secondary structure derivation using grammar strings.
Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh
2011-04-01
Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.
Inherent and antigen-induced airway hyperreactivity in NC mice
Directory of Open Access Journals (Sweden)
Tetsuto Kobayashi
1999-01-01
Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.
Coronary collateral circulation during exercise assessed with stress Tl-201 SPECT
International Nuclear Information System (INIS)
Tanaka, Takeshi; Aizawa, Tadanori
1995-01-01
Stree Tl-201 single photon emission computed tomography (SPECT) was undertaken in 25 patients with complete occlusion of the left anterior descending artery in which the major collateral circulation was septal segment supplied by the right posterior descending artery with no significant occlusion. The ratio of blood flow in ischemic area to that in normal area was quantitatively determined on Tl-201 images, and the degree of ischemia was expressed by Tl uptake ratio. Ischemia was found in 22 of the 25 patients. Of the 22 patients, 9 showed Tl uptake ratio of less than 50%. Tl uptake ratio in the inferior segment was 76.8±10.3%. In 11 patients, it was less than 75%. Redistribution images were acquired in 19 patients. Changes in Tl uptake ratio on the 90 degrees projection of the septum were less than 20%, with a lowest value of 59.1±11.3% in 14 patients; and these were 20% or more, with a lowest value of 45.2±11.1% in 8 patients. When coronary collateral circulation is not supplied by exercise, septal perfusion may be decreased. In cases of complete occlusion of the anteiror descending artery, ischemia may not uniform over the whole ischemic area and may be noticeable around the anterior descending artery. In cases of lesions in the anteior descending artery, however, collateral circulation supplied by the right coronary artery may occur by exercise when ischemia in the anterior segment was severer than in the septal segment. (N.K.)
Sand as in situ TL dosimeter in radiation hygienisation of sewage sludge
International Nuclear Information System (INIS)
Benny, P.G.; Bhatt, B.C.
1999-01-01
Recently, we have investigated the thermoluminescence (TL) properties of the sand, collected from the sewage sludge, after various extensive cleansing procedures. In the present studies, the sand separated from the sludge was used to estimate irradiation dose to sludge at Sludge Hygienisation Research Irradiator (SHRI), Vadodara, India. A dose vs TL response calibration curve was established for the 220 deg. C TL peak for the hydrogen peroxide (H 2 O 2 )-treated and HF-treated sludge sand samples collected from the unirradiated batch. This was used to estimate the dose absorbed in the corresponding batch of the irradiated sludge. Similar curve was plotted for the 370 deg. C TL peak for the HF-treated sand samples for its application as an in-situ dosimeter. Using this method, the absorbed dose rate delivered to the sludge during irradiation at SHRI was estimated to be 0.49 ± 0.02 kGy per hour. Also, the saturation levels of the TL response curves for these peaks are reported here. (author)
Ahn, Jae-Jun; Akram, Kashif; Shahbaz, Hafiz Muhammad; Kwon, Joong-Ho
2014-12-01
Frozen fish fillets (walleye Pollack and Japanese Spanish mackerel) were selected as samples for irradiation (0-10 kGy) detection trials using different hydrolysis methods. Photostimulated luminescence (PSL)-based screening analysis for gamma-irradiated frozen fillets showed low sensitivity due to limited silicate mineral contents on the samples. Same limitations were found in the thermoluminescence (TL) analysis on mineral samples isolated by density separation method. However, acid (HCl) and alkali (KOH) hydrolysis methods were effective in getting enough minerals to carry out TL analysis, which was reconfirmed through the normalization step by calculating the TL ratios (TL1/TL2). For improved electron spin resonance (ESR) analysis, alkali and enzyme (alcalase) hydrolysis methods were compared in separating minute-bone fractions. The enzymatic method provided more clear radiation-specific hydroxyapatite radicals than that of the alkaline method. Different hydrolysis methods could extend the application of TL and ESR techniques in identifying the irradiation history of frozen fish fillets.
International Nuclear Information System (INIS)
Mukuda, Hidekazu; Shiki, Nozomu; Kimoto, Naoki; Yashima, Mitsuharu; Kitaoka, Yoshio; Tokiwa, Kazuyasu; Iyo, Akira
2016-01-01
We report 63 Cu- and 205 Tl-NMR studies on six-layered (n = 6) high-T c superconducting (SC) cuprate TlBa 2 Ca 5 Cu 6 O 14+δ (Tl1256) with T c ∼ 100 K, which reveal that antiferromagnetic (AFM) order takes place below T N ∼ 170 K. In this compound, four underdoped inner CuO 2 planes [n(IP) = 4] sandwiched by two outer planes (OPs) are responsible for the onset of AFM order, whereas the nearly optimally-doped OPs responsible for the onset of bulk SC. It is pointed out that an increase in the out-of-plane magnetic interaction within an intra-unit-cell causes T N ∼ 45 K for Tl1245 with n(IP) = 3 to increase to ∼170 K for Tl1256 with n(IP) = 4. It is remarkable that the marked increase in T N and the AFM moments for the IPs does not bring about any reduction in T c , since T c ∼ 100 K is maintained for both compounds with nearly optimally doped OP. We highlight the fact that the SC order for n ≥ 5 is mostly dominated by the long-range in-plane SC correlation even in the multilayered structure, which is insensitive to the magnitude of T N and the AFM moments at the IPs or the AFM interaction among the IPs. These results demonstrate a novel interplay between the SC and AFM orders when the charge imbalance between the IPs and OP is significantly large. (author)
Sample dependent correlation between TL and LM-OSL in Al2O3:C
International Nuclear Information System (INIS)
Dallas, G.I.; Polymeris, G.S.; Stefanaki, E.C.; Afouxenidis, D.; Tsirliganis, N.C.; Kitis, G.
2008-01-01
Al 2 O 3 :C single crystals are known to exhibit different, sample dependent, glow-curve shapes. The relation between the Thermoluminescence (TL) traps and the linear modulated optically stimulation luminescence (LM-OSL) traps is of high importance. In the present work a correlation study is attempted using 23 single crystals with dimensions between 400 and 500μm. The correlation study involved two steps. In the first step, both TL glow curves and LM-OSL decay curves are deconvoluted and a one-to-one correlation between TL peaks and LM-OSL components is attempted. In the second step the TL glow-curves are corrected for thermal quenching, the corrected curves are deconvoluted and a new correlation between TL and LM-OSL individual components is performed
Improving TL dosimetry for external radiotherapy
International Nuclear Information System (INIS)
Bustos, S.R.; Velez, G.; Rubio, M.
1998-01-01
Full text: In vivo thermoluminescence dosimetry (TLD) has always been one of the most accurate dosimetry method for external radiotherapy control, but the delay in the response is a well know drawback when it is applied. In this work we show some improvements and demonstrate that keeping the precision and accuracy of this technique, it is possible to obtain a response in few hours. Harshaw 4000 TL reader and LiF TLD-100 dosimeters, chips (3,1 x 3,1 x 0,9 mm 3 ) and rods (1 x 1 x 6 mm 3 ) have been used. The thermal treatment necessary to reuse the TLD is only 1h at 400 degree C, by using a glow curve analyser developed at the Ciemat (Spain), that allows a complete, prompt and precise identification of the individuals peaks. The dosimeters are periodically and individually calibrated. We also have study the factors contributing to the relation TL-dose like linearity, energy correction, directional response and fading. All those results are included into an Excel worksheet which automatically give us the dose resulting from the TL reading (peaks areas 4 and 5). The obtained uncertainty is better than 5%. The TLD already irradiated in radiotherapy institutions distant 30-40 Km from our centre can be read and analysed in about 3-4 hours. These facts render our methods rapid and allow a better control of radiotherapy treatment even if it is bi-fractionated. (author) [es
TL and OSL dosimetric properties of Opal gemstone for gamma radiation dosimetry
International Nuclear Information System (INIS)
Antonio, Patrícia L.; Gronchi, Claudia C.; Oliveira, Raquel A.P.; Khoury, Helen J.; Caldas, Linda V.E.
2016-01-01
In this work, the response of the natural material Opal was studied in relation to its thermoluminescence (TL) and optically stimulated luminescence (OSL), after exposure to the gamma radiation of a "6"0Co source. The structure of the powdered Opal was verified using the X-ray diffraction, scanning electronic microscopy and energy-dispersive X-ray spectroscopy techniques. The material, in its stone form, was turned into powder and mixed to Teflon (also in powder) in three different concentrations, and then pellets were manufactured. The aim of this work was to evaluate the response of these pellets in high-doses of gamma radiation beams, and to observe their possible application as dosimeters, using the TL and OSL techniques. The dosimetric properties of the samples were analyzed by means of different tests, as: TL emission curves and OSL signal decay curves, reproducibility of TL and OSL response, minimum detectable dose, TL and OSL dose–response curves (5 Gy–10 kGy), and fading. The results obtained in this work, for the TL and OSL phenomena, demonstrated that the pellets of Opal + Teflon present an adequate performance e possibility of use as dosimeters in beams of high-dose gamma radiation. - Highlights: • The XRD, SEM and EDX techniques were used to investigate powdered Opal. • Pellets of three different concentrations of Opal and Teflon were studied. • The dosimetric properties of the Opal + Teflon pellets were verified. • TL and OSL techniques were used to analyze the characteristics of the pellets. • Pellets of concentration of 2:1 (Opal:Teflon) presented the most adequate results.
RDM lifetime measurements in 187Tl
International Nuclear Information System (INIS)
Chamoli, S.K.; Joshi, P.; Kumar, A.; Govil, I.M.; Mukherjee, G.; Singh, R.P.; Muralithar, S.; Bhowmik, R.K.
2003-01-01
The present work is an attempt to study the shape changes in 187 Tl through a measurement of electromagnetic transition probabilities of the high spin states. The Doppler shifted recoil distance technique was used to measure the lifetimes
Trefilova, L N; Kovaleva, L V; Zaslavsky, B G; Zosim, D I; Bondarenko, S K
2002-01-01
Based on the analysis of light yield dependence on activator concentration for NaI:Tl and CsI:Tl excited by gamma-rays, soft X-rays and alpha-particles, an explanation of the effect of energy resolution enhancement with the rise of Tl content has been proposed. Based on the concept regarding the electron track structure, we proposed an alternative explanation of the intrinsic resolution value. The concept does not take into account the non-proportional response to electrons of different energies and is based on the statistic fluctuation of scintillation photon number formed outside and inside the regions of higher ionization density.
On the Constitution of SoTL: Its Domains and Contexts
Booth, S.; Woollacott, L. C.
2018-01-01
In this paper, we present an analysis of the Scholarship of Teaching and Learning in Higher Education (SoTL) which contributes to SoTL both as a field of research practice and as a background to professional development in higher education. We analyse and describe the constitution of the field, and in so doing address its nature in the face of the…
International Nuclear Information System (INIS)
Lou Ying; Jiang Jinqi; Xie Wenhui; Yuan Fang; Wang Tong; Yang Yiqing
2012-01-01
Objective: To evaluate the value of dipyridamole stress 201 Tl myocardial SPECT in detecting dysfunction of coronary microcirculation. Methods: Forty-eight patients diagnosed with cardiac syndrome X underwent dipyridamole stress 201 Tl myocardial SPECT. Dipyridamole (0.56 mg/kg) was intravenously injected over 4 min followed by 201 Tl (111 MBq) injection at 2 min after dipyridamole administration. Image was acquired at 10 min and 240 min post-injection and co-analyzed by over two experienced doctors in nuclear medicine after three-dimensional reconstruction. The patients with 'reverse redistribution' underwent repeated dipyridamole stress 201 Tl SPECT after medical therapy for 2 weeks. The clinical symptoms and results of the treadmill exercise test pre-and post-therapy were compared. Results: Forty two patients (42/48, 87.50%) showed segmental defects: 'reverse redistribution' on delayed (240 min) 201 Tl images. After medical treatment, 36 cases of the 42 'reverse redistribution' patients had improvement in both clinical symptoms and treadmill exercise test. Post-treatment 201 Tl imaging showed improvement in 45/49 (91.84%) defect segments. Six of the 42 patients had no improvement in clinical symptoms and/or treadmill exercise test. Post-treatment 201 Tl imaging showed no improvement in all the 7 defect segments on the first scan. Conclusion: Dipyridamole stress 201 Tl myocardial SPECT may be valuable in evaluation of impaired coronary microcirculation associated with cardiac syndrome X. (authors)
High-pressure single-crystal X-ray diffraction of Tl2SeO4
International Nuclear Information System (INIS)
Grzechnik, Andrzej; Breczewski, Tomasz; Friese, Karen
2008-01-01
The effect of pressure on the crystal structure of thallium selenate (Tl 2 SeO 4 ) (Pmcn, Z=4), containing the Tl + cations with electron lone pairs, has been studied with single-crystal X-ray diffraction in a diamond anvil cell up to 3.64 GPa at room temperature. No phase transition has been observed. The compressibility data are fitted by a Murnaghan equation of state with the zero-pressure bulk modulus B 0 =29(1) GPa and the unit-cell volume at ambient pressure V 0 =529.6(8) A 3 (B'=4.00). Tl 2 SeO 4 is the least compressible in the c direction, while the pressure-induced changes of the a and b lattice parameters are quite similar. These observations can be explained by different pressure effects on the nine- and 11-fold coordination polyhedra around the two non-equivalent Tl atoms. The SeO 4 2- tetrahedra are not rigid units and become more distorted. Their contribution to the compressibility is small. The effect of pressure on the isotypical oxide materials A 2 TO 4 with the β-K 2 SO 4 structure is discussed. It appears that the presence of electron lone pairs on the Tl + cation does not seem to influence the compressibility of Tl 2 SeO 4 . - Graphical abstract: Pressure dependence of normalized lattice parameters and unit-cell volumes in Tl 2 SeO 4 (Pmcn, Z=4). The solid line is the Murnaghan equation of state
Improving Earth Science Metadata: Modernizing ncISO
O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.
2016-12-01
ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.
Explorations of the extended ncKP hierarchy
International Nuclear Information System (INIS)
Dimakis, Aristophanes; Mueller-Hoissen, Folkert
2004-01-01
A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities
International Nuclear Information System (INIS)
Nagpal, J.S.
1980-01-01
Photoluminescence and absorption spectra of TL phosphors TLD-100, CaF 2 :Dy, CaSO 4 :Dy(0.05%wt), CaSO 4 :Tm(0.05%wt) and Mg 2 SiO 4 :Tb have been measured. The absorption spectra are typical of RE 2+ in rare earth doped irradiated phosphors. On heating RE 2+ yields RE 3+ and emission from the excited states of RE 3+ is observed. (author)
Mechanisms of TL for production of the 230 {sup o}C peak in natural sodalite
Energy Technology Data Exchange (ETDEWEB)
Cano, Nilo F., E-mail: nilocano@dfn.if.usp.b [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil); Professional School of Physics, University of San Agustin of Arequipa, Av. Independencia S/N, Arequipa (Peru); Blak, Ana R. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil); Ayala-Arenas, Jorge S. [Professional School of Physics, University of San Agustin of Arequipa, Av. Independencia S/N, Arequipa (Peru); Watanabe, Shigueo [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil)
2011-02-15
The thermoluminescence (TL) peak in natural sodalite near 230 {sup o}C, which appears only after submitted to thermal treatments and to gamma irradiation, has been studied in parallel with electron paramagnetic resonance (EPR) spectrum appearing under the same procedure. This study revealed a full correlation between the 230 {sup o}C TL peak and the eleven hyperfine lines from EPR spectrum. In both case, the centers disappear at the same temperature and are restored after gamma irradiation. A complete model for the 230 {sup o}C TL peak is presented and discussed. In addition to the correlation and TL model, specific characteristics of the TL peaks are described.
An analysis of annual maximum streamflows in Terengganu, Malaysia using TL-moments approach
Ahmad, Ummi Nadiah; Shabri, Ani; Zakaria, Zahrahtul Amani
2013-02-01
TL-moments approach has been used in an analysis to determine the best-fitting distributions to represent the annual series of maximum streamflow data over 12 stations in Terengganu, Malaysia. The TL-moments with different trimming values are used to estimate the parameter of the selected distributions namely: generalized pareto (GPA), generalized logistic, and generalized extreme value distribution. The influence of TL-moments on estimated probability distribution functions are examined by evaluating the relative root mean square error and relative bias of quantile estimates through Monte Carlo simulations. The boxplot is used to show the location of the median and the dispersion of the data, which helps in reaching the decisive conclusions. For most of the cases, the results show that TL-moments with one smallest value was trimmed from the conceptual sample (TL-moments (1,0)), of GPA distribution was the most appropriate in majority of the stations for describing the annual maximum streamflow series in Terengganu, Malaysia.
Effects of smoking on lung uptake of 201Tl during exercise myocardial perfusion imaging
International Nuclear Information System (INIS)
Ouyang Wei; He Guorong; Liu Jinhua
2004-01-01
Objective: To investigate the influence of smoking on lung uptake of 201 Tl during myocardial perfusion imaging. Methods: Ninety-two healthy subjects, with normal 201 Tl myocardial perfusion imaging findings but no evidence of left ventricular hypertrophy and pulmonary disease, were divided into three groups, smoker, nonsmoker and quitted smoker groups. Exercise/delay 201 Tl myocardial perfusion imaging was performed on all subjects included. Lung/heart ratio was defined on the anterior planar image obtained during exercise tomography. Results: Both the lung/heart ratios during exercise in smoker (0.40 ± 0.07, F=10.635, P 201 Tl lung/heart ratios in smokers are higher than in nonsmokers and this must be kept in mind when 201 Tl lung/heart ratios are used clinically, even in quitted smokers
The model of recombination process in TlBr
International Nuclear Information System (INIS)
Grigorjeva, L.; Millers, D.
2002-01-01
The time-resolved luminescence was used as a tool in the study of recombination process in several undoped TlBr crystals. The spectra and decay kinetics observed under electron beam excitation were investigated. Observation of several luminescence bands with different decay rates shows that more than one recombination center is involved and the recombination process is quite complicated. The band at ∼2.5 eV is dominant under 10 ns excitation pulse (electron beam or nitrogen laser pulses). The results of short-lived absorption and luminescence are used for analysis of possible mechanisms of recombination processes in TlBr
Wheat stem rust (Puccinia graminis f. sp. tritici Eriks. and E. Henn.) is one of the most destructive diseases world-wide. Races belonging to Ug99 (or TTKSK) continue to cause crop losses in East Africa and threaten global wheat production. Developing and deploying wheat varieties with multiple race...
Wheat production is threatened by the disease stem rust, which is caused by the biotrophic fungal pathogen Puccinia graminis Pers.:Pers. f. sp. tritici (Pgt). Among all known Pgt races, TTKSK (Ug99) and TRTTF are significant threats to North American wheat production due to their virulence against f...
Clinical evaluation of the Tl-201 ECG-gated myocardial SPECT
International Nuclear Information System (INIS)
Mochizuki, Teruhito
1989-01-01
In order to evaluate the clinical usefulness of the Tl-201 ECG-gated myocardial single photon emission computed tomography (SPECT), we compared the wall motion and the grade of the Tl-201 uptake of the ECG-gated myocardial SPECT with the wall motion of the ECG-gated blood pool SPECT. Materials were 87 patients of 50 old myocardial infarctions (OMIs), 19 hypertrophic cardiomyopathies (HCMs), 2 dilated cardiomyopathies (DCMs) and 16 others. After intravenous injection of 111-185 MBq (3-5 mCi) of Tl-201 at rest, the projection data were acquired using a rotating gamma-camera through 180deg, from RAO 45deg in 24 directions, each of which consisted of 80-100 beats. For the reconstruction of ED, ES and non-gated images, R-R interval was divided into about 20 (18-22) fractions. In 348 regions of interest (anterior, septal, lateral and inferior wall) in 87 cases, wall motion and the Tl-201 uptake were evaluated to three grades (normal, hypokinesis and akinesis; normal, low and defect, respectively), which were compared with the wall motion of the ECG-gated blood pool SPECT. The wall motion and the grade of the Tl-201 uptake of the ECG-gated myocardial SPECT correlated well with the wall motion of the ECG-gated blood pool SPECT (96.6% and 87.9%, respectively). In conclusion, the ECG-gated myocardial SPECT can provide clear perfusion images and is a very useful diagnostic strategy to evaluate the regional wall motion and perfusion simultaneously. (author)
Development of NaI(Tl) scintillating films for imaging soft x-rays
International Nuclear Information System (INIS)
Shepherd, J.A.
1993-01-01
Thin film NaI(Tl) scintillators, of areas of up to 130 cm 2 , have been fabricated and characterized for use on soft x-ray imaging photomultiplier tubes. Relevant parameters of photon-counting imaging detectors are defined and used to predict the performance of several materials, including CsI(Na), CsI(Tl), CaF 2 (Eu), Lu 2 (SiO 4 )O:Ce, and NaI(Tl), as thin film scintillators on fiber optic substrates. Also, x-ray imaging methodologies are compared. The NaI(Tl) films were vapor-deposited onto quartz and fiber optic substrates using a powder flash deposition technique. When compared to single crystal NaI(Tl), the films were found to have equally high light yield but lower energy resolution. Light yield optimization was studied in detail including the effects of substrate temperature, activator concentration in the evaporant, and boat temperature. Spatial resolution as well as parallax errors are discussed and measured for film thicknesses up to 61 μm. A technique is described that can substantially increase the light collection of high index films on fiber optic disks. The light collection was improved by 20% by coating the disk with potassium silicate before the NaI(Tl) deposition. Large area films, up to 130 cm 2 , had a spatial uniformity of response within ±1.5% for count rate and ±3.5% for light yield, and their spatial resolution exceeded 16.6 lp mm -1 when deposited onto fiber optic substrates. The 8-keV x-ray detection efficiency of the microchannel plate imaging photomultiplier tube coupled to a NaI(Tl) film scintillator is predicted to be 88%. Other uses for the films are also described
Minimising the Spurious TL of Recently Fired Ceramics Using the Foil Technique
International Nuclear Information System (INIS)
Michael, C.T.; Zacharias, N.; Polikreti, K.; Pagonis, V.
1999-01-01
The new foil technique for measuring the natural dose in TL dating is briefly presented. In this technique very thin samples are made with the necessary plasticity to achieve the best heating contact between sample and heater plate. Measurements can then be made in vacuum and it is possible to use higher heating rates. The effect of the increase of the TL signal with the increase of the heating rate is presented. The foil technique reduces chemiluminescence and increases the TL signal. This allows the application of TL dating to be extended to lower limits (lower ages). These limits are determined by estimating quantitatively the effects of the sample preparation procedure on the induction of spurious TL (triboluminescence). Samples from a two year old ceramic vase were prepared with two different powder preparation procedures: (a) by using a hand drill with a common steel edge and (b) by crushing a piece using a vice. Measurements at a heating rate of 50 deg. C.s -1 were made. The two estimates of P (total dose) provide an estimate of age for each procedure. The age estimation for the vice prepared sample is about 30 years and for the drilled sample is higher than 120 years. It is suggested that the use of a drill for powder preparation be avoided, especially in TL dating and authenticity tests of recently fired ceramics (less than 500 years). (author)
Portable in situ NaI(Tl) γ spectroscopy system
International Nuclear Information System (INIS)
Wang Bairong; Dong Binjiang; Zeng Liping; Shen Tingyun
2000-01-01
The author describes a portable in situ NaI(Tl) γ spectroscopy system, which consists of a NaI (Tl) scintillation detector, an integrative spectroscopy card, a notebook computer and spectroscopy software. The spectrometer addresses applications in environmental or nuclear accident in situ γ spectroscopy measurements, and gives valid quantitative results of radionuclide concentrations per unit volume (Bq/kg) or unit area (Bq/cm 2 ) in the soil and absorbed dose rate in air at 1 m above ground (Gy/h)
Examination of TL and optical absorption in calcite's mineral
International Nuclear Information System (INIS)
Sabikoglu, I.; Can, N.
2009-01-01
Calcite which is a form of crystalline of the calcium carbonate composes parent material of chalk stone (limestone) and marble. Calcite which presents in various colors also in our country consists of yellow, blue, transparent and green colors. In this study, green calcite mineral which is taken from the region of Ayvalik, was examined of its thermoluminescence (TL) and optical absorption features in different doses. It has been obtained a large TL peak in 179 degree C and absorption peak in 550 mm.
International Nuclear Information System (INIS)
Bruine, J.F. de.
1988-01-01
The development, animal and human experiments and the first clinical results of a new blood flow tracer thallium-201 diethyldithiocarbamate (Tl-201 DDC) are discussed for functional brain imaging with single-photon emission computed tomography (SPECT). 325 refs.; 43 figs.; 22 tabs
EPR and TL correlation in some powdered Greek white marbles
International Nuclear Information System (INIS)
Baieetto, Vanessa; Villeneuve, Gerard; Guibert, Pierre; Schvoerer, Max
2000-01-01
Thermoluminescence of white powdered marble samples, chosen to display different EPR spectra, were studied. Two peaks at 280 deg. C and 360 deg. C can be observed among the TL glow curves while the EPR spectra exhibit two signals: the A signal with g perp =2.0038 and g par =2.0024 due to the SO - 3 centre and the B one with g 1 =2.0005; g 2 =2.0001; g 3 =1.9998 due to mechanical powder reduction (drilling). Owing to heating and simultaneous experiments, a correlation have been established: the 280 deg. C TL peak is associated to the A signal and thus to the SO - 3 centre and the 360 deg. C TL peak is caused by mechanical treatment corresponding to the B EPR signal
EPR and TL correlation in some powdered Greek white marbles.
Baïetto, V; Villeneuve, G; Guibert, P; Schvoerer, M
2000-02-01
Thermoluminescence of white powdered marble samples, chosen to display different EPR spectra, were studied. Two peaks at 280 degrees C and 360 degrees C can be observed among the TL glow curves while the EPR spectra exhibit two signals: the A signal with g perpendicular = 2.0038 and g parallel = 2.0024 due to the SO3- centre and the B one with g1 = 2.0005; g2 = 2.0001; g3 = 1.9998 due to mechanical powder reduction (drilling). Owing to heating and simultaneous experiments, a correlation have been established: the 280 degrees C TL peak is associated to the A signal and thus to the SO3- centre and the 360 degrees C TL peak is caused by mechanical treatment corresponding to the B EPR signal.
Microcomputer control of automated TL reader
International Nuclear Information System (INIS)
Bjarland, B.
1980-01-01
An automatic TL reader has been developed for use within a TLD based personal monitoring service. A 6800 based microcomputer is used for system control, operator communication, calibration and checking of reader operation, and for output of data. The dosimeter identity code is printed in human readable characters on the dosimeter card, and is read by using an optical character recognition unit. The code may include individual sensitivity correction coefficients for the TL chips on the card. The chips are heated with hot nitrogen gas and the thermoluminescence is recorded by a photomultiplier tube circuit, the gain and offset of which are continuously monitored and, when necessary, adjusted, to maintain calibration. The reader may operate in any of seven modes, i.e. reading modes for three types of dosimeters, semiautomatic modes for production of the three types of dosimeters, and a monitor mode. (Auth.)
Energy Technology Data Exchange (ETDEWEB)
Preciado F, S.; Melendrez, R.; Chernov, V.; Barboza F, M. [Universidad de Sonora, A.P. 13 y A.P. 5-088, 83000 Hermosillo, Sonora (Mexico); Schreck, M. [Universitaet Augsburg, Institut fuer Physik D-86135 (Germany); Cruz Z, E. [ICN, UNAM, 04500 Mexico D.F. (Mexico)
2005-07-01
The diamond possesses a privileged position regarding other materials of great technological importance. Their applications go from the optics, microelectronics, metals industry, medicine and of course as dosemeter, in the registration and detection of ionizing and non ionizing radiation. In this work the results of TL/LOE obtained in two samples of diamond of 10 {mu}m thickness grown by the chemical vapor deposition method (CVD) assisted by microwave plasma. The films were deposited in a silicon substrate (001) starting from a mixture of gases composed of CH{sub 4}/H{sub 2} and 750 ppm of molecular nitrogen as dopant. The samples were exposed to beta radiation (Sr{sup 90}/ Y{sup 90}) and ultraviolet, being stimulated later on thermal (TL) and optically (LOE) to evaluate their dosimetric properties. The sample without doping presented high response TL/LOE to the ultraviolet and beta radiation. The TL glow curve of the sample without doping showed two TL peaks with second order kinetics in the range of 520 to 550 K, besides a peak with first order kinetics of more intensity around 607 K. The TL efficiency of the non doped sample is bigger than the doped with nitrogen; however the LOE efficiency is similar in both samples. The results indicate that the CVD diamond possesses excellent perspectives for dosimetric applications, with special importance in radiotherapy due to it is biologically compatible with the human tissue. (Author)
Pressure-induced transition in Tl2MoO4
International Nuclear Information System (INIS)
Machon, Denis; Friese, Karen; Breczewski, Tomasz; Grzechnik, Andrzej
2010-01-01
Tl 2 MoO 4 has been studied under high-pressure by X-ray diffraction, Raman spectroscopy, and optical absorption measurements. A first-order phase transition is observed at 3.5±0.5 GPa. The nature (ordered vs. disordered) of the high-pressure phase strongly depends on the local hydrostatic conditions. Optical absorption measurements tend to show that this transition is concomitant with an electronic structure transformation. Prior to the transition, single crystal X-ray diffraction shows that pressure induces interactions between MoO 4 fragments and the Mo coordination number tends to increase. In addition, the stereoactivity of the lone-pair electrons on the three symmetrically independent Tl-sites is not uniform; while for two sites the stereoactivity decreases with increasing pressures for the third site the stereoactivity increases. - Graphical Abstract: (up) Structural evolutions of Tl 2 MoO 4 in the low-pressure phase. (Down) Optical properties of the high-pressure phase as a function of pressure. Display Omitted
Directory of Open Access Journals (Sweden)
S.Z. Mohammadi
2016-11-01
Full Text Available Dispersive liquid–liquid microextraction based on solidification of floating organic droplet was successfully used as a sample preparation method prior to flame atomic absorption determination of trace amounts of Tl(III and Tl(I in hair samples. In the proposed method, 1-(2-pyridylazo-2-naphthol, 1-dodecanol and ethanol were used as chelating agent, extraction and dispersive solvent, respectively. Several factors that may be affected in the extraction process, such as type and volume of extraction and disperser solvents, pH, salting out effect, ionic strength and extraction time were studied. Under the optimal conditions, linearity was maintained between 6.0 and 900.0 ng mL−1 for Tl(III. The relative standard deviation for seven replicate determinations of 0.2 μg mL−1 Tl(III was 2.5%. The detection limit based on 3Sb for Tl(III in the original solution was 2.1 ng mL−1. The proposed method has been applied for the determination of trace amounts of thallium in hair samples and satisfactory results were obtained.
International Nuclear Information System (INIS)
Seiderer, M.
1979-01-01
Changes in 201 Tl myocardial scintiscans upon administration of dipyridamole or dobutamine and upon ergometer exercise relative to scintiscans at rest were investigated as well as the influence of myocardial background subtraction on scintiscan quality and information. A total of 90 201 Tl examinations were carried out in 59 patients. 18 patients had no myocardial disease, 30 patients had a coronary disease, 5 patients suffered from cardiomyopathy and 6 from left ventricular hypertrophy. The findings are discussed in detail. (orig.) [de
Directory of Open Access Journals (Sweden)
V. G. Grossman
2017-12-01
Full Text Available The Tl2MoO4–R2(MoO43–Zr(MoO42 (R = Al, Cr systems were studied in the subsolidus region using X-ray powder diffraction and differential scanning calorimetric (DSC analysis. Quasi-binary joins were revealed, and triangulation was carried out. New ternary molybdates: Tl5RZr(MoO46 (5:1:2 and TlRZr0.5(MoO43 (1:1:1 (R = Al, Cr were prepared. The unit cell parameters for the new compounds were calculated.
Energy Technology Data Exchange (ETDEWEB)
Villa, Marcelo Barros; Costa, Alessandro Martins da, E-mail: amcosta@usp.br [Universidade de Sao Paulo (FFCLRP/USP), Ribeirao Preto, SP (Brazil). Faculdade de Filosofia, Ciencias e Letras. Dept. de Fisica
2014-07-01
In measurements of gamma rays with Nai (Tl) scintillator, the detectors output data are pulse height spectra, that corresponding to distorted information about the radiation source due to various errors associated with the crystal scintillation process and electronics associated, instead of power spectra photons. Pulse height spectra are related to the real power spectra by means of scintillator detector response function NaI (Tl). In this work, the response function for a cylindrical crystal of Nal (Tl) of 7,62 x 7,62 cm (diameter x length) was studied, by Monte Carlo method, using the EGSnrc tool to model the transport of radiation, combined with experimental measurements. An inverse response matrix, even with the energy of the square root, which transforms the pulse height spectrum of photon energy spectrum was obtained. The results of this transformation of pulse height spectrum for photon energy spectrum is presented, showing that the methodology employed in this study is suitable.
Solvent extraction of Tl(I) with 2-mercaptobenzothiazole into chloroform
International Nuclear Information System (INIS)
Itawi, R.K.; Turel, Z.R.
1984-01-01
The extraction of Tl(I) with 2-mercaptobenzothiazole into chloroform was studied. The effect of various parameters on the extraction coefficient value was evaluated. The stoichiometry of the extracted species obtained from the substoichiometric extraction was found to be 1:1. This was further supported by the slope ratio method. Decontamination factors of a number of elements in the substoichiometric extraction of Tl(I) were also obtained. (author)
Enhanced thermoelectric figure of merit in strained Tl-doped Bi2Se3
Saeed, Y.
2014-07-21
We explain recent experimental findings on Tl-doped Bi2Se3 by determining the electronic and transport properties by first-principles calculations and semi-classical Boltzmann theory. Though Tl-doping introduces a momentum-dependent spin-orbit splitting, the effective mass of the carriers is essentially not modified, while the band gap is reduced. Tl is found to be exceptional in this respect as other dopants modify the dispersion, which compromises thermoelectricity. Moreover, we demonstrate that only after Tl-doping strain becomes an efficient tool for enhancing the thermoelectric performance. A high figure of merit of 0.86 is obtained for strong p-doping (7 × 10^20 cm^(−3), maximal power factor) at 500 K under 2% tensile strain.
International Nuclear Information System (INIS)
Hashimoto, T.; Yokosaka, K.; Habuki, H.
1987-01-01
The TL spectrometry of natural quartz exposed to a gamma radiation dose of 8.8 kGy proved that the red TL, mainly from volcanically originated quartz, has a broad emission band with a peak around 620 nm, while the blue TL from plutonically originated quartz also has a broad emission band giving a peak around 470 nm. These typical red or blue intrinsic colours were also confirmed on the thermoluminescence colour images (TLCI). Exceptionally, a pegmatite quartz changed its TLCI colour from red to blue when the absorbed dose was increased. By using colour filter assemblies, all these quartz samples were shown to emit mainly blue and red TLs, which have distinctly different TL responses to the absorbed dose; the blue invariably showed a supralinearity relation between 1 and 10 kGy dose. For the purpose of dating, the use of red TL, is preferable. The red TL component is related to the impurity Eu content in quartz minerals. (author)
Experience with TL-102M for the treatment of radiation stomatitis
International Nuclear Information System (INIS)
Nishio, Juntaro; Matsuya, Tokuzo; Inoue, Kazuo; Miyazaki, Tadashi; Maeda, Noriaki.
1984-01-01
TL-102M was administered to 14 patients who had radiation stomatitis following radiation therapy for malignant tumors in the oral cavity. Regarding the degree of overall improvement, one of the 14 patients was evaluated as ''extremely improved'', eight as ''improved'', four as ''slightly improved'', and one as ''unchanged''. None of the patients had side effects. Adherent, powdered TL-102M was easy to take for patients. Most of the patients desired to continue to take this drug because of having neither painfulness nor adhesive feeling. The usage of TL-102M could be helpful in promoting the treatment for cancer, thus suggesting that it is useful in treating radiation stomatitis. (Namekawa, K.)
Anisotropic superconducting state parameters of Tl-2212 superconductors
International Nuclear Information System (INIS)
Khaskalam, Amit K.; Singh, R.K.; Varshney, Dinesh
2001-01-01
We have estimated the superconducting state parameters and their anisotropy in thallium based superconductors (Tl-2212), in the frame work of Fermi liquid approach. Determination of the effective mass of the charge carriers from the Fermi velocity and estimated anisotropic superconducting state parameters, particularly, the magnetic penetration depth along and perpendicular to the conducting plane. The coherence length along and perpendicular to the ab plane is evaluated and appears to be higher. The temperature dependence of penetration depth, their anisotropy and Ginsburg Landau parameter for optimised doped Tl based cuprates shows the power law. The technique permits a consistency with the reported data. (author)
Observation of curious spiral growth features in Tl doped Hg bearing ...
Indian Academy of Sciences (India)
Synthesis of H(Tl)Ba2Ca2Cu3O8+ superconducting tapes have been accomplished by annealing the precursor tape, Ba2Ca2Cu3O (fabricated by doctor blade tape casting technique) in an environment of H(Tl) vapour. Characterization of superconducting HTSC tape sample was carried out through XRD, TEM, SEM ...
Centers responsible for the TL peaks of willemite mineral estimated by EPR analysis
Energy Technology Data Exchange (ETDEWEB)
Gundu Rao, T.K. [Instituto de Física, Universidade de São Paulo, Rua do Matão, Travessa R, 187, CEP 05508-090, São Paulo, SP (Brazil); Cano, Nilo F., E-mail: nilo.cano@unifesp.br [Departamento de Ciências do Mar, Universidade Federal de São Paulo, Rua Doutor Carvalho de Mendonça, 144, CEP 11070-102, Santos, SP (Brazil); Silva-Carrera, Betzabel N.; Ferreira, Reinaldo M. [Instituto de Física, Universidade de São Paulo, Rua do Matão, Travessa R, 187, CEP 05508-090, São Paulo, SP (Brazil); Javier-Ccallata, Henry S., E-mail: henrysjc@gmail.com [Escuela Profesional de Física, Facultad de Ciencias Naturales y Formales, Universidad Nacional de San Agustín (UNSA), Av. Independencia S/N, Arequipa (Peru); Watanabe, Shigueo, E-mail: watanabe@if.usp.br [Instituto de Física, Universidade de São Paulo, Rua do Matão, Travessa R, 187, CEP 05508-090, São Paulo, SP (Brazil)
2016-09-15
The mineral willemite (Zn{sub 2}SiO{sub 4}) exhibits five thermoluminescence (TL) peaks approximately at 160, 225, 260, 310 and 400 °C. Electron paramagnetic resonance (EPR) studies were carried out to study the defect centers induced in the mineral by gamma irradiation and also to identify the centers responsible for the TL process. Room temperature EPR spectrum of irradiated mineral is a superposition of at least four distinct centers. One of the centers (center I) with an isotropic g factor 2.0114 is attributable to an intrinsic O{sup −} type center and the center correlates with the TL peak at 160 °C. Center II exhibiting hyperfine lines is also tentatively assigned to an O{sup −} ion and is related to the low temperature TL peak at 160 °C. Center III is characterized by an axially symmetric g-tensor with principal values g{sub ||}=2.0451 and g{sub ⊥}=2.011 and is identified as an O{sub 2}{sup −} ion. This center appears to be related to 160, 225 and 260 °C TL peaks. Center IV with principal g-values g{sub ||}=2.0025 and g{sub ⊥}=2.0088 is attributed to an F{sup +}-type center (singly ionized oxygen vacancy) and is the likely recombination center for TL peaks between 160 and 310 °C.
EPR and TL correlation in some powdered Greek white marbles
Energy Technology Data Exchange (ETDEWEB)
Baieetto, Vanessa E-mail: crpaa@montaigne.u-bordeaux.fr; Villeneuve, Gerard; Guibert, Pierre; Schvoerer, Max
2000-02-01
Thermoluminescence of white powdered marble samples, chosen to display different EPR spectra, were studied. Two peaks at 280 deg. C and 360 deg. C can be observed among the TL glow curves while the EPR spectra exhibit two signals: the A signal with g{sub perp}=2.0038 and g{sub par} =2.0024 due to the SO{sup -}{sub 3} centre and the B one with g{sub 1}=2.0005; g{sub 2}=2.0001; g{sub 3}=1.9998 due to mechanical powder reduction (drilling). Owing to heating and simultaneous experiments, a correlation have been established: the 280 deg. C TL peak is associated to the A signal and thus to the SO{sup -}{sub 3} centre and the 360 deg. C TL peak is caused by mechanical treatment corresponding to the B EPR signal.
Pulsed laser deposition of Tl-Ca-Ba-Cu-O films
International Nuclear Information System (INIS)
Ianno, N.J.; Liou, S.H.; Woollam, J.A.; Thompson, D.; Johs, B.
1990-01-01
Pulsed laser deposition is a technique commonly used to deposit high quality thin films of high temperature superconductors. This paper discusses the results obtained when this technique is applied to the deposition of Tl-Ca-Ba-Cu-O thin films using a frequency doubled Nd:YAG laser operating at 532 nm and an excimer laser operating at 248 nm. Films with onset temperatures of 125 K and zero resistance temperatures of 110 K deposited on (100) oriented MgO from a composite Tl2Ca2Ba2Cu3Ox target were obtained at both wavelengths upon appropriate post deposition annealing. Films deposited at 532 nm exhibit a rough surface, while those deposited at 248 nm are smooth and homogeneous. Upon annealing, films deposited at both wavelengths are single phase Tl2Ca2Ba2Cu3Ox. 12 refs
TL sensitivity of CaSO4:Dy phosphor powder - effect of grinding
International Nuclear Information System (INIS)
Shastry, S.S.; Kher, R.K.
1979-01-01
Grinding of polycrystalline CaSO 4 :Dy phosphor to powder form induces lattice defects. Changes in thermoluminescence (TL) sensitivity due to variation in trap density in the bulk and on the surface of phosphor grains are studied using gamma and UV radiations. TL sensitivity to gamma increases with grinding time due to the contribution from the new bulk traps which are generated by grinding. The surface traps degrade with increase in grinding time resulting in a decrease in UV sensitivity. Results on regeneration of the TL sensitivity due to annealing at different temperatures are also included. (Auth.)
Energy Technology Data Exchange (ETDEWEB)
Melendrez, R.; Pedroza M, M.; Chernov, V.; Ochoa N, J.D.; Bernal, R.; Barboza F, M. [CIF, UNISON, A.P. 5-088, 83190 Hermosillo, Sonora (Mexico); Castaneda, B. [Departamento de Fisica, Universidad de Sonora, Apdo. Postal 1626, Hermosillo, Sonora (Mexico); Goncalves, J.A.N.; Sandonato, G.M. [Laboratorio Associado de Plasma, Instituto Nacional de Pesquisas Espaciais C.P. 515- 12201 -970, Sao Jose dos Campos, SP (Brazil); Cruz Z, E. [Instituto de Ciencias Nucleares, UNAM, Apdo. Postal 70-543, 04510 Mexico D.F. (Mexico); Preciado F, S.; Cruz V, C.; Brown, F. [Departamento de Investigacion en Polimeros y Materiales de la Universidad de Sonora, Apdo. Postal 130, 83000 Hermosillo, Sonora (Mexico); Schreck, M. [Universitaet Augsburg, Institut fuer Physik D-86135 Augsburg (Germany)
2004-07-01
The diamond is a material that possesses extreme physical properties, such as its hardness to the radiation, its low chemical reactivity besides its equivalence to the human tissue, which qualify him as an ideal material for radiation dosimetry. In this work, it was studied the thermal and optically stimulated response (Tl and OSL) of polycrystalline diamond films grown by the technique of CVD pure and contaminated with Boron-carbon (B/C) with the intention of characterizing their efficiency like a dosemeter for radiation in a range of 0 - 3000 Gy. For the case of the films without impurities, the Tl curve presents four main peaks, two of them in an interval of temperatures of 150-200 C and other two additional around of 250-400 C. The dependence of the response of integrated Tl and that of OSL always maintained a lineal relationship with the exhibition dose up to 100 Gy. The behavior of the films contaminated with B/C (2000 - 20000 ppm) was established through experiments that involved the signal of OSL and their relationship with the Tl response. It was found that this processes are correlated, since the electrons caught in the traps of low temperature (50 - 250 C) of the Tl they are the electrons that recombining with more probability to provide the signal of OSL. According to these results it is possible to propose the diamond films as a good candidate for dosimetry to, using the traditional technique of Tl so much as well as the but recent of OSL. (Author)
M1 transitions between superdeformed states in 195Tl
International Nuclear Information System (INIS)
Zheng Xing; Xingqu Chen; Xiaochun Wang
1996-01-01
Using a triaxial-particle-rotor model, the quadrupole and dipole transition energies, kinematic and dynamic moments of inertia, electromagnetic transition probabilities and the relative intensity of the E2 γ-transitions are calculated for superdeformed bands in 195 Tl. A strong perturbation effect of rotation on transition energies and M1 and E2 transitions of superdeformed states is investigated. The total M1 transitions, enhanced by internal conversion, are expected to compete strongly with the E2 γ-ray at low spins in the superdeformed 195 Tl nucleus. (author)
Dopant concentration and thermoluminescence (TL) properties of tailor-made Ge-doped SiO2 fibres
International Nuclear Information System (INIS)
Zahaimi, Nurul Arina; Ooi Abdullah, Mohd Haris Ridzuan; Zin, Hafiz; Abdul Rahman, Ahmad Lutfi; Hashim, Suhairul; Saripan, Mohd Iqbal; Paul, Mukul Chandra; Bradley, D.A.; Abdul Rahman, Ahmad Taufek
2014-01-01
Study focuses on characterisation of diverse concentrations of Ge-doped SiO 2 fibre as a potential thermoluminescence (TL) system for radiotherapy dosimetry. Irradiations were made using a linear accelerator providing 6 MV and 10 MV photon beams. Investigation has been done on various doped core diameter Ge-doped SiO 2 glass fibres such as commercial telecommunication fibres of 8 µm and 9 µm (CorActive High Tech, Canada), tailor-made fibres of 23 and 50 µm produced by the Central Glass and Ceramic Research Institute Kolkata, and tailor-made fibres of 11 µm produced by the University of Malaya Photonics Research Centre. The fibres have been characterised for TL sensitivity, reproducibility, dose- and energy-dependence. The area under the TL glow curve increases with increasing core diameter. For repeat irradiations at a fixed dose the dosimeter produces a flat response better than 4% (1SD) of the mean of the TL distribution. Minimal TL signal fading was found, less than 0.5% per day post irradiation. Linearity of TL has been observed with a correlation coefficient (r 2 ) of better than 0.980 (at 95% confidence level). For particular dopant concentrations, the least square fits show the change in TL yield, in counts per second per unit mass, obtained from 50 µm core diameter fibres irradiated at 6 MV of photon to be 8 times greater than that of 8 µm core diameter fibre. With respect to energy response, the TL yield at 10 MV decreases by∼5% compared to that at 6 MV, primarily due to the lower mass energy absorption coefficient at higher photon energy. These early results indicate that selectively screened fibres can be developed into a promising TL system, offering high spatial resolution capability and, with this, verification of complex radiotherapy dose distributions. - Highlights: • We examined the TL glow curve intensity for various diameter sizes of germanium doped silica glass fibre. • TL sensitivity increased with the increase of fibre core
The usefulness of [sup 201]TlCl scintigraphy for the diagnosis of breast tumor
Energy Technology Data Exchange (ETDEWEB)
Takahashi, Tamami; Moriya, Etsuo; Miyamoto, Yukio; Kawakami, Kenji; Kubo, Hirotaka; Uchida, Takeshi [Jikei Univ., Tokyo (Japan). School of Medicine
1994-06-01
The usefulness of [sup 201]TlCl SPECT (Tl SPECT) for the diagnosis of breast cancer was evaluated in 14 patients with various breast tumors (9 with invasive ductal carcinoma, 2 with fibroadenoma and 3 with benign process). These tumors ranged in size from 1.5 cm x 1.5 cm to 15.0 cm x 14.0 cm. Tl SPECT was carried out 2 hours after the intravenous injection of [sup 201]TlCl (185 MBq). For quantitative study, ROIs were set in the tumor (T), normal tissue of the opposite breast (B) and myocardium (M). Count ratios of T/B and T/M were calculated. Eight patients with breast cancer and a case of fibroadenoma showed intense accumulation of [sup 201]TlCl in the tumors. The T/B ratio was 1.20[+-]0.68 and the T/M ratio was 0.68[+-]0.31 in the 9 cases. Lymph node metastasis was detected in 2 of 6 cases that were confirmed at operation. No remarkable accumulation of [sup 201]TlCl was seen in 4 patients with benign process. One patient with benign tumor showed a false positive result. The rates of accuracy of mammography and ultrasonography for the same subjects were 82% and 84%, respectively. The results suggest that [sup 201]TlCl SPECT might be useful to assess breast cancer in cases in which the findings of other modalities are equivocal. (author).
Structure and scintillation properties of CsI(Tl) films on Si single crystal substrates
Energy Technology Data Exchange (ETDEWEB)
Guo, Lina [State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China, Chengdu 610054 (China); Liu, Shuang, E-mail: shuangliu@uestc.edu.cn [State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China, Chengdu 610054 (China); Chen, Dejun; Zhang, Shangjian; Liu, Yong; Zhong, Zhiyong [State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China, Chengdu 610054 (China); Falco, Charles M. [University of Arizona, College of Optical Sciences, AZ 85721 (United States)
2016-10-30
Highlights: • We obtained the desired micro-columnar structure of CsI(Tl) films on the orienting Si substrates. • We improved the micro-columnar structure of CsI(Tl) films under the relatively large deposition rate through using the substrate with a pre-deposited CsI nanolayer. • We modeled the interface structures between the CsI(Tl) films with (200) and (310) orientation and Si(111) substrates to explain the preferred orientation of film under the influence of the orienting substrate significantly. • We gained a new spectrum of the CsI(Tl) films peaked at 740 nm wavelength. - Abstract: CsI(Tl) scintillation films fabricated on glass substrates are widely applied for X-ray imaging because their ability to grow in micro-columnar structure and proper emission wavelength matching CCD cameras. But the coupling process between the CsI(Tl) films and Si-based photo detector would cause coupling loss. In this work, CsI(Tl) films were deposited on the orienting Si substrates and the Si substrates covered by the pre-deposited CsI nanolayers. Structure and scintillation properties of films were examined by using scanning electron microscopy, X-ray diffraction, photoluminescence and radioluminescent spectrum. The films deposited on the orienting Si substrates show the micro-columnar morphology with perfect single crystalline structure and the photoluminescence spectra with bimodal distribution. The performances of the films prepared on the pre-deposited CsI nanolayer, containing micro-columns structure and the light yield are improved.
Structure and scintillation properties of CsI(Tl) films on Si single crystal substrates
International Nuclear Information System (INIS)
Guo, Lina; Liu, Shuang; Chen, Dejun; Zhang, Shangjian; Liu, Yong; Zhong, Zhiyong; Falco, Charles M.
2016-01-01
Highlights: • We obtained the desired micro-columnar structure of CsI(Tl) films on the orienting Si substrates. • We improved the micro-columnar structure of CsI(Tl) films under the relatively large deposition rate through using the substrate with a pre-deposited CsI nanolayer. • We modeled the interface structures between the CsI(Tl) films with (200) and (310) orientation and Si(111) substrates to explain the preferred orientation of film under the influence of the orienting substrate significantly. • We gained a new spectrum of the CsI(Tl) films peaked at 740 nm wavelength. - Abstract: CsI(Tl) scintillation films fabricated on glass substrates are widely applied for X-ray imaging because their ability to grow in micro-columnar structure and proper emission wavelength matching CCD cameras. But the coupling process between the CsI(Tl) films and Si-based photo detector would cause coupling loss. In this work, CsI(Tl) films were deposited on the orienting Si substrates and the Si substrates covered by the pre-deposited CsI nanolayers. Structure and scintillation properties of films were examined by using scanning electron microscopy, X-ray diffraction, photoluminescence and radioluminescent spectrum. The films deposited on the orienting Si substrates show the micro-columnar morphology with perfect single crystalline structure and the photoluminescence spectra with bimodal distribution. The performances of the films prepared on the pre-deposited CsI nanolayer, containing micro-columns structure and the light yield are improved.
Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows
International Nuclear Information System (INIS)
Osborne, P.E.
2002-01-01
The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of 233 U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF 6 and subsequent steam treatments of UO 2 F 2 . For each mole of UF 6 converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance
Miller-Young, Janice E.; Yeo, Michelle; Manarin, Karen
2018-01-01
Faculty members from five years of an annual Scholarship of Teaching and Learning (SoTL) development program were invited to participate in a study about the impact of SoTL on their teaching, scholarship, and career trajectory. During semi-structured interviews, many expressed feeling discomfort during their journey into SoTL. A qualitative…
Factors which define the α/γ ratio in CsI:Tl crystals
International Nuclear Information System (INIS)
Kudin, Alexander M.; Sysoeva, Elena P.; Sysoeva, Elena V.; Trefilova, Larisa N.; Zosim, Dmitry I.
2005-01-01
Dependences of light yield and α/γ ratio on the Tl concentration have been studied within a wide range of shaping times. It is shown that the α/γ ratio essentially depends on the Tl concentration. Proper combination of the Tl concentration and optimum shaping time in electronics allows to obtain detectors with rather high light output for γ-rays, α-particles and α/γ ratio values. It has been shown that both the light yield at α-excitation and the α/γ-ratio depend on the time of crystal storage after polishing. On the basis of the idea of the formation of deformation-induced point defects in a thin surface-adjacent layer, the causes of the temporary increasing in light yield for α-particle are explained. An explanation is given of the results obtained by Gwin and Murray concerning the fact that the α/γ ratio is practically independent on Tl concentration
Correlation between TL and OSL properties of CaF2:N
International Nuclear Information System (INIS)
Polymeris, George S.; Kitis, George; Tsirliganis, Nestor C.
2006-01-01
Natural CaF 2 is very well known thermoluminescent (TL) material, since it has been extensively used as a dosimeter. Its basic advantage is the exhibited high TL sensitivity. In the present work, the optically stimulated luminescence (OSL) sensitivity of this material was studied by exposing it to environmental radiation for time intervals of few hours up to a few days, and was found to be very high. By analyzing the TL glow curves and the OSL decay curves into their individual glow-peaks and components respectively, a relation between specific glow-peaks and OSL components was established. An intense thermal transfer effect occurring during optical stimulation at high temperature was observed and an explanation is offered according to existing models
Enhanced thermoelectric figure of merit in strained Tl-doped Bi2Se3
Saeed, Y.; Singh, Nirpendra; Schwingenschlö gl, Udo
2014-01-01
We explain recent experimental findings on Tl-doped Bi2Se3 by determining the electronic and transport properties by first-principles calculations and semi-classical Boltzmann theory. Though Tl-doping introduces a momentum-dependent spin
Energy Technology Data Exchange (ETDEWEB)
Focke, H.; Brueggmann, R.; Mende, F.; Steinkraus, D.; Wauer, R. [BEB Erdgas und Erdoel GmbH, Hannover (Germany)
1998-12-31
The article describes the concepts of the plants and equipment and the specific features of the underground storage at Uelsen. The underground storage will be purpose-built as an H-gas storage in a nearly depleted sandstone deposit. At a nominal deliverability of 250.000 cubic m/h (Vn) the storage at Uelsen has more potential for expansion. This potential was taken into account by designing appropriate pressure stages, capacities, performance characteristics and space. (orig.). [Deutsch] Die nachfolgende Veroeffentlichung stellt das anlagentechnische Grundkonzept und die spezifischen Besonderheiten des UGS Uelsen dar. Der im suedwestlichen Niedersachsen als H-Gasspeicher in einer nahezu ausgefoerderten Buntsandsteinlagerstaette eingerichtete UGS Uelsen wird in mehreren Ausbaustufen bedarfsgerecht fertiggestellt. Bei einer Nennentnahmekapazitaet von 450.000 m{sup 3}/h (Vn) und einer Nenninjektionsleistung von 250.000 m{sup 3}/h (Vn) weist der UGS Uelsen noch weiteres Potential fuer Erweiterungen auf. Dieses Ausbaupotential wurde bei der Planung und dem Bau der bestehenden Anlagen durch Festlegung entsprechender Druckstufen, Kapazitaeten, Leistungsgroessen und Platzanordnungen beruecksichtigt. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Hosokawa, Shinya; Stellhorn, Jens Ruediger [Department of Physics, Kumamoto University, Kumamoto (Japan); Ikemoto, Hiroyuki [Department of Physics, University of Toyama, Toyama (Japan); Mimura, Kojiro [Department of Mathematical Sciences, Graduate School of Engineering, Osaka Prefecture University, Sakai (Japan); Wakita, Kazuki [Faculty of Engineering, Chiba Institute of Technology, Narashino (Japan); Mamedov, Nazim [Institute of Physics, Azerbaijan National Academy of Sciences, Baku (Azerbaijan)
2018-01-15
Tl L{sub II} and In K X-ray absorption fine structure (XAFS) measurements were performed on a TlInSe{sub 2} thermoelectric material in the temperature range of 25-300 K including the incommensurate-commensurate phase transition temperature of about 135 K. Most of the bond lengths obtained from the present XAFS measurements are in good agreement with existing X-ray diffraction data at room temperature, while only the Tl-Tl correlation shows inconsistent values indicating the commensurate properties of the Tl chains expected from the thermodynamic properties. The present XAFS data clearly support positional fluctuations of the Tl atoms found in three-dimensional atomic images reconstructed from X-ray fluorescence holography. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Impact of precursor purity on optical properties and radiation detection of CsI:Tl scintillators
Energy Technology Data Exchange (ETDEWEB)
Saengkaew, Phannee; Cheewajaroen, Kulthawat; Yenchai, Chadet; Thong-aram, Decho [Chulalongkorn University, Department of Nuclear Engineering, Faculty of Engineering, Bangkok (Thailand); Sanorpim, Sakuntam [Chulalongkorn University, Department of Physics, Faculty of Science, Bangkok (Thailand); Jitpukdee, Manit [Kasetsart University, Department of Applied Radiation and Isotope, Faculty of Science, Bangkok (Thailand); Yordsri, Visittapong; Thanachayanont, Chanchana [Ministry of Science and Technology, National Metal and Materials Technology Center, National Science and Technology Development Agency, Pathumthani (Thailand); Nuntawong, Noppadon [Ministry of Science and Technology, National Electronic and Computer Technology Center, National Science and Technology Development Agency, Pathumthani (Thailand)
2016-08-15
Cesium iodide doped with thallium (CsI:Tl) crystals was grown to develop the gamma-ray detectors by using low-cost raw materials. Effect of impurities on optical properties and radiation detection performance was investigated. By a modified homemade Bridgman-Stockbarger technique, CsI:Tl samples were grown in two levels of CsI and TlI reactant materials, i.e., having as a very high purity of 99.999 % and a high purity of 99.9 %. XRD measurements indicate CsI:Tl crystals having a good quality with a dominant (110) plane. Having a cubic structure, a lattice constant of CsI crystals of 0.4574 nm and a crystallite size of 43.539 nm were obtained. From the lower-purity raw materials, calcite was found in an orange crystal with a lattice constant of 0.4560 nm and a crystallite size of 43.089 nm. By PL measurements, the optical properties of the CsI:Tl crystals were analyzed. ∝540-nm-wavelength PL peak was observed from the colorless high-purity crystal, and ∝600-nm-wavelength PL peak was observed from the orange crystal. The brighter PL emission was obtained from the orange crystals suggesting impurities. CsI:Tl surface morphology by SEM exhibited a smooth surface with some parallel crystal facets. For electrical properties of high-quality CsI:Tl crystals, the electrical resistances were 230 ± 16 MΩ in cross-sectional direction and 714 ± 136 MΩ in vertical direction with respect to more homogeneous crystal quality in cross-sectional direction than that in vertical direction. TEM measurement was applied to evaluate the microstructure of colorless CsI:Tl crystal with different patterns of a cubic structure. Both CsI:Tl crystals show good efficiencies and good resolutions. Maintaining the same electronic conditions and amplifications, the colorless CsI:Tl scintillators represented a higher detection efficiency at 122 keV of Co-57 of 78.4 % and the energy resolution of 23.3 % compared to the detection efficiency of 75.9 % and the energy resolution of 34.6 % of the
Vazquez, Justin; Ali, Halima; Punjabi, Alkesh
2009-11-01
Ciraolo, Vittot and Chandre method of building invariant manifolds inside chaos in Hamiltonian systems [Ali H. and Punjabi A, Plasma Phys. Control. Fusion, 49, 1565--1582 (2007)] is used in the ASDEX UG tokamak. In this method, a second order perturbation is added to the perturbed Hamiltonian [op cit]. It creates an invariant torus inside the chaos, and reduces the plasma transport. The perturbation that is added to the equilibrium Hamiltonian is at least an order of magnitude smaller than the perturbation that causes chaos. This additional term has a finite, limited number of Fourier modes. Resonant magnetic perturbations (m,n) = (3,2)+(4,3) are added to the field line Hamiltonian for the ASDEX UG. An area-preserving map for the field line trajectories in the ASDEX UG is used. The common amplitude δ of these modes that gives complete chaos between the resonant surfaces ψ43 and ψ32 is determined. A magnetic barrier is built at a surface with noble q that is very nearly equals to the q at the physical midpoint between the two resonant surfaces. The maximum amplitude of magnetic perturbation for which this barrier can be sustained is determined. This work is supported by US Department of Energy grants DE-FG02-07ER54937, DE-FG02-01ER54624 and DE-FG02-04ER54793.
Radiation Hardness Study of CsI(Tl) Crystals for Belle II Calorimeter
Matvienko, D V; Sedov, E V; Shwartz, B A
2017-01-01
The Belle II calorimeter (at least, its barrel part) consists of CsI(Tl) scintillation crystals which have been used at the Belle experiment. We perform the radiation hardness study of some typical Belle crystals and conclude their light output reductions are acceptable for Belle II experiment where the absorption dose can reach 10 krad during the detector operation. CsI(Tl) crystals have high stablity and low maintenance cost and are considered as possible option for the calorimeter of the future Super-Charm-Tau factory (SCT) in Novosibirsk. Our study demonstrates sufficiently high radiation hardness of CsI(Tl) crystals for SCT conditions.
Energy Technology Data Exchange (ETDEWEB)
Heinke, Frank; Schlegel, Robert; Schwarzmueller, Stefan; Oeckler, Oliver [Institute for Mineralogy, Crystallography, and Materials Science, Faculty of Chemistry and Mineralogy, Leipzig University (Germany); Eisenburger, Lucien [University of Munich (LMU), Department Chemie (Germany)
2017-03-16
Tl{sub 4.5}Bi{sub 0.5}Te{sub 3} crystallizes in a distorted variant of the Tl{sub 5}Te{sub 3} structure type in the space group I4/m. The symmetry reduction compared to Tl{sub 5}Te{sub 3} (space group I4/mcm) is a consequence of cation ordering as shown by resonant X-ray scattering using synchrotron radiation. Tl and Bi predominantly occupy one Wyckoff site each. This ordering is accompanied by displacements of Te atoms. The influence of nanostructuring on the thermoelectric performance of Tl{sub 4.5}Bi{sub 0.5}Te{sub 3} was investigated for the new composite model system Tl{sub 4.5}Bi{sub 0.5}Te{sub 3} - TlInTe{sub 2}. For the nominal composition (Tl{sub 4.5}Bi{sub 0.5}Te{sub 3}){sub 0.6}(TlInTe{sub 2}){sub 0.4}, the thermoelectric Figure of merit ZT reaches 0.8 at 325 C. Nanoscaled precipitates with sizes of about 100-200 nm probably have beneficial influence on the thermal conductivity at this temperature. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
An overview on STEP-NC compliant controller development
Othman, M. A.; Minhat, M.; Jamaludin, Z.
2017-10-01
The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.
International Nuclear Information System (INIS)
Vural, G.; Atasever, T.; Oezdemir, A.; Oeznur, I.; Karabacak, N.I.; Goekcora, N.; Isik, S.; Uenlue, M.
1997-01-01
Tl-201 scintigraphy were performed in sixty-eight patients with 70 breast abnormalities (51 palpable, 19 nonpalpable) and compared with mammography and ultrasonography (US). Early (15 min) and late (3 h) images of the breasts were obtained following the injection of 111 MBq (3 mCi) of Tl-201. Visual and semiquantitative interpretation was performed. Final diagnosis confirmed 52 malignant breast lesions and 18 benign conditions. Tl-201 visualized 47 of 52 (90%) overall malignant lesions. Thirty-eight of 40 (95%) palpable and 9 of 12 (75%) nonpalpable breast cancers were detected by Tl-201 scintigraphy. The smallest mass lesion detected by Tl-201 measured 1.5x1.0 cm. Eleven breast lesions were interpreted as indeterminate by mammography and/or sonography. Tl-201 scintigraphy excluded malignancy in 7 of 8 (88%) patients with benign breast lesions interpreted as indeterminate. Five of the 18 (28%) benign breast lesions showed Tl-201 uptake. None of the fibroadenoma and fibrocystic changes accumulated Tl-201. Tl-201 scintigraphy, mammography and ultrasonography showed 90%, 92%, 85% overall sensitivity and 72%, 56%, 61% overall specificity respectively. Twenty-one of the 28 (75%) axillary nodal metastatic sites were also detected by Tl-201. In malignant and benign lesions, early and late lesion/contralateral normal side (L/N) ratios were 1.58±0.38 (mean±SD) and 1.48±0.32 (p>0.05), 1.87±0.65 and 1.34±0.20 (p 0.05). (orig./MG) [de
Activation analysis of thallium by /sup 203/Tl(n,2n)/sup 202/Tl reaction in nuclear reactors
Energy Technology Data Exchange (ETDEWEB)
Cohen, I M; Resnizky, S M; Baro, G B [Comision Nacional de Energia Atomica, Buenos Aires (Argentina). Gerencia de Radioisotopos y Radiaciones
1982-01-01
Two techniques are described for neutron activation analysis of thallium in biological and geological materials, based on /sup 203/Tl(n,2n)/sup 202/Tl reaction in nuclear reactors. Co-precipitation with bismuth sulphide is used as a pre-concentration method of thallium in urine samples, and post-irradiation chemical separation is also performed. The detection limit is 0.5 ..mu..g/l, for 100 ml urine samples. For thallium determination in blendes a radiochemical separation is carried out after the irradiation. An extension of this technique is presented for glass and silicate rocks. Results for seven blende samples from different places of Argentina are shown. Analysis of two reference materials, the 614 glass from the National Bureau of Standards and the granodiorite GSP-1 from the U.S. Geological Survey were also performed. The results are in very good agreement with the certified or estimated values.
Disquisition and technical alteration about TL apparatus
International Nuclear Information System (INIS)
Wang Guangxiang; Li Mingliang
2002-01-01
The author simply introduces the disadvantage of TL apparatus controlled by single chip. The project uses the PC computer to replace single chip control. So it must be changed the interface and made up a software with Chinese
Superdeformation in the Hg-Tl-Pb region
International Nuclear Information System (INIS)
Henry, E.A.; Becker, J.A.; Yates, S.W.; Wang, T.F.; Kuhnert, A.; Brinkman, M.J.; Cizewski, J.A.; Deleplanque, M.A.; Diamond, R.M.; Stephens, F.S.; Azaiez, F.; Korten, W.; Draper, J.E.
1990-10-01
Superdeformation in the Hg-Tl-Pb region is discussed, with concentration on the experimental results. At least twenty-five superdeformed bands are known in this region, providing much new data to test theoretical calculations. 22 refs., 5 figs
Evaluation of /sup 201/TlCl and delayed scan for thyroid imaging agent
Energy Technology Data Exchange (ETDEWEB)
Taniguchi, Tatsuyoshi; Harada, Taneichi; Takahashi, Tatsuo; Senoo, Tsuneaki; Ohtsuka, Nobuaki; Ito, Yasuhiko [Kawasaki Medical School, Kurashiki, Okayama (Japan)
1982-11-01
The results of 189 patients with nodular goiter by imaging with /sup 201/TlCl following with sup(99m)TcO/sub 4//sup -/ was presented. Accumulation of /sup 201/TlCl to the corresponding area was observed in 85.5% of cancer, 62.2% of adenoma, 42.5% of adenomatous goiter, and the usefulness of /sup 201/TlCl (early scan) for thyroid imaging agent was recognized. On the other hand, delayed scan for purpose of differentiation from benign to malignant was also performed. However, no significant differences were obtained.
Eijk, A.; Lange, D. de; Maljaars, J.; Tenbrock-Ingenhorst, A.; Gottmer, A.
2014-01-01
Two large identical 6-cylinder Ariel JGB/6 reciprocating compressors each of 7.5 MW, are used for an underground gas storage system (UGS) plant of RWE Gasspeicher GmbH located in Epe, Germany. The system is in operation since 2005. In 2011 several internals parts (baffle plates and baffle choke
Intercomparison of Environmental Dosemeters Using Various TL Materials and Dosimetry Systems
International Nuclear Information System (INIS)
Crnic, B.; Gobec, S.; Zorko, B.; Knezevic, Z.; Majer, M.; Ranogajec-Komor, M.
2013-01-01
The aim of the present work was to compare the ambient dose equivalent (H*(10)) values determined at 20 sites around NPP Krško, using different thermoluminescence (TL) materials and various dosimetry systems. The H*(10) was measured by the CaF 2 :Mn (TLD-400) provided by the Jozef Stefan Institute (JSI) Ljubljana, Slovenia. These dosemeters were deployed in the environment in plastic bags and suspended inside the plastic bottles. On the other hand the Ruder Boskovic Institute (RBI), Zagreb, Croatia applied LiF:Mg,Cu,P (TLD-100H), CaF 2 :Mn, Al 2 O 3 :C TL detectors and radiophotoluminescence (RPL) glass dosemeters type SG1. They were placed at the same locations in as much as possible same conditions as JSI detectors. According to the protocol established for this intercomparison, the control and transport detectors (not deployed in the environment) were held in dark storage containers and used to determine the background radiation. The TL responses were corrected for individual sensitivity of the TL detectors which is an important factor after the calibration irradiations. The calibration irradiations were performed by 137Cs sources provided in Secondary Standard Dosimetry Laboratory facilities at the JSI and RBI. The results obtained by different TL materials and different dosimetry systems show interesting features especially concerning local environmental peculiarities. The H*(10) obtained by the dosemeters of various types deployed in the countryside fluctuate less than 10 %. The outcome should emphasize also in the manner that the results obtained and reported in the intercomparison are traceable to the primary standards.(author)
Program for the evaluation of TL-brick dating: 'ADAM-1-EVA'
International Nuclear Information System (INIS)
Novotna, V.; Kubelik, M.; Musilek, L.
2000-01-01
Although the evaluation of the TL-mean date has presented very little diversity since first published, the error evaluation has prompted a lot of discussion. Particularly the physical, chemical, statistical and mathematical differences as reflected in the specifics of the evaluation of the individual random and systematic errors in ceramic and brick dating are undervalued in literature. The construction of an automated TL-Reader (ADAM-1) at the Czech Technical University in Prague was taken as an opportunity to create a whole new software package for the evaluation ('EVA') of TL-dates. ADAM-1 is designed primarily for brick dating, using the fine-grain technique. The philosophy of data processing is similar to that applied by the Berlin group in their research of Venetian Villas. The program was developed using Delphi, as it is user-friendlier than pure Pascal, offers a strong graphic platform and allows flexibility in data management. This was important, as the program was conceived to either interact directly with ADAM-1, or to be operated independently for data evaluation and management. The software package consists of two discrete yet combinable components: one for the calculation of the TL mean date, using all raw data obtained from ADAM-1 and peripheral measurements; the other for the evaluation of systematic, random and context errors of individual samples and sample groups. All steps in the calculations are also graphically available, e.g. glow curves, plateau test, TL vs. dose dependence and charts summarising the results of all calculations for an individual sample and a given context. (author)
78 FR 72009 - Establishment of Class E Airspace; Star, NC
2013-12-02
...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...
International Nuclear Information System (INIS)
Toyama, Takuji; Nishimura, Tsunehiko; Uehara, Toshiisa
1992-01-01
To determine the utility for detecting ischemic heart disease (IHD), dipyridamole thallium myocardial images (DIP-Tl) have been performed in 103 patients with atherosclerotic vascular disease who can't exercise fully. Of the 103 patients, there were 36 patients with arteriosclerosis obliterans (ASO), 31 patients with aneurysm of the abdominal aorta (AAA), 24 patients with aneurysm of the thoracic aorta (TAA) and 12 patients with dissecting aortic aneurysm (DAA). Clinical evidence of IHD was found in 20 patients with ASO, 10 with AAA, 7 with TAA and 4 with DAA. Positive evidence of DIP-Tl was identified in 66% of 41 patients who had clinical evidence of IHD, and particularly in the patients with AAA (80%) and ASO (65%). On the other hand, in the patients without clinical evidence of IHD, positive evidence of DIP-Tl was identified in 19% of 62 patients and particularly in the patients with AAA (39%). In all patients, the percentage of the positive DIP-Tl ratio was 38%. And, when the 38% patients of the positive DIP-Tl were added to the patients of the negative DIP-Tl who had clinical evidence of IHD, almost half patients (51%) were considered to be complicated with IHD. This study suggests that the atherosclerotic vascular disease is highly complicated with IHD and DIP-Tl is useful to detect IHD. (author)
Lam, Alice D; Maus, Douglas; Zafar, Sahar F; Cole, Andrew J; Cash, Sydney S
2017-09-01
In mesial temporal lobe (mTL) epilepsy, seizure onset can precede the appearance of a scalp EEG ictal pattern by many seconds. The ability to identify this early, occult mTL seizure activity could improve lateralization and localization of mTL seizures on scalp EEG. Using scalp EEG spectral features and machine learning approaches on a dataset of combined scalp EEG and foramen ovale electrode recordings in patients with mTL epilepsy, we developed an algorithm, SCOPE-mTL, to detect and lateralize early, occult mTL seizure activity, prior to the appearance of a scalp EEG ictal pattern. Using SCOPE-mTL, 73% of seizures with occult mTL onset were identified as such, and no seizures that lacked an occult mTL onset were identified as having one. Predicted mTL seizure onset times were highly correlated with actual mTL seizure onset times (r=0.69). 50% of seizures with early mTL onset were lateralizable prior to scalp ictal onset, with 94% accuracy. SCOPE-mTL can identify and lateralize mTL seizures prior to scalp EEG ictal onset, with high sensitivity, specificity, and accuracy. Quantitative analysis of scalp EEG can provide important information about mTL seizures, even in the absence of a visible scalp EEG ictal correlate. Copyright © 2017 International Federation of Clinical Neurophysiology. Published by Elsevier B.V. All rights reserved.
A portable in situ NaI(Tl) γ spectroscopy system
International Nuclear Information System (INIS)
Wang Bairong; Dong Binjiang; Zeng Liping
1999-01-01
The author describes a portable in situ NaI(Tl) γ spectroscopy system, which consists of a NaI(Tl) scintillation detector, an integrative spectroscopy card, a notebook computer and the spectroscopy software. The spectrometer addresses applications in environmental or nuclear accident in situ γ spectroscopy measurements, and gives valid quantitative results of radionuclide concentrations per unit volume (Bq/kg) or per unit area (Bq/cm 2 ) in the soil and absorbed dose rate in air 1 m above ground (Gy/h)
78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC
2013-04-24
... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...
Software module for geometric product modeling and NC tool path generation
International Nuclear Information System (INIS)
Sidorenko, Sofija; Dukovski, Vladimir
2003-01-01
The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)
International Nuclear Information System (INIS)
Sahin, Ali; Senturk, Murat; Ciftci, Mehmet; Varoglu, Erhan; Kufrevioglu, Omer Irfan
2010-01-01
Aim: The inhibitory effects of thallium-201 ( 201 Tl) solution on human erythrocyte glucose 6-phosphate dehydrogenase (G6PD) activity were investigated. Methods: For this purpose, erythrocyte G6PD was initially purified 835-fold at a yield of 41.7% using 2',5'-Adenosine diphosphate sepharose 4B affinity gel chromatography. The purification was monitored by sodium dodecyl sulfate-polyacrylamide gel electrophoresis, which showed a single band for the final enzyme preparation. The in vitro and in vivo effects of the 201 Tl solution including Tl + , Fe +3 and Cu +2 metals and the in vitro effects of the radiation effect of the 201 Tl solution and non-radioactive Tl + , Fe +3 and Cu +2 metals on human erythrocyte G6PD enzyme were studied. Enzyme activity was determined with the Beutler method at 340 nm using a spectrophotometer. All purification procedures were carried out at +4 deg. C. Results: 201 Tl solution and radiation exposure had inhibitory effects on the enzyme activity. IC 50 value of 201 Tl solution was 36.86 μl ([Tl + ]: 0.0036 μM, [Cu +2 ]: 0.0116 μM, [Fe +3 ]: 0.0132 μM), of human erythrocytes G6PD. Seven human patients were also used for in vivo studies of 201 Tl solution. Furthermore, non-radioactive Tl + , Fe +3 and Cu +2 were found not to have influenced the enzyme in vitro. Conclusion: Human erythrocyte G6PD activity was inhibited by exposure for up to 10 minutes to 0.057 mCi/kg 201 Tl solution. It was detected in in vitro and in vivo studies that the human erythrocyte G6PD enzyme is inhibited due to the radiation effect of 201 Tl solution.
Seryotkin, Yu. V.; Bakakin, V. V.; Likhacheva, A. Yu.; Dementiev, S. N.; Rashchenko, S. V.
2017-10-01
The structural evolution of Tl-exchanged natrolite with idealized formula Tl2[Al2Si3O10]·2H2O, compressed in penetrating (water:ethanol 1:1) and non-penetrating (paraffin) media, was studied up to 4 GPa. The presence of Tl+ with non-bonded electron lone pairs, which can be either stereo-chemically active or passive, determines distinctive features of the high-pressure behavior of the Tl-form. The effective volume of assemblages Tl+(O,H2O) n depends on the E-pairs activity: single-sided coordination correlates with smaller volumes. At ambient conditions, there are two types of Tl positions, only one of them having a nearly single-sided coordination as a characteristic of stereo-activity of the Tl+ E pair. Upon the compression in paraffin, a phase transition occurs: a 5% volume contraction of flexible natrolite framework is accompanied by the conversion of all the Tl+ cations into stereo-chemically active state with a single-sided coordination. This effect requires the reconstruction of all the extra-framework subsystems with the inversion of the cation and H2O positions. The compression in water-containing medium leads to the increase of H2O content up to three molecules pfu through the filling of partly vacant positions. This hinders a single-sided coordination of Tl ions and preserves the configuration of their ion-molecular subsystem. It is likely that the extra-framework subsystem is responsible for the super-structure modulation.
Streptomyces venezuelae TX-TL - a next generation cell-free synthetic biology tool.
Moore, Simon J; Lai, Hung-En; Needham, Hannah; Polizzi, Karen M; Freemont, Paul S
2017-04-01
Streptomyces venezuelae is a promising chassis in synthetic biology for fine chemical and secondary metabolite pathway engineering. The potential of S. venezuelae could be further realized by expanding its capability with the introduction of its own in vitro transcription-translation (TX-TL) system. TX-TL is a fast and expanding technology for bottom-up design of complex gene expression tools, biosensors and protein manufacturing. Herein, we introduce a S. venezuelae TX-TL platform by reporting a streamlined protocol for cell-extract preparation, demonstrating high-yield synthesis of a codon-optimized sfGFP reporter and the prototyping of a synthetic tetracycline-inducible promoter in S. venezuelae TX-TL based on the tetO-TetR repressor system. The aim of this system is to provide a host for the homologous production of exotic enzymes from Actinobacteria secondary metabolism in vitro. As an example, the authors demonstrate the soluble synthesis of a selection of enzymes (12-70 kDa) from the Streptomyces rimosus oxytetracycline pathway. © 2017 The Authors. Biotechnology Journal published by WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
TL/OSL properties of natural schist for archaeological dating and retrospective dosimetry
International Nuclear Information System (INIS)
Afouxenidis, D.; Stefanaki, E.C.; Polymeris, G.S.; Sakalis, A.; Tsirliganis, N.C.; Kitis, G.
2007-01-01
Schist, a metamorphic rock composed largely of quartz and muscovite, has been used as a building stone through the centuries in many parts of the world. In ancient Greece, it was used in buildings and monuments (Knossos, Karthaia, etc). Basic TL and OSL properties of schist are studied in the present work to evaluate its potential use in archaeological dating and retrospective dosimetry. In particular, the optical stability, as well as the linearity of the TL and OSL signal were investigated for samples of natural schist obtained from a roofing slate. The results indicate that both signals are rapidly bleached when the sample is exposed to sunlight. An exposure of 1 min reduces the TL signal by 93%, the IRSL signal by 99% and the post-IR BSL signal by 90%. The dose response was found to be linear for a radiation dose at least up to 75 Gy for the TL and the IR OSL signal and at least up to 25 Gy for the post-IR BSL signal
X-ray dosimetry of TlGaSe2 single crystals
International Nuclear Information System (INIS)
Kerimova, E.M.; Mustafaeva, S.N.; Mamedbeili, S.D.; Jabarov, J.N.; Iskenderova, P.M.; Kazimov, S.B.
2002-01-01
TlGaSe 2 compound belongs to group of layered semiconductors of A 3 B 3 C 2 6 -type. Photoelectric and optical properties of TlGaSe 2 single crystals were investigated in detail. Influence of gamma-, electron and neutron radiation on photoelectric properties of TlGaSe 2 single crystals is investigated too. The present work deals with experimental results relative to X-ray dosimetric characteristics of TlGaSe 2 crystals at 300 K. X-ray conductivity and X-ray dosimetric characteristic measurements are carried out in low load resistance regime. The source of X-ray radiation is the installation of X-ray diffraction analysis (URS-55a) with the BCV-2(Cu). Intensity of X-ray radiation (E) is regulated by measurement with current variation in tube at each given value of X-ray radiation dose E (R/min) are measured by crystal dosimeter DRGZ-02. X-ray conductivity coefficients K σ characterising X-ray sensitivity of investigated crystals are determined as the relative change of conductivity under X-ray radiation a per dose. There have been determined values of characteristic coefficients of TlGaSe 2 single crystal X-ray conductivity at different values of accelerating voltage (V a ) on the tube and corresponding doses of X-ray radiation. Analysis of obtained data showed that X-ray conductivity coefficients K σ in studied crystals are regularly decreased (from 0.276 to 0.033) as with the rise of dose (E=0.75-78.0 R/min) as with the increase of values of V a on X-ray tube (V a =254-50 keV). One of the possible reasons of observed regularities is that X-ray conductivity in investigated crystals, especially at comparatively low V a is due predominantly to radiation of thin layer of crystal. In this case with the rise of radiation intensity there have been started to prevail the mechanism of surface quadratic recombination which leads to observed decrease of X-ray conductivity. With the rise of accelerating potential 'effective hardness' is increased, as a result of which there
International Nuclear Information System (INIS)
Lee, Dong Soo; Lee, Won Woo; Yeo, Jeong Yeo; Kim, Seok Ki; Kim, Ki Bong; Chung, June Key; Lee, Myung Chul
1998-01-01
Using rest Tl-201/ dipyridamole stress gated Tc-99m-MIBI/24 hour delay Tl-201 SPECT, we investigated the predictive values of the markers of the stress-rest reversibility (Rev), Tl-201 rest perfusion (Rest), Tl-201 24 hour redistribution (Del) and Tc-99m-MIBI gated systolic thickening (Thk) for wall motion improvement after coronary artery bypass surgery. In 39 patients (M:F=34:5, age 58±8), preoperative and postoperative (3 months) SPECT were compared. 24 hour delayed SPECT was done in 16 patients having perfusion defects at rest. Perfusion or wall motion was scored from 0 to 3 (0: normal to 3: defect or dyskinesia). Wall motion was abnormal in 142 segments among 585 segments of 99 artery territories which were surgically revascularized. After bypass surgery, ejection fraction increased from 37.8±9.0% to 45.5±12.3% in 22 patients who had decreased ejectin fraction preoperatively. Wall motion improved in 103 (72.5%) segments among 142 dysfunctional segments. Positive predictive values (PPV) of Rev, Rest, Del, and Thk were 83%, 76%, 43%, and 69% respectively. Negative predictive values (NPV) of Rev, Rest, Del, and Thk were 48%, 44%, 58%, and 21%, respectively. Rest/gated stress/delay SPECT had PPV of 74% and NPV of 46%. Through univariate logistic regression analysis revealed Rev( p=0.0008) and Rest (p=0.024) as significant predictors, stepwise multivariate test found Rev as the only good predictor (p=0.0008). Among independent predictors obtained by rest Tl-201/stress gated Tc-99m-MIBI/delayed Tl-201 myocardial SPECT for wall motion improvement after bypass surgery, stress-rest reversibility was the single most useful predictor
MOF derived Ni/Co/NC catalysts with enhanced properties for oxygen evolution reaction
Hu, Jiapeng; Chen, Juan; Lin, Hao; Liu, Ruilai; Yang, Xiaobing
2018-03-01
Designing efficient electrocatalysts for oxygen evolution reaction (OER) is very important for renewable energy storage and conversion devices. In this paper, we introduced a new strategy to synthesize Ni doped Co/NC catalysts (NC is the abbreviation of nitrogen-doped graphitic carbon), which were derived from ZIF-67. All catalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscope (TEM) and oxygen evolution reaction (OER). The results show that Ni was well doped in the Ni/Co/NC catalysts and the doping of Ni has great influence on the OER activity of Ni/Co/NC catalysts. Among these catalysts, 0.50Ni/Co/NC exhibits the highest OER activity. The onset potential of 0.50Ni/Co/NC is 1.47 V, which is superior than the onset potential of Co/NC (1.54 V), 0.25Ni/Co/NC (1.48 V), 1.00Ni/Co/NC (1.53 V). The excellent OER activity of 0.50Ni/Co/NC catalyst makes its potential to be used on renewable energy storage.
Quantitative evaluation of right ventricular overload in cor pulmonale using 201Tl myocardial SPECT
International Nuclear Information System (INIS)
Kato, Hiroshi; Misawa, Toshihiro; Kutsumi, Yasunori
1991-01-01
To determine quantitatively the discriminant and characteristics of cor pulmonale, 201 Tl myocardial perfusion SPECT was performed in 16 patients with chronic obstructive pulmonary disease (COPD) and 7 with restrictive pulmonary disease (RPD). One section of the short-axis SPECT image in which the right ventricle was most clearly visualized was selected. Tl-score was defined as the ratio of the sum of counts in the region of interest (ROI) at the anterior, mid, and posterior regions of the right ventricular free wall to the sum of counts in ROI at the posterior, lateral, and anterior walls of the left ventricle, and the anterior and posterior regions of the interventricular septum. In the group of COPD patients, Tl-score was positively correlated with mean pulmonary arterial pressure (mPAP), total pulmonary vascular resistance (TPR), and arterial carbon dioxide tension (PaCO 2 ), while it was inversely correlated with arterial oxygen tension (PaO 2 ). However, there was no significant correlation between Tl-score and mPAP, TPR, PaCO 2 , and PaO 2 in the group of RPD patients. In assessing pulmonary hypertension as defined by mPAP over 20 mmHg, a Tl-score greater than 0.25 was useful with a sensitivity of 69% and a specificity of 90%. The occurrence of cor pulmonale is a major factor in determining the prognosis of COPD patients. It was concluded that 201 Tl myocardial SPECT is useful for evaluating right ventricular overload quantitatively, as well as for assessing core pulmonale, especially in COPD patients, since the ratio of Tl counts in the right and left ventricles was significantly correlated with right cardiopulmonary hemodynamic parameters. (N.K.)
Effects of cross talk on dual energy SPECT imaging between 123I-BMIPP and 201Tl
International Nuclear Information System (INIS)
Morita, Masato; Narita, Hitoshi; Yamamoto, Juro; Fukutake, Naoshige; Ohyanagi, Mitsumasa; Iwasaki, Tadaaki; Fukuchi, Minoru
1994-01-01
The study was undertaken to determine how much cross talk influences the visual assessment of dual energy single photon emission computed tomographic (SPECT) images with iodine 123 beta-methyl-p-iodophenylpentadecanoic acid (I-123 BMIPP) and thallium-201 in 15 patients with acute myocardial infarction. After single SPECT with I-123 BMIPP was undertaken, simultaneous dual SPECT with I-123 BMIPP and Tl-201 were undertaken in all patients. Three patients also underwent single SPECT with Tl-201. I-123 BMIPP and Tl-201 uptake was graded in four-score for the comparison between single and dual SPECT images. There was good correlation between dual energy SPECT and both single I-123 BMIPP SPECT (pS=0.97) and single Tl-201 SPECT (pS=0.59). Uptake scores were increased on dual energy SPECT, compared with single I-123 SPECT (8 out of 132 segments) and single Tl-201 SPECT (12 out of 36 segments). Overall, there was a comparatively well correlation between single SEPCT with either I-123 BMIPP or Tl-201 and dual energy SPECT images. However, one tracer uptake sometimes increased in the other tracer defect areas. This was noticeable when I-123 BMIPP exerted an effect on Tl-201. (N.K.)
Study of multi-quasiparticle band structures in 197Tl using α beam
International Nuclear Information System (INIS)
Mukherjee, G.; Nandi, S.; Pai, H.
2016-01-01
Study of the multi-quasiparticle (qp) states and the band structures built on them in the neutron deficient Tl nuclei in A ∼ 190 mass region provides useful information on particle-hole interaction in the heavy nuclei. In order to investigate the multi-qp band structures we have studied the excited states in 197 Tl by gamma ray spectroscopy
Problems of Gas Pressure Build-up in Casing String of UGS and Gas Wells
Directory of Open Access Journals (Sweden)
Peter Sovius
2006-10-01
Full Text Available This paper consists of three basic parts. The opening part is a brief description of problems associated with the secondary untightness of UGS wells (Underground Gas Storages and gas wells generally.The main part of the paper is composed of some cases that we have met in our company. Solution proposals of various cases are also supplied in this part. Separate problem situations are described in terms of finding out an untight point and also a testing result and consequential removing of untightness.The conclusion includes knowledge summary that were taken by solution of complicatedsituations connected with well non-hermeticity.
Tumor and infection localization in AIDS patients: Ga-67 and Tl-201 findings.
Turoglu, H T; Akisik, M F; Naddaf, S Y; Omar, W S; Kempf, J S; Abdel-Dayem, H M
1998-07-01
Examples of Ga-67 and Tl-201 scans in AIDS patients performed at St. Vincent's Hospital and Medical Center of New York are presented. Use of these methods is the adopted approach at this institution in AIDS patients for localizing sites of tumor or infection involvement. A Ga-67 scan is the most common nuclear medicine examination performed on AIDS patients. Sequential Tl-201 and Ga-67 scans have a role in differentiating Kaposi's sarcoma from malignant lymphoma and opportunistic infections. For intracranial lesions, Tc-99m MIBI or Tl-201-201-201-201 chloride can differentiate malignant from benign inflammatory lesions.
Temperature dependence of positron annihilation parameters in Tl-Ba-Ca-Cu-O superconductors
International Nuclear Information System (INIS)
Sundar, C.S.; Bharathi, A.; Ching, W.Y.; Jean, Y.C.; Hor, P.H.; Meng, R.L.; Huang, Z.J.; Chu, C.W.
1990-01-01
The results of positron lifetime and Doppler broadened line-shape parameter measurements as a function of temperature, across T c , in the Tl-Ba-Ca-Cu-O superconductors are presented. The bulk lifetime in the normal state is found to decrease with the increase in the number of CuO 2 layers. Different temperature dependencies of the annihilation parameters are observed in the various Tl systems containing different numbers of CuO 2 layers. In the Tl 2 Ba 2 Ca 2 Cu 3 O 10 system, an increase in lifetime is observed below T c , whereas in Tl 2 Ba 2 CaCu 2 O 8 , a decrease in lifetime is seen below T c . In the Tl 2 Ba 2 CuO 6 system, the lifetime is observed to be temperature independent. The different temperature variations of positron annihilation parameters are discussed in the light of the positron density distribution, obtained with use of the results of the self-consistent orthogonalized linear combination of atomic orbitals band-structure calculations. It is argued that the different temperature dependencies of the annihilation parameters is related to the positron density distribution within the unit cell and arise due to local charge transfer in the vicinity of the CuO 2 layer in the superconducting state
Directory of Open Access Journals (Sweden)
Jayaveeramuthu Nirmala
2017-10-01
Full Text Available Wheat stem rust, caused by Puccinia graminis f. sp. tritici Eriks. & E. Henn, can incur yield losses in susceptible cultivars of durum wheat, Triticum turgidum ssp. durum (Desf. Husnot. Although several durum cultivars possess the stem rust resistance gene Sr13, additional genes in durum wheat effective against emerging virulent races have not been described. Durum line 8155-B1 confers resistance against the P. graminis f. sp. tritici race TTKST, the variant race of the Ug99 race group with additional virulence to wheat stem rust resistance gene Sr24. However, 8155-B1 does not confer resistance to the first-described race in the Ug99 race group: TTKSK. We mapped a single gene conferring resistance in 8155-B1 against race TTKST, Sr8155B1, to chromosome arm 6AS by utilizing Rusty/8155-B1 and Rusty*2/8155-B1 populations and the 90K Infinium iSelect Custom bead chip supplemented by KASP assays. One marker, KASP_6AS_IWB10558, cosegregated with Sr8155B1 in both populations and correctly predicted Sr8155B1 presence or absence in 11 durum cultivars tested. We confirmed the presence of Sr8155B1 in cultivar Mountrail by mapping in the population Choteau/Mountrail. The marker developed in this study could be used to predict the presence of resistance to race TTKST in uncharacterized durum breeding lines, and also to combine Sr8155B1 with resistance genes effective to Ug99 such as Sr13. The map location of Sr8155B1 cannot rule out the possibility that this gene is an allele at the Sr8 locus. However, race specificity indicates that Sr8155B1 is different from the known alleles Sr8a and Sr8b.
Energy Technology Data Exchange (ETDEWEB)
Khyzhun, O.Y., E-mail: khyzhun@ipms.kiev.ua [Frantsevych Institute for Problems of Materials Science, National Academy of Sciences of Ukraine, 3 Krzhyzhanivsky Street, 03142 Kyiv (Ukraine); Piasecki, M. [Institute of Physics, J.Dlugosz University Częstochowa, Armii Krajowej 13/15, Częstochowa PL-42-217 (Poland); Kityk, I.V. [Electrical Engineering Department, Częstochowa University Technology, Armii Krajowej 17, PL-42-200 Częstochowa (Poland); Luzhnyi, I. [Frantsevych Institute for Problems of Materials Science, National Academy of Sciences of Ukraine, 3 Krzhyzhanivsky Street, 03142 Kyiv (Ukraine); Fedorchuk, A.O. [Department of Inorganic and Organic Chemistry, Lviv National University of Veterinary Medicine and Biotechnologies, 50 Pekarska Street, 79010 Lviv (Ukraine); Fochuk, P.M. [Yuriy Fed’kovych Chernivtsi National University, 2 Kotziubynskoho Street, 58012 Chernivtsi (Ukraine); Levkovets, S.I. [Department of Inorganic and Physical Chemistry, Lesya Ukrainka Eastern European National University, 13 Voli Avenue, 43025 Lutsk (Ukraine); Karpets, M.V. [Frantsevych Institute for Problems of Materials Science, National Academy of Sciences of Ukraine, 3 Krzhyzhanivsky Street, 03142 Kyiv (Ukraine); Parasyuk, O.V. [Department of Inorganic and Physical Chemistry, Lesya Ukrainka Eastern European National University, 13 Voli Avenue, 43025 Lutsk (Ukraine)
2016-10-15
Single crystal of the ternary halide Tl{sub 10}Hg{sub 3}Cl{sub 16} was grown using Bridgman-Stockbarger method. For the Tl{sub 10}Hg{sub 3}Cl{sub 16} crystal, we have measured X-ray photoelectron spectra for both pristine and Ar{sup +} ion-bombarded surfaces and additionally investigated photoinduced piezoelectricity. Our data indicate that the Tl{sub 10}Hg{sub 3}Cl{sub 16} single crystal surface is very sensitive with respect to Ar{sup +} ion-bombardment. In particular, Ar{sup +} ion-bombardment with energy of 3.0 keV over 5 min at an ion current density of 14 μA/cm{sup 2} causes significant changes of the elemental stoichiometry of the Tl{sub 10}Hg{sub 3}Cl{sub 16} surface resulting in an abrupt decrease of the mercury content in the top surface layers of the studied single crystal. As a result of the treatment, the mercury content becomes nil in the top surface layers. In addition, the present XPS measurements allow for concluding about very low hygroscopicity of the Tl{sub 10}Hg{sub 3}Cl{sub 16} single crystal surface. The property is extremely important for the crystal handling in optoelectronic or nano-electronic devices working at ambient conditions. The photoinduced piezoelectricity has been explored for Tl{sub 10}Hg{sub 3}Cl{sub 16} depending on nitrogen (λ=371 nm) laser power density and temperature. - Graphical abstract: As-grown single crystal boule of Tl{sub 10}Hg{sub 3}Cl{sub 16}; dependence of the effective piezoelecric coefficient d{sub 33} versus the photoinducing nitrogen laser power density, I, at different temperatures, T; and packing of the polyhedra of halide atoms around Hg atoms in the Tl{sub 10}Hg{sub 3}Cl{sub 16} structure. - Highlights: • High-quality Tl{sub 10}Hg{sub 3}Cl{sub 16} single crystal has been grown by Bridgman-Stockbarger method. • Electronic structure of Tl{sub 10}Hg{sub 3}Cl{sub 16} is studied by the XPS method. • Tl{sub 10}Hg{sub 3}Cl{sub 16} single crystal surface is sensitive with respect to Ar{sup +} ion
T-L Plane Abstraction-Based Energy-Efficient Real-Time Scheduling for Multi-Core Wireless Sensors
Directory of Open Access Journals (Sweden)
Youngmin Kim
2016-07-01
Full Text Available Energy efficiency is considered as a critical requirement for wireless sensor networks. As more wireless sensor nodes are equipped with multi-cores, there are emerging needs for energy-efficient real-time scheduling algorithms. The T-L plane-based scheme is known to be an optimal global scheduling technique for periodic real-time tasks on multi-cores. Unfortunately, there has been a scarcity of studies on extending T-L plane-based scheduling algorithms to exploit energy-saving techniques. In this paper, we propose a new T-L plane-based algorithm enabling energy-efficient real-time scheduling on multi-core sensor nodes with dynamic power management (DPM. Our approach addresses the overhead of processor mode transitions and reduces fragmentations of the idle time, which are inherent in T-L plane-based algorithms. Our experimental results show the effectiveness of the proposed algorithm compared to other energy-aware scheduling methods on T-L plane abstraction.
Štúdium oneskoreného štiepenia po $\\beta$-rozpade v izotopoch $^{178-182}$Tl
Andel, Boris
Topic of the thesis is $\\beta$-delayed fission. We describe nuclear fission, more specifically $\\beta$-delayed fission and its importance in the theoretical part of the thesis. We look briefly to four models of fission barriers (FRLDM, Thomas-Fermi, LSD and ETFSI model) and to $\\alpha$- and $\\beta$-decay of the nucleus. In the beginning of the experimental part of the thesis we describe ISOLDE facility at CERN and the detection setup of our experiment. In result part of the thesis, we are comparing models of fission barriers and analyzing data from the experiment IS466 –(2), which was undertook at ISOLDE. Four separate measurements were performed with the direct production of isotopes $^{178}$Tl, $^{180}$Tl, $^{182}$Tl and $^{202}$Fr. We evaluated delayed fission probabilities of produced isotopes $P_{βDF}\\,$($^{178}$Tl) = (2,8 ± 1,1)$\\times$10$^{-3}$, $P_{βDF}\\,$($^{180}$Tl) = (3,9 ± 1,1)$\\times$10$^{-5}$, $P_{βDF}\\,$($^{182}$Tl) < 1,4$\\times$10$^{-8}$ and $P_{βDF}\\,$($^{202}$Fr) = (2,1 ± 0,4)...
TL and OSL studies on undoped diamond films grown by hot filament chemical vapor deposition
Energy Technology Data Exchange (ETDEWEB)
Soni, Anuj, E-mail: anujsoni.phy@gmail.com [Radiological Physics and Advisory Division, Bhabha Atomic Research Center, Mumbai 400 085 (India); Choudhary, R.K. [Materials Processing Division, Bhabha Atomic Research Center, Mumbai 400 085 (India); Polymeris, G.S. [Ankara University, Institute of Nuclear Sciences (Turkey); Mishra, D.R. [Radiological Physics and Advisory Division, Bhabha Atomic Research Center, Mumbai 400 085 (India); Mishra, P. [Materials Processing Division, Bhabha Atomic Research Center, Mumbai 400 085 (India); Kulkarni, M.S. [Radiation Safety Systems Division, Bhabha Atomic Research Center, Mumbai 400 085 (India)
2016-09-15
In this work, approximately 0.5 µm thick diamond films were grown on a silicon substrate by hot filament chemical vapour deposition (HFCVD) method in a gas mixture of hydrogen and methane. The batch to batch reproducibility of the sample using this technique was found to be very good. The obtained film was characterized by micro laser Raman spectroscopy (MLRS), grazing incidence X-ray diffractometry (GIXRD), scanning electron microscopy (SEM) and atomic force miscroscopy (AFM) techniques. MLRS and GIXRD results confirmed the formation of diamond whereas SEM and AFM analyses indicated uniform morphology of the film with an average grain size of 200 nm. The deposited film was studied for ionizing radiation dosimetry applications using the thermoluminescence (TL) and optically stimulated luminescence (OSL) techniques after irradiating the film by a calibrated 5 mCi, {sup 90}Sr/{sup 90}Y beta source. In the TL measurement, for a heating rate of 4 K/s, broad glow curve was obtained which was deconvoluted into seven TL peaks. The integrated TL counts were found to vary linearly with increasing the radiation dose up to 10 kGy. The characteristic TL output seen in the temperature range 200–300 °C, may be considered good for thermal stability of the film and it could also avoid TL fading during storage and non-interference of any black body radiation during the measurement. However, in comparison to TL output, the OSL response for 470 nm LED stimulation was found to be lesser. The CW–OSL decay curve has shown two components contributing to the OSL signal, having photoionization cross-section 1.5×10{sup −18} and 5.2×10{sup −19} cm{sup 2} respectively. The studies have revealed the possibility of using diamond film for high dose radiation dosimetry with TL/OSL method.
201Tl scintigraphic evaluation of tumor mass and viability of bone and soft-tissue tumors
International Nuclear Information System (INIS)
Tsuda, Takatoshi; Kubota, Masahiro; Yoshida, Satoru; Shibata, Masahito; Wakabayashi, Jun-ichi; Obata, Hiroyuki; Matsuyama, Toshikatsu; Usui, Masamichi; Ishii, Sei-ichi.
1994-01-01
To characterize 201 Tl uptake in patients with bone and soft-tissue tumor, we studied 49 patients with surgically proven tumors and one patient with a tumor diagnosed arteriographically. In 37 of our 50 patients, the tumor was evaluated with 201 Tl and arteriography. Moreover, in 14 of patients with pre-operative chemotherapy, pathologic changes were graded on the basis of percent tumor necrosis as defined histologically. The percent tumor necrosis histologically was compared with changes in the scintigraphic and conventional angiographic studies. Radiologic comparisons demonstrated a high degree of correlation with images of 201 Tl and both arterial and blood pool phase of 99m Tc-HMDP. Ninety-six percent of 28 malignant tumors had positive 201 Tl uptake. None of the patients showed any thallium accumulation in the soft tissues or skeleton adjacent to the lesion. Activity of 201 Tl was mainly dependent upon a tumor blood flow and a vascular density. In of 14 cases with the preoperative chemotherapeutic treatment, 201 Tl scintigraphic changes showed concordance with % tumor necrosis. Thallium-201 was superior to 99m Tc-HMDP in predicting tumor response to chemotherapy. Interestingly, delayed images of 99m Tc-HMDP of 5 responders with >90% tumor necrosis showed decreased uptake in the adjacent bone to the tumor mass lesions. It seems to be quite all right to consider that a major determinant of 201 Tl uptake is intratumoral angiogenecity, which is closely connected with tumor viability. Therefore, 201 Tl is a sensitive radiopharmaceutical for detection of vascular rich bone and soft-tissue tumors, and appears to be a simple and an accurate test for evaluating the response to specific therapeutic regimens of malignant bone and soft-tissue tumors. (author)
International Nuclear Information System (INIS)
Tsuji, Akinori; Kojima, Akihiro; Oyama, Yoichi; Tomiguchi, Seiji; Kira, Tomohiro; Takagi, Yoshikazu; Shimomura, Osamu; Takahashi, Mutsumasa; Matsumoto, Masanori
1999-01-01
We have developed a new method of crosstalk correction in simultaneous dual-isotope imaging with Tl-201 and I-123 by using crosstalk ratios and a blurring filter. Single isotope myocardial studies (10 for Tl-201 and 7 for I-123) were performed with a dual energy window acquisition mode and two low energy general-purpose collimators. Then two planar images acquired with dual energy windows for a Tl-201 line source and an I-123 line source were obtained to measure line spread functions (LSFs) and crosstalk ratios for each image. The line source experiments showed that the LSFs for the Tl-201 imaging window from the single Tl-201 source were very similar to those for the I-123 imaging window from the single Tl-201 source, but the LSFs for the Tl-201 imaging window from the single I-123 source had broad shapes which differed from those for the I-123 imaging window from the single I-123. To obtain accurate I-123 crosstalk images in the Tl-201 imaging window from the I-123 images in the I-123 imaging window, we designed a low-pass blurring filter. In 7 clinical I-123 MIBG studies, I-123 window images processed with this filter became very similar to the Tl-201 window image from the single I-123 source. The method proposed in this study can accurately correct the crosstalk in dual isotope studies with Tl-201 and I-123 and is easily applicable to conventional gamma camera systems with any dual energy window acquisition mode. (author)
Rehkämper, Mark; Halliday, Alex N.
1999-07-01
The precision of Tl isotopic measurements by thermal ionization mass spectrometry (TIMS) is severely limited by the fact that Tl possesses only two naturally occurring isotopes, such that there is no invariant isotope ratio that can be used to correct for instrumental mass discrimination. In this paper we describe new chemical and mass spectrometric techniques for the determination of Tl isotopic compositions at a level of precision hitherto unattained. Thallium is first separated from the geological matrix using a two-stage anion-exchange procedure. Thallium isotopic compositions are then determined by multiple-collector inductively coupled plasma-mass spectrometry with correction for mass discrimination using the known isotopic composition of Pb that is admixed to the sample solutions. With these procedures we achieve a precision of 0.01-0.02% for Tl isotope ratio measurements in geological samples and this is a factor of ≥3-4 better than the best published results by TIMS. However, without adequate precautions, experimental artifacts can be generated that result in apparent Tl isotopic fractionations of up to one per mil. Analysis of five terrestrial samples indicate the existence of Tl isotopic variations related to natural fractionation processes on the Earth. Two of the three igneous rocks analyzed in this study display Tl isotopic compositions indistinguishable from our laboratory standard, the reference material NIST-997 Tl. A third sample, however, is characterized by ɛ Tl ≈ 2.5 ± 1.5, where ɛ Tl represents the deviation of the 205Tl/ 203Tl ratio of the sample relative to NIST-997 Tl in parts per 10 4. Even larger deviations were identified for two ferromanganese crusts from the Pacific Ocean, which display ɛ Tl-values of +5.0 ± 1.5 and +11.7 ± 1.3. We suggest that the large variability of Tl isotopic compositions in the latter samples are caused by low-temperature processes related to the formation of the Fe-Mn crusts by precipitation and
TL and LOE dosimetric evaluation of diamond films exposed to beta and ultraviolet radiation
International Nuclear Information System (INIS)
Preciado F, S.; Melendrez, R.; Chernov, V.; Barboza F, M.; Schreck, M.; Cruz Z, E.
2005-01-01
The diamond possesses a privileged position regarding other materials of great technological importance. Their applications go from the optics, microelectronics, metals industry, medicine and of course as dosemeter, in the registration and detection of ionizing and non ionizing radiation. In this work the results of TL/LOE obtained in two samples of diamond of 10 μm thickness grown by the chemical vapor deposition method (CVD) assisted by microwave plasma. The films were deposited in a silicon substrate (001) starting from a mixture of gases composed of CH 4 /H 2 and 750 ppm of molecular nitrogen as dopant. The samples were exposed to beta radiation (Sr 90 / Y 90 ) and ultraviolet, being stimulated later on thermal (TL) and optically (LOE) to evaluate their dosimetric properties. The sample without doping presented high response TL/LOE to the ultraviolet and beta radiation. The TL glow curve of the sample without doping showed two TL peaks with second order kinetics in the range of 520 to 550 K, besides a peak with first order kinetics of more intensity around 607 K. The TL efficiency of the non doped sample is bigger than the doped with nitrogen; however the LOE efficiency is similar in both samples. The results indicate that the CVD diamond possesses excellent perspectives for dosimetric applications, with special importance in radiotherapy due to it is biologically compatible with the human tissue. (Author)
Exploration of GaInTlP and related Tl-containing III-V alloys for photovoltaics
International Nuclear Information System (INIS)
Friedman, D. J.; Kurtz, Sarah R.; Kibbler, A. E.
1999-01-01
This paper discusses the results of an attempt to grow GaInTlP for application as a 1-eV material for the third junction of a GaInP/GaAs/3rd-junction high-efficiency solar cell. Although early indications from the literature were promising, we are unable to produce crystalline homogeneous material, and so we conclude that this material is not a promising candidate for such applications as photovoltaics
International Nuclear Information System (INIS)
Fridrich, L.
1989-01-01
Dipyridamole stress is favorable in patients unable to exercise maximally for 201 Tl myocardial scintigraphy. Aside from an analysis of uptake defects, proper washout analysis can be limited by heart rate variations when isolated dipyridamole stress is used. Heart rate standardized 201 Tl washout kinetics after a combined dipyridamole and submaximal exercise stress protocol (CDSE), feasible in elderly patients as well as in patients with peripheral artery disease, were therefore studied to investigate the 201 Tl washout after CDSE in differently defined patient groups: Group I comprised 19 patients with documented heart disease and angiographically excluded coronary artery disease (CAD); group II contained 17 patients with a very low likelihood of CAD determined by both normal exercise radionuclide ventriculography and normal 201 Tl uptake. Group III comprised 56 patients with a 50% pretest likelihood of CAD but normal 201 Tl uptake. Mean washout values were nearly identical in all groups. Despite similar uptake patterns, however, washout standardized by CDSE was significantly lower than the normal washout values after maximal treadmill exercise. Thus an obviously lower 201 Tl washout after CDSE than after maximal treadmill exercise must be considered if washout analysis criteria after dipyridamole are applied to evaluate ischemic heart disease. Nevertheless, heart rate elevation achieved by additional submaximal exercise stress seems necessary, adequate and clinically safe for standardisation of washout analysis in dipyridamole 201 Tl scintigraphy. (orig.)
International Nuclear Information System (INIS)
Mori, Takao; Yamabe, Hiroshi; Suda, Kenichirou; Ohnishi, Masataka; Shiotani, Hideyuki; Kurimoto, Yasuyuki; Kobayashi, Katsuya; Maeda, Kazumi; Fukuzaki, Hisashi
1987-01-01
To clarify the significance of Tl-201 redistribution on infarcted regions, coronary sinus and great cardiac vein flow response and lactate metabolism assessed by Webster catheter on 14 infarcted regions after dipyridamole administration were compared with Tl-201 redistribution phenomenon. The regional coronary flow response and lactate extraction ratio in 11 regions with Tl-201 redistribution were lower than those in 3 regions without Tl-201 redistribution. Only 5 regions in 11 with Tl-201 redistribution showed lactate production. The coronary flow response in 5 regions with lactate production was not different from those in 6 without lactate production (1.16 ± 0.89 vs. 1.47 ± 0.67; n.s.). The degree of Tl-201 redistribution assessed by relative activity was not different between regions with and without lactate production. The left ventricular end-diastolic pressure elevated in 5 regions with lactate production (17.8 ± 5.4 mmHg to 29.6 ± 4.9 mmHg; p < 0.05), but didn't in 6 regions without lactate production. Five regions with lactate production contained 4 hypokinetic regions, on the other hand 6 regions without lactate production contained only 3 hypokinetic regions. In conclusion, Tl-201 redistribution on infarcted region revealed not only ischemia but also decreased coronary flow response without lactate production and/or left ventricular dysfunction. (author)
Development of STEP-NC Adaptor for Advanced Web Manufacturing System
Ajay Konapala, Mr.; Koona, Ramji, Dr.
2017-08-01
Information systems play a key role in the modern era of Information Technology. Rapid developments in IT & global competition calls for many changes in basic CAD/CAM/CAPP/CNC manufacturing chain of operations. ‘STEP-NC’ an enhancement to STEP for operating CNC machines, creating new opportunities for collaborative, concurrent, adaptive works across the manufacturing chain of operations. Schemas and data models defined by ISO14649 in liaison with ISO10303 standards made STEP-NC file rich with feature based, rather than mere point to point information of G/M Code format. But one needs to have a suitable information system to understand and modify these files. Various STEP-NC information systems are reviewed to understand the suitability of STEP-NC for web manufacturing. Present work also deals with the development of an adaptor which imports STEP-NC file, organizes its information, allowing modifications to entity values and finally generates a new STEP-NC file to export. The system is designed and developed to work on web to avail additional benefits through the web and also to be part of a proposed ‘Web based STEP-NC manufacturing platform’ which is under development and explained as future scope.
TL and OSL studies of carbon doped magnesium aluminate (MgAl2O4:C)
Raj, Sanu S.; Mishra, D. R.; Soni, Anuj; Grover, V.; Polymeris, G. S.; Muthe, K. P.; Jha, S. K.; Tyagi, A. K.
2016-10-01
The MgAl2O4:C has been synthesized by using two different methods by electron gun and vacuum assisted melting of MgAl2O4 in presence of graphite. The MgAl2O4:C phosphor thus developed by these two different methods have similar types of the TL/OSL defects with multiple overlapping TL glow peaks from 100 °C to 400 °C. The Computerized Curve De-convolution Analysis (CCDA) has been used to measure TL parameters such as thermal trap depth, frequency factor and order of kinetic associated with charge transfer process in TL phenomenon. The investigated TL/OSL results show that these two methods of incorporating carbon in MgAl2O4 have generated closely resemble the defects of similar types in MgAl2O4:C lattice. However, the MgAl2O4:C synthesized by electron gun shows relatively larger concentration of the TL/OSL defects as compared to MgAl2O4:C synthesized using vacuum assisted melting method. The photo-ionization cross-section (PIC) associated with fastest OSL component of MgAl2O4: C is found to be ∼ 0.5 times than that of fastest OSL component of commercially available dosimetric grade α-Al2O3:C. The MgAl2O4:C thus developed shows good dynamic OSL dose linearity from few mGy to 1 Gy. This work reveals that MgAl2O4:C could be developed as potential tissue equivalent OSL / TL material.
Experimental study on the CsI (Tl) crystal anti-compton detector in CDEX
International Nuclear Information System (INIS)
Liu Shukui; Yue Qian; Tang Changjian
2012-01-01
CDEX (China Dark matter Experiment) Collaboration will carry out direct search for dark matter with Ultra-Low Energy Threshold High Purity germanium (ULE-HPGe) detector at CJPL (China Jinping deep underground Laboratory). Before underground research, some experiments of the CsI (Tl) crystal Anti-Compton detector have been done on the ground, including light guide choice, wrapping material choice, height uniformity of CsI (Tl) crystal, side uniformity of CsI (Tl) crystal and the test results of all the crystals. Through the preliminary work on the ground, we have got some knowledge of the anti-compton detector and prepared for the underground experiment. (authors)
Magnetic measurements on Tl-2212 and Bi-2212 single crystals: a comparative study
International Nuclear Information System (INIS)
Oussena, M.; Porter, S.; Volkozub, A.; De Groot, P.A.J.; Lanchester, P.C.; Ogborne, D.; Weller, M.T.; Balakrishnan, G.; Paul, D.McK.
1994-01-01
We have compared the magnetic behaviour of two identically shaped single crystals, Tl 2 Ba 2 CaCu 2 O 8 and Bi 2 Sr 2 CaCu 2 O 8 . The critical current density is found to decrease more rapidly with temperature in Bi-2212 although it is the highest in this material at low temperatures (T < 10K). I-V characteristic curves have been obtained from measurements of magnetic sweep rate dependencies of the hysteresis loops. We have found that the characteristic temperature at which flux motion becomes important is significantly higher in Tl-2212 than in Bi-2212. Hence the Tl-2212 has a larger effective pinning. (orig.)
Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows
Energy Technology Data Exchange (ETDEWEB)
Osborne, P.E.
2002-09-11
The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of {sup 233}U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF{sub 6} and subsequent steam treatments of UO{sub 2}F{sub 2}. For each mole of UF{sub 6} converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance.
Energy Technology Data Exchange (ETDEWEB)
Kishimoto, Katsushi [Graduate School of Materials Science, Nara Institute of Science and Technology, Nara, 630-0192 (Japan); Nose, Yoshitaro [Department of Materials Science and Engineering, Kyoto University, Kyoto, 606-8501 (Japan); Ishikawa, Yasuaki, E-mail: yishikawa@ms.naist.jp [Graduate School of Materials Science, Nara Institute of Science and Technology, Nara, 630-0192 (Japan); Fujii, Mami N.; Uraoka, Yukiharu [Graduate School of Materials Science, Nara Institute of Science and Technology, Nara, 630-0192 (Japan)
2016-07-05
Thermal reaction between thallium oxide (Tl{sub 2}O{sub 3}) and zinc oxide (ZnO), tin oxide (SnO{sub 2}) or indium oxide (In{sub 2}O{sub 3}) annealed at 600 °C for 18 h in the air atmosphere was investigated. From XRD results of 600 °C annealed samples, Tl{sub 2}O{sub 3} had the biggest reactivity compared with ZnO. The EDX results suggest the mechanism in which the thallium atoms scattered and attached uniformly only on ZnO particles. We also analyzed XPS data to compare O 1s bond and Tl 4f bond of as-mixed samples with that of annealed samples, and found that Zn and Sn can contribute in improving Tl and O bonding stability. However, the affinity of In for Tl is weaker than that of Zn or Sn. Finally, we prepared the samples mixed with ZnO, SnO{sub 2}, and Tl{sub 2}O{sub 3} powder and the samples mixed with Zn{sub 2}SnO{sub 4} and Tl{sub 2}O{sub 3} powder annealed at 600 °C for 18 h. Results show that Zn{sub 2}SnO{sub 4} has the same or more reactivity than SnO{sub 2} and ZnO mixed particle despite of the more stable and sufficient dispersion of Zn and Sn atoms. More stable TlSnZnO can be fabricated from Zn{sub 2}SnO{sub 4} + Tl{sub 2}O{sub 3} powder by suitable thermal processes. It is expected that TlSnZnO sputtering target can be fabricated by suitable calcination. - Highlights: • Thermal reaction of Tl{sub 2}O{sub 3} and ZnO, SnO or In{sub 2}O{sub 3} were investigate. • It is found that Tl{sub 2}O{sub 3} is reactive with ZnO rather than SnO or In{sub 2}O{sub 3}. • Two-step annealing process is promising route for forming TlSnZnO tablet.
Discordant Tl-201 and Tc-99m imaging in a patient with thyroid carcinoma and Hashimoto's disease
International Nuclear Information System (INIS)
Morita, S.; Ishibashi, M.; Hirayama, T.; Kumabe, T.; Ohtake, H.
1990-01-01
In a case of Hashimoto's disease complicated by thyroid gland cancer, the primary site of the cancer was visualized as a cold nodule on Tc-99m pertechnetate scintigraphy, as a warm nodule on Tl-201 early imaging, and as a hot nodule on Tl-201 delayed imaging. Generally, Tl-201 shows markedly diffuse accumulation in the lesions of Hashimoto's disease. The warm nodules observed on early scans suggested similar accumulation at the sites of Hashimoto's disease and thyroid cancer. The hot nodules on delayed imaging may be due to the difference in Tl-201 washout time between the sites of Hashimoto's disease and thyroid cancer. There was markedly increased Tl-201 accumulation in bilateral cervical metastatic lymph nodes on both early and delayed images
Inherent and antigen-induced airway hyperreactivity in NC mice
Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa
1999-01-01
In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...
Core breaking and octupole low-spin states in $^{207}$ Tl
We propose to study the low-spin level structure of the $^{207}$Tl nucleus populated by the $\\beta$- decay of $^{207}$Hg. While $^{207}$Tl is a single-proton hole nucleus, the majority of the observed states will have a three-particle structure thus requiring the breaking of the neutron or proton core, or a collective octupole phonon coupled to the single proton hole. Thus information will be obtained on the single particle orbitals in the vicinity of the N=126 and Z=82 magic numbers, and on the size of the shell gap. The results will be used to improve the predictive power of the shell model for more exotic nuclei as we move to lighter N=126 nuclei.The experiment will use the ISOLDE Decay station, and will take advantage of the $^{207}$Hg beam from the molten lead target. A test on the feasibility to produce an $^{208}$Hg beam from the same target, with the aim to study the $\\beta$-decay into $^{208}$Tl, could be performed at the same time.
On pseudorandom generators in NC0
DEFF Research Database (Denmark)
Cryan, Mary; Miltersen, Peter Bro
2001-01-01
In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...
78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC
2013-09-04
...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...
Energy Technology Data Exchange (ETDEWEB)
Vural, G.; Atasever, T.; Oezdemir, A.; Oeznur, I.; Karabacak, N.I.; Goekcora, N.; Isik, S. [Gazi Univ., Dept. of Nuclear Medicine, Ankara (Turkey)]|[Gazi Univ., Dept. of Radiology, Ankara (Turkey); Uenlue, M. [Gazi Univ., Dept. of Nuclear Medicine, Ankara (Turkey)
1997-12-01
Tl-201 scintigraphy were performed in sixty-eight patients with 70 breast abnormalities (51 palpable, 19 nonpalpable) and compared with mammography and ultrasonography (US). Early (15 min) and late (3 h) images of the breasts were obtained following the injection of 111 MBq (3 mCi) of Tl-201. Visual and semiquantitative interpretation was performed. Final diagnosis confirmed 52 malignant breast lesions and 18 benign conditions. Tl-201 visualized 47 of 52 (90%) overall malignant lesions. Thirty-eight of 40 (95%) palpable and 9 of 12 (75%) nonpalpable breast cancers were detected by Tl-201 scintigraphy. The smallest mass lesion detected by Tl-201 measured 1.5x1.0 cm. Eleven breast lesions were interpreted as indeterminate by mammography and/or sonography. Tl-201 scintigraphy excluded malignancy in 7 of 8 (88%) patients with benign breast lesions interpreted as indeterminate. Five of the 18 (28%) benign breast lesions showed Tl-201 uptake. None of the fibroadenoma and fibrocystic changes accumulated Tl-201. Tl-201 scintigraphy, mammography and ultrasonography showed 90%, 92%, 85% overall sensitivity and 72%, 56%, 61% overall specificity respectively. Twenty-one of the 28 (75%) axillary nodal metastatic sites were also detected by Tl-201. In malignant and benign lesions, early and late lesion/contralateral normal side (L/N) ratios were 1.58{+-}0.38 (mean{+-}SD) and 1.48{+-}0.32 (p>0.05), 1.87{+-}0.65 and 1.34{+-}0.20 (p<0.5) respectively. The mean early and late L/N ratios of malignant and benign groups did not show statistical difference (p>0.05). (orig./MG) [Deutsch] 68 Patientinnen mit insgesamt 70 Laesionen (davon 51 palpable Tumoren) wurden untersucht: 15 Min. und 3 Std. nach Injektion von 111 MBq (3 mCi) {sup 201}Tl-Cl wurden planare Aufnahmen von ventral, lateral und schraeg-lateral durchgefuehrt. Die Auswertung erfolgte sowohl visuel-qualitativ als auch semiquantitativ. Von 52 Karzinomen wurden durch die {sup 201}Tl-Szintigraphie 47 (90%) richtig erkannt
Improvements in the Tl dosimetry for Radiotherapy
International Nuclear Information System (INIS)
Bustos, S.; Velez, G.; Rubio, M.
1998-01-01
The thermoluminescent dosimetry (TLD) in vivo has been demonstrated to be one of the most reliable for the control of radiotherapeutic treatments, but the delay in the response is the main disadvantage in its applicability. In this work are presented important improvements and it is demonstrated that maintaining the accuracy and reliability of the technique, it is possible to accelerate the response times at a few hours. To realize this work is utilized a lecturer Harshaw 4000, dosemeters LiF-TLD-100 chips (3.1 x 3.1 x 0.89 mm 3 ) and rods (1 x 1 x 6 mm 3 ). With the implementation of a glow curve analysis program developed in CIEMAT, its obtained a Tl peaks separation in such manner rapid and accurate, by that the thermal treatment of dosemeters may be reduced at one unique annealing pre-irradiation for 1 hr at 400 Centigrade. It is realized a periodical and individual calibration of the TLD and a study of the factors which influencing the ratio Tl signal-dose as linearity, correction by energy, directional response and pride of Tl signal. the results of this study are introducing in a calculation list specially designed and which allows to obtain absorbed dose by TLD starting of the dates (dosimetric peaks area) which appear of the glow curves analysis. The dose is obtained with an accuracy less than 5 %. The dosemeters already irradiated (in vivo) are analysed and informed in only four hours, allowing a greater control of the treatment and a correction of the possible errors for the next session, still in bi fractional treatments. The method implemented results thus accurate, rapid and reliable. (Author)
Trace element geochemistry and thermoluminescence (TL) of quartz ...
African Journals Online (AJOL)
*
3Department of Materials Science and Engineering, Tsinghua University, Beijing 100084, China. ... exposure in the recent twenty years, the TL characteristics of the fish otolith have not yet been ..... New discoveries in the study of carp otoliths.
Development of low-background CsI(Tl) crystals for WIMP search
International Nuclear Information System (INIS)
Lee, H.S.; Bhang, H.; Hahn, I.S.; Hwang, M.J.; Kim, H.J.; Kim, S.C.; Kim, S.K.; Kim, S.Y.; Kim, T.Y.; Kim, Y.D.; Kwak, J.W.; Kwon, Y.J.; Lee, J.; Lee, J.I.; Lee, M.J.; Li, J.; Myung, S.S.; Park, H.; Zhu, J.J.
2007-01-01
Search for weakly interacting massive particles (WIMPs) is being carried out at the underground laboratory, Yangyang, Korea. Characteristics and internal background of CsI(Tl) crystal have been investigated. In our extensive R and D, we reduced internal background in the CsI(Tl) crystal. With the latest, we have achieved 5.50+/-0.10cpd (counts/keV/kg/day) at 10-15keV low-energy region. Further reduction of internal background is foreseen with the CsI powder lately produced
Tl and OSL dosimetry of diamond films CVD pure and unpurified with boron-carbon
International Nuclear Information System (INIS)
Melendrez, R.; Pedroza M, M.; Chernov, V.; Ochoa N, J.D.; Bernal, R.; Barboza F, M.; Castaneda, B.; Goncalves, J.A.N.; Sandonato, G.M.; Cruz Z, E.; Preciado F, S.; Cruz V, C.; Brown, F.; Schreck, M.
2004-01-01
The diamond is a material that possesses extreme physical properties, such as its hardness to the radiation, its low chemical reactivity besides its equivalence to the human tissue, which qualify him as an ideal material for radiation dosimetry. In this work, it was studied the thermal and optically stimulated response (Tl and OSL) of polycrystalline diamond films grown by the technique of CVD pure and contaminated with Boron-carbon (B/C) with the intention of characterizing their efficiency like a dosemeter for radiation in a range of 0 - 3000 Gy. For the case of the films without impurities, the Tl curve presents four main peaks, two of them in an interval of temperatures of 150-200 C and other two additional around of 250-400 C. The dependence of the response of integrated Tl and that of OSL always maintained a lineal relationship with the exhibition dose up to 100 Gy. The behavior of the films contaminated with B/C (2000 - 20000 ppm) was established through experiments that involved the signal of OSL and their relationship with the Tl response. It was found that this processes are correlated, since the electrons caught in the traps of low temperature (50 - 250 C) of the Tl they are the electrons that recombining with more probability to provide the signal of OSL. According to these results it is possible to propose the diamond films as a good candidate for dosimetry to, using the traditional technique of Tl so much as well as the but recent of OSL. (Author)
Dipole response of the odd-proton nucleus 205Tl up to the neutron-separation energy
Benouaret, N.; Beller, J.; Pai, H.; Pietralla, N.; Ponomarev, V. Yu; Romig, C.; Schnorrenberger, L.; Zweidinger, M.; Scheck, M.; Isaak, J.; Savran, D.; Sonnabend, K.; Raut, R.; Rusev, G.; Tonchev, A. P.; Tornow, W.; Weller, H. R.; Kelley, J. H.
2016-11-01
The low-lying electromagnetic dipole strength of the odd-proton nuclide 205Tl has been investigated up to the neutron separation energy exploiting the method of nuclear resonance fluorescence. In total, 61 levels of 205Tl have been identified. The measured strength distribution of 205Tl is discussed and compared to those of even-even and even-odd mass nuclei in the same mass region as well as to calculations that have been performed within the quasi-particle phonon model.
Dipole response of the odd-proton nucleus 205Tl up to the neutron-separation energy
International Nuclear Information System (INIS)
Benouaret, N; Beller, J; Pai, H; Pietralla, N; Ponomarev, V Yu; Romig, C; Schnorrenberger, L; Zweidinger, M; Scheck, M; Isaak, J; Savran, D; Sonnabend, K; Raut, R; Rusev, G; Tonchev, A P; Tornow, W; Weller, H R; Kelley, J H
2016-01-01
The low-lying electromagnetic dipole strength of the odd-proton nuclide 205 Tl has been investigated up to the neutron separation energy exploiting the method of nuclear resonance fluorescence. In total, 61 levels of 205 Tl have been identified. The measured strength distribution of 205 Tl is discussed and compared to those of even–even and even–odd mass nuclei in the same mass region as well as to calculations that have been performed within the quasi-particle phonon model. (paper)
Magnetic measurements on Tl-2212 and Bi-2212 single crystals: a comparative study
Energy Technology Data Exchange (ETDEWEB)
Oussena, M. (Physics Dept., Univ. of Southampton (United Kingdom)); Porter, S. (Physics Dept., Univ. of Southampton (United Kingdom)); Volkozub, A. (Physics Dept., Univ. of Southampton (United Kingdom)); De Groot, P.A.J. (Physics Dept., Univ. of Southampton (United Kingdom)); Lanchester, P.C. (Physics Dept., Univ. of Southampton (United Kingdom)); Ogborne, D. (Physics Dept., Univ. of Southampton (United Kingdom) Chemistry Dept., Univ. of Southampton (United Kingdom)); Weller, M.T. (Physics Dept., Univ. of Southampton (United Kingdom) Chemistry Dept., Univ. of Southampton (United Kingdom)); Balakrishnan, G. (Physics Dept., Univ. of Southampton (United Kingdom) Physics Dept., Univ. of Warwick, Coventry (United Kingdom)); Paul, D.McK. (Physics Dept., Univ. of Southampton (United Kingdom) Physics Dept., Univ. of Warwick, Coventry (United Kingdom))
1994-02-01
We have compared the magnetic behaviour of two identically shaped single crystals, Tl[sub 2]Ba[sub 2]CaCu[sub 2]O[sub 8] and Bi[sub 2]Sr[sub 2]CaCu[sub 2]O[sub 8]. The critical current density is found to decrease more rapidly with temperature in Bi-2212 although it is the highest in this material at low temperatures (T < 10K). I-V characteristic curves have been obtained from measurements of magnetic sweep rate dependencies of the hysteresis loops. We have found that the characteristic temperature at which flux motion becomes important is significantly higher in Tl-2212 than in Bi-2212. Hence the Tl-2212 has a larger effective pinning. (orig.)
Huang, Richard Y-C; Krystek, Stanley R; Felix, Nathan; Graziano, Robert F; Srinivasan, Mohan; Pashine, Achal; Chen, Guodong
2018-01-01
TL1A, a tumor necrosis factor-like cytokine, is a ligand for the death domain receptor DR3. TL1A, upon binding to DR3, can stimulate lymphocytes and trigger secretion of proinflammatory cytokines. Therefore, blockade of TL1A/DR3 interaction may be a potential therapeutic strategy for autoimmune and inflammatory diseases. Recently, the anti-TL1A monoclonal antibody 1 (mAb1) with a strong potency in blocking the TL1A/DR3 interaction was identified. Here, we report on the use of hydrogen/deuterium exchange mass spectrometry (HDX-MS) to obtain molecular-level details of mAb1's binding epitope on TL1A. HDX coupled with electron-transfer dissociation MS provided residue-level epitope information. The HDX dataset, in combination with solvent accessible surface area (SASA) analysis and computational modeling, revealed a discontinuous epitope within the predicted interaction interface of TL1A and DR3. The epitope regions span a distance within the approximate size of the variable domains of mAb1's heavy and light chains, indicating it uses a unique mechanism of action to block the TL1A/DR3 interaction.
Identification of irradiated spices by the use of thermoluminescence method (TL)
Energy Technology Data Exchange (ETDEWEB)
Sharifzadeh, M.; Sohrabpour, M. (Atomic Energy Organization of Iran, Teheran (Iran, Islamic Republic of))
In this paper the results of the investigation of identification of irradiated spices by the use of thermoluminescence method is reported. The materials used were black and red peppers, turmeric, cinnamon, and garlic powder. Gamma Cell 220 was used for irradiating samples at dose values of 2.5, 5, 7.5 and 10 kGy respectively. The TL intensity of the unirradiated spices as well as the fading characteristics of the irradiated samples having received a dose of 10 kGy have been measured. Post-irradiation temperature treatment of the irradiated (10 kGy) and unirradiated samples at 60[sup o]C and 100[sup o]C for 24 hours have also been performed. The results show that the TL intensities of unirradiated and irradiated samples from different batches of each spice are fairly distributed. A reasonable TL intensity versus dose has been observed in nearly all cases. Based on the observation made it is possible to distinguish irradiated spices after (4-9) months post-irradiation. (author).
Identification of irradiated spices by the use of thermoluminescence method (TL)
International Nuclear Information System (INIS)
Sharifzadeh, M.; Sohrabpour, M.
1993-01-01
In this paper the results of the investigation of identification of irradiated spices by the use of thermoluminescence method is reported. The materials used were black and red peppers, turmeric, cinnamon, and garlic powder. Gamma Cell 220 was used for irradiating samples at dose values of 2.5, 5, 7.5 and 10 kGy respectively. The TL intensity of the unirradiated spices as well as the fading characteristics of the irradiated samples having received a dose of 10 kGy have been measured. Post-irradiation temperature treatment of the irradiated (10 kGy) and unirradiated samples at 60 o C and 100 o C for 24 hours have also been performed. The results show that the TL intensities of unirradiated and irradiated samples from different batches of each spice are fairly distributed. A reasonable TL intensity versus dose has been observed in nearly all cases. Based on the observation made it is possible to distinguish irradiated spices after (4-9) months post-irradiation. (author)
Response function study of a scintillator detector of NaI(Tl)
International Nuclear Information System (INIS)
Villa, Marcelo Barros; Costa, Alessandro Martins da
2014-01-01
In measurements of gamma rays with Nai (Tl) scintillator, the detectors output data are pulse height spectra, that corresponding to distorted information about the radiation source due to various errors associated with the crystal scintillation process and electronics associated, instead of power spectra photons. Pulse height spectra are related to the real power spectra by means of scintillator detector response function NaI (Tl). In this work, the response function for a cylindrical crystal of Nal (Tl) of 7,62 x 7,62 cm (diameter x length) was studied, by Monte Carlo method, using the EGSnrc tool to model the transport of radiation, combined with experimental measurements. An inverse response matrix, even with the energy of the square root, which transforms the pulse height spectrum of photon energy spectrum was obtained. The results of this transformation of pulse height spectrum for photon energy spectrum is presented, showing that the methodology employed in this study is suitable
Characterizing ncRNAs in human pathogenic protists using high-throughput sequencing technology
Directory of Open Access Journals (Sweden)
Lesley Joan Collins
2011-12-01
Full Text Available ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, snoRNAs and long ncRNAs on a genomic scale making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases.
Characterizing ncRNAs in Human Pathogenic Protists Using High-Throughput Sequencing Technology
Collins, Lesley Joan
2011-01-01
ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses, and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, small nucleolar RNAs (snoRNAs), and long ncRNAs on a genomic scale, making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational, and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases. PMID:22303390
X-ray photoemission analysis of chemically modified TlBr surfaces for improved radiation detectors
International Nuclear Information System (INIS)
Nelson, A. J.; Voss, L. F.; Beck, P. R.; Graff, R. T.; Conway, A. M.; Nikolic, R. J.; Payne, S. A.; Lee, J.-S.; Kim, H.; Cirignano, L.; Shah, K.
2013-01-01
We subjected device-grade TlBr to various chemical treatments used in room temperature radiation detector fabrication to determine the resulting surface composition and electronic structure. As-polished TlBr was treated separately with HCl, SOCl 2 , Br:MeOH and HF solutions. High-resolution photoemission measurements on the valence band electronic structure and Tl 4f, Br 3d, Cl 2p and S 2p core lines were used to evaluate surface chemistry and shallow heterojunction formation. Surface chemistry and valence band electronic structure were correlated with the goal of optimizing the long-term stability and radiation response
Myocardial scintigraphy with 199Tl chloride for the assessment of antianginal effect of cardil
International Nuclear Information System (INIS)
Chernov, V.I.; Mordovin, V.F.; Vesnina, Zh.V.; Triss, S.V.; Bazilevich, I.A.; Lishmanov, Yu.B.
1995-01-01
The aim of this research was examination of myocardial perfusion in cardil therapy of twenty-two coronary patients and analysis of potentialities of load 199 Tl scintigraphy in assessment of the antianginal effect in the course of therapy of coronary patients. The findings evidence that due to short 199 Tl half life and low radiation load of the body because of this radionuclide load 199 Tl scintigraphy of the myocardium carried out in the course of therapy of coronary patients may be used as an objective test to assess myocardial perfusion under the effect of treatment. 8 refs
International Nuclear Information System (INIS)
2011-01-01
Gypsum crystals taken from Sivrihisar-Eskisehir district were investigated and dated by Electron Spin Resonance (ESR) and Thermoluminescence (TL) techniques. The natural ESR spectra of gypsum samples had also the signals of Mn 2 + in addition to the signal at g=2.009. It was observed that the intensity of ESR signal at g=2.009 increased with gamma irradiation dose. This ESR signal (g=2.009) was used as a dating signal in dating of gypsum samples. The only one TL peak at about 278 degree Celsius was observed in TL glow curves of nonirradiated gypsum sample. In the case of irradiated sample, TL peak at 157 degree Celsius was observed in addition of TL peak at 278 degree Celsius. Gypsum samples were irradiated with a 6 0Co gamma source. The ESR spectra and TL glow curve of gypsum samples were recorded by X-band ESR spectrometer and Risφ TL/OSL reader, respectively. For samples, ESR/TL dose-response curves was constructed. Dose-response curves were fitted with an exponential saturation function. Based on this model, accumulated dose (AD) values for dating are determined. 2 38U, 2 32Th and 4 0K analysis was carried out for gypsum crystals and dolomite which enveloped these gypsum crystals. The internal dose rate was calculated from 2 38U, 2 32Th and 4 0K analysis results of gypsum sample. The external dose rate was calculated by using 2 38U, 2 32Th and 4 0K analysis results of dolomite and cosmic dose rate. Internal and external gamma dose-rate was used for dating calculations. Because of successive recrystallization of gypsum sample after formation, calculated age values of gypsum is smaller than expected formation age.
DEFF Research Database (Denmark)
Akbari, Mansour; Otterlei, Marit; Pena Diaz, Javier
2004-01-01
Nuclear uracil-DNA glycosylase UNG2 has an established role in repair of U/A pairs resulting from misincorporation of dUMP during replication. In antigen-stimulated B-lymphocytes UNG2 removes uracil from U/G mispairs as part of somatic hypermutation and class switch recombination processes. Using......, PCNA and DNA ligase, the latter detected as activity. Short-patch repair was the predominant mechanism both in extracts and UNG2-ARC from proliferating and less BER-proficient growth-arrested cells. Repair of U/G mispairs and U/A pairs was completely inhibited by neutralizing UNG...
International Nuclear Information System (INIS)
Sugo, Nobuo; Kuroki, Takao; Nemoto, Masaaki; Mito, Toshiaki; Seiki, Yoshikatsu; Shibata, Iekado
2000-01-01
The accumulation levels of 201 TlCl and Na + -K + ATPase activity in tumor tissue were compared among glioblastoma, benign glioma and meningioma to study the difference in the mechanism of 201 TlCl accumulation. The subjects were 19 cases comprised of 6 glioblastoma, 2 oligodendroglioma, 1 fibrillary astrocytoma, 1 pilocytic astrocytoma and 9 meningioma. Preoperative 201 TlCl SPECT was performed in all the cases, and Thallium Index (TL index) was calculated by a ratio of 201 TlCl in the tumor area and the contralateral area. In addition, cell membrane was extracted from the tumor tissue collected intraoperatively to determine Na + -K + ATPase activity. No statistically significant difference in TL index was noted between the glioblastoma group (6.97±2.67) and the meningioma group (5.87±1.99). This fact showed that there was no difference in the accumulation level of 201 TlCl between the two groups. On the other hand, the glioblastoma group indicated a higher value of Na + -K + ATPase activity (49.13±43.76 μmole/hour/mg protein) than the meningioma group (7.73±13.84 μmol/hour/mg protein) (p + -K + ATPase activity in 201 TlCl accumulation in glioblastoma and the influences of other accumulation mechanism than Na + -K + ATPase activity such as the volume of intratumoral vascular bed in meningioma. (author)
International Nuclear Information System (INIS)
Souza, J.H.
1985-01-01
Thermoluminescence (TL) sensivitivy of natural quartz (beaches, paleobeaches and fixed dunes) to Beta and Gamma rays has been studied in a temperature range between 250-400 0 C, before and after bleaching by solar irradiation. A first TL glow growth curve was obtained through Beta irradiation of 'as found' samples and a second glow growth curve was obtained by bleaching through solar irradiation the TL acquired either through an excitation Gamma dose or through environmental radiation to finally re-irradiate the samples under Beta rays. Experimental results showing the constancy of sensitivity, for doses of until about 10K rads, are the basis for a proposal to improve TL dating methodology expanding its present limits. (Author) [pt
Stark broadening parameters and transition probabilities of persistent lines of Tl II
de Andrés-García, I.; Colón, C.; Fernández-Martínez, F.
2018-05-01
The presence of singly ionized thallium in the stellar atmosphere of the chemically peculiar star χ Lupi was reported by Leckrone et al. in 1999 by analysis of its stellar spectrum obtained with the Goddard High Resolution Spectrograph (GHRS) on board the Hubble Space Telescope. Atomic data about the spectral line of 1307.50 Å and about the hyperfine components of the spectral lines of 1321.71 Å and 1908.64 Å were taken from different sources and used to analyse the isotopic abundance of thallium II in the star χ Lupi. From their results the authors concluded that the photosphere of the star presents an anomalous isotopic composition of Tl II. A study of the atomic parameters of Tl II and of the broadening by the Stark effect of its spectral lines (and therefore of the possible overlaps of these lines) can help to clarify the conclusions about the spectral abundance of Tl II in different stars. In this paper we present calculated values of the atomic transition probabilities and Stark broadening parameters for 49 spectral lines of Tl II obtained by using the Cowan code including core polarization effects and the Griem semiempirical approach. Theoretical values of radiative lifetimes for 11 levels (eight with experimental values in the bibliography) are calculated and compared with the experimental values in order to test the quality of our results. Theoretical trends of the Stark width and shift parameters versus the temperature for spectral lines of astrophysical interest are displayed. Trends of our calculated Stark width for the isoelectronic sequence Tl II-Pb III-Bi IV are also displayed.
The strongest magnetic barrier in the DIII-D tokamak and comparison with the ASDEX UG
Ali, Halima; Punjabi, Alkesh
2013-05-01
Magnetic perturbations in tokamaks lead to the formation of magnetic islands, chaotic field lines, and the destruction of flux surfaces. Controlling or reducing transport along chaotic field lines is a key challenge in magnetically confined fusion plasmas. A local control method was proposed by Chandre et al. [Nucl. Fusion 46, 33-45 (2006)] to build barriers to magnetic field line diffusion by addition of a small second-order control term localized in the phase space to the field line Hamiltonian. Formation and existence of such magnetic barriers in Ohmically heated tokamaks (OHT), ASDEX UG and piecewise analytic DIII-D [Luxon, J.L.; Davis, L.E., Fusion Technol. 8, 441 (1985)] plasma equilibria was predicted by the authors [Ali, H.; Punjabi, A., Plasma Phys. Control. Fusion 49, 1565-1582 (2007)]. Very recently, this prediction for the DIII-D has been corroborated [Volpe, F.A., et al., Nucl. Fusion 52, 054017 (2012)] by field-line tracing calculations, using experimentally constrained Equilibrium Fit (EFIT) [Lao, et al., Nucl. Fusion 25, 1611 (1985)] DIII-D equilibria perturbed to include the vacuum field from the internal coils utilized in the experiments. This second-order approach is applied to the DIII-D tokamak to build noble irrational magnetic barriers inside the chaos created by the locked resonant magnetic perturbations (RMPs) (m, n)=(3, 1)+(4, 1), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation with amplitude δ. A piecewise, analytic, accurate, axisymmetric generating function for the trajectories of magnetic field lines in the DIII-D is constructed in magnetic coordinates from the experimental EFIT Grad-Shafranov solver [Lao, L, et al., Fusion Sci. Technol. 48, 968 (2005)] for the shot 115,467 at 3000 ms in the DIII-D. A symplectic mathematical map is used to integrate field lines in the DIII-D. A numerical algorithm [Ali, H., et al., Radiat. Eff. Def. Solids Inc. Plasma Sc. Plasma Tech. 165, 83
Directory of Open Access Journals (Sweden)
Piotr Karwasiński
2015-12-01
Full Text Available W artykule omówiono zagadnienia związane z procesami informatyzacji Biblioteki Uniwersyteckiej w Poznaniu. W celu dokładnego scharakteryzowania przemian, prócz rysu historycznego, przedstawiono obszary, które wyraźnie poprawiły jakość pracy personelu i obsługę czytelników oraz przyczyniły się do poznania, upowszechniania i wdrażania nowoczesnych rozwiązań technologicznych. Zaprezentowano proces zmian w zakresie funkcjonowania systemu biblioteczno-informacyjnego Horizon i współpracy z narodowym katalogiem centralnym NUKAT. Opisano etapy rozwoju elektronicznej przestrzeni informacyjnej, w tym budowania elektronicznych zasobów wiedzy i tworzenia narzędzi do ich obsługi i wykorzystania w procesach wyszukiwania źródeł informacji. Zaprezentowano Bibliotekę Uniwersytecką jako partnera w aranżowaniu instytucjonalnych platform cyfrowych do deponowania i udostępniania dorobku intelektualnego społeczności naukowej Uniwersytetu im. Adama Mickiewicza w Poznaniu. Wskazano także funkcjonalność zaprojektowanych i wdrożonych innowacyjnych usług wirtualnych pakietu Libsmart, optymalizujących funkcjonowanie Biblioteki Uniwersyteckiej.
Reader's Response: What Is a SoTL?
Griebenow, Kai
2010-01-01
In this response to, "SoTL Commons Conference: A Spirit of Inquiry" (Margaret Davis, Kera Watkins, and Deborah Allen, "International Journal for the Scholarship of Teaching and Learning,"v3 n2 Jul 2009), Griebenow adds his personal impressions as an "SOTL newbie." He states that many scientists have an idea of…
Energy Technology Data Exchange (ETDEWEB)
Kato, Hiroshi; Misawa, Toshihiro; Kutsumi, Yasunori [Fukui Medical School, Matsuoka (Japan); and others
1991-01-01
To determine quantitatively the discriminant and characteristics of cor pulmonale, {sup 201}Tl myocardial perfusion SPECT was performed in 16 patients with chronic obstructive pulmonary disease (COPD) and 7 with restrictive pulmonary disease (RPD). One section of the short-axis SPECT image in which the right ventricle was most clearly visualized was selected. Tl-score was defined as the ratio of the sum of counts in the region of interest (ROI) at the anterior, mid, and posterior regions of the right ventricular free wall to the sum of counts in ROI at the posterior, lateral, and anterior walls of the left ventricle, and the anterior and posterior regions of the interventricular septum. In the group of COPD patients, Tl-score was positively correlated with mean pulmonary arterial pressure (mPAP), total pulmonary vascular resistance (TPR), and arterial carbon dioxide tension (PaCO{sub 2}), while it was inversely correlated with arterial oxygen tension (PaO{sub 2}). However, there was no significant correlation between Tl-score and mPAP, TPR, PaCO{sub 2}, and PaO{sub 2} in the group of RPD patients. In assessing pulmonary hypertension as defined by mPAP over 20 mmHg, a Tl-score greater than 0.25 was useful with a sensitivity of 69% and a specificity of 90%. The occurrence of cor pulmonale is a major factor in determining the prognosis of COPD patients. It was concluded that {sup 201}Tl myocardial SPECT is useful for evaluating right ventricular overload quantitatively, as well as for assessing core pulmonale, especially in COPD patients, since the ratio of Tl counts in the right and left ventricles was significantly correlated with right cardiopulmonary hemodynamic parameters. (N.K.).
Superdeformation studies in the odd-odd nucleus {sup 192}Tl
Energy Technology Data Exchange (ETDEWEB)
Fischer, S.; Carpenter, M.P.; Janssens, R.V.F. [and others
1995-08-01
The study of yrast and near-yrast structures of odd-odd nuclei to high spins is somewhat limited due to the complexity of the spectra resulting from the many proton-neutron couplings near the Fermi surface. In superdeformed nuclei, the number of available protons and neutrons near the Fermi surface is somewhat limited due to the presence of large-shell gaps which stabilize the nuclear shape. A relatively small number of available neutron and proton configurations can lead to fragmentation of the SD intensity into a number of different bands. Two good examples of this phenomenon were found in {sup 192}Tl and {sup 194}Tl where the presence of six superdeformed bands were reported in both nuclei. We reexamined {sup 192}Tl at Gammasphere using the {sup 160}Gd({sup 37}Cl,5n) reaction at 178 MeV to populate states in the superdeformed well of this nucleus. While our previous study on {sup 192}Tl at ATLAS was very successful, a number of questions remained which formed the basis of our objectives in this experiment: obtain better {gamma}-ray energies for the known transitions and identify higher spin members in each band; determine how the bands feed the known yrast states in {sup 192}Tl as well as determine the complete spectrum in coincidence with the SD bands; look for M1 transitions connecting proposed signature partners; and attempt to identify other excitations in the superdeformed well. Analysis is underway and four of the six bands were confirmed. The reasons that two of the reported bands were not observed in this latest work is still under investigation. As of this time, no other superdeformed bands were identified in the data. Two of the confirmed SD bands have a constant moment of inertia and show indications of cross-talk between each other. This observation is not unexpected since the calculated M1 rates for the proposed configuration of the band, {pi}{sub 13/2} x {upsilon}j{sub 15/2}, indicate that M1 transitions linking the two SD bands should be observed.
Investigation of TL, OSL and PTTL properties of Mg2SiO4:Tb dosimeters
International Nuclear Information System (INIS)
Oguz, K. F.; Goekce, M.; Karali, T.; Harmansah, C.
2010-01-01
In this study thermoluminescence (TL) and optically stimulated luminescence (OSL) properties of Mg 2 SiO 4 :Tb in the form of sintered pellets were investigated. Mg 2 SiO 4 :Tb is a recently developed dosimetric material which offers high sensitivity for TL and OSL in dosimetric applications. Thermoluminescence glow curve of Tb doped Mg 2 SiO 4 samples show a glow peak at about 200 degree Celsius with two small peaks at about 275 and 330 degree Celsius, respectively. OSL experiments showed that blue light (470 nm) is six times more efficient than green light (532 nm) to stimulate the OSL emission. The aim of this study was to determine the TL and OSL fading properties of Mg 2 SiO 4 : Tb using OSL and TL methods. In addition, PTTL properties of the Mg 2 SiO 4 : Tb was investigated by using blue LEDs, UV lamp and blue laser. Investigations on the fading properties also showed that the TL signal fades % 10 in a period of 1 month and OSL signal fades % 10 in a period of 3 month, which then the signal remains relatively stable for longer periods.
OSL and TL retrospective dosimetry with a fluorapatite glass-ceramic used for dental restorations
International Nuclear Information System (INIS)
Ekendahl, Daniela; Judas, Libor; Sukupova, Lucie
2013-01-01
Optically Stimulated Luminescence (OSL) and Thermoluminescence (TL) properties of a fluorapatite glass-ceramic have been investigated, with a view to developing a dose assessment technique for medical triage following unplanned exposures of individuals to ionizing radiation. The ceramic is an innovative material used in dental prostheses and restorations. It is strongly sensitive to radiation and the intensity of both the OSL and TL signals are proportional to the absorbed radiation dose. We focused on the optimization of the measuring procedure and investigated characteristics such as reproducibility, fading, minimum detectable dose (MDD), dose response and photon energy response of TL and OSL signals. The dental ceramic exhibited very good reproducibility (<5% at 2σ level) when measured and a linear dose response for a wide range of doses (50 mGy–20 Gy). The MDD values for the samples investigated were ∼5 mGy. The material is not tissue equivalent and the OSL and TL signals are strongly dependent on incident photon energy. Both the luminescence signals exhibited significant fading during the first few hours after irradiation. Its rate was dependent on the parameters of measurement. The results indicate that the material can be used for the purposes of accident dosimetry, however, the fading and photon energy response have to be properly corrected for a reliable dose assessment. - Highlights: ► A dental ceramic was considered as a retrospective and accident dosimeter. ► Dosimetry application was investigated using OSL and TL. ► TL and OSL signals are proportional to absorbed radiation dose. ► Accuracy is dependent on correction of fading and photon energy response
Understanding NaI(Tl) crystal background for dark matter searches
Energy Technology Data Exchange (ETDEWEB)
Adhikari, G.; Adhikari, P.; Kong, S.Y.; Oh, S.Y. [Sejong University, Department of Physics and Astronomy, Seoul (Korea, Republic of); Ha, C.; Jeon, E.J.; Kim, N.Y.; Lee, H.S.; Park, J.S.; Park, K.S. [Institute for Basic Science (IBS), Center for Underground Physics, Daejeon (Korea, Republic of); Kim, Y.D. [Institute for Basic Science (IBS), Center for Underground Physics, Daejeon (Korea, Republic of); Sejong University, Department of Physics and Astronomy, Seoul (Korea, Republic of)
2017-07-15
We have developed ultra-low-background NaI(Tl) crystals to reproduce the DAMA results with the ultimate goal of achieving purity levels that are comparable to or better than those of the DAMA/LIBRA crystals. Even though the achieved background level does not approach that of DAMA/LIBRA, it is crucial to have a quantitative understanding of the backgrounds. We have studied background simulations toward a deeper understanding of the backgrounds and developed background models for a 9.16-kg NaI(Tl) crystal used in the test arrangement. In this paper we describe the contributions of background sources quantitatively by performing Geant4 Monte Carlo simulations that are fitted to the measured data to quantify the unknown fractions of the background compositions. In the fitted results, the overall simulated background spectrum well describes the measured data with a 9.16-kg NaI(Tl) crystal and shows that the background sources are dominated by surface {sup 210}Pb and internal {sup 40}K in the 2-6-keV energy interval, which produce 2.4 counts/day/keV/kg (dru) and 0.5 dru, respectively. (orig.)
Comparison of 201Tl solution sources in UK hospitals, 2001
International Nuclear Information System (INIS)
Baker, M.; Woods, M.
2001-01-01
During recent years, concerns have been raised within the nuclear medicine field about the accuracy of activity measurements for 201 Tl. And indeed, NPL calibrations repeatedly indicated that the level of impurities present in such samples and the significant amount of activity adsorbed onto the glass wall of the container could produce erroneous results. In addition, the standard P6 vials, in which 201 Tl solution had been previously supplied, were recently replaced with the new ''10R Type 1 plus'' Schott vials. To assess the magnitude of these effects on the accuracy of clinical measurements of the activity of 201 Tl, an intercomparison exercise was conducted between the National Physical Laboratory (NPL), Nycomed-Amersham (NA) and the UK hospital physics community. The majority of the 273 reported results were within the ± 10 % limit of accuracy that hospitals aim to achieve for diagnosis, biased high. The tendency to overestimate the activity was more evident for syringe measurements. The exercise also revealed that the adsorption losses experienced with P6 vials had been solved by the introduction of the 10R vials, but individual calibrators need to be recalibrated for this new container. (author)
International Nuclear Information System (INIS)
Horowitz, Y. S.; Belaish, Y.; Oster, L.
2006-01-01
In this paper some of the many theoretical models dealing with characteristics of TL materials are discussed. Special attention is given to some of the models dealing with the effects of ionisation density, that is Modified Track Structure Theory (MTST) and Micro-dosimetric Track Structure Theory (MTT) for the calculation of Heavy Charged Particle relative TL efficiencies, as well as solid-state models based on conduction band/valence band theory. Failures, successes, conflicts and trends are highlighted as well as a peek into future avenues of research for dosimetric TL materials. (authors)
Developing SoTL through Organized Scholarship Institutes
Directory of Open Access Journals (Sweden)
Elizabeth Marquis
2015-12-01
Full Text Available The need to further integrate SoTL into college and university cultures has been discussed relatively frequently in recent teaching and learning literature. While a number of useful strategies to assist in this task have been advanced, one especially promising suggestion is the development of organized, institutionally-recognized scholarship institutes. Centres or units of this sort have been created at higher education institutions in a number of countries, but little published information currently exists about the design of these institutes or the experiences of individuals affiliated with them. To that end, the present study sought to examine the perceived benefits, challenges and design features of teaching and learning scholarship institutes at research-intensive universities worldwide. A website scan and a survey of individuals affiliated with these units were used to collect qualitative and quantitative data of relevance to the research questions. Based on the findings, and on ideas from the existing research institute and scholarship of teaching and learning literatures, a series of recommendations for individuals and campuses interested in developing effective SoTL institutes are provided.
Dicty_cDB: Contig-U15201-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2e-04 2 ( EX698640 ) GF_AW109651c08 AW1 Schistosoma mansoni cDNA clone... 44 2e-04 2 ( CD147...-0107T-L395-E12-U.B MG1-0107 Schistosoma manso... 44 2e-04 2 ( CD147233 ) ML1-0002T-M131-E11-U.G ML1-0002 Sc
International Nuclear Information System (INIS)
Lu Yanchou; Zhang Jingzhao; Xie Jun
1988-01-01
Six ceramics and two baked soil samples collected from the famous Xian Terracotta Army Site have been dated by using fine grain (2-8 μ) thermoluminescence (TL) technique. Five samples of pottery sherds exhibited peak TL at about 275 0 C and 395 0 C gave the TL age ranges from 2.13 ± 0.14 ka to 2.25 ± 0.14 ka and a mean TL age of 2.20 ± 0.15 ka, with a good plateau in the range of 290-400 0 C. Another sample, however, showed a larger peak at 365 0 C and could not be dated because of serious fading. TL ages of 1.93 ± 0.13 ka and 2.20 ± 0.19 ka have been also obtained from the baked soil samples with a plateau between 300 and 350 0 C. The TL dates of the ceramics and baked soil are consistent with C-14 dates on charcoal samples taken from the same layer in Xian Terracotta Army Site. It is consistent with other evidence that the Terracotta Army figures were made about 2200 yr ago and that the site burned down soon afterwards. (author)
Pulse shape analysis using CsI(Tl) Crystals
International Nuclear Information System (INIS)
Silva, J.; Fiori, E.; Loher, B.; Savran, D.; Wirth, R.; Vencelj, M.
2013-06-01
The decay time of CsI(Tl) scintillating material consists of more than a single exponential component. The ratio between the intensity of these components varies as a function of the ionizing power of the absorbed particles, such as γ -rays or protons, and the temperature. This property can therefore be used for particle discrimination and for temperature monitoring, using pulse shape analysis. An unsupervised method that uses fuzzy clustering algorithms for particle identification based on pulse shape analysis is presented. The method is applied to discriminate between photon and proton-induced signals in CsI(Tl) scintillator detectors. The first results of a method that uses pulse shape analysis for correcting the temperature-dependent gain effect of the detector are also presented. The method aims at conserving a good energy resolution in a temperature varying environment without the need to measure the temperature of the detector externally (authors)
CsI(Tl)-photodiode detectors for gamma-ray spectroscopy
Fioretto, E; Viesti, G; Cinausero, M; Zuin, L; Fabris, D; Lunardon, M; Nebbia, G; Prete, G
2000-01-01
We report on the performances of CsI(Tl)-photodiode detectors for gamma-ray spectroscopy applications. Light output yield and energy resolution have been measured for different crystals and read-out configurations.
Assessment of FIV-C infection of cats as a function of treatment with the protease inhibitor, TL-3
Directory of Open Access Journals (Sweden)
de Rozières Sohela
2004-11-01
Full Text Available Abstract Background The protease inhibitor, TL-3, demonstrated broad efficacy in vitro against FIV, HIV and SIV (simian immunodeficiency virus, and exhibited very strong protective effects on early neurologic alterations in the CNS of FIV-PPR infected cats. In this study, we analyzed TL-3 efficacy using a highly pathogenic FIV-C isolate, which causes a severe acute phase immunodeficiency syndrome, with high early mortality rates. Results Twenty cats were infected with uncloned FIV-C and half were treated with TL-3 while the other half were left untreated. Two uninfected cats were used as controls. The general health and the immunological and virological status of the animals was monitored for eight weeks following infection. All infected animals became viremic independent of TL-3 treatment and seven of 20 FIV-C infected animals developed severe immunodepletive disease in conjunction with significantly (p ≤ 0.05 higher viral RNA loads as compared to asymptomatic animals. A marked and progressive increase in CD8+ T lymphocytes in animals surviving acute phase infection was noted, which was not evident in symptomatic animals (p ≤ 0.05. Average viral loads were lower in TL-3 treated animals and of the 6 animals requiring euthanasia, four were from the untreated cohort. At eight weeks post infection, half of the TL-3 treated animals and only one of six untreated animals had viral loads below detection limits. Analysis of protease genes in TL-3 treated animals with higher than average viral loads revealed sequence variations relative to wild type protease. In particular, one mutant, D105G, imparted 5-fold resistance against TL-3 relative to wild type protease. Conclusions The findings indicate that the protease inhibitor, TL-3, when administered orally as a monotherapy, did not prevent viremia in cats infected with high dose FIV-C. However, the modest lowering of viral loads with TL-3 treatment, the greater survival rate in symptomatic animals of
The baryon vector current in the combined chiral and 1/Nc expansions
Energy Technology Data Exchange (ETDEWEB)
Flores-Mendieta, Ruben; Goity, Jose L [JLAB
2014-12-01
The baryon vector current is computed at one-loop order in large-Nc baryon chiral perturbation theory, where Nc is the number of colors. Loop graphs with octet and decuplet intermediate states are systematically incorporated into the analysis and the effects of the decuplet-octet mass difference and SU(3) flavor symmetry breaking are accounted for. There are large-Nc cancellations between different one-loop graphs as a consequence of the large-Nc spin-flavor symmetry of QCD baryons. The results are compared against the available experimental data through several fits in order to extract information about the unknown parameters. The large-Nc baryon chiral perturbation theory predictions are in very good agreement both with the expectations from the 1/Nc expansion and with the experimental data. The effect of SU(3) flavor symmetry breaking for the |Delta S|=1 vector current form factors f1(0) results in a reduction by a few percent with respect to the corresponding SU(3) symmetric values.
Anomalous fading of the TL, Blue-SL and IR-SL signals of fluorapatite
International Nuclear Information System (INIS)
Tsirliganis, N.; Polymeris, G.; Loukou, Z.; Kitis, G.
2006-01-01
The thermoluminescence (TL), blue stimulated luminescence (BSL) and infrared stimulated luminescence (IRSL) signals of fluorapatite (originating from Durango, Mexico) were measured and found to exhibit strong anomalous fading (AF). The experimentally obtained OSL and IRSL decay curves were transformed into pseudo-linear modulated (pseudo-LM) decay curves. The resulting glow-curve shaped pseudo-LM decay curves were analyzed using a deconvolution analysis, similar to the one used for the glow-curve deconvolution (GCD) of TL glow-curves. It was found that the pseudo-LM OSL and IRSL decay curves consist of two components named fast and slow, respectively, and their individual contribution was estimated. The AF of the remnant TL, BSL and IRSL as a function of the storage time was fitted using the tunneling model equations and the fading rate g, in terms of percentage per decade was evaluated. According to the obtained g values, the AF of the BSL and IRSL is stronger than that of the TL. The AF of the fast component of BSL and IRSL is almost the same. The AF of the slow component of IRSL is, by approximately a factor of 2, stronger than that of the BSL
33 CFR 110.170 - Lockwoods Folly Inlet, N.C.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...
Effects of cross talk on dual energy SPECT imaging between [sup 123]I-BMIPP and [sup 201]Tl
Energy Technology Data Exchange (ETDEWEB)
Morita, Masato; Narita, Hitoshi; Yamamoto, Juro; Fukutake, Naoshige; Ohyanagi, Mitsumasa; Iwasaki, Tadaaki; Fukuchi, Minoru (Hyogo College of Medicine, Nishinomiya (Japan))
1994-01-01
The study was undertaken to determine how much cross talk influences the visual assessment of dual energy single photon emission computed tomographic (SPECT) images with iodine 123 beta-methyl-p-iodophenylpentadecanoic acid (I-123 BMIPP) and thallium-201 in 15 patients with acute myocardial infarction. After single SPECT with I-123 BMIPP was undertaken, simultaneous dual SPECT with I-123 BMIPP and Tl-201 were undertaken in all patients. Three patients also underwent single SPECT with Tl-201. I-123 BMIPP and Tl-201 uptake was graded in four-score for the comparison between single and dual SPECT images. There was good correlation between dual energy SPECT and both single I-123 BMIPP SPECT (pS=0.97) and single Tl-201 SPECT (pS=0.59). Uptake scores were increased on dual energy SPECT, compared with single I-123 SPECT (8 out of 132 segments) and single Tl-201 SPECT (12 out of 36 segments). Overall, there was a comparatively well correlation between single SEPCT with either I-123 BMIPP or Tl-201 and dual energy SPECT images. However, one tracer uptake sometimes increased in the other tracer defect areas. This was noticeable when I-123 BMIPP exerted an effect on Tl-201. (N.K.).
International Nuclear Information System (INIS)
Vega C, H. R.; Ortiz R, J. M.; Benites R, J. L.; De Leon M, H. A.
2015-09-01
The response functions of a NaI(Tl) detector have been estimated using Monte Carlo methods. Response functions were calculated for monoenergetic photon sources (0.05 to 3 MeV). Responses were calculated for point-like sources and for sources distributed in Portland cement cylinders. The responses were used to calculate the efficiency functions in term of photon energy. Commonly, sources used for calibration are point-like, and eventually sources to be measured have different features. In order to use the calibrated sources corrections due to solid angle, self-absorption and scattering, must be carried out. However, some of these corrections are not easy to perform. In this work, the calculated responses were used to estimate the detector efficiency of point-like sources, and sources distributed in Portland type cement. Samples of Portland paste were prepared and were exposed to photoneutrons produced by a 15 MV linac. Some of the elements in the cement were activated producing γ-emitting radionuclides that were measured with a NaI(Tl) gamma-ray spectrometer, that was calibrated with point-like sources. In order to determine the specific activity in the induced radioisotopes calculated efficiencies were used to make corrections due to the differences between the solid angle, photon absorption and photon scattering in the point-like calibration sources and the sources distributed in cement. During the interaction between photoneutrons and the cement samples three radioisotopes were induced: 56 Mn, 24 Na, and 28 Al. (Author)
Energy Technology Data Exchange (ETDEWEB)
Vega C, H. R.; Ortiz R, J. M. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Benites R, J. L. [Centro Estatal de Cancerologia de Nayarit, Calz. de la Cruz 118 Sur, Tepic, Nayarit (Mexico); De Leon M, H. A., E-mail: fermineutron@yahoo.com.mx [Instituto Tecnologico de Aguascalientes, Av. Adolfo Lopez Mateos 1801 Ote., 20155 Aguascalientes, Ags. (Mexico)
2015-09-15
The response functions of a NaI(Tl) detector have been estimated using Monte Carlo methods. Response functions were calculated for monoenergetic photon sources (0.05 to 3 MeV). Responses were calculated for point-like sources and for sources distributed in Portland cement cylinders. The responses were used to calculate the efficiency functions in term of photon energy. Commonly, sources used for calibration are point-like, and eventually sources to be measured have different features. In order to use the calibrated sources corrections due to solid angle, self-absorption and scattering, must be carried out. However, some of these corrections are not easy to perform. In this work, the calculated responses were used to estimate the detector efficiency of point-like sources, and sources distributed in Portland type cement. Samples of Portland paste were prepared and were exposed to photoneutrons produced by a 15 MV linac. Some of the elements in the cement were activated producing γ-emitting radionuclides that were measured with a NaI(Tl) gamma-ray spectrometer, that was calibrated with point-like sources. In order to determine the specific activity in the induced radioisotopes calculated efficiencies were used to make corrections due to the differences between the solid angle, photon absorption and photon scattering in the point-like calibration sources and the sources distributed in cement. During the interaction between photoneutrons and the cement samples three radioisotopes were induced: {sup 56}Mn, {sup 24}Na, and {sup 28}Al. (Author)
Energy Technology Data Exchange (ETDEWEB)
Fujii, Tadashige; Tanaka, Masao; Takeda, Masashi; Matsuzawa, Yukinori; Handa, Kenjiro; Yoshimura, Kazuhiko [Shinshu Univ., Matsumoto, Nagano (Japan). Faculty of Medicine
1993-04-01
Tl-201 myocardial scintigraphy was performed in 130 patients with chronic obstructive pulmonary disease (COPD) to evaluate right ventricular hypertrophy, and the clinical significance of this method was studied. Tl-201 uptake ratios of the right ventricle, which represents the ratio of total counts of the right ventricle to counts of the administered dose of Tl-201, was higher in COPD, especially in pulmonary emphysema and B type COPD by Burrows classification than in controls. The grade of visualization of the right ventricle by visual assessment (RVV) was marked (+++) in only a few cases and moderate (++) in many cases (more than 80%) in all diseases except bronchial asthma. The incidence of right ventricular hypertrophy by electrocardiogram, right-sided heart failure and marked dyspnea (Hugh-Jones 4[center dot]5) were very low in cases with RVV grade ++ and very high in cases with +++. The grade of RVV was related to the severity of pulmonary perfusion impairment, although in diffuse panbronchiolitis the RVV was relatively slight compared with the impairment of perfusion. May parameters of pulmonary function such as %VC, FEV1.0%, RV/TLC, V25, %DLCO, Raw, [Delta]N[sub 2] and PaO[sub 2] showed abnormal values in patients with RVV grade of (++) or (+++) in all diseases except bronchial asthma. In COPD, Tl-201 myocardial scintigraphy seems to be useful for assessment of right ventricular overloading, and for follow-up observation and differentiation between cor pulmonale and right ventricular hypertrophy secondary to cardiac diseases by observing Tl-201 uptake of the lung and left ventricle. (author).
International Nuclear Information System (INIS)
Fujii, Tadashige; Tanaka, Masao; Takeda, Masashi; Matsuzawa, Yukinori; Handa, Kenjiro; Yoshimura, Kazuhiko
1993-01-01
Tl-201 myocardial scintigraphy was performed in 130 patients with chronic obstructive pulmonary disease (COPD) to evaluate right ventricular hypertrophy, and the clinical significance of this method was studied. Tl-201 uptake ratios of the right ventricle, which represents the ratio of total counts of the right ventricle to counts of the administered dose of Tl-201, was higher in COPD, especially in pulmonary emphysema and B type COPD by Burrows classification than in controls. The grade of visualization of the right ventricle by visual assessment (RVV) was marked (+++) in only a few cases and moderate (++) in many cases (more than 80%) in all diseases except bronchial asthma. The incidence of right ventricular hypertrophy by electrocardiogram, right-sided heart failure and marked dyspnea (Hugh-Jones 4·5) were very low in cases with RVV grade ++ and very high in cases with +++. The grade of RVV was related to the severity of pulmonary perfusion impairment, although in diffuse panbronchiolitis the RVV was relatively slight compared with the impairment of perfusion. May parameters of pulmonary function such as %VC, FEV1.0%, RV/TLC, V25, %DLCO, Raw, ΔN 2 and PaO 2 showed abnormal values in patients with RVV grade of (++) or (+++) in all diseases except bronchial asthma. In COPD, Tl-201 myocardial scintigraphy seems to be useful for assessment of right ventricular overloading, and for follow-up observation and differentiation between cor pulmonale and right ventricular hypertrophy secondary to cardiac diseases by observing Tl-201 uptake of the lung and left ventricle. (author)
International Nuclear Information System (INIS)
Gao Zhou; Shi yu; Chen Hongyan; Jia Shaowei
2002-01-01
Objective: Employing the differences in physical properties of 99m Tc-MIBI and 201 Tl, the authors discuss the contrast result of nitroglycerin interventional dual-isotope myocardium perfusion imaging and 201 Tl re-injection imaging to detect viable myocardium so that authors can enhance the image quality and shorten the examination time. Method: 34 OMI patients took the 99m Tc-MIBI and 201 Tl dual-isotope myocardium perfusion imaging and 201 Tl re-injection imaging respectively in two weeks. During the peak of normal dipyridamole stress i.v. 201 Tl 100 MBq was given and myocardium imaging was taken 15 min later. The dual-isotope group was given nitroglycerin 1mg under the tongue. Five min later, i.v. 99m Tc-MIBI 1110 mBq was given. In 201 Tl re-injection group i.v. 201 Tl 40 MBq was given 4 hour later and were imaged. Among the 34 OMI patients, 19 patients undertook another 99m Tc-MIBI static imaging. Results: There are no obvious differences between nitroglycerin interventional dual-isotope myocardium perfusion imaging and 201 Tl re-injection imaging in detection rate of viable myocardium, χ 2 =0.823, p>0.25. But they have great difference in perfusion changed sectional myocardium absorb rate, t=2.73, p 2 =27.867, p 201 Tl re-injection imaging
Evaluation of brain tumors by simultaneous dual isotope SPECT with 201Tl-chloride and 99mTc-MIBI
International Nuclear Information System (INIS)
Nagai, Hidemasa; Yamasaki, Toshiki; Yamamoto, Yoshiaki; Takada, Daikei; Miyazaki, Takeshi; Sugimoto, Keiji; Matsumoto, Yoshifumi; Akiyama, Yasuhiko; Moritake, Kouzo
2004-01-01
Single photon emission computed tomography (SPECT) is useful for detecting brain tumors. In this study, we evaluated the utility of simultaneous dual SPECT with 201 Tl-Chloride (Tl) and 99m Tc-MIBI (MIBI) for diagnosis of brain tumors. We evaluated 20 cases, including 2 glioblastomas, 7 anaplastic astrocytomas, 2 oligodendrogliomas, 2 anaplastic ependymomas, 2 medulloblastomas, 2 meningiomas, 1 malignant meningioma, 1 pituitary adenoma, and 1 craniopharyngioma. We analyzed the uptake ratio (T/N ratio) of tracers in both Tl and MIBI at max counts/pixels ratio in the region of interest. The T/N ratios in early and delayed images were described as early ratios (ER) and delay ratios (DR), respectively. The retention index (RI) was calculated as the DR/ER ratio. Significant correlations were found between ER and DR for both Tl (DR=0.797 x ER+0.359, r=0.871), and MIBI (DR=0.961 x ER-0.191, r=0.784). Next, we analyzed the correlations between Tl and MIBI SPECT, for ER, DR, and RI. ER values for the two were strongly correlated (r=0.791), DR values were weakly correlated (r=0.556), and RI exhibited no correlation between them (r=0.328). There were no correlations between tumor volume and T/N ratio for the two (ER-Tl; r=0.0095, DR-Tl; r=0.0050, ER-MIBI; r=0.036, DR-MIBI; r=0.254). Lastly no correlation was found between RI-Tl and RI-MIBI (r=0.328). We discuss the difference in the mechanism of accumulation of two tracers and the significance of simultaneous dual SPECT using them for the differential diagnosis of pituitary tumors, regrowth of oligodendrogliomas, and multi-drug resistance of chemotherapy. Dual SPECT with Tl and MIBI appears to be useful for the diagnosis of brain tumor. (author)
Koopmans, Martin P.; Schaeffer-Reiss, Christine; de Leeuw, Jan W.; Lewan, Michael D.; Maxwell, James R.; Schaeffer, Philippe; Sinninghe Damsté, Jaap S.
1997-06-01
Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature ( Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330°C for 72 h to study the diagenetic fate of n-C 37 and n-C 38 di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260°C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C 37 and n-C 38 skeletons, saturated n-C 37 and n-C38 methyl, ethyl, and mid-chain ketones, C 37 and C 38 mid-chain 2,5-di- n-alkylthiophenes, C 37 and C 38 1,2-di- n-alkylbenzenes, and C 37 and C 38n-alkanes. With increasing thermal maturation, three forms of the n-C 37 and n-C 38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di- n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C 37 and n-C 38 skeleton can be expected as well as the corresponding hydrocarbons.
Koopmans, M.P.; Schaeffer-Reiss, C.; De Leeuw, J. W.; Lewan, M.D.; Maxwell, J.R.; Schaeffer, P.; Sinninghe, Damste J.S.
1997-01-01
Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330??C for 72 h to study the diagenetic fate of n-C37 and n-C38 di-and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260??C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S-and O-bound n-C37 and n-C38 skeletons, saturated n-C37 and n-C38 methyl, ethyl, and mid-chain ketones, C37 and C38 mid-chain 2,5-di-n-alkylthiophenes, C37 and C38 1,2-di-n-alkylbenzenes, and C37 and C38 n-alkanes. With increasing thermal maturation, three forms of the n-C37 and n-C38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S-and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C37 and n-C38 skeleton can be expected as well as the corresponding hydrocarbons. Copyright ?? 1997 Elsevier Science Ltd.
Assessment of left ventricular function by 201Tl FCG-gated myocardial SPECT
International Nuclear Information System (INIS)
Toba, Masahiro; Ishida, Yoshio; Fukuchi, Kazuki; Fukushima, Kazuhito; Katafuchi, Tetsurou; Hayashida, Kohei; Oka, Hisashi; Takamiya, Makoto
1999-01-01
We applied the QGS program for LV function analysis (described by Germano, 1995) to a 201 Tl SPECT study at rest, and estimated its accuracy. We performed 201 Tl ECG-gated myocardial SPECT in 25 patients with ischemic heart disease under an acquisition time used in the routine 99m Tc ECG-gated SPECT study. The quality of the gated images was visually assessed with a 4-point grading system. LVEDV, LVESV, LVEF determined by the QGS program were compared with those by Simpson's method on biplane LVG in 25 patients. Regional wall motion scores in 7 myocardial segments were assessed on the three-dimensional display created by the QGS program and the cine display of biplane LVG with a 5-point grading system. Wall motion scores obtained by the QGS program were compared with those by LVG. Although 72.0% of 201 Tl ECG-gated SPECT images were fair or poor in image quality, there were good correlations between the values obtained by the QGS program and LVG (LVEDV: r=0.82, LVESV: r=0.88, LVEF: r=0.89). In addition, wall motion scores by the QGS program were correspondent to those by LVG in 77.1% of all 175 myocardial segments. We conclude that the QGS program provides high accuracy in evaluating left ventricular function even from 201 Tl ECG-gated myocardial SPECT data. (author)
Removal of 99mTc and 201Tl by means of Lemna Gibba
International Nuclear Information System (INIS)
Fernandez R, E.; Carreno de L, M. C.; Cuevas S, J. C.; Hernadez T, U. O.; Monroy G, F.
2012-10-01
In this work the capacity of the water macrophyte Lemna gibba coming from San Pedro Tultepec in the Mexico State was studied to remove the radioisotopes 99m Tc and 201 Tl, in order to show the capacity of this macrophyte for to treat some radioactive waste flowing that could contain this radioisotopes type. The removal capacity of 99m Tc and 201 Tl of the macrophyte Lemna gibba was determined using the batch method. In accordance with the values of the obtained K d , the Lemna gibba with a size of particle diameter among 1mm - 300 μm presents a better adsorption of 99m Tc. The 201 Tl is adsorbed better in the bioadsorbent when it has a size of particle diameter <150μm. (Author)
Energy Technology Data Exchange (ETDEWEB)
Basurto G, B.S
2002-07-01
The objective of this work, is the one of determining the kinetic parameters of the dosemeter of LiF: Mg, Cu, P + Ptfe; starting from the curves Tl obtained at being irradiated with alpha radiation ({alpha}), beta ({beta}) and gamma ({gamma}). As like to compare its sensitivity with each radiation type, considering the sensitivity of the TLD-100 as the unit. In the Chapter 1, the fundamental structure of the matter is described, making emphasis in the different radiation types, and their interaction with this. In the Chapter 2, the units are described but used in the dosimetry of the radiation. In the Chapter 3, the basic concepts of the phenomenon of Tl are described and those are explained characteristic of the deconvolution method to determine the kinetics of the one phenomenon. In the Chapter 4, the methodology is detailed that was used in the elaboration of this thesis work, describing the material Tl that were considered like reference, as well as the sources of ionizing radiation, with those that the dosemeters were irradiated and the equipment in the one that the curves Tl was obtained. Reference is made to the software used to carry out the deconvolution of the curves Tl that were obtained in the one experimental development. In the Chapter 5, the obtained results of this study are presented, showing the tables of homogenization of dosemeters and the reading of the same one; they are observed the curves Tl obtained to different radiation doses (alpha, beta and gamma), the intensity Tl in function of the dose. Also they are tabulated, the obtained results in the kinetic parameters of the three different study materials (TLD-100H, USA; TLD-100, USA and LiF: Mg, Cu, P + Ptfe developed in the l.N.l.N). They are analyzed shortly for each material Tl their sensitivity to the ionizing radiation as well as their kinetic parameters. The obtained results showed that the Tl dosemeters of LiF: Mg,Cu,P + Ptfe, they presented a bigger sensitivity that the TLD-100 when
International Nuclear Information System (INIS)
Sasaki, Akira
1996-01-01
Dual single photon emission computed tomography (SPECT) was performed in 30 patients with Duchenne's muscular dystrophy (DMD) using 201 thallium (Tl) for myocardial perfusion 123 I-β-methyl-p-iodophenylpentadecanoic acid (BMIPP) for myocardial fatty acid metabolism scintigraphy. The left ventricle was divided into 9 regions, and accumulation of the radiotracers was assessed visually for each region to calculate defect score for each tracer. There was some degree of decrease in the myocardial accumulation of both tracers in all DMD patients. Reduced accumulation was most common at the apex (BMIPP, 70%; Tl, 63%), followed by the posterior wall, lateral wall, and anterior wall. It was less common on the apical side of the ventricular septum for both tracers (BMIPP, 3%; Tl, 17%). Accumulation of Tl was lower than BMIPP in 18/30 patients (60%) and higher in 9 (30%), while both tracers showed equal accumulation in 3 (10%). BMIPP showed higher accumulation than Tl in all regions but the septum. A significant negative correlation was found between the defect scores for both tracers and the left ventricular ejection fraction (LVEF) (r=-0.629 for Tl; r=-0.567 for BMIPP). The strongest negative correlation was that between the sum of the Tl and BMIPP defect scores and the LVEF (r=-0.681). Dual SPECT myocardial scintigraphy with Tl and BMIPP provided an accurate evaluation of the progression of cardiac lesions in DMD by detecting abnormalities of the myocardial metabolism of each substance thereby enabling the assessment of left ventricular function. (author)
Results from an investigation of the physical origins of nonproportionality in CsI(Tl)
Asztalos, S.; Hennig, W.; Warburton, W. K.
2011-10-01
The relative scintillation response per energy deposited by Compton electrons, or nonproportionality, has traditionally been considered an intrinsic scintillator property. However, such an interpretation is inconsistent with recent results that show nonproportionality to depend on external factors such as shaping time, temperature and supplier. Apparently, at least some of the overall nonproportionality has an extrinsic origin. In this work we describe the results from a suite of measurements designed to test the hypothesis that nonproportionality in CsI(Tl) material has an extrinsic component that correlates with impurity levels. Our choice of material was motivated by the excellent energy resolution observed in one bulk crystal (6.4%)—a marked departure from that measured with conventional CsI(Tl) stock (8-8.5%). Six bulk CsI(Tl) crystals were procured and diced into 44 wafers. Using X-ray fluorescence techniques no conclusive evidence for impurities was found in any of the wafers at the 1-50 ppm level. One crystal exhibited a distinct correlation among energy resolution, decay lifetimes, nonproportionality and a very low level of Tl doping.
Results from an investigation of the physical origins of nonproportionality in CsI(Tl)
International Nuclear Information System (INIS)
Asztalos, S.; Hennig, W.; Warburton, W.K.
2011-01-01
The relative scintillation response per energy deposited by Compton electrons, or nonproportionality, has traditionally been considered an intrinsic scintillator property. However, such an interpretation is inconsistent with recent results that show nonproportionality to depend on external factors such as shaping time, temperature and supplier. Apparently, at least some of the overall nonproportionality has an extrinsic origin. In this work we describe the results from a suite of measurements designed to test the hypothesis that nonproportionality in CsI(Tl) material has an extrinsic component that correlates with impurity levels. Our choice of material was motivated by the excellent energy resolution observed in one bulk crystal (6.4%)-a marked departure from that measured with conventional CsI(Tl) stock (8-8.5%). Six bulk CsI(Tl) crystals were procured and diced into 44 wafers. Using X-ray fluorescence techniques no conclusive evidence for impurities was found in any of the wafers at the 1-50 ppm level. One crystal exhibited a distinct correlation among energy resolution, decay lifetimes, nonproportionality and a very low level of Tl doping.
International Nuclear Information System (INIS)
Maeno, Masakazu; Matsuo, Takeshi; Imamura, Takurou; Koiwaya, Yasushi; Eto, Tanenao; Nagamachi, Shigeki; Jinnouchi, Seishi
2001-01-01
We carried out stress 201 Tl (Tl) and rest 99m Tc-tetrofosmin (TF) myocardial scintigraphy with dual energy acquisition in 24 patients with suspected ischemic heart disease performed coronary arteriography and elucidated the sensitivity of this method. One hour after light meal eating, TF (555 MBq) was injected intravenously at rest and after 3 minutes from injection of TF exercise or pharmacologic stress was performed. During stress Tl (111 MBq) was injected intravenously before end-point or at adequate point of pharmacologic stress. Dual energy acquisition using triple energy windows (TEW) was started after 5 minutes (early) and 4 hours (delayed) from stress. The sensitivity (Sn), specificity (Sp) and accuracy (Ac) in diagnosis of non-infarcted branches by using Tl (early)-TF (rest) and Tl (early)-Tl (delayed) were 79% vs. 53% (Sn), 78% vs. 96% (Sp) and 79% vs. 71% (Ac) respectively. Accordance of uptake score of infarcted region between TF (rest) and Tl (delayed) was 70%. In conclusion, this protocol is seemed to be useful as usual protocol for detection of myocardial ischemia and viability during about only 1 hour. (author)
Directory of Open Access Journals (Sweden)
R.P. Singh
2014-12-01
Full Text Available To study the structural, electronic and thermodynamic behavior of CeMgTl, full-potential linear augmented plane wave plus local orbital (FP-LAPW + lo method has been used. The lattice parameters (a0, c0, bulk modulus (B0 and its first order pressure derivative (B0′ have been calculated for CeMgTl. Band structure and density of states histograms depicts that “5d” orbital electrons of Tl have dominant character in the electronic contribution to CeMgTl. Impact of the temperature and pressure on unit cell volume, bulk modulus, Debye temperature, Grüneisen parameter, specific heat and thermal expansion coefficient (α have been studied in wide temperature range (0–300 K and pressure range (0–15 GPa.
Dielectric Losses and Charge Transfer in Antimony-Doped TlGaS2 Single Crystal
Asadov, S. M.; Mustafaeva, S. N.
2018-03-01
Effect of semimetallic antimony (0.5 mol % Sb) on the dielectric properties and ac-conductivity of TlGaS2-based single crystals grown by the Bridgman-Stockbarger method has been studied. The experimental results on the frequency dispersion of dielectric coefficients and the conductivity of TlGa0.995Sb0.005S2 single crystals allowed the revealing of the dielectric loss nature, the charge transfer mechanism, and the estimation of the parameters of the states localized in the energy gap. The antimony-doping of the TlGaS2 single crystal leads to an increase in the density of states near the Fermi level and a decrease in the average time and average distance of hopes.
International Nuclear Information System (INIS)
Matsumura, Kentaro; Nakase, Emiko; Haiyama, Tohru; Hasegawa, Akira; Saito, Takayuki
1992-01-01
To clarify the coronary hemodynamics and myocardial perfusion in patients with vasospastic angina, we performed exercise 201 Tl-myocardial scintigraphy (planar and SPECT) in 72 patients and left coronary digital subtraction angiography (DSA) in 37 patients without significant organic coronary artery stenosis. Coronary artery spasm was documented by coronary angiography in all patients. Fifty-four patients (75%) developed exercise-induced 201 Tl-myocardial perfusion defect on SPECT. 201 Tl pulmonary uptake (L/H) was significantly increased in patients with vasospastic angina. Especially, L/H was higher in patients with multiple small perfusion defect on 201 Tl-SPECT, so that exercise-induced left ventricular dysfunction existed in patients with vasospastic angina and especially in cases of multiple small perfusion defect on 201 Tl-SPECT. The left coronary circulation time (CCT) was prolonged in patients with vasospastic angina. The mechanism of prolonged CCT is still unknown, but we suspected that prolonged CCT was induced by increased peripheral coronary vascular resistance in patients with vasospastic angina. It was concluded that the peripheral coronary circulation was disturbed in patients with vasospastic angina, but its abnormal coronary circulation had no relation to location of spasm-induced vessels. We concluded that impaired coronary microcirculation was taken a part of pathophysiology in vasospastic angina. (author)
Comparison of laboratory and in situ evaluation of environmental TL dosimeters
International Nuclear Information System (INIS)
Deme, S.; Apathy, I.; Feher, I.; Osvay, M.
1996-01-01
The passive environmental gamma-radiation dosimetry is mainly based on TL (thermoluminescent) dosimetry. This method offers considerable advantages due to its high precision, low cost, wide range, etc.. At the same time its application involves uncertainty caused by the dose collected during the transport from the point of annealing to the place of exposure and back to the place of evaluation. Should an accident occur read-out is delayed due to the need to transport to a laboratory equipped with a TLD reader. A portable reader capable of reading out the TL dosimeter at the place of exposure (in situ TLD reader) eliminates the disadvantages mentioned above. A microprocessor based portable TLD reader was developed by us for monitoring environmental gamma-radiation doses. Using a portable reader for in situ evaluation there are several disadvantages as well. The method requires the transport of the reader instead of dosimeters. The portable reader should be battery operated with low power consumption. Due to this requirement the temperature stabilization of the reader requests different solution as in laboratory type devices. Comparison of recently developed in situ and traditional laboratory evaluation methods of environmental TL dosimeters is given in recent paper. The comparison was made in the same conditions. The most characteristic - for environmental monitoring - numerical TL data (dose range, reproducibility, fading, self dose etc.) are given for manufactured by us CaSO 4 :Dy bulbs (portable reader) and very advantageous, high sensitive Al 2 O 3 :C dosimeters (laboratory evaluation). (author)
Liu, Juan; Luo, Xuwen; Wang, Jin; Xiao, Tangfu; Chen, Diyun; Sheng, Guodong; Yin, Meiling; Lippold, Holger; Wang, Chunlin; Chen, Yongheng
2017-05-01
Thallium (Tl) is a highly toxic rare element. Severe Tl poisoning can cause neurological brain damage or even death. The present study was designed to investigate contents of Tl and other associated heavy metals in arable soils and twelve common vegetables cultivated around a steel plant in South China, a newly-found initiator of Tl pollution. Potential health risks of these metals to exposed population via consumption of vegetables were examined by calculating hazard quotients (HQ). The soils showed a significant contamination with Tl at a mean concentration of 1.34 mg/kg. The Tl levels in most vegetables (such as leaf lettuce, chard and pak choy) surpassed the maximum permissible level (0.5 mg/kg) according to the environmental quality standards for food in Germany. Vegetables like leaf lettuce, chard, pak choy, romaine lettuce and Indian beans all exhibited bioconcentration factors (BCF) and transfer factors (TF) for Tl higher than 1, indicating a hyperaccumulation of Tl in these plants. Although the elevated Tl levels in the vegetables at present will not immediately pose significant non-carcinogenic health risks to residents, it highlights the necessity of a permanent monitoring of Tl contamination in the steel-making areas. Copyright © 2017 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Rubio, T.; Sillano, O.; Espinoza, J.; Roman, A.; Deza, A.
1992-01-01
TL measurements, of irradiated and unirradiated strawberries were carried out, using peel, seeds (achenes), leaves and sediment. The four types of samples presented a different thermoluminescence response. The best results were obtained with sediment removed from the soil of the fruit surface. It is concluded that TL is a promising technique for detecting irradiated strawberries using sediment samples. (author)
$\\beta$-decay study of neutron-rich Tl and Pb isotopes
It is proposed to study the structure of neutron-rich nuclei beyond $^{208}$Pb. The one-proton hole $^{211-215}$Tl and the semi magic $^{213}$Pb will be produced and studied via nuclear and atomic spectroscopy searching for long-lived isomers and investigating the $\\beta$-delayed $\\gamma$- emission to build level schemes. Information on the single particle structure in $^{211-215}$Pb, especially the position of the g$_{9/2}$ and i$_{11/2}$ neutron orbitals, will be extracted along with lifetimes. The $\\beta$-decay will be complemented with the higher spin selectivity that can be obtained by resonant laser ionization to single-out the decay properties of long-living isomers in $^{211,213}$Tl and $^{213}$Pb.
Hyper- and hypobaric processing of Tl-Ba-Ca-Cu-O superconductors
Goretta, K. C.; Routbort, J. L.; Shi, Donglu; Chen, J. G.; Hash, M. C.
1989-11-01
Tl-based superconductors of initial composition Tl:Ca:Ba:Cu equal to 2:2:2:3 and 1:3:1:3 were heated in oxygen at pressures of 10(sup 4) to 6 (times) 10(sup 5) Pa. The 2:2:2:3 composition formed primarily the 2-layer superconductor with zero resistance from 77 to 104 K. The 1:3:1:3 composition formed nearly phase pure 3-layer superconductor with a maximum zero resistance temperature of 120 K. Application of hyperbaric pressure influenced phase purities and transition temperatures slightly; phase purities decreased significantly with application of hypobaric pressures.
Performance of a high-resolution CsI(Tl)-PIN readout detector
International Nuclear Information System (INIS)
Kudenko, Yu.G.; Imazato, J.
1992-10-01
A study of a large-volume CsI(Tl) detector with a PIN diode readout was carried out. Our results show a light output of ≤20000 photoelectrons/MeV, an equivalent noise charge (rms) of about 900 electrons, and an equivalent noise level of ≤ 60 keV. We obtained an energy resolution of 11.2% (fwhm) for 1275 keV gamma rays from a 22 Na source. The characteristics of the PIN - preamplifier system as well as the parameters of a small CsI(Tl) - PIN detector with a direct and wavelength shifter readout are also reported. (author)
DEFF Research Database (Denmark)
Zhang, Zhe; Thomsen, Ole Cornelius; Andersen, Michael A. E.
2011-01-01
In this paper, a circuit-level decoupling modulation strategy is proposed for the three-level (TL) neutral-point-clamped (NPC) inverters. With the proposed modulation scheme, the TL-NPC inverter can be decoupled into two three-level Buck converters in each defined operating section, which makes...
International Nuclear Information System (INIS)
Leung, P.L.; Tang Qiang; Li, Mike; Zhang Chunxiang
2005-01-01
The single-aliquot regenerative-dose (SAR) protocol with optically stimulated luminenscence (OSL) was applied to measure the equivalent dose (ED) of ancient Chinese bricks ranging in age from 180 to 1600 years. In the protocol, sensitivity changes can be corrected by using OSL response to a fixed test dose during measurement. For comparative study between OSL and TL, thermoluminescence (TL) measurement procedures were also applied to determine the paleodose of the bricks. Both results of OSL and TL are in agreement with the known ages of the bricks, and the paleodose ratios(ED OSL / ED TL ) are between 0.96 and 1.21, mean value 1.08+/-0.02. The annual doses of the bricks, estimated by the paleodoses and the known ages, range from 5.07 to 6.79mGy/a, comparable with the measured annual dose values of the bricks. Therefore, it is concluded that the SAR protocol is a rapid and effective OSL technique to authenticate Chinese bricks
A comparative study between OSL and TL techniques for the dating of ancient chinese bricks
International Nuclear Information System (INIS)
Leung, P.L.; Li, M.; Tang Qiang; Zhang Chunxiang
2004-01-01
The single-aliquot regenerative-dose (SAR) protocol to the optically stimulated luminescence (OSL) was applied to measure the paleodose of ancient Chinese bricks with an age range from 180 to 1600 years. In the protocol, sensitivity changes can be corrected by using OSL response to a fixed test dose during measurement. For comparative study between OSL and TL, thermoluminescence (TL) measurement procedures were also applied to determine the paleodose of the bricks. Both results of OSL and TL are in good agreement with, and the paleodose ratios (De OSL /De TL ) are between 0.96 and 1.21, with a mean value of 1.08 ± 0.07. The annual dose of the bricks, estimated by the paleodoses and the known ages, ranges from 5.07 to 6.85 mGy/a, comparable with the measured annual dose values. Therefore, it is concluded that the SAR protocol is a rapid and effective OSL technique to authenticate Chinese bricks. (authors)
Akhmedova, A. M.
2018-04-01
The behavior of an electronic subsystem is investigated in the course of formation and development of a memory channel in solid solutions of the TlInTe2-TlYbTe2 system. An analysis of the current-voltage characteristics allows getting an insight into the reason for a sharp change in electrical conductance of the specimens under study during their transition from the high-resistance to high-conductance state and the reasons for the well known instability of threshold converters, which makes it possible to design devices with high threshold voltage stability.
Radiation exposure around patients after 201Tl-myocardial scintigraphy
International Nuclear Information System (INIS)
Kurtaran, A.; Preitfellner, J.; Kohoutek, D.; Tousek, A.; Virgolini, I.; Havlik, E.
1997-01-01
Aim: It was the aim of the study to assess the additional radiation exposure to patients, attendents and nurses by patients who are undergoing nuclear medicine investigations (myocardial scintigraphy) with 201 Tl-chloride ( 201 Tl-Cl). Methode: In 16 cases the dose rates at 0.5, 1 and 2 m distance from patients were measured at 0.5, 1.5, 3-4 and 24, in some cases until 370 h after administration of 100±10 MBq 201 Tl-Cl. From the time courses of the dose rates around the patients the possible radiation exposure of other persons were estimated. Results: The initial values of the dose rate were 3.82 μSv/h at 0.5 m, 1.18 μSv/h at 1 m and 0.30 μSv/h at 2 m distance from the patients respectively. The dose rates were decreasing following a monoexponential course with an effective half-life of 60 h. The maximum doses to other persons at 1 m distance from the patients were determined by considering three scenarios. The values were 13 μSv in the waiting room, 26 μSv for nurses working in the ward and 105 μSv for persons living in the same household. Conclusion: Even at very restrictive assumptions the doses were far below the maximum permissible dose to non-radiation workers set by radiation protection regulations (1.5 mSv per year). (orig.) [de
Directory of Open Access Journals (Sweden)
Dunya Mahammad Babanly
2017-01-01
Full Text Available The solid-phase diagram of the Tl-TlBr-S system was clarified and the fundamental thermodynamic properties of Tl6SBr4 compound were studied on the basis of electromotive force (EMF measurements of concentration cells relative to a thallium electrode. The EMF results were used to calculate the relative partial thermodynamic functions of thallium in alloys and the standard integral thermodynamic functions (-ΔfG0, -ΔfH0, and S0298 of Tl6SBr4 compound. All data regarding thermodynamic properties of thallium chalcogen-halides are generalized and comparatively analyzed. Consequently, certain regularities between thermodynamic functions of thallium chalcogen-halides and their binary constituents as well as degree of ionization (DI of chemical bonding were revealed.
Correlation between TL and OSL signals in KMgF3:Ce3+: Bleaching study of individual glow-peaks
International Nuclear Information System (INIS)
Dallas, G.I.; Polymeris, G.S.; Afouxenidis, D.; Tsirliganis, N.C.; Tsagas, N.F.; Kitis, G.
2010-01-01
KMgF 3 :Ce 3+ is an ultra sensitive Thermoluminescence (TL) material with a complex TL and OSL glow-curve structure. The aim of the present work is to attempt a one-to-one correspondence between specific TL glow-peaks and OSL components in KMgF 3 :Ce 3+ . The correlation study involves the deconvolution of the TL curves and the estimation of the bleaching decay constants for individual glow-peaks followed by the deconvolution of the LM-OSL curve using the estimated decay constants. It was found that the bleaching of each individual glow-peak takes place in three different rates; namely in a fast, medium and slow rate.
Noise in NC-AFM measurements with significant tip–sample interaction
Directory of Open Access Journals (Sweden)
Jannis Lübbe
2016-12-01
Full Text Available The frequency shift noise in non-contact atomic force microscopy (NC-AFM imaging and spectroscopy consists of thermal noise and detection system noise with an additional contribution from amplitude noise if there are significant tip–sample interactions. The total noise power spectral density DΔf(fm is, however, not just the sum of these noise contributions. Instead its magnitude and spectral characteristics are determined by the strongly non-linear tip–sample interaction, by the coupling between the amplitude and tip–sample distance control loops of the NC-AFM system as well as by the characteristics of the phase locked loop (PLL detector used for frequency demodulation. Here, we measure DΔf(fm for various NC-AFM parameter settings representing realistic measurement conditions and compare experimental data to simulations based on a model of the NC-AFM system that includes the tip–sample interaction. The good agreement between predicted and measured noise spectra confirms that the model covers the relevant noise contributions and interactions. Results yield a general understanding of noise generation and propagation in the NC-AFM and provide a quantitative prediction of noise for given experimental parameters. We derive strategies for noise-optimised imaging and spectroscopy and outline a full optimisation procedure for the instrumentation and control loops.
ORF Sequence: NC_002695 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN
ORF Sequence: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME
ORF Sequence: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP
ORF Sequence: NC_002942 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME
ORF Sequence: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA
International Nuclear Information System (INIS)
Han, Y.; Li, H.; Tso, Y.W.
1999-01-01
A trap model is introduced to describe the behaviours of both thermally sensitive and radiation sensitive TL traps. The former are relatively shallow traps. The latter are deep traps, in which population increases with exposure to alpha dose. Thermal decay of both types of traps at ambient temperature is dependent on the trap lifetimes. A trap's population can be measured as TL sensitivity to a laboratory test dose. The trap model has been supported by observations of age dependent TL signals from granitic quartz samples with different crystallisation ages. The trap lifetimes are from 1.98 x 10 9 to 5.36 x 10 15 years estimated using the isothermal decay experiment with the assumption of first order kinetics. Dating techniques are proposed based on the trap model. For old granites (>400 Ma), ages can be obtained by measuring the total exposed alpha dose using the additive alpha dose method, whereas for young granites (<400 Ma), ages can also be obtained by interpolating the TL sensitivity to a curve of TL sensitivities for known ages. (author)
Tsipis, Athanassios C; Gkekas, George N
2013-06-21
The molecular, electronic, bonding and photophysical properties of a series of inorganic metallocenes with the general formula {[Pt3(μ2-L)3(L')3]2(μ6-Tl)}(+) (L = CO, CH3CN, PH2, C6F5, or SO2 and L' = CO, PH3, CH3CN, C6F5) have been studied by means of DFT electronic structure calculations. The estimated Tl-cd distances between Tl(+) cations and the centroids (cd) of the trimetallic Pt3(μ2-L)3(L')3 {3 : 3 : 3} decks were found in the range 2.932-3.397 Å. The predicted bond dissociation energy, D0, of the (c-Pt3)···Tl(+) bonds was found to lie within the range -31.5 up to -77.5 kcal mol(-1) at the B3LYP/LANL2TZ(f)(Pt) ∪ 6-31G(d,p)(E) ∪ SRLC(Tl) level of theory. Most of the [(c-Pt3)Tl(c-Pt3)](+) inorganic metallocenes adopt a bend titanocene-like structure. The Localized Orbital Locator (LOL) contour maps along with the 3D contour plots of the Reduced Gradient Density (RDG) mirror the composite nature of the interaction of Tl(+) with the triangular Pt3 metallic ring cores consisting of electrostatic, covalent and dispersion interaction components. The Pt3···Tl(+)···Pt3 bonding mode was further validated by Energy Decomposition Analysis (EDA) calculations which demonstrated that the electrostatic and covalent components of the interaction contribute almost equally to the bonding interactions. Furthermore, Charge Decomposition Analysis (CDA) and Natural Bond Orbital Analysis (NBO) calculations indicated that charge transfer from the Tl(+) cation to the Pt3(0) {3 : 3 : 3} decks also occurs. The {[Pt3(μ2-L)3(L')3]2(μ6-Tl)}(+) sandwiches absorb in the UV-Vis region (300-500 nm) and emit in the visible-near IR region (600-1000 nm). The absorption bands are mainly of MLCT/MC character while phosphorescence is predicted to occur via the first triplet excited state, T1, since the spin density of this excited state could be described as a SOMO - 1/SOMO combination. Generally, no significant distortions occur upon excitation of these systems
Silicon drift detectors coupled to CsI(Tl) scintillators for spaceborne gamma-ray detectors
International Nuclear Information System (INIS)
Marisaldi, M.; Fiorini, C.; Labanti, C.; Longoni, A.; Perotti, F.; Rossi, E.; Soltau, H.
2006-01-01
Silicon Drift Detectors (SDDs), thanks to their peculiar low noise characteristics, have proven to be excellent photodetectors for CsI(Tl) scintillation light detection. Two basic detector configurations have been developed: either a single SDD or a monolithic array of SDDs coupled to a single CsI(Tl) crystal. A 16 independent detectors prototype is under construction, designed to work in conjunction with the MEGA Compton telescope prototype under development at MPE, Garching, Germany. A single SDD coupled to a CsI(Tl) crystal has also been tested as a monolithic detector with an extended energy range between 1.5 keV and 1 MeV. The SDD is used as a direct X-ray detector for low energy photons interacting in silicon and as a scintillation light photodetector for photons interacting in the crystal. The type of interaction is identified by means of pulse shape discrimination technique. Detectors based on an array of SDDs coupled to a single CsI(Tl) crystal have also been built. The readout of these detectors is based on the Anger camera technique, and submillimeter spatial resolution can be achieved. The two detectors' approaches and their applications will be described
International Nuclear Information System (INIS)
Costentin, G.; Borel, M.M.; Grandin, A.; Leclaire, A.; Raveau, B.
1991-01-01
Thallium molybdenum triphosphate, TlMo 2 P 3 O 13 , M r =679.16, monoclinic, P2 1 /c, a=9.7536 (3), b=19.0640 (16), c=6.3945 (7) A, β=107.099 (7) 0 , V=1136 (2) A 3 , Z=4, D m not measured, D x =4.08 Mg m -3 , λ(MoKα)=0.71073 A, μ=16.90 mm -1 , F(000)=314, T=293 K, 951 reflections, R=0.047, ωR=0.047. The lattice is built up from MoO 6 , PO 4 and P 2 O 7 groups delimiting tunnels where the Tl + ions are located. The title compound is isotyopic with β-KMo 2 P 3 O 13 . (orig.)
New Seeds are Resistant to Wheat Stem Rust (Ug99) Multinational Programme Supported by FAO and IAEA
International Nuclear Information System (INIS)
2013-01-01
Full text: A multinational effort supported by the International Atomic Energy Agency and the U.N. Food and Agriculture Organization marked a key milestone this week when a Kenyan university debuted two new varieties of disease-resistant wheat to the nation's farmers. Over the past two days, thousands of Kenyan farmers have visited Eldoret University in western Kenya for a two-day agriculture fair highlighting the latest farming technologies. Supporting the development of the new varieties were the IAEA's Technical Cooperation Department and the Joint FAO/IAEA Programme of Nuclear Techniques in Food and Agriculture. They manage an interregional Technical Cooperation project to develop varieties of wheat that are resistant to a devastating type of fungus, causing a disease known as wheat stem rust. Wheat stem rust under control for over 30 years, but a resurgence of the disease was discovered in 1999 in Uganda that swiftly spread to neighbouring Kenya. The wheat stem rust, caused by the strain of the fungus known as Ug99, named after its place and year of origin, has since spread to Iran, Yemen and South Africa and threatens crops as far away as India as spores are carried by wind. Parasitic rusts threaten global wheat production, reducing plant growth and crop yields. The disease can destroy up to 70-100 percent of the yield of wheat crop if not prevented. 'Improving food security in developing countries through the use of nuclear techniques is an important priority of the IAEA', said IAEA Director General Yukiya Amano. 'I am pleased that we have been able to make an important contribution to fighting wheat rust'. 'Wheat rusts, particularly the Ug99 strain, are a major threat to food security because rust epidemics can result in devastating yield losses. This international project involving affected countries, plant scientists and breeders and international organizations is a major breakthrough. It clearly shows the benefits of FAO/IAEA collaboration and that
Das, Debajyoti; Mondal, Praloy
2017-09-01
Growth of highly conducting nanocrystalline silicon (nc-Si) thin films of optimum crystalline volume fraction, involving dominant crystallographic preferred orientation with simultaneous low fraction of microstructures at a low substrate temperature and high growth rate, is a challenging task for its promising utilization in nc-Si solar cells. Utilizing enhanced electron density and superior ion flux densities of the high frequency (∼27.12 MHz) SiH4 plasma, improved nc-Si films have been produced by simple optimization of H2-dilution, controlling the ion damage and enhancing supply of atomic-hydrogen onto the growing surface. Single junction nc-Si p-i-n solar cells have been prepared with i-nc-Si absorber layer and optimized. The physical parameters of the absorber layer have been systematically correlated to variations of the solar cell parameters. The preferred alignment of crystallites, its contribution to the low recombination losses for conduction of charge carriers along the vertical direction, its spectroscopic correlation with the dominant growth of ultra-nanocrystalline silicon (unc-Si) component and corresponding longer wavelength absorption, especially in the neighborhood of i/n-interface region recognize scientific and technological key issues that pave the ground for imminent advancement of multi-junction silicon solar cells.
ORF Sequence: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT
ORF Sequence: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK
International Nuclear Information System (INIS)
Hoer, G.; Sebening, H.; Sauer, E.; Dressler, J.; Lutilsky, L.; Wagner-Manslau, C.; Bofilias, I.; Technische Univ. Muenchen
1979-01-01
Scans were performed on 8 healthy subjects and 25 with coronary heart disease proven by angiography and ventriculography including 6 with previous myocardial infarction at rest, exercise, and 1 and 2 h after exercise. Data were collected by a gamma camera interfaced to a data collection system. In healthy subjects 201 Tl distribution was homogeneous at rest and after exercise, the count rate ranging between 100% - as set in the region of maximum - and 80% over other regions of myocardium. In 19 patients with coronary heart disease it was uniform only at rest; 6 patients with previous myocardial infarction had locally diminished 201 Tl uptake even at rest. In patients with coronary heart disease without previous myocardial infarction, scans made immediately after exercise showed significant 201 Tl hypofixation in region of minimum, the count rate of which was less than 80% of the count rate as determined over region of maximum, 201 Tl uptake. Scans made 1 and 2 h after exercise had filling-in of 201 Tl within the region of minimum the count rate of which returned to the normal range of at least 80% of the count rate measured over region of maximum uptake. This return to resting distribution was called 201 Tl redistribution. Six patients with coronary heart disease and previous myocardial infarction had 201 Tl defects larger after exercise than at rest, without redistribution being observed. Redistribution in late postexercise scans is a sign of reversible ischemia in coronary heart disease. Scans at rest may be omitted in coronary heart disease, because transient ischemia is undetectable, unless spontaneous angina occurs during scan procedure. (orig.) [de
Effect of deep native defects on ultrasound propagation in TlInS{sub 2} layered crystal
Energy Technology Data Exchange (ETDEWEB)
Seyidov, MirHasan Yu., E-mail: smirhasan@gtu.edu.tr [Department of Physics, Gebze Technical University, 41400 Gebze, Kocaeli (Turkey); Institute of Physics of NAS of Azerbaijan, H. Javid Avenue, 33, AZ-1143 Baku (Azerbaijan); Suleymanov, Rauf A. [Department of Physics, Gebze Technical University, 41400 Gebze, Kocaeli (Turkey); Institute of Physics of NAS of Azerbaijan, H. Javid Avenue, 33, AZ-1143 Baku (Azerbaijan); Odrinsky, Andrei P. [Institute of Technical Acoustics, National Academy of Sciences of Belarus, Lyudnikov Avenue 13, Vitebsk 210717 (Belarus); Kırbaş, Cafer [Department of Physics, Gebze Technical University, 41400 Gebze, Kocaeli (Turkey); The Scientific and Technological Research Council of Turkey, National Metrology Institute (TUBITAK UME), PQ 54 41470 Gebze, Kocaeli (Turkey)
2016-09-15
We have investigated p-type semiconductor–ferroelectric TlInS{sub 2} by means of Photo-Induced Current Transient Spectroscopy (PICTS) technique in the temperature range 77–350 K for the detection of native deep defect levels in TlInS{sub 2}. Five native deep defect levels were detected and their energy levels and capture cross sections were evaluated. Focusing on these data, the influence of these defects on the longitudinal and transverse ultrasound waves propagation as well as the effect of electric field on ultrasound waves were studied at different temperatures. The acoustic properties were investigated by the pulse-echo method. The direct contribution of thermally activated charged defects to the acoustic properties of TlInS{sub 2} was demonstrated. The key role of charged native deep level defects in elastic properties of TlInS{sub 2} was shown.
Assessment of myocardial viability by exercise stress myocardial tomography with 201Tl
International Nuclear Information System (INIS)
Narita, Michihiro; Kurihara, Tadashi; Murano, Kenichi; Usami, Masahisa
1992-01-01
Exercise stress (Ex) and redistribution (RD) myocardial tomography with Tl-201 has been widely used for evaluating myocardial viability. But recent studies have demonstrated that reinjection (ReI) study following RD study is necessary for detecting reversible ischemic myocardium. On the other hand, decreased myocardial washout of Tl-201 after Ex is an indicator of myocardial ischemia. So we have studied the usefulness of myocardial Tl-201 washout rate (WOR) for the evaluation of myocardial viability by comparing it with ReI images. Ex and RD myocardial tomographies were obtained immediately after Ex and 3 hours later. After RD study a small amount of Tl-201 was injected and ReI imaging was repeated. We studied 64 myocardial segments (in 58 patients with coronary artery disease) in which Ex-induced perfusion defects persisted in RD images. According to the changes of perfusion defects between Ex, RD and ReI images, they were classified into 3 types: Type I; perfusion defect on the RD image was identical to ReI image (75%). Type I was divided into 2 subgroups whether perfusion defect at Ex was unchanged (Ia, 42%) or improved (Ib, 33%) on the RD image. Type II; perfusion defect at Ex was reduced on the RD image and it improved furthermore at ReI image (17%). Type III; perfusion defect was the same at Ex and RD but it was reduced on the ReI image (8%). WOR less than 30% was defined as abnormal when Ex heart rate exceeded 120 bpm and lung-myocardial Tl-201 uptake ratio was less than 0.45. The differentiation between Type Ia and Type III is of great importance. History of myocardial infarction, effort angina and Ex induced ST depression could not differentiate these 2 groups. WOR abnormality was observed in all of Type III, but WOR was normal in Type Ia. In conclusion, WOR abnormality in Ex-RD myocardial imaging is useful for evaluating myocardial viability. ReI imaging is necessary for the precise evaluation of viable muscle mass and for inadequate Ex. (author)
Dating archeological ceramics from the Valley of Vitor, Arequipa by the TL method
Cano, N. F.; Arizaca, E. C.; Yauri, J. M.; Arenas, J. S. A.; Watanabe, S.
The age of some ancient pottery from the Valley of Vitor in the region of Arequipa, Peru, is determined by the thermoluminescence (TL) method. For dating, a 325 °C TL peak was used and irradiation with γ-dose from 5 to 50 Gy was carried out for the additive method, and from 0.4 to 5 Gy for the regeneration method. For these dose values, the TL intensity is observed to grow linearly, obtaining an accumulated dose of 1.62±0.09 Gy and 1.36±0.03 Gy for the additive and regeneration methods, respectively. The age (A) of the sample was calculated by the two methods, being A=867±195 years after Christ (AC) for the additive method and A=1050±157 years AC for the regeneration method. Both results are within 800-1200 years AC, which is the period of the Wari culture.
Sequential change of cardiomyopathy of Duchenne muscular dystrophy by 201Tl myocardial SPECT
International Nuclear Information System (INIS)
Ono, Seiji; Sugimoto, Seiichirou; Inoue, Kenjirou; Jinnouchi, Seishi; Hoshi, Hiroaki; Watanabe, Katsushi.
1989-01-01
201 Tl myocardial SPECT were performed to evaluate of cardiomyopathy in Duchenne type of progressive muscular dystrophy (DMD). Follow up SPECT images of the same patients were also obtained about 1 year after the first scan. Cases subjected to study were 10 DMD. At the first study the hypoperfusion area of the left ventricular muscle were observed in 6 cases (60%) out of 10. At the second study the hypoperfusion areas became wider and lower in 4 out of 6 cases (66.7%). The new hypoperfusion area which was not demonstrated at the first study was observed at the second study in one case of these cases. These results suggested that the positive rate of cardiomyopathy in DMD by 201 Tl myocardial SPECT was high, and 201 Tl myocardial SPECT is a useful examination to detect the change of myocardial damage in DMD. (author)
ORF Sequence: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL
Tl response of KMgF3 :Lu+PTFE depending on the dose of gamma radiation of 60Co
International Nuclear Information System (INIS)
Lopez, A.; Gonzalez, P.R.; Furetta, C.; Azorin, J; Rivera, T.; Sepulveda, F.
2002-01-01
Due to the great interest in Tl dosimetry for measuring the levels of radiation doses, as environmental as in the different medical radiation applications in different laboratories of the World it is continued in the searching of new Tl materials with optimum dosimetric characteristics and low cost. In this work the obtained results when irradiating Tl dosemeters of KMgF 3 :Lu + PTFE with gamma radiation of 60 Co are presented. Such results showed that this material presents linearity of response depending on the dose between 0.016 to 100 Gy. Although it is continued with the characterization tests it is able to say that this Tl new material can be used for dosimetric aims. (Author)
Tsujimura, Kunio; Obata, Yuichi; Matsudaira, Yasue; Ozeki, Satoshi; Taguchi, Osamu; Nishida, Keiko; Okanami, Yuko; Akatsuka, Yoshiki; Kuzushima, Kiyotaka; Takahashi, Toshitada
2004-11-01
Mouse thymus-leukemia antigens (TL) are aberrantly expressed on T lymphomas in C57BL/6 (B6) and C3H/He (C3H) mice, while they are not expressed on normal T lymphocytes in these strains. When N-butyl-N-nitrosourea (NBU), a chemical carcinogen, was administered orally to B6 and C3H strains, lymphoma development was slower than in T3(b)-TL gene-transduced counterpart strains expressing TL ubiquitously as self-antigens, suggesting that anti-TL immunity may play a protective role. In addition, the development of lymphomas was slightly slower in C3H than in B6, which seems to be in accordance with the results of skin graft experiments indicating that both cellular and humoral immunities against TL were stronger in C3H than B6 mice. The interesting finding that B lymphomas derived from a T3(b)-TL transgenic strain (C3H background) expressing a very high level of TL were rejected in C3H, but not in H-2K(b) transgenic mice (C3H background), raises the possibility that TL-specific effector T cell populations are eliminated and/or energized to a certain extent by interacting with H-2K(b) molecules.
On clinical usefulness of Tl-201 scintigraphy for the management of malignant soft tissue tumors
International Nuclear Information System (INIS)
Terui, Shoji; Terauchi, Takashi; Abe, Hiroyuki; Fukuma, Hisatoshi; Beppu, Yasuo; Chuman, Koichi; Yokoyama, Ryohei
1994-01-01
The purpose of this study was to investigate Tl-201 as a tumor scanning agent in patients with malignant soft tissue sarcomas and to establish the sensitivity of this type of scintigraphy concerning local recurrences or metastases that may remain clinically suspected. Seventy-eight patients with malignant soft tissue sarcomas and 22 with benign soft tissue tumors were studied. Of these 78 malignant soft tissue sarcomas patients, the sensitivity of Tl-201 (81.2%) was higher than that of Ga-67 (68.8%). Thirty-three out of 78 patients received a total of 95 consecutive scintigraphic follow-up examinations. Therapeutic effects was assessed by comparing the results of Tl-201 examinations with the clinical findings. Of these 33 patients, the therapeutic effects observed were as follows: complete remission 1, partial remission 8, progress of disease 1, and no remarkable change 23. Tl-201 scintigraphy has proved itself very useful not only in clinically detecting the malignant soft tissue sarcomas and in assessing therapeutic effects on these diseases, but also in assessing the follow-up patients with malignant soft tissue sarcomas. (author)
Dosimetric characteristics of Li2B4O7:Cu,Ag,P solid TL detectors
International Nuclear Information System (INIS)
Proki, M.
2002-01-01
The main dosimetric characteristics are presented of newly prepared tissue-equivalent, highly sensitive thermoluminescent detector, Li 2 B 4 O 7 :Cu,Ag,P in the form of sintered pellets, developed at the Institute of Nuclear Sciences, Vin a . As a result of an advancement in the preparation procedure by the sensitising of basic copper activated lithium borate TL material, significant improvement in the TL sensitivity of Li 2 B 4 O 7 :Cu,Ag,P was gained. The glow curve of Li 2 B 4 O 7 :Cu,Ag,P consists of well defined main dosimetric peak situated at about 185-190 deg. C with the TL sensitivity which is about four to five times higher than that of LiF:Mg,Ti (TLD-100). From the experimental results a very wide linear dose response range, up to 10 3 Gy is evident. Dosimetric characteristics make sintered solid Li 2 B 4 O 7 :Cu,Ag,P TL detectors very promising for different dosimetry applications particularly in medical dosimetry and also for individual monitoring. (author)
Computerized study with 201Tl of the gold thyroid node
International Nuclear Information System (INIS)
Palermo, F.; Saitta, B.; Coghetto, F.; Tiberio, M.; Caldato, L.
1982-01-01
Because of its physical and potassium-metabolic characteristics 201 Tl is more suitable than 131 Cs for radioisotopic studies of the cold thyroid nodule, with the further diagnostic possibility of quantitatively assessing intranodular behaviour for a specific differentiation among different kinds of neoformations. Using a gamma-camera on line with a computer data processing device, sequential scintiscans were recorded for the first 20-30 min after i.v. administration of 15-20 μCi/kg of radiothallium; delayed sequences were taken at 40-60 min if intranodular uptake appeared. A quantitative appraisal was made of the differential 201 Tl uptake-ratio between nodule and healthy thyroid tissue (density-index) and the multiparameter analysis of thyroid time/activity curves generated on the relative regions of interest (ROIs). This computerized study, in 120 out of 293 patients submitted to this radiothallium test, has shown a) diagnostic agreement between clinical-histological and radioisotopic findings in 76 out of 79 colloid-cystic or degenerative neoformations, in all 16 malignant and in 23 out of 25 hyperplastic benign nodules; b) significant statistical difference of the density-index in solid versus cystic but not between benign and malignant nodules; c) different 201 Tl kinetics behaviour in different kinds of solid thyroid lesions with a satisfactory statistical difference of the radiothallium nodular dissappearance-index. (orig.) [de
ORF Sequence: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS
ORF Sequence: NC_003280 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST
A Novel Type of Non-coding RNA, nc886, Implicated in Tumor Sensing and Suppression
Directory of Open Access Journals (Sweden)
Yong Sun Lee
2015-06-01
Full Text Available nc886 (=vtRNA2-1, pre-miR-886, or CBL3 is a newly identified non-coding RNA (ncRNA that represses the activity of protein kinase R (PKR. nc886 is transcribed by RNA polymerase III (Pol III and is intriguingly the first case of a Pol III gene whose expression is silenced by CpG DNA hypermethylation in several types of cancer. PKR is a sensor protein that recognizes evading viruses and induces apoptosis to eliminate infected cells. Like viral infection, nc886 silencing activates PKR and induces apoptosis. Thus, the significance of the nc886:PKR pathway in cancer is to sense and eliminate pre-malignant cells, which is analogous to PKR's role in cellular innate immunity. Beyond this tumor sensing role, nc886 plays a putative tumor suppressor role as supported by experimental evidence. Collectively, nc886 provides a novel example how epigenetic silencing of a ncRNA contributes to tumorigenesis by controlling the activity of its protein ligand.
76 FR 29645 - Safety Zone, Newport River; Morehead City, NC
2011-05-23
...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...
76 FR 18669 - Safety Zone, Newport River; Morehead City, NC
2011-04-05
...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...
76 FR 38018 - Safety Zone, Newport River; Morehead City, NC
2011-06-29
...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...
76 FR 23227 - Safety Zone, Newport River; Morehead City, NC
2011-04-26
...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...
Firing temperature of pottery using TL and OSL techniques
International Nuclear Information System (INIS)
Polymeris, G.S.; Sakalis, A.; Papadopoulou, D.; Dallas, G.; Kitis, G.; Tsirliganis, N.C.
2007-01-01
Several methods of thermal analysis are used to determine in the laboratory the firing temperature of ancient ceramic sherds. These methods are based primarily on changes of physical characteristics occurring when clay minerals are heated. The luminescence properties of quartz grains in a ceramic matrix also undergo certain changes during firing. The possibility of measuring the sensitivity change (sensitization) of quartz in order to determine the firing temperature of archeological ceramic artifacts was investigated. The sensitivity change was studied for both the thermoluminescence (TL) and the optically stimulated luminescence (OSL) signal for a ceramic sample of known firing temperature. Various segments of the sample were annealed to a different temperature. Subsequently, the initial sensitivity, as well as the thermal and the pre-dose sensitization were measured for both TL and OSL at room temperature as a function of the annealing temperature. The obtained TL glow curves showed different shapes for annealing temperatures above the firing temperature. Thermal and pre-dose sensitizations also exhibited a similar, although less prominent, rise. The OSL signal was analyzed by integrating the raw signal over the initial second of stimulation. The initial sensitivity showed an abrupt change for annealing temperatures around the firing temperature. An alternative approach used for the analysis of the OSL signal involved a full-component resolved sensitization study. The same abrupt change for the initial sensitivity of both the first and second components was observed, as well as, a clear but not very prominent thermal sensitization trend for annealing temperatures above the firing temperature
ORF Sequence: NC_003279 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ
International Nuclear Information System (INIS)
Polymeris, George S.; Afouxenidis, Dimitrios; Raptis, Spyridoula; Liritzis, Ioannis; Tsirliganis, Nestor C.; Kitis, George
2011-01-01
Knowledge of the relative luminescence response to alpha and beta radiation is very important in TL and OSL dating. In the present study the relative alpha to beta response is studied in a sedimentary quartz sample, previously fired at 900 deg. C for 1 h, in the dose region between 1 and 128 Gy, for both thermoluminescence (TL) and linearly modulated optically stimulated luminescence (LM - OSL). The LM - OSL measurements were performed at room temperature and at 125 deg. C. All OSL signals were deconvolved into their individual components. Comparison of OSL curves after alpha and beta irradiation strongly supports that quartz OSL components follow first order kinetics in both cases. In the case of TL, the relative alpha to beta response is found to be very different for each TL glow-peak, but it does not depend strongly on irradiation dose. In the case of LM - OSL measurements, it is found that the relative behaviour of the alpha to beta response is different for three distinct regions, namely the fast OSL component, the region of medium OSL component originating from the TL glow-peak at 110 deg. C when stimulation takes place at room temperature and finally the region of slow OSL component. Following stimulation at ambient temperature, the relative alpha to beta response of all components was not observed to depend significantly on dose, with the value of ratio being 0.03 and a tendency to decrease with increasing dose. However, in the case of measurements performed at 125 deg. C, the relative response of the fast components is much enhanced, and for the remaining components it increases with increasing dose. Special care must be taken to examine the relative alpha to beta response of the fast component at 125 deg. C which contrasts the relative response of the TL peak at ca. 325 deg. C. The implications for the dating of annealed quartz are also briefly discussed. - Highlights: → Relative alpha to beta response for TL and LM-OSL is studied in annealed
International Nuclear Information System (INIS)
Oster, L.; Druzhyna, S.; Orion, I.; Horowitz, Y.S.
2013-01-01
In this paper we discuss and compare the potential application of combined OSL/TL measurements using 6 LiF:Mg,Ti (TLD-600 is enriched of isotope 6 Li which has a high cross-section for the reaction with slow neutrons) or 7 LiF:Mg,Ti ( TLD-700 is enriched of 7 Li isotope) and TLD-100 (natural isotopic composition) detectors. The OSL/TL duel readout of LiF:Mg,Ti as an ionization density discriminator avoids some of the difficulties inherent to the various types of discrimination mixed-field passive dosimeters, and in addition has several advantages. The preferential excitation of OSL compared to TL following high ionization density (HID) alpha irradiation, naturally explained via the identification of OSL with the “two-hit” F 2 or F 3 center, whereas the major component of composite TL glow peak 5 is believed to arise from a ''one-hit'' complex defect. This evidence allows near-total discrimination between HID radiation and low-ionization density (LID) radiation. Beta and alpha particle irradiations were carried out with 90 Sr/ 90 Y (∼500 keV average energy) and 241 Am sources (4.7 MeV) respectively and neutron irradiations were carried out at the PTB (Germany) (E n = 5 MeV) and RARAF (Columbia University, USA) (E n = 6 MeV) accelerator facilities. The highest values of the FOM obtained was ∼30 for neutron/gamma discrimination and ∼110 for alpha/gamma discrimination using OSL/TL – peak 5 measurements in TLD-700. -- Highlights: ► The increased response of OSL compared to TL following HID irradiation is observed. ► This evidence is explained via the identification of OSL with the ''two-hit'' F2 centers. ► The potential application of combined OSL/TL in discrimination dosimetry is discussed. ► The values of FOM were 110 for alpha/gamma and 30 for neutron/gamma discrimination
Krasnodębska-Ostręga, Beata; Sadowska, Monika; Ostrowska, Sylwia
2012-05-15
Besides the dominant species in plants-Tl(I), noticeable amounts of Tl(III) (about 10% of total Tl content) were found in extracts of plants cultivated in the presence of tailing sediments, which are the main source of anthropogenic thallium already present in the environment. It is an important step of gaining knowledge about the detoxification mechanisms developed by Sinapis alba. This plant species is highly tolerant to Tl and it is able to cumulate high amounts of Tl and transport it into the above-ground organs. For more adequate estimation of accumulating abilities of S. alba, the elements' bioavailability was taken into consideration. The obtained bioconcentration factors of Cd (AF=0.6) and Zn (AF=1-2) were significantly lower than of Tl (AF=100-200). The biomass production was similar to the biomass of control cultivation. The results were based on ICP MS measurements of total elements' content and HPLC ICP MS for speciation analysis. The quality of obtained results was evaluated based on the intermethod comparison with voltammetry as a reference method. Comparison of data obtained using ICP MS and electrochemical methods (after a proper chemical treatment) was also used for indication of Tl(III) presence and for proving that Tl(I) was not transferred into Tl(III) during analytical procedures. Copyright © 2012 Elsevier B.V. All rights reserved.
Geology of the U12n.07 UG-3 drill hole, area 12, Nevada Test Site
International Nuclear Information System (INIS)
Terry, S.S.; Cunningham, M.J.
1975-11-01
The U12n.07 UG-3 horizontal drill hole, located near the eastern edge of the center of Rainier Mesa, Nevada Test Site, was drilled to a total depth of 809 m (2,653 ft). This hole was drilled to further evaluate the tunnel-level stratigraph, and structure southwest of the U12n tunnel complex. The drill hole is collared in the middle of Tertiary tunnel bed 3A and penetrates upsection through tunnel beds 3 and 4 and terminates in subunit 4K, all of Tertiary age. Stratigraphy, structure, engineering geology, and physical properties and their relation to tunnel engineering are discussed
First approval procedure of the TL dosimetric service of the NPP in Slovenia
International Nuclear Information System (INIS)
Janzekovic, H.; Krizman, M.; Pucelj, B.; Stuhec, M.; Zdesar, U.
2001-01-01
The individual dosimetry of exposed workers in a NPP is one of the essential parts which demonstrates the radiation protection standards achieved in a facility. According to the current legislation the Ministry of Health of the Republic of Slovenia has the authority to grant approvals to personal dosimetric services which perform the dosimetric monitoring of workers in Slovenia. Due to the fact that the detailed approval procedure is not given in national regulations, the Ministry of Health in 2000 established a group of experts with the task to prepare technical and organising requirements for such approval. Based on international documents [1,2,3] the Approval procedure for the thermoluminescence dosimetric (TL) services was created. Following this procedure the assessment of the TL dosimetric service in the NPP was performed. The problems related to the technical and organising requirements with the emphasise on the QA/QC criteria of the TL dosimetric service will be discussed.(author)
Effects of carboxylic acids on nC60 aggregate formation
International Nuclear Information System (INIS)
Chang Xiaojun; Vikesland, Peter J.
2009-01-01
The discovery that negatively charged aggregates of C 60 fullerene (nC 60 ) are stable in water has raised concerns regarding the potential environmental and health effects of these aggregates. In this work, we show that nC 60 aggregates produced by extended mixing in the presence of environmentally relevant carboxylic acids (acetic acid, tartaric acid, citric acid) have surface charge and morphologic properties that differ from those produced by extended mixing in water alone. In general, aggregates formed in the presence of these acids have a more negative surface charge and are more homogeneous than those produced in water alone. Carboxylic acid identity, solution pH, and sodium ion concentration, which are all intricately coupled, play an important role in setting the measured surface charge. Comparisons between particle sizes determined by analysis of TEM images and those obtained by dynamic light scattering (DLS) indicate that DLS results require careful evaluation when used to describe nC 60 aggregates. - The effects of carboxylic acids on the formation of nC 60 aggregates are discussed
ORF Sequence: NC_003909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP
ORF Sequence: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN
Giant Tc shift in HgBa2CaCu2O6+δ and TlBa2CaCu2O7-δ superconductors due to Hg-Tl exchange
International Nuclear Information System (INIS)
Gapud, A.A.; Wu, J.Z.; Kang, B.W.; Yan, S.L.; Xie, Y.Y.; Siegal, M.P.
1999-01-01
The irreversibility lines of epitaxial thin films of HgBa 2 CaCu 2 O 6+δ and TlBa 2 CaCu 2 O 7-δ , whether deduced from field-induced magnetoresistive broadening or onset of nonhysteretic magnetization, were found to coincide when plotted against reduced temperature, showing the same exponential-decay temperature behavior for T/T c c >0.8 (where T c is zero-field, zero-resistivity critical temperature). These results indicate that replacing Tl with Hg has no noticeable effect on the anisotropy and suggests that T c is not determined by anisotropy. copyright 1999 The American Physical Society
Kasa, Siti Norbaya; Omar, Mohd Firdaus; Ismail, Ismarul Nizam
2017-12-01
Nanocrystalline cellulose (NCC) was synthesized from banana stem through strong acid hydrolysis with measured length of approximately 287.0 ± 56.4 nm and diameter of 26.6 ± 4.8 nm. Modification of NCC was carried by acetylation reaction in order to increase the compatibility during reinforcement with polylactic acid (PLA) polymer. The reinforcing effect towards morphology, crystallinity, mechanical and thermal properties of bio-nanocomposites was investigated. Scanning Electron Microscope (SEM) micrograph reveals the uniform dispersion achieved at 1 %, 3 % and 5% aNC loading while agglomeration was found at 7 % aNC loading. Disappearance of crystallinity peak at 2θ = 22.7⁰ for low aNC loading during elemental analysis using X-Ray Diffraction (XRD) indicates the proper dispersion of aNC in PLA polymer. From the tensile test, 1 % aNC loading gives the highest mechanical properties of bio-nanocomposite film with 82.71 %, 118.7 % and 24.18 % increment in tensile strength, tensile modulus and elongation at break. However, 7 % aNC loading gives the highest increment in TGA of aNC-PLA nanocomposites which is from 310 °C to 320 °C.
Statistics and the additive dose method in TL dating
International Nuclear Information System (INIS)
Scott, E.M.
1988-01-01
Estimation of the palaeo-dose and its associated error in thermoluminescence (TL) dating requires assumptions to be made concerning the error structures of both the TL signal and dose. In this paper, we consider the sensitivity of palaeo-dose estimation to different error structures and describe techniques for estimation of the resultant palaeo-dose errors. We also indicate how the validity of the assumptions may be verified. We have taken the approach that procedures for the analysis of a glow curve at a single temperature must first be proved prior to their inclusion in a full analysis of the glow curves over a series of temperatures. Thus, the paper deals mainly with the analysis of the univariate structure of glow curves, i.e. estimation of the palaeo-dose and error at each temperature, but in the final section of the paper, we discuss briefly the multivariate structure of the results including automatic detection of plateau regions. (author)
Energy Technology Data Exchange (ETDEWEB)
McKillop, J.H.; McDougall, I.R.; Billingham, M.; Schroeder, J.S.
1982-06-01
Rest myocardial /sup 201/Tl scintigraphy was undertaken in 15 males mean age 39 years (22-54) who had been accepted for cardiac transplantation. Complete pathological correlation was obtained in 14 after transplantation and in 1 who died before a suitable donor heart became available. The average time from scintigraphy to pathological evaluation was 42 days (9-103). All the /sup 201/Tl images were grossly abnormal and on the basis of these studies it was not possible to differentiate ischemic from idiopathic cardiomyopathy. Each of the three views of the /sup 201/Tl study was divided into three segments, therefore 135 areas were available for comparison (3 x 3 x 15). Eighty-eight of these were abnormal on scan and 78 of these were abnormal pathologically. The right ventricle was seen on all rest images but the degree of uptake bore no relationship to the measured thickness of the right ventricular wall. Structures such as the atrial wall and the enlarged papillary muscle were visualized in some patients. In two patients there was an improvement of the rest /sup 201/Tl image in delayed views and histologically these areas showed a mixture of muscle and fibrous tissue. The sensitivity of /sup 201/Tl imaging in this study was 89% and there was close correlation of the images with gross and microscopic pathological findings.
International Nuclear Information System (INIS)
Ritchie, J.L.; Trobaugh, G.B.; Hamilton, G.W.; Gould, K.L.; Narahara, K.A.; Murray, J.A.; Williams, D.L.
1977-01-01
Myocardial imaging with intravenous thallium-201 ( 201 Tl) was performed at rest and following maximal treadmill exercise in 101 patients with suspected coronary artery disease. Results were interpreted from Polaroid scintiphotos by three independent observers with complete interobserver agreement in 79%. Of 25 patients with no or insignificant coronary artery disease ( 201 Tl image defect, one (4%) had an exercise 201 Tl defect, none had an ECG Q wave, and four (16%) had exercise ST-segment depression. Among 76 patients with coronary artery disease (greater than or equal to 50% diameter stenosis), 58 (76%) had a defect on either the rest or exercise 201 Tl image. The proportion of patients with an exercise image defect (50/76, 66%) was greater than the proportion with exercise ST depression alone (34/76, 45%; P 201 Tl is easily accomplished with readily available imaging equipment. The image data enhanced the diagnostic sensitivity of stress electrocardiography, and provided spatial identification of the abnormal segment(s) of myocardium
Perswazyjność komunikatów reklamowych w Internecie na podstawie analizy usług finansowych SKOK-ów
Idzik, Beata
2014-01-01
Praca jest wynikiem kilkuletnich obserwacji praktycznej strony funkcjonowania reklamy w zakresie usług finansowych. Autorka starała się oddać wyraz swojemu zainteresowaniu psychologią konsumenta, marketingiem w sektorze finansowym a także fascynacji możliwościom, jakie stwarzają w tym zakresie nowe technologie oparte na Internecie. Praca ma charakter teoretyczno - badawczy. W założeniach metodologicznych sformułowano problem badawczy, cele oraz cztery hipotezy badawcze, które poddano wery...
Measurement of conversion coefficients in 208Tl
International Nuclear Information System (INIS)
Wendling, F.
1976-06-01
A electron spectrometer composed by a Li drifted Si detector and a uniform magnetic field was constructed. The magnetic field is used to focus the electrons on the detector and to filter the other radiations. After the construction the instrument was calibrated in absolute eficience and was used together with a Ge(Li) spectrometer also calibrated, in the measurement of internal conversion coeficients of the 433 and 453 keV transitions in 208 Tl [pt
Design and Investigation of SST/nc-Si:H/M (M = Ag, Au, Ni and M/nc-Si:H/M Multifunctional Devices
Directory of Open Access Journals (Sweden)
A. F. Qasrawi
2013-01-01
Full Text Available Hydrogenated nanocrystalline Silicon thin films prepared by the very high frequency chemical vapor deposition technique (VHF-CVD on stainless steel (SST substrates are used to design Schottky point contact barriers for the purpose of solar energy conversion and passive electronic component applications. In this process, the contact performance between SST and M (M = Ag, Au, and Ni and between Ag, Au, and Ni electrodes was characterized by means of current-voltage, capacitance-voltage, and light intensity dependence of short circuit ( current and open circuit voltage ( of the contacts. Particularly, the devices ideality factors, barrier heights were evaluated by the Schottky method and compared to the Cheung's. Best Schottky device performance with lowest ideality factor suitable for electronic applications was observed in the SST/nc-Si:H/Ag structure. This device reflects a of 229 mV with an of 1.6 mA/cm2 under an illumination intensity of ~40 klux. On the other hand, the highest being 9.0 mA/cm2 and the of 53.1 mV were observed for Ni/nc-Si:H/Au structure. As these voltages represent the maximum biasing voltage for some of the designed devices, the SST/nc-Si:H/M and M/nc-Si:H/M can be regarded as multifunctional self-energy that provided electronic devices suitable for active or passive applications.
Synthesis and in vivo evaluation of 201Tl(III)-DOTA complexes for applications in SPECT imaging
Hijnen, N.M.; Vries, de A.; Blange, R.; Burdinski, D.; Grüll, H.
2010-01-01
Introduction The aim of this study was to assess the use of 201thallium3+ (201Tl3+) as a radiolabel for nuclear imaging tracers. Methods for labeling of 1,4,7,10-tetraazacyclododecane-N,N',N¿,N'¿ tetraacetic acid (DOTA) and diethylenetriaminepentaacetic acid (DTPA) chelators with 201Tl3+ were
International Nuclear Information System (INIS)
Auinger, M; Gritzner, G; Bertrand, Ch; Galez, Ph; Soubeyroux, J-L
2007-01-01
The formation pathway of (Tl 0.5 Pb 0.5 )(Sr 0.9 Ba 0.1 ) 2 Ca 2 Cu 3 O z and (Tl 0.5 Pb 0.5 )(Sr 0.8 Ba 0.2 ) 2 Ca 2 Cu 3 O z was studied by neutron and x-ray diffraction. The following reaction pathway was proposed: thallium oxide and lead oxide react with Sr-rich (Sr 1-x Ca x )CuO 2 and Ca-rich (Ca x Sr 1-x )O to form Sr 4 Tl 2 O 7 and (Ca x Sr 1-x )PbO 3 , respectively. The thallate and the plumbate compounds then form the (Tl 0.5 Pb 0.5 )-1212 phase starting at a temperature of 600 deg. C. Finally, between 850 and 900 deg. C, the 1223 phase is formed from (Tl 0.5 Pb 0.5 )-1212 (Ca x Sr 1-x ) 2 CuO 3 and CuO. Parallel experiments to fabricate the (Tl, Pb)-1223 superconductor resulted in specimens with critical temperatures of 117.5 K and 116 K, respectively, and transition widths of 2 K. Differences between the pathways for the formation of Pb-doped, Sr-rich and Pb-free, Ba-rich Tl-1223 superconductors are discussed
Enhancement of the superconducting properties of TlBa2CaCu2O7+δ thin films via postannealing
International Nuclear Information System (INIS)
Siegal, M.P.; Venturini, E.L.; Newcomer, P.P.; Morosin, B.; Overmyer, D.L.; Dominguez, F.; Dunn, R.
1995-01-01
The superconducting properties of TlBa 2 CaCu 2 O 7+δ (Tl-1212) films are greatly enhanced by annealing in unreactive ambients such as nitrogen at temperatures ranging from T a =250--600 degree C. The transition temperature, T c , of these Tl-1212 films as-grown in oxygen is 70 K. Annealing for 1 h at 250 degree C elevates T c above 90 K. T c further increases and sharpens for T a =600 degree C. In addition, subtle changes occur in the microstructure correlating with improved critical current density. These results indicate that Tl-1212 films may be of greater relevance for electronics applications than previously believed. copyright 1995 American Institute of Physics
EnviroAtlas - Durham, NC - Demo (Parent)
U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...
Energy Technology Data Exchange (ETDEWEB)
Gonzalez M, P.R.; Tovar M, V.M. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico); Azorin N, J. [UAM-I, 09340 Mexico D.F. (Mexico); Furetta, C. [Universita degli Studi di Roma ' La Sapienza' , Piazzale Aldo Moro 2, 00185 Roma (Italy); Quiroz C, M.C. [Facultad de Medicina, UAEM, 50180 Toluca, Estado de Mexico (Mexico)
2005-07-01
In this work the obtained results of the irradiation of thermoluminescent dosemeters (Tl) of LiF: Mg,Cu,P + Ptfe with X rays for the effective radiation energy of 24, 42 and 100 keV, in an interval of Kerma in air in the sinus of the air between 0.05 and 1.0 Gy are presented. The rate of Kerma in air was determined with an ionization chamber PTW-1152, gauged by the Laboratoire Central des Industries Electriques (LCIE). As reference commercial TLD-100 dosemeters was used. The results showed that the studied Tl dosemeters presented a lineal response in the interval of mentioned Kerma. On the other hand the estimated Kerma with the Tl dosemeter in the calibration curves for X rays, were similar to the one measured with the previously gauged ionization chamber. The Tl of LiF: Mg, Cu, P + Ptfe, developed in the ININ, are highly reliable for X-ray dosimetry. (Author)
International Nuclear Information System (INIS)
Lin Jinghui; Chai Xiaofeng; Zhu Mei
1997-01-01
PURPOSE: To compare 201 Tl reinjection imaging with late imaging in detecting myocardial viability. METHODS: 62 patients with myocardial infarction underwent 201 Tl exercise, 3∼5 hours redistribution, 16∼35 minutes and 12∼19 hours post 201 Tl reinjection mycoardial tomography imaging. After imaging, percutaneous transluminal coronary angioplasty (PTCA) were performed in 15 patients, and then exercise-redistribution myocardial imaging were repeated. RESULTS: 62 patients had 126 segments of irreversible defects on stress-redistribution imaging, 48 segments showed radioactive filling at 16∼35 minutes post-reinjection. The detecting rate of myocardial viability was 38.1% (48/126). 51 segments presented redistribution on 12∼19 hours late imaging, the detecting rate of myocardial viability was 40.5% (51/126). There were no significant difference in the detecting rate between them (x 2 0.16, P>0.05). But in combination of both methods, there were 62 segments refilling, thereby detecting rate was enhanced to 49.2% (62/126). In 15 patients who had PTCA, out of 17 segments were discovered to be viable before PTCA. After PTCA 12 segments had an improved perfusion of 201 Tl, the positive predictive accuracy was 70.6%. Out of 11 segments were discovered to be infarcted, 9 segments had non-improved 201 Tl perfusion after PTCA, the negative predictive accuracy was 81.8%. CONCLUSION: There were no significant difference in the detecting rate of myocardial viability between 2 '0 1 Tl reinjection and late imaging. In combination of both methods the detecting rate can be enhanced
ORF Sequence: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra
ORF Sequence: NC_005363 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR
ORF Sequence: NC_003078 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp
ORF Sequence: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV
ORF Sequence: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL
ORF Sequence: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP
Directory of Open Access Journals (Sweden)
Anatoly V. Kasatkin
2018-05-01
Full Text Available Tsygankoite, ideally Mn8Tl8Hg2(Sb21Pb2TlΣ24S48, is a new sulfosalt discovered at the Vorontsovskoe gold deposit, Northern Urals, Russia. It occurs as lath-like elongated crystals up to 0.2 mm embedded in calcite–dolomite–clinochlore matrix. The associated minerals also include aktashite, alabandite, arsenopyrite, barite, cinnabar, fluorapatite, orpiment, pyrite, realgar, routhierite, sphalerite, tilasite, and titanite. The new mineral is non-fluorescent, black, and opaque with a metallic lustre and black streak. It is brittle with an uneven fracture and no obvious parting and cleavage. Its Vickers hardness (VHN10 is 144 kg/mm2 (range 131–167 kg/mm2 and its calculated density is 5.450 g cm. In reflected light, tsygankoite is white; between crossed polars it is dark grey to black. It is strongly anisotropic: rotation tints vary from light grey to dark grey to black. Pleochroism and internal reflections are not observed. The chemical composition of tsygankoite (wt %, electron-microprobe data is: Mn 6.29, Hg 5.42, Tl 26.05, Pb 5.84, As 3.39, Sb 30.89, S 21.87, total 99.75. The empirical formula, calculated on the basis of 90 atoms pfu, is: Mn8.06Tl8.00Hg1.90(Sb17.87As3.19Pb1.99Tl0.97Σ24.02S48.03. Tsygankoite is monoclinic, space group C2/m, a = 21.362(4 Å, b = 3.8579(10 Å, c = 27.135(4 Å, β = 106.944(14°, V = 2139.19(17 Å3 and Z = 1. The five strongest diffraction peaks from X-ray powder pattern (listed as (d,Å(I(hkl are: 3.587(100(112, 3.353(70(−114, 3.204(88(405, 2.841(72(−513, and 2.786(99(−514. The crystal structure of tsygankoite was refined from single-crystal X-ray diffraction data to R = 0.0607 and consists of an alternation of two thick layer-like arrays, one based on PbS-archetype and the second on SnS-archetype. Tsygankoite has been approved by the IMA-CNMNC under the number 2017-088. It is named for Mikhail V. Tsyganko, a mineral collector from Severouralsk, Northern Urals, Russia, who collected the samples where the
Dosimetric characteristics of LKB:Cu,P solid TL detector
International Nuclear Information System (INIS)
Hashim, S.; Alajerami, Y.S.M.; Ghoshal, S.K.; Saleh, M.A.; Saripan, M.I.; Kadir, A.B.A.; Bradley, D.A.; Alzimami, K.
2014-01-01
The dosimetric characteristics of newly developed borate glass dosimeter modified with lithium and potassium carbonate (LKB) and co-doped with CuO and NH 4 H 2 PO 4 are reported. Broad peaks in the absence of any sharp peak confirms the amorphous nature of the prepared glass. A simple glow curve of Cu doped sample is observed with a single prominent peak (T m ) at 220 °C. The TL intensity response shows an enhancement of ∼100 times due to the addition of CuO (0.1 mol%) to LKB compound. A further enhancement of the intensity by a factor of 3 from the addition of 0.25 mol% NH 4 H 2 PO 4 as a co-dopant impurity is attributed to the creation of extra electron traps with consequent increase in energy transfer of radiation recombination centers. The TL yield performance of LKB:Cu,P with Z eff ≈8.92 is approximately seventeen times less sensitive compared to LiF:Mg,Ti (TLD-100). The proposed dosimeter shows good linearity up to 10 3 Gy, minimal fading and photon energy independence. These attractive features offered by our dosimeter is expected to pave the way towards dosimetric applications. - Highlights: • The NH 4 H 2 PO 4 impurities are cross linked with the CuO defect. • The addition of NH 4 H 2 PO 4 as a co-dopant improved the TL intensity by a factor of 3. • The proposed dosimeter shows good linearity up to 10 3 Gy. • Minimal fading and photon energy independence were observed
77 FR 57063 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC
2012-09-17
... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...
77 FR 64906 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC
2012-10-24
... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...
ORF Sequence: NC_006155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin
ORF Sequence: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK
Pulse-shape discrimination between electron and nuclear recoils in a NaI(Tl) crystal
International Nuclear Information System (INIS)
Lee, H.S.; Adhikari, G.; Adhikari, P.; Choi, S.; Hahn, I.S.
2015-01-01
We report on the response of a high light-output NaI(Tl) crystal to nuclear recoils induced by neutrons from an Am-Be source and compare the results with the response to electron recoils produced by Compton-scattered 662 keV γ-rays from a 137 Cs source. The measured pulse-shape discrimination (PSD) power of the NaI(Tl) crystal is found to be significantly improved because of the high light output of the NaI(Tl) detector. We quantify the PSD power with a quality factor and estimate the sensitivity to the interaction rate for weakly interacting massive particles (WIMPs) with nucleons, and the result is compared with the annual modulation amplitude observed by the DAMA/LIBRA experiment. The sensitivity to spin-independent WIMP-nucleon interactions based on 100 kg⋅year of data from NaI detectors is estimated with simulated experiments, using the standard halo model.
Sequential change of cardiomyopathy of Duchenne muscular dystrophy by /sup 201/Tl myocardial SPECT
Energy Technology Data Exchange (ETDEWEB)
Ono, Seiji; Sugimoto, Seiichirou; Inoue, Kenjirou; Jinnouchi, Seishi; Hoshi, Hiroaki; Watanabe, Katsushi.
1989-03-01
/sup 201/Tl myocardial SPECT were performed to evaluate of cardiomyopathy in Duchenne type of progressive muscular dystrophy (DMD). Follow up SPECT images of the same patients were also obtained about 1 year after the first scan. Cases subjected to study were 10 DMD. At the first study the hypoperfusion area of the left ventricular muscle were observed in 6 cases (60%) out of 10. At the second study the hypoperfusion areas became wider and lower in 4 out of 6 cases (66.7%). The new hypoperfusion area which was not demonstrated at the first study was observed at the second study in one case of these cases. These results suggested that the positive rate of cardiomyopathy in DMD by /sup 201/Tl myocardial SPECT was high, and /sup 201/Tl myocardial SPECT is a useful examination to detect the change of myocardial damage in DMD. (author).
Pulse-shape discrimination between electron and nuclear recoils in a NaI(Tl) crystal
Energy Technology Data Exchange (ETDEWEB)
Lee, H.S. [Department of Physics, Ewha Womans University,Seoul 120-750 (Korea, Republic of); Adhikari, G.; Adhikari, P. [Department of Physics, Sejong University,Seoul 143-747 (Korea, Republic of); Choi, S. [Department of Physics and Astronomy, Seoul National University,Seoul 151-747 (Korea, Republic of); Hahn, I.S. [Department of Science Education, Ewha Womans University,Seoul 120-750 (Korea, Republic of)
2015-08-18
We report on the response of a high light-output NaI(Tl) crystal to nuclear recoils induced by neutrons from an Am-Be source and compare the results with the response to electron recoils produced by Compton-scattered 662 keV γ-rays from a {sup 137}Cs source. The measured pulse-shape discrimination (PSD) power of the NaI(Tl) crystal is found to be significantly improved because of the high light output of the NaI(Tl) detector. We quantify the PSD power with a quality factor and estimate the sensitivity to the interaction rate for weakly interacting massive particles (WIMPs) with nucleons, and the result is compared with the annual modulation amplitude observed by the DAMA/LIBRA experiment. The sensitivity to spin-independent WIMP-nucleon interactions based on 100 kg⋅year of data from NaI detectors is estimated with simulated experiments, using the standard halo model.
A new luminescence detection and stimulation head for the Risø TL/OSL reader
International Nuclear Information System (INIS)
Lapp, T.; Kook, M.; Murray, A.S.; Thomsen, K.J.; Buylaert, J.-P.; Jain, M.
2015-01-01
A new automated Detection And Stimulation Head (DASH) has been developed for the Risø TL/OSL luminescence reader to provide easy access to new technologies, new signals and new measurement methods. The automated DASH includes a filter changer and a detector changer that makes it possible to change stimulation filters (4 × 4 filter combinations possible) and detectors (3 detectors possible) as part of a measurements sequence. The new automated DASH with dedicated driver electronics does not affect the use of other attachments, and can be retrospectively fitted to existing Risø TL/OSL readers. - Highlights: • A new detection and stimulation head for the Risø TL/OSL reader is described. • An example of the use of the filter changer is presented. • The power and spatial uniformity of blue, green and IR stimulation are characterised. • The potential of an EMCCD camera detector is described.
Detection Characteristics of Gamma-Irradiated Seeds by using PSL, TL, ESR and GC/MS
International Nuclear Information System (INIS)
Kim, K.H.; Shon, J.H.; Kang, Y.J.; Jo, T.Y.; Park, H.Y.; Kwak, J.Y.; Lee, J.H.; Park, Y.C.; Kim, J.I.; Lee, H.J.; Lee, S.J.; Han, S.B.
2013-01-01
In this study, we investigated the applicability of the photostimulated luminescence (PSL), thermoluminescence (TL), electron spin resonance (ESR) and gas chromatography/mass spectrometry (GC/MS) methods for 5 seeds which are not allowed to be irradiated in Korea. All 5 seeds including evening primrose seed, safflower seed, rape seed, sunflower seed and flax seed were analyzed. Samples were irradiated at 1~10 kGy using a 60 Co gamma-ray irradiator. In PSL study, the photon counts of all the unirradiated samples showed negative (lower than 700). The photon counts of irradiated (1, 5, 10 kGy) samples showed positive (higher than 5,000). In TL analysis, results showed that it is possible to apply TL method to all foods containing minerals. In ESR measurements, the ESR signal (single-line) intensity of irradiated foods was higher than non-irradiated foods. The hydrocarbons 1,7-hexadecadiene (C 16:2 ) and 8-heptadecene (C 17:1 ) from oleic acid were detected only in the irradiated samples before and after the treatment at doses ≥ 1 kGy, but they were not detected in non-irradiated samples before and after treatment. These two hydrocarbons could be used as markers to identify irradiated safflower seed, rape seed, Sunflower seed and flax seed. And then, the hydrocarbons 1,7,10-hexadecatriene (C 16:3 ) and 6,9-heptadecadiene (C 17:2 ) from linoleic acid were detected in the evening primrose seed, safflower seed and sunflower seed. According to the results, PSL, TL and GC/ MS methods were successfully applied to detect the irradiated foods. It is concluded that PSL, TL and GC/MS methods are suitable for detection of irradiated samples and a combined method is recommendable for enhancing the reliability of detection results. (author)
CAI System with Multi-Media Text Through Web Browser for NC Lathe Programming
Mizugaki, Yoshio; Kikkawa, Koichi; Mizui, Masahiko; Kamijo, Keisuke
A new Computer Aided Instruction (CAI) system for NC lathe programming has been developed with use of multi-media texts including movies, animations, pictures, sound and texts through Web browser. Although many CAI systems developed previously for NC programming consist of text-based instructions, it is difficult for beginners to learn NC programming with use of them. In the developed CAI system, multi-media texts are adopted for the help of users' understanding, and it is available through Web browser anytime and anywhere. Also the error log is automatically recorded for the future references. According to the NC programming coded by a user, the movement of the NC lathe is animated and shown in the monitor screen in front of the user. If its movement causes the collision between a cutting tool and the lathe, some sound and the caution remark are generated. If the user makes mistakes some times at a certain stage in learning NC, the corresponding suggestion is shown in the form of movies, animations, and so forth. By using the multimedia texts, users' attention is kept concentrated during a training course. In this paper, the configuration of the CAI system is explained and the actual procedures for users to learn the NC programming are also explained too. Some beginners tested this CAI system and their results are illustrated and discussed from the viewpoint of the efficiency and usefulness of this CAI system. A brief conclusion is also mentioned.
Wang, Jianjian; Cao, Yuze; Zhang, Huixue; Wang, Tianfeng; Tian, Qinghua; Lu, Xiaoyu; Lu, Xiaoyan; Kong, Xiaotong; Liu, Zhaojun; Wang, Ning; Zhang, Shuai; Ma, Heping; Ning, Shangwei; Wang, Lihua
2017-01-04
The Nervous System Disease NcRNAome Atlas (NSDNA) (http://www.bio-bigdata.net/nsdna/) is a manually curated database that provides comprehensive experimentally supported associations about nervous system diseases (NSDs) and noncoding RNAs (ncRNAs). NSDs represent a common group of disorders, some of which are characterized by high morbidity and disabilities. The pathogenesis of NSDs at the molecular level remains poorly understood. ncRNAs are a large family of functionally important RNA molecules. Increasing evidence shows that diverse ncRNAs play a critical role in various NSDs. Mining and summarizing NSD-ncRNA association data can help researchers discover useful information. Hence, we developed an NSDNA database that documents 24 713 associations between 142 NSDs and 8593 ncRNAs in 11 species, curated from more than 1300 articles. This database provides a user-friendly interface for browsing and searching and allows for data downloading flexibility. In addition, NSDNA offers a submission page for researchers to submit novel NSD-ncRNA associations. It represents an extremely useful and valuable resource for researchers who seek to understand the functions and molecular mechanisms of ncRNA involved in NSDs. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.
QPM Analysis of 205Tl Nuclear Excitations below the Giant Dipole Resonance
Directory of Open Access Journals (Sweden)
Benouaret N.
2015-01-01
Full Text Available We analysed our experimental recent findings of the dipole response of the odd-mass stable nucleus 205Tl within the quasi-particle phonon model. Using the phonon basis constructed for the neighbouring 204Hg and wave function configurations for 205Tl consisting of a mixture of quasiparticle ⊗ N-phonon configurations (N=0,1,2, only one group of fragmented dipole excited states has been reproduced at 5.5 MeV in comparison to the experimental distribution which shows a second group at about 5 MeV. The computed dipole transition strengths are mainly of E1 character which could be associated to the pygmy dipole resonance.
QPM Analysis of 205Tl Nuclear Excitations below the Giant Dipole Resonance
Benouaret, N.; Beller, J.; Isaak, J.; Kelley, J. H.; Pai, H.; Pietralla, N.; Ponomarev, V. Yu.; Raut, R.; Romig, C.; Rusev, G.; Savran, D.; Scheck, M.; Schnorrenberger, L.; Sonnabend, K.; Tonchev, A. P.; Tornow, W.; Weller, H. R.; Zweidinger, M.
2015-05-01
We analysed our experimental recent findings of the dipole response of the odd-mass stable nucleus 205Tl within the quasi-particle phonon model. Using the phonon basis constructed for the neighbouring 204Hg and wave function configurations for 205Tl consisting of a mixture of quasiparticle ⊗ N-phonon configurations (N=0,1,2), only one group of fragmented dipole excited states has been reproduced at 5.5 MeV in comparison to the experimental distribution which shows a second group at about 5 MeV. The computed dipole transition strengths are mainly of E1 character which could be associated to the pygmy dipole resonance.
Study of sup 1 sup 9 sup 4 Tl sup g decay
Sudarshan, K; Tripathi, R; Goswami, A; Tomar, B S; Reddy, A V R
2003-01-01
Absolute gamma ray intensities in the decay of sup 1 sup 9 sup 4 Tl sup g have been measured following the radiochemical separation of sup 1 sup 9 sup 4 Pb produced in the reaction of sup 1 sup 9 F + sup 1 sup 8 sup 1 Ta. The (EC+beta sup +) branching ratios in the decay of sup 1 sup 9 sup 4 Tl sup g to various levels of sup 1 sup 9 sup 4 Hg were deduced. Three new levels are introduced in the decay scheme. A precise value of half life of sup 1 sup 9 sup 4 Pb (10.0+-0.4 min) is reported.
Temperature dependence of CsI(Tl) gamma-ray excited scintillation characteristics
International Nuclear Information System (INIS)
1993-01-01
Gamma-ray excited emission spectrum, absolute scintillation yield, rise and decay time constants, and thermoluminescence emissions of CsI(Tl) were measured at -100 to +50 C, for crystals from 4 different vendors. The thermoluminescence glow curves were the only property that varied significantly from crystal to crystal; room temperature operation in current mode could be susceptible to temperature fluctuations. The CsI(Tl) emission spectrum has emission bands peaking around 400 and 560 nm; the former band disappears between -50 and -75 C. The RT absolute scintillation yield was calculated to be 65,500±4,100 photons/MeV. The two primary decay time constants increases about exponentially with inverse temperature. An ultra-fast decay component was confirmed. Applications are discussed
precision deburring using NC and robot equipment. Final report
Energy Technology Data Exchange (ETDEWEB)
Gillespie, L.K.
1980-05-01
Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.
Neutron Scattering from fcc Pr and Pr3Tl
DEFF Research Database (Denmark)
Birgeneau, R. J.; Als-Nielsen, Jens Aage; Bucher, E.
1972-01-01
Elastic-neutron-scattering measurements on the singlet-ground-state ferromagnets fcc Pr and Pr3 Tl are reported. Both exhibit magnetic phase transitions, possibly to a simple ferromagnetic state at 20 and 11.6 °K, respectively. The transitions appear to be of second order although that in fcc Pr...
Determination of kinetic parameters in Tl dosemeters of LiF: Mg, Cu, P + PTFE developed in the ININ
International Nuclear Information System (INIS)
Basurto G, B.S.
2002-01-01
The objective of this work, is the one of determining the kinetic parameters of the dosemeter of LiF: Mg, Cu, P + Ptfe; starting from the curves Tl obtained at being irradiated with alpha radiation (α), beta (β) and gamma (γ). As like to compare its sensitivity with each radiation type, considering the sensitivity of the TLD-100 as the unit. In the Chapter 1, the fundamental structure of the matter is described, making emphasis in the different radiation types, and their interaction with this. In the Chapter 2, the units are described but used in the dosimetry of the radiation. In the Chapter 3, the basic concepts of the phenomenon of Tl are described and those are explained characteristic of the deconvolution method to determine the kinetics of the one phenomenon. In the Chapter 4, the methodology is detailed that was used in the elaboration of this thesis work, describing the material Tl that were considered like reference, as well as the sources of ionizing radiation, with those that the dosemeters were irradiated and the equipment in the one that the curves Tl was obtained. Reference is made to the software used to carry out the deconvolution of the curves Tl that were obtained in the one experimental development. In the Chapter 5, the obtained results of this study are presented, showing the tables of homogenization of dosemeters and the reading of the same one; they are observed the curves Tl obtained to different radiation doses (alpha, beta and gamma), the intensity Tl in function of the dose. Also they are tabulated, the obtained results in the kinetic parameters of the three different study materials (TLD-100H, USA; TLD-100, USA and LiF: Mg, Cu, P + Ptfe developed in the l.N.l.N). They are analyzed shortly for each material Tl their sensitivity to the ionizing radiation as well as their kinetic parameters. The obtained results showed that the Tl dosemeters of LiF: Mg,Cu,P + Ptfe, they presented a bigger sensitivity that the TLD-100 when being
International Nuclear Information System (INIS)
Chernov, V.; Paz-Moreno, F.; Piters, T. M.; Barboza-Flores, M.
2006-01-01
The paper presents the first results of an investigation on optical absorption (OA), thermally and infrared stimulated luminescence (TL and IRSL) of the Pinacate plagioclase (labradorite). The OA spectra reveal two bands with maxima at 1.0 and 3.2 eV connected with absorption of the Fe 3+ and Fe 2+ and IR absorption at wavelengths longer than 2700 nm. The ultraviolet absorption varies exponentially with the photon energy following the 'vitreous' empirical Urbach rule indicating exponential distribution of localised states in the forbidden band. The natural TL is peaked at 700 K. Laboratory beta irradiation creates a very broad TL peak with maximum at 430 K. The change of the 430 K TL peak shape under the thermal cleaning procedure and dark storage after irradiation reveals a monotonous increasing of the activation energy that can be explained by the exponential distribution of traps. The IRSL response is weak and exhibits a typical decay behaviour. (authors)
Chernov, V; Paz-Moreno, F; Piters, T M; Barboza-Flores, M
2006-01-01
The paper presents the first results of an investigation on optical absorption (OA), thermally and infrared stimulated luminescence (TL and IRSL) of the Pinacate plagioclase (labradorite). The OA spectra reveal two bands with maxima at 1.0 and 3.2 eV connected with absorption of the Fe3+ and Fe2+ and IR absorption at wavelengths longer than 2700 nm. The ultraviolet absorption varies exponentially with the photon energy following the 'vitreous' empirical Urbach rule indicating exponential distribution of localised states in the forbidden band. The natural TL is peaked at 700 K. Laboratory beta irradiation creates a very broad TL peak with maximum at 430 K. The change of the 430 K TL peak shape under the thermal cleaning procedure and dark storage after irradiation reveals a monotonous increasing of the activation energy that can be explained by the exponential distribution of traps. The IRSL response is weak and exhibits a typical decay behaviour.
International Nuclear Information System (INIS)
Fujii, Tadashige; Tanaka, Masao; Koizumi, Tomonori; Kubo, Keishi
2000-01-01
Tl-201 lung uptake in 74 patients (85 lesions) and pulmonary perfusion in 105 patients were studied to evaluate clinical usefulness of Tl-201 lung uptake and perfusion lung scintigraphy in pulmonary tuberculosis, using a scintillation camera with a mini-computer system. As indices of Tl-201 lung uptake, lung (lesion) to upper mediastinum uptake ratio (L/M) and visual grading were used. L/M in pulmonary tuberculosis was 1.96±0.66, which was significantly larger than 1.04±0.24 in healthy controls and lower than that in heart diseases with left heart failure and idiopathic interstitial pneumonia, and showed no significant differences with that in acute pneumonia, pyothorax, primary lung cancer and malignant mediastinal tumor. L/M in pulmonary tuberculosis did not correlate with CRP, erythrocyte sedimentation rate, Gaffky number of sputum and body temperature. It correlated with the type of pulmonary tuberculosis according to the Gakken Classification reflecting the disease activity. It was larger in the exudative type, caseo-infiltrative one, disseminated one, one with cavity in infiltrative lesion than the fibro-caseous one. On perfusion lung scintigram, impairment of pulmonary perfusion larger than area of the entire unilateral lung was observed in 68 cases (64.8%). Area of hypoperfused lung field, which correlated with % vital capacity (r=0.60, p=0.0002) and PaO 2 (r=0.39,p=0.0024), was significantly larger in patients with silicosis and those with bilateral pleural involvements such as pleural callosity than in those with type III according to the Gakkai Classification. Most of the patients showed decreased pulmonary perfusion and Tl-201 accumulation of which grade reflects the disease activity in active tuberculous lesion. Patients with miliary tuberculosis and those with silicotuberculosis showed diffuse Tl-201 accumulation in the both lungs. Tl-201 lung scintigraphy seems to be useful for visualizing active tuberculous lesions, particularly the ones that
International Nuclear Information System (INIS)
Moore, S.C.; Tow, D.E.; English, R.J.; Syravanh, C.; Zimmerman, R.E.; Chan, K.H.; Kijewski, M.F.; Brigham and Women's Hospital, Boston, MA
1995-01-01
The advantages of simultaneous acquisition of TC-99m and Tl-201 myocardial perfusion SPECT images can be fully realized only if the effects of the Tc-99m agent can be accurately removed from the Tl-201 image. The authors and others have previously reported simultaneous dual-isotope techniques for cardiac studies which make use of a third energy-window to estimate the Tc-99m scatter to be subtracted from the Tl-201 window. The authors have recently demonstrated, however, using a Monte Carlo program which simulates all details of the photon transport, that lead x-rays produced in the collimator may also contribute significantly to contamination in the Tl-201 window. The spatial distribution of the Tc-99m scattered photons differs from that of the lead x-rays. Therefore, the authors modified their correction technique so that, at each projection angle, the contaminant image to be subtracted from the image in the Tl-201 window was estimated as a linear combination of a scatter-window (90--110 keV) image, blurred by a 2D Gaussian filter, and the Tc-99m photopeak image, blurred by a different Gaussian filter. For simulated data which included 'liver' activity and non-uniform 'lung' attenuation, the improved dual-window subtraction technique provided a more accurate estimate of the true Tl-201 image, with less image noise, than did the single-window correction
International Nuclear Information System (INIS)
Zular, André; Sawakuchi, André O.; Guedes, Carlos C.F.; Giannini, Paulo C.F.
2015-01-01
In the São Francisco do Sul (SFS) barrier in southern Brazil, the optically stimulated luminescence (OSL) and thermoluminescence (TL) sensitivities of coastal sands vary according to geomorphological units. Sands from older beach ridges (ages older than 2000 years ago) show higher OSL and TL sensitivities than younger units (ages younger than 2000 years). Geomorphological units in the SFS attest to changes in provenance as a result of a coastal climate shift evidenced through grain size and heavy mineral analysis. We argue that in the SFS barrier sands, OSL and TL sensitivity signals provide an additional proxy to climate events and can be used as an alternative method to assess changes in provenance and tracking source-to-sink systems to monitor past and future environmental changes. - Highlights: • OSL and TL sensitivities are confronted with grain size and heavy minerals data. • We report OSL and 110 °C TL sensitivities as provenance proxies. • 110 °C TL sensitivity outlines environmental changes better than OSL sensitivity data.
ORF Sequence: NC_003283 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR
ORF Sequence: NC_003280 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME
International Nuclear Information System (INIS)
Gonzalez M, P.R.
2008-01-01
The electric power generation, it has been one of the radiation applications of bigger weight, mainly in developed countries. Another sector of more impact is without a doubt that of the medicine. However, for a sure operation with radiations, those international organisms of radiological safety, exist every time more precise detection systems. The thermoluminescent dosimetry is one of the more reliable methods for this purpose, for that several groups of investigators from different parts of the world, they have guided its investigations in the development of new TL materials. However, to avoid underestimate or overestimation of the measured dose with the use of these materials, it should take into account it effective atomic number (Z eff ) it is well known that some TL materials considered as equivalent to the tissue, presents smaller TL intensity when being irradiated with low energy photons, while the TL material known as not equivalent to the tissue, they present the supra sensitivity effect for this radiation type. Nowadays, the estimate of the Z eff has not been clear, in this work the Z eff is determined by means of the traditional methods and an own method is presented for its determination. The results of the TL signal of different materials, when being irradiated with photons of effective energy between 24 keV and 1.25 MeV and their relationship with their calculated Z eff are also presented. (Author)
Correlation of basic TL, OSL and IRSL properties of ten K-feldspar samples of various origins
Energy Technology Data Exchange (ETDEWEB)
Sfampa, I.K. [Aristotle University of Thessaloniki, Nuclear Physics Laboratory, 54124 Thessaloniki (Greece); Polymeris, G.S. [Institute of Nuclear Sciences, Ankara University, 06100 Besevler, Ankara (Turkey); Pagonis, V. [McDaniel College, Physics Department, Westminster, MD 21157 (United States); Theodosoglou, E. [Department of Mineralogy-Petrology-Economic Geology, School of Geology, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Tsirliganis, N.C. [Laboratory of Radiation Applications and Archaeological Dating, Department of Archaeometry and Physicochemical Measurements, ‘Athena’ R.& I.C., Kimmeria University Campus, GR67100 Xanthi (Greece); Kitis, G., E-mail: gkitis@auth.gr [Aristotle University of Thessaloniki, Nuclear Physics Laboratory, 54124 Thessaloniki (Greece)
2015-09-15
Highlights: • OSL and IRSL bleaching behavior of ten K-feldspar samples is presented. • OSL and IRSL decay curves were component resolved using tunneling model. • The growth of integrated OSL and IRSL signals versus time was described by new expression based on tunneling model. • Correlation between TL, OSL and IRSL signals and of all properties with K-feldspar structure was discussed. - Abstract: Feldspars stand among the most widely used minerals in dosimetric methods of dating using thermoluminescence (TL), optically stimulated luminescence (OSL) and infrared stimulated luminescence (IRSL). Having very good dosimetric properties, they can in principle contribute to the dating of every site of archaeological and geological interest. The present work studies basic properties of ten naturally occurring K-feldspar samples belonging to three feldspar species, namely sanidine, orthoclase and microcline. The basic properties studied are (a) the influence of blue light and infrared stimulation on the thermoluminescence glow-curves, (b) the growth of OSL, IRSL, residual TL and TL-loss as a function of OSL and IRSL bleaching time and (c) the correlation between the OSL and IRSL signals and the energy levels responsible for the TL glow-curve. All experimental data were fitted using analytical expressions derived from a recently developed tunneling recombination model. The results show that the analytical expressions provide excellent fits to all experimental results, thus verifying the tunneling recombination mechanism in these materials and providing valuable information about the concentrations of luminescence centers.
Neutron capture at the s-process branching points $^{171}$Tm and $^{204}$Tl
Branching points in the s-process are very special isotopes for which there is a competition between the neutron capture and the subsequent b-decay chain producing the heavy elements beyond Fe. Typically, the knowledge on the associated capture cross sections is very poor due to the difficulty in obtaining enough material of these radioactive isotopes and to measure the cross section of a sample with an intrinsic activity; indeed only 2 out o the 21 ${s}$-process branching points have ever been measured by using the time-of-flight method. In this experiment we aim at measuring for the first time the capture cross sections of $^{171}$Tm and $^{204}$Tl, both of crucial importance for understanding the nucleosynthesis of heavy elements in AGB stars. The combination of both (n,$\\gamma$) measurements on $^{171}$Tm and $^{204}$Tl will allow one to accurately constrain neutron density and the strength of the 13C(α,n) source in low mass AGB stars. Additionally, the cross section of $^{204}$Tl is also of cosmo-chrono...
International Nuclear Information System (INIS)
Gomez-Rio, Manuel; Martinez del Valle Torres, Dolores; Rodriguez-Fernandez, Antonio; Llamas-Elvira, Jose Manuel; Lozano, Simeon Ortega; Font, Carlos Ramos; Lopez Ramirez, Escarlata; Katati, Majed
2004-01-01
The aim of this work was to describe the usefulness of a simple 201 Tl single-photon emission computed tomography (SPECT) technique in the differential diagnosis between tumour recurrence and radionecrosis during the follow-up of patients treated for low-grade gliomas. The study population comprised 84 patients treated for low-grade gliomas who showed suspicion of tumour recurrence during their follow-up. All patients were examined by neuro-anatomical imaging procedures (CT, MRI) and 201 Tl-SPECT. 201 Tl-SPECT images were assessed by visual analysis based only on the information on the prescription form and by estimation of the uptake index (ratio of mean counts in the lesion to those in the contralateral mirror area). Examiners were blinded to the results of other tests. Under these conditions, the neuro-anatomical procedures yielded 26.2% inconclusive reports, with a global diagnostic accuracy of 0.61, a sensitivity of 0.63 and a specificity of 0.59. The global diagnostic accuracy for 201 Tl-SPECT was 0.83, with a sensitivity of 0.88 and a specificity of 0.76. Diagnostic pitfalls were observed in regions with physiological 201 Tl uptake, i.e. the posterior cranial fossa, diencephalon, lateral ventricles and cavernous and longitudinal venous sinuses. An uptake index cut-off value of 1.25 showed a sensitivity of 0.90 and specificity of 0.80 for detection of tumour activity. 201 Tl-SPECT has adequate diagnostic accuracy to be part of routine algorithms in the follow-up of patients with low-grade glioma suspected of tumour recurrence, as an alternative to neuro-anatomical procedures and not solely as a complementary test. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Sasaki, Akira [Kyorin Univ., Mitaka, Tokyo (Japan). School of Medicine
1996-03-01
Dual single photon emission computed tomography (SPECT) was performed in 30 patients with Duchenne`s muscular dystrophy (DMD) using {sup 201} thallium (Tl) for myocardial perfusion {sup 123}I-{beta}-methyl-p-iodophenylpentadecanoic acid (BMIPP) for myocardial fatty acid metabolism scintigraphy. The left ventricle was divided into 9 regions, and accumulation of the radiotracers was assessed visually for each region to calculate defect score for each tracer. There was some degree of decrease in the myocardial accumulation of both tracers in all DMD patients. Reduced accumulation was most common at the apex (BMIPP, 70%; Tl, 63%), followed by the posterior wall, lateral wall, and anterior wall. It was less common on the apical side of the ventricular septum for both tracers (BMIPP, 3%; Tl, 17%). Accumulation of Tl was lower than BMIPP in 18/30 patients (60%) and higher in 9 (30%), while both tracers showed equal accumulation in 3 (10%). BMIPP showed higher accumulation than Tl in all regions but the septum. A significant negative correlation was found between the defect scores for both tracers and the left ventricular ejection fraction (LVEF) (r=-0.629 for Tl; r=-0.567 for BMIPP). The strongest negative correlation was that between the sum of the Tl and BMIPP defect scores and the LVEF (r=-0.681). Dual SPECT myocardial scintigraphy with Tl and BMIPP provided an accurate evaluation of the progression of cardiac lesions in DMD by detecting abnormalities of the myocardial metabolism of each substance thereby enabling the assessment of left ventricular function. (author).
Energy Technology Data Exchange (ETDEWEB)
Sugo, Nobuo; Kuroki, Takao; Nemoto, Masaaki; Mito, Toshiaki; Seiki, Yoshikatsu; Shibata, Iekado [Toho Univ., Tokyo (Japan). Omori Hospital
2000-07-01
The accumulation levels of {sup 201}TlCl and Na{sup +} -K{sup +} ATPase activity in tumor tissue were compared among glioblastoma, benign glioma and meningioma to study the difference in the mechanism of {sup 201}TlCl accumulation. The subjects were 19 cases comprised of 6 glioblastoma, 2 oligodendroglioma, 1 fibrillary astrocytoma, 1 pilocytic astrocytoma and 9 meningioma. Preoperative {sup 201}TlCl SPECT was performed in all the cases, and Thallium Index (TL index) was calculated by a ratio of {sup 201}TlCl in the tumor area and the contralateral area. In addition, cell membrane was extracted from the tumor tissue collected intraoperatively to determine Na{sup +} -K{sup +} ATPase activity. No statistically significant difference in TL index was noted between the glioblastoma group (6.97{+-}2.67) and the meningioma group (5.87{+-}1.99). This fact showed that there was no difference in the accumulation level of {sup 201}TlCl between the two groups. On the other hand, the glioblastoma group indicated a higher value of Na{sup +} -K{sup +} ATPase activity (49.13{+-}43.76 {mu}mole/hour/mg protein) than the meningioma group (7.73{+-}13.84 {mu}mol/hour/mg protein) (p<0.05, t test). These results suggested the involvement of Na{sup +} -K{sup +} ATPase activity in {sup 201}TlCl accumulation in glioblastoma and the influences of other accumulation mechanism than Na{sup +} -K{sup +} ATPase activity such as the volume of intratumoral vascular bed in meningioma. (author)
Computerized study with /sup 201/Tl of the cold thyroid node
Energy Technology Data Exchange (ETDEWEB)
Palermo, F.; Saitta, B.; Coghetto, F.; Tiberio, M.; Caldato, L.
1982-02-01
Because of its physical and potassium-metabolic characteristics /sup 201/Tl is more suitable than /sup 131/Cs for radioisotopic studies of the cold thyroid nodule, with the further diagnostic possibility of quantitatively assessing intranodular behaviour for a specific differentiation among different kinds of neoformations. Using a gamma-camera on line with a computer data processing device, sequential scintiscans were recorded for the first 20-30 min after i.v. administration of 15-20 ..mu..Ci/kg of radiothallium; delayed sequences were taken at 40-60 min if intranodular uptake appeared. A quantitative appraisal was made of the differential /sup 201/Tl uptake-ratio between nodule and healthy thyroid tissue (density-index) and the multiparameter analysis of thyroid time/activity curves generated on the relative regions of interest (ROIs). This computerized study, in 120 out of 293 patients submitted to this radiothallium test, has shown a) diagnostic agreement between clinical-histological and radioisotopic findings in 76 out of 79 colloid-cystic or degenerative neoformations, in all 16 malignant and in 23 out of 25 hyperplastic benign nodules; b) significant statistical difference of the density-index in solid versus cystic but not between benign and malignant nodules; c) different /sup 201/Tl kinetics behaviour in different kinds of solid thyroid lesions with a satisfactory statistical difference of the radiothallium nodular dissappearance-index.
ORF Sequence: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI
Giant Rashba spin splitting in Bi2Se3: Tl
Singh, Nirpendra; Saeed, Yasir; Schwingenschlö gl, Udo
2014-01-01
First-principles calculations are employed to demonstrate a giant Rashba spin splitting in Bi2Se3:Tl. Biaxial tensile and compressive strain is used to tune the splitting by modifying the potential gradient. The band gap is found to increase under
Background studies for NaI(Tl) detectors in the ANAIS dark matter project
International Nuclear Information System (INIS)
Amaré, J.; Borjabad, S.; Cebrián, S.; Cuesta, C.; Fortuño, D.; García, E.; Ginestra, C.; Gómez, H.; Martínez, M.; Oliván, M. A.; Ortigoza, Y.; Solórzano, A. Ortiz de; Pobes, C.; Puimedón, J.; Sarsa, M. L.; Villar, J. A.; Villar, P.
2013-01-01
Several large NaI(Tl) detectors, produced by different companies, have been operated in the Canfranc Underground Laboratory (LSC) in the frame of the ANAIS (Annual modulation with NaI Scintillators) project devoted to the direct detection of dark matter. A complete background model has been developed for a 9.6 kg detector (referred as ANAIS-0 prototype) after a long data taking at LSC. Activities from the natural chains of 238 U and 232 Th, and 40 K in the NaI(Tl) crystal were evaluated applying different methods: discrimination of alpha particles vs beta/gamma background by Pulse Shape Analysis for quantifying the content of the natural chains and coincidence techniques for 40 K. Radioactive contaminations in the detector and shielding components were also determined by HPGe spectrometry. Monte Carlo simulations using Geant4 package were carried out to evaluate their contribution. At high energies, most of the measured background is nicely reproduced; at low energy some non-explained components are still present, although some plausible background sources have been analyzed. The 40 K content of the NaI(Tl) crystal has been confirmed to be the dominant contributor to the measured background with this detector. In addition, preliminary results of the background characterization, presently underway at the LSC, of two recently produced NaI(Tl) detectors, with 12.5 kg mass each, will be presented: cosmogenic induced activity has been clearly observed and is being quantified, and 40 K activity at a level ten times lower than in ANAIS-0 has been determined
International Nuclear Information System (INIS)
Fernandes, L.; Silva, C.P.G. da
1986-01-01
The extraction chromatography technique was used for the lig and 201 Tl separation. It was used glass columns of 5,0 cm height and 1,0 cm diameter filled with Voltalef powder impregnated with TBP/cyclohexane. By the Voltalef columns solutions of 203 Hg 2+ , 201 Tl 1+ and 20 1Te 3 were separately percolated in a nitric environment of 4 to 8 M concentration and in a hydrochloridric environment of 0,5 to 4 M. The separation of Hg and 201 Tl was obtained by the retention of 201 Tl3 + in the column during the elution of all the Hg with HCl 2 M. The 201 Tl 3+ was eluted from the column after its reduction with a hot hydrazine dichloride solution. (Author) [pt
Longo, S.; Roney, J. M.
2018-03-01
Pulse shape discrimination using CsI(Tl) scintillators to perform neutral hadron particle identification is explored with emphasis towards application at high energy electron-positron collider experiments. Through the analysis of the pulse shape differences between scintillation pulses from photon and hadronic energy deposits using neutron and proton data collected at TRIUMF, it is shown that the pulse shape variations observed for hadrons can be modelled using a third scintillation component for CsI(Tl), in addition to the standard fast and slow components. Techniques for computing the hadronic pulse amplitudes and shape variations are developed and it is shown that the intensity of the additional scintillation component can be computed from the ionization energy loss of the interacting particles. These pulse modelling and simulation methods are integrated with GEANT4 simulation libraries and the predicted pulse shape for CsI(Tl) crystals in a 5 × 5 array of 5 × 5 × 30 cm3 crystals is studied for hadronic showers from 0.5 and 1 GeV/c KL0 and neutron particles. Using a crystal level and cluster level approach for photon vs. hadron cluster separation we demonstrate proof-of-concept for neutral hadron detection using CsI(Tl) pulse shape discrimination in high energy electron-positron collider experiments.
The quantitative evaluation of 201Tl myocardial scintigraphy using reinjection method
International Nuclear Information System (INIS)
Naruse, Hitoshi; Itano, Midoriko; Yamamoto, Juro; Morita, Masato; Fukutake, Naoshige; Kawamoto, Hideo; Ohyanagi, Mitsumasa; Iwasaki, Tadaaki; Fukuchi, Minoru
1993-01-01
This study was designed to determine whether Tl-201 myocardial scintigraphy using reinjection method would improve the rate of redistribution (RD) and, if improved, which would contribute to RD improvement, extent or severity of ischemia shown by the bolls-eye view method. In 17 patients with ischemic heart disease, exercise Tl-201 myocardial images were acquired at 10 min (early images) and 180 min (delayed images) after intravenous injection of 74 MBq of TlCl. In addition, 37 MBq of TlCl was injected again after delayed imaging and then images were acquired (RI images). Among the 17 patients, 7 were judged as RD(+), 8 as RD(-), and 2 as undefined. In 8 RD(-) patients and 2 undefined patients, RD became (+) on RI images. Visual changes in extent and severity of ischemia from early to delayed images were 68±42 for RD(+) cases vs. 3±20 for RD(-) cases and 0.4±0.8 for RD(+) cases vs. 0.1±0.3 for RD(-) cases, respectively. The corresponding figures from delayed to RI images for extent and score of ischemia were 50±46 for RD(+) cases vs. 13±22 for RD(-) cases and 0.4±30.3 for RD(+) cases vs. 0.1±0.5 for RD(-) cases, respectively. For 5 patients undergoing coronary revascularization, extent was improved in all cases, but severity was improved in only some cases. In conclusion, when RD became (+) on RI images, myocardial viability seemed to have been underestimated. Quantitative evaluation revealed that RD improved from early to delayed images depended on extent and that RD improved from delayed to RI images depended on both extent and severity. In postoperative improvement of RD, extent of ischemia was mainly involved. RI imaging was found to compensate for the underestimation of RD. Quantitative evaluation was also useful in the observation of subtle changes of ischemia. (N.K.)
ORF Sequence: NC_004605 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family
ORF Sequence: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin
Mobility and lifetime of sup 2 sup 0 sup 8 Tl ions in liquid xenon
Walters, A J
2003-01-01
Positively charged sup 2 sup 0 sup 8 Tl ions are transported through liquid xenon using electric fields in the range of 4-10 kV cm sup - sup 1 and for drift distances up to 50 mm. From these measurements we deduce upper limits on the attenuation length for Tl ions in liquid xenon, resulting in a lifetime >5.5 s. In addition to these results, the field independent mobility of Tl bearing species in liquid xenon was measured to be 1.33+-0.04x10 sup - sup 4 cm sup 2 V sup - sup 1 s sup - sup 1. This result, when coupled with those for other species by previous workers, suggests that positive ion mobility in liquid xenon is proportional to the hard-core radius. Applications to Ba ion collection in a double beta decay experiment are also discussed.
Clinical significance of increased lung/heart ratio in 210Tl stress myocardial image
International Nuclear Information System (INIS)
Liu Zaoli; Chang Fengqin; Zhang Fengge; Wang Xiaoyuan; Liu Liuhua
1990-01-01
230 cases were studied with 201 Tl stress image. The results showed that the lung/heart ratio closely correlated with the presence and severity of coronary heart disease (CHD). Among them, 18 cases (7.8%) showed significantly elevated lung/heart ratio (> 0.50). It was confirmed that all of the 18 cases have severe CHD with left ventricular insufficiency. The author emphasizes that measurement of the lung/heart ratio during 201 Tl stress myocardial image may be useful for the assessment of the severity, evalation of the left ventricular function and judgement of prognosis in CHD
Energy Technology Data Exchange (ETDEWEB)
Ellegaard, C; Barnes, P D [Carnegie-Mellon Univ., Pittsburgh, Pa. (USA); Flynn, E R [Los Alamos Scientific Lab., N.Mex. (USA)
1976-03-22
The reactions /sup 210/Pb(t,..cap alpha..)/sup 209/Tl and /sup 210/Pb(t,d)/sup 211/Pb have been studied with 20 MeV tritons. Seven levels in /sup 209/Tl have been identified in the /sup 210/Pb(t,..cap alpha..)/sup 209/Tl reaction. Level spins have been suggested by comparing the observed spectrum with that of the corresponding reaction on /sup 208/Pb. Nineteen levels in /sup 211/Pb were identified in the /sup 210/Pb(t,d)/sup 211/Pb reaction. Angular distributions were measured and lsub(n) values and spectroscopic factors were extracted by DWBA calculations. In both cases the spectra are very similar to the spectra obtained with /sup 208/Pb as a target. The deviations from these simple spectra would appear to be amenable to a description in terms of a coupling of the extra particle or hole to the /sup 210/Pb core.